Sample records for marine green alga

  1. Electrophysiology of turgor regulation in marine siphonous green algae.


    Bisson, M A; Beilby, M J; Shepherd, V A


    We review electrophysiological measures of turgor regulation in some siphonous green algae, primarily the giant-celled marine algae, Valonia and Ventricaria, with particular comparison to the well studied charophyte algae Chara and Lamprothamnium. The siphonous green algae have a less negative plasma membrane potential, and are unlikely to have a proton-based chemiosmotic transport system, dominated by active electrogenic K(+) uptake. We also make note of the unusual cellular structure of the siphonous green algae. Hypertonic stress, due to increased external osmotic pressure, is accompanied by positive-going potential difference (PD), increase in conductance, and slow turgor regulation. The relationship between these is not yet resolved, but may involve changes in K(+ )conductance (G (K)) or active K(+) transport at both membranes. Hypotonic turgor regulation, in response to decreased external osmotic pressure, is approximately 3 times faster than hypertonic turgor regulation. It is accompanied by a negative-going PD, although conductance also increases. The conductance increase and the magnitude of the PD change are strongly correlated with the magnitude of hypotonic stress.

  2. Fitness Effects of Spontaneous Mutations in Picoeukaryotic Marine Green Algae.


    Krasovec, Marc; Eyre-Walker, Adam; Grimsley, Nigel; Salmeron, Christophe; Pecqueur, David; Piganeau, Gwenael; Sanchez-Ferandin, Sophie


    Estimates of the fitness effects of spontaneous mutations are important for understanding the adaptive potential of species. Here, we present the results of mutation accumulation experiments over 265-512 sequential generations in four species of marine unicellular green algae, Ostreococcus tauri RCC4221, Ostreococcus mediterraneus RCC2590, Micromonas pusilla RCC299, and Bathycoccus prasinos RCC1105. Cell division rates, taken as a proxy for fitness, systematically decline over the course of the experiment in O. tauri, but not in the three other species where the MA experiments were carried out over a smaller number of generations. However, evidence of mutation accumulation in 24 MA lines arises when they are exposed to stressful conditions, such as changes in osmolarity or exposure to herbicides. The selection coefficients, estimated from the number of cell divisions/day, varies significantly between the different environmental conditions tested in MA lines, providing evidence for advantageous and deleterious effects of spontaneous mutations. This suggests a common environmental dependence of the fitness effects of mutations and allows the minimum mutation/genome/generation rates to be inferred at 0.0037 in these species. PMID:27175016

  3. Fitness Effects of Spontaneous Mutations in Picoeukaryotic Marine Green Algae

    PubMed Central

    Krasovec, Marc; Eyre-Walker, Adam; Grimsley, Nigel; Salmeron, Christophe; Pecqueur, David; Piganeau, Gwenael; Sanchez-Ferandin, Sophie


    Estimates of the fitness effects of spontaneous mutations are important for understanding the adaptive potential of species. Here, we present the results of mutation accumulation experiments over 265–512 sequential generations in four species of marine unicellular green algae, Ostreococcus tauri RCC4221, Ostreococcus mediterraneus RCC2590, Micromonas pusilla RCC299, and Bathycoccus prasinos RCC1105. Cell division rates, taken as a proxy for fitness, systematically decline over the course of the experiment in O. tauri, but not in the three other species where the MA experiments were carried out over a smaller number of generations. However, evidence of mutation accumulation in 24 MA lines arises when they are exposed to stressful conditions, such as changes in osmolarity or exposure to herbicides. The selection coefficients, estimated from the number of cell divisions/day, varies significantly between the different environmental conditions tested in MA lines, providing evidence for advantageous and deleterious effects of spontaneous mutations. This suggests a common environmental dependence of the fitness effects of mutations and allows the minimum mutation/genome/generation rates to be inferred at 0.0037 in these species. PMID:27175016

  4. A novel ether-linked phytol-containing digalactosylglycerolipid in the marine green alga, Ulva pertusa

    SciTech Connect

    Ishibashi, Yohei; Nagamatsu, Yusuke; Miyamoto, Tomofumi; Matsunaga, Naoyuki; Okino, Nozomu; Yamaguchi, Kuniko; Ito, Makoto


    Highlights: • Alkaline-resistant galactolipid, AEGL, was found in marine algae. • The sugar moiety of AEGL is identical to that of digalactosyldiacylglycerol. • AEGL is the first identified glycolipid that possesses an ether-linked phytol. • AEGL is ubiquitously distributed in green, red and brown marine algae. - Abstract: Galactosylglycerolipids (GGLs) and chlorophyll are characteristic components of chloroplast in photosynthetic organisms. Although chlorophyll is anchored to the thylakoid membrane by phytol (tetramethylhexadecenol), this isoprenoid alcohol has never been found as a constituent of GGLs. We here described a novel GGL, in which phytol was linked to the glycerol backbone via an ether linkage. This unique GGL was identified as an Alkaline-resistant and Endogalactosylceramidase (EGALC)-sensitive GlycoLipid (AEGL) in the marine green alga, Ulva pertusa. EGALC is an enzyme that is specific to the R-Galα/β1-6Galβ1-structure of galactolipids. The structure of U. pertusa AEGL was determined following its purification to 1-O-phytyl-3-O-Galα1-6Galβ1-sn-glycerol by mass spectrometric and nuclear magnetic resonance analyses. AEGLs were ubiquitously distributed in not only green, but also red and brown marine algae; however, they were rarely detected in terrestrial plants, eukaryotic phytoplankton, or cyanobacteria.

  5. Cryptic sex in the smallest eukaryotic marine green alga.


    Grimsley, Nigel; Péquin, Bérangère; Bachy, Charles; Moreau, Hervé; Piganeau, Gwenaël


    Ostreococcus spp. are common worldwide oceanic picoeukaryotic pelagic algae. The complete genomes of three strains from different ecological niches revealed them to represent biologically distinct species despite their identical cellular morphologies (cryptic species). Their tiny genomes (13 Mb), with approximately 20 chromosomes, are colinear and densely packed with coding sequences, but no sexual life cycle has been described. Seventeen new strains of one of these species, Ostreococcus tauri, were isolated from 98 seawater samplings from the NW Mediterranean by filtering, culturing, cloning, and plating for single colonies and identification by sequencing their ribosomal 18S gene. In order to find the genetic markers for detection of polymorphisms and sexual recombination, we used an in silico approach to screen available genomic data. Intergenic regions of DNA likely to evolve neutrally were analyzed following polymerase chain reaction amplification of sequences using flanking primers from adjacent conserved coding sequences that were present as syntenic pairs in two different species of Ostreococcus. Analyses of such DNA regions from eight marker loci on two chromosomes from each strain revealed that the isolated O. tauri clones were haploid and that the overall level of polymorphism was approximately 0.01. Four different genetic tests for recombination showed that sexual exchanges must be inferred to account for the between-locus and between-chromosome marker combinations observed. However, our data suggest that sexual encounters are infrequent because we estimate the frequency of meioses/mitoses among the sampled strains to be 10(-6). Ostreococcus tauri and related species encode and express core genes for mitosis and meiosis, but their mechanisms of cell division and recombination, nevertheless, remain enigmatic because a classical eukaryotic spindle with 40 canonical microtubules would be much too large for the available approximately 0.9-microm(3) cellular

  6. Evidence for equal size cell divisions during gametogenesis in a marine green alga Monostroma angicava

    PubMed Central

    Togashi, Tatsuya; Horinouchi, Yusuke; Sasaki, Hironobu; Yoshimura, Jin


    In cell divisions, relative size of daughter cells should play fundamental roles in gametogenesis and embryogenesis. Differences in gamete size between the two mating types underlie sexual selection. Size of daughter cells is a key factor to regulate cell divisions during cleavage. In cleavage, the form of cell divisions (equal/unequal in size) determines the developmental fate of each blastomere. However, strict validation of the form of cell divisions is rarely demonstrated. We cannot distinguish between equal and unequal cell divisions by analysing only the mean size of daughter cells, because their means can be the same. In contrast, the dispersion of daughter cell size depends on the forms of cell divisions. Based on this, we show that gametogenesis in the marine green alga, Monostroma angicava, exhibits equal size cell divisions. The variance and the mean of gamete size (volume) of each mating type measured agree closely with the prediction from synchronized equal size cell divisions. Gamete size actually takes only discrete values here. This is a key theoretical assumption made to explain the diversified evolution of isogamy and anisogamy in marine green algae. Our results suggest that germ cells adopt equal size cell divisions during gametogenesis. PMID:26333414

  7. Evidence for equal size cell divisions during gametogenesis in a marine green alga Monostroma angicava.


    Togashi, Tatsuya; Horinouchi, Yusuke; Sasaki, Hironobu; Yoshimura, Jin


    In cell divisions, relative size of daughter cells should play fundamental roles in gametogenesis and embryogenesis. Differences in gamete size between the two mating types underlie sexual selection. Size of daughter cells is a key factor to regulate cell divisions during cleavage. In cleavage, the form of cell divisions (equal/unequal in size) determines the developmental fate of each blastomere. However, strict validation of the form of cell divisions is rarely demonstrated. We cannot distinguish between equal and unequal cell divisions by analysing only the mean size of daughter cells, because their means can be the same. In contrast, the dispersion of daughter cell size depends on the forms of cell divisions. Based on this, we show that gametogenesis in the marine green alga, Monostroma angicava, exhibits equal size cell divisions. The variance and the mean of gamete size (volume) of each mating type measured agree closely with the prediction from synchronized equal size cell divisions. Gamete size actually takes only discrete values here. This is a key theoretical assumption made to explain the diversified evolution of isogamy and anisogamy in marine green algae. Our results suggest that germ cells adopt equal size cell divisions during gametogenesis.

  8. Overview on Biological Activities and Molecular Characteristics of Sulfated Polysaccharides from Marine Green Algae in Recent Years

    PubMed Central

    Wang, Lingchong; Wang, Xiangyu; Wu, Hao; Liu, Rui


    Among the three main divisions of marine macroalgae (Chlorophyta, Phaeophyta and Rhodophyta), marine green algae are valuable sources of structurally diverse bioactive compounds and remain largely unexploited in nutraceutical and pharmaceutical areas. Recently, a great deal of interest has been developed to isolate novel sulfated polysaccharides (SPs) from marine green algae because of their numerous health beneficial effects. Green seaweeds are known to synthesize large quantities of SPs and are well established sources of these particularly interesting molecules such as ulvans from Ulva and Enteromorpha, sulfated rhamnans from Monostroma, sulfated arabinogalactans from Codium, sulfated galacotans from Caulerpa, and some special sulfated mannans from different species. These SPs exhibit many beneficial biological activities such as anticoagulant, antiviral, antioxidative, antitumor, immunomodulating, antihyperlipidemic and antihepatotoxic activities. Therefore, marine algae derived SPs have great potential for further development as healthy food and medical products. The present review focuses on SPs derived from marine green algae and presents an overview of the recent progress of determinations of their structural types and biological activities, especially their potential health benefits. PMID:25257786

  9. Blue-green algae


    “Blue-green algae” describes a large and diverse group of simple, plant-like organisms found in salt water and some large fresh water lakes. Blue-green algae products are used for many conditions, but so ...

  10. Strong induction of phytochelatin synthesis by zinc in marine green alga, Dunaliella tertiolecta.


    Hirata, K; Tsujimoto, Y; Namba, T; Ohta, T; Hirayanagi, N; Miyasaka, H; Zenk, M H; Miyamoto, K


    Synthesis of phytochelatins (PCs), heavy-metal-sequestering peptides, in the marine green alga, Dunaliella tertiolecta, was evaluated under various conditions of exposure to heavy metals. To investigate the effect of heavy metals on both PC synthesis and their upstream biosynthetic reactions, an ion-pair-HPLC system was developed in this study, by which PCs and their biosynthetic intermediates, cysteine (Cys), gamma-glutamylcysteine (gammaEC) and glutathione (GSH), could be determined simultaneously with high sensitivity. When the cells were exposed to Zn2+, the level of PCs was maximal at 200 microM and significantly higher than that obtained after exposure to 400 microM Cd2+, which is the strongest inducer of PC synthesis in higher plants in vivo and in vitro as well as in microalgae. The predominant PC subtype was PC4, followed by PC3 and PC5, whereas PC2, which is generally abundant in higher plants, has the lowest level among PC2 to PC5. These results suggest that the characteristics of PC synthase in D. tertiolecta including the requirement of heavy metals for its catalysis and substrate specificity towards GSH and PC(n) are considerably different from those in higher plants and other algae. While PC synthesis proceeded in the heavy-metal-treated cells, the level of GSH did not appreciably change. To maintain the same size of the GSH pool, GSH must be newly synthesized to balance the amount consumed for PC synthesis. PMID:16233052

  11. A multidisciplinary study of iron transport and storage in the marine green alga Tetraselmis suecica.


    Hartnett, Andrej; Böttger, Lars H; Matzanke, Berthold F; Carrano, Carl J


    The iron uptake and storage systems of terrestrial/higher plants are now reasonably well understood with two basic strategies being distinguished: strategy I involves the induction of a Fe(III)-chelate reductase (ferrireductase) along with Fe(II) or Fe(III) transporter proteins while strategy II plants have evolved sophisticated systems based on high-affinity, iron specific, binding compounds called phytosiderophores. In contrast, there is little knowledge about the corresponding systems in marine, plant-like lineages. Herein we report a study of the iron uptake and storage mechanisms in the green alga Tetraselmis suecica. Short term radio-iron uptake studies indicate that iron is taken up by Tetraselmis in a time and concentration dependent manner consistent with an active transport process. Based on inhibitor and other studies it appears that a reductive-oxidative pathway such as that found in yeast and the green alga Chlamydomonas reinhardtii is likely. Upon long term exposure to (57)Fe we have been able, using a combination of Mössbauer and X-ray absorption spectroscopies, to identify three metabolites. The first exhibits Mössbauer parameters typical of a [Fe(4)S(4)](2+) cluster and which accounts for approximately 10% of the total intracellular iron pool. The second displays a spectrum typical of a [Fe(II)O(6)] system accounting for approximately 2% of the total pool. The largest component (ca. 85+%) consists of polymeric iron-oxo mineral species with parameters between that of the crystalline ferrihydrite core of animal ferritins and the amorphous hydrated ferric phosphate of bacterial and plant ferritins.

  12. Ornithinimicrobium algicola sp. nov., a marine actinobacterium isolated from the green alga of the genus Ulva.


    Ramaprasad, E V V; Sasikala, Ch; Ramana, Ch V


    A Gram-staining-positive, non-spore-forming actinobacterium, strain JC311T, isolated from marine green alga of the genus Ulva was studied to examine its taxonomic position. On the basis of the 16S rRNA gene sequence similarity studies, strain JC311T was shown represent a member of the genus Ornithinimicrobium and to be closely related to Ornithinimicrobium pekingense LW6T (98.6 %), Ornithinimicrobium kibberense K22-20T (98.3 %) and Ornithinimicrobium humiphilum HKI 0124T (98.1 %). However, strain JC311T showed less than 22 % DNA reassociation value (based on DNA-DNA hybridization) with O. pekingense JCM14001T, O. kibberense JCM12763T and O. humiphilum KCTC19901T. The predominant menaquinone of strain JC311T was MK-8(H4). The peptidoglycan contained l-ornithine as the diagnostic diamino acid. The polar lipid profile consisted of the lipids diphosphatidylglycerol, phosphatidylglycerol, phosphatidylinositol, glycophospholipid, aminophospholipid, phospholipid and two unidentified lipids. The major fatty acids iso-C16 : 0, iso-C15 : 0, iso-C17 : 1ω9c and iso-C17 : 0 were consistent with the fatty acid patterns reported for members of the genus Ornithinimicrobium. The distinct genomic, morphological, physiological and chemotaxonomic differences from the previously described taxa support the classification of JC311T as a representative of a novel species of the genus Ornithinimicrobium, for which we propose the name Ornithinimicrobium algicola sp. nov., with the type strain JC311T ( = KCTC 39559 T =  LMG 28808T).

  13. Biosorption of copper, cobalt and nickel by marine green alga Ulva reticulata in a packed column.


    Vijayaraghavan, K; Jegan, J; Palanivelu, K; Velan, M


    Biosorption of copper, cobalt and nickel by marine green alga Ulva reticulata were investigated in a packed bed up-flow column. The experiments were conducted to study the effect of important design parameters such as bed height and flow rate. At a bed height of 25 cm, the metal-uptake capacity of U. reticulata for copper, cobalt and nickel was found to be 56.3+/-0.24, 46.1+/-0.07 and 46.5+/-0.08 mgg(-1), respectively. The Bed Depth Service Time (BDST) model was used to analyze the experimental data. The computed sorption capacity per unit bed volume (N0) was 2580, 2245 and 1911 mgl(-1) for copper, cobalt and nickel, respectively. The rate constant (K(a)) was recorded as 0.063, 0.081 and 0.275 lmg(-1)h(-1) for copper, cobalt and nickel, respectively. In flow rate experiments, the results confirmed that the metal uptake capacity and the metal removal efficiency of U. reticulata decreased with increasing flow rate. The Thomas model was used to fit the column biosorption data at different flow rates and model constants were evaluated. The column regeneration studies were carried out for three sorption-desorption cycles. The elutant used for the regeneration of the biosorbent was 0.1 M CaCl2 at pH 3 adjusted using HCl. For all the metal ions, a decreased breakthrough time and an increased exhaustion time were observed as the regeneration cycles progressed, which also resulted in a broadened mass transfer zone. The pH variations during both sorption and desorption process have been reported. PMID:15924962

  14. Polyclonal antibodies to light-harvesting CHL-protein of PSII (LHC II) in marine green algae Bryopsis corticulans

    NASA Astrophysics Data System (ADS)

    Wu, Xiaonan; Zhou, Baicheng; Tseng, C. K.


    Polyc·lonal antibodies raised against LHC II isolated from SDS-solubilized Bryopsis corticulans thylakiod membranes by SDS-PAGE, were characterised by double immunodiffusion, Rocket immunoelectrophoresis and antigen-antibody crossed immunoelectro-phoresis assays showed the antibodies had strong cross-reaction with all B. corticulans LHC II components (even with those which were incubated in boiling water) and showed immunological cross-reactivity with LHC II polypeptides of spinach and the marine green alga Codium fragile. The results suggested that LHC II of different species had similar antigenic determinants and also conservation of amino acid sequences of the polypeptides during evolution, and that the antibodies could cross react with apoproteins of D2 proteins (which contain P680) from B. corticulans, spinach and C. fragile, but not with apoproteins of P700 Chl-proteins. Our results indicated some similarities in primary structure between LHC II of different species, and between LHC II and D2 proteins of marine green algae and spinach. Our finding that D2 and P700 Chl-proteins are not immunologically related suggested that P700 Chl-proteins and D2 proteins pass through independent evolutionary pathways.

  15. Biological importance of marine algae

    PubMed Central

    El Gamal, Ali A.


    Marine organisms are potentially prolific sources of highly bioactive secondary metabolites that might represent useful leads in the development of new pharmaceutical agents. Algae can be classified into two main groups; first one is the microalgae, which includes blue green algae, dinoflagellates, bacillariophyta (diatoms)… etc., and second one is macroalgae (seaweeds) which includes green, brown and red algae. The microalgae phyla have been recognized to provide chemical and pharmacological novelty and diversity. Moreover, microalgae are considered as the actual producers of some highly bioactive compounds found in marine resources. Red algae are considered as the most important source of many biologically active metabolites in comparison to other algal classes. Seaweeds are used for great number of application by man. The principal use of seaweeds as a source of human food and as a source of gums (phycocollides). Phycocolloides like agar agar, alginic acid and carrageenan are primarily constituents of brown and red algal cell walls and are widely used in industry. PMID:23960716

  16. Hydrogen production from salt water by Marine blue green algae and solar radiation

    NASA Technical Reports Server (NTRS)

    Mitsui, A.; Rosner, D.; Kumazawa, S.; Barciela, S.; Phlips, E.


    Two marine bluegreen algae, Oscillatoria sp. Miami BG 7 and Synechococcus sp Miami 041511 have been selected as the result of over 10 years continuous and intensive effort of isolation, growth examination, and the screening of hydrogen photoproduction capability in this laboratory. Both strains photoproduced hydrogen for several days at high rates and a quantity of hydrogen was accumulated in a closed vessel. Overall hydrogen donor substance of the hydrogen photoproduction was found to be salt water. Using strain Miami BG 7, a two step method of hydrogen photoproduction from salt water was successfully developed and this was recycled several times over a one month period using both free cells and immobilized cells in both indoor and outdoor under natural sunlight. According to these experiments, a prototype floating hydrogen production system was designed for further development of the biosolar hydrogen production system.

  17. Screening and isolation of the algicidal compounds from marine green alga Ulva intestinalis

    NASA Astrophysics Data System (ADS)

    Sun, Xue; Jin, Haoliang; Zhang, Lin; Hu, Wei; Li, Yahe; Xu, Nianjun


    Twenty species of seaweed were collected from the coast of Zhejiang, China, extracted with ethanol, and screened for algicidal activity against red tide microalgae Heterosigma akashiwo and Prorocentrum micans. Inhibitory effects of fresh and dried tißsues of green alga Ulva intestinalis were assessed and the main algicidal compounds were isolated, purified, and identified. Five seaweed species, U. intestinalis, U. fasciata, Grateloupia romosissima, Chondria crassicaulis, and Gracilariopsis lemaneiformis, were investigated for their algicidal activities. Fresh tissues of 8.0 and 16.0 mg/mL of U. intestinalis dissolved in media significantly inhibited growth of H. akashiwo and P. micans, respectively. Dried tissue and ethyl acetate (EtOAc) extracts of U. intestinalis at greater than 1.2 and 0.04 mg/mL, respectively, were fatal to H. akashiwo, while its water and EtOAc extracts in excess of 0.96 and 0.32 mg/mL, respectively, were lethal to P. micans. Three algicidal compounds in the EtOAc extracts were identified as 15-ethoxy-(6z,9z,12z)-hexadecatrienoic acid (I), (6E,9E,12E)-(2-acetoxy- β-D-glucose)-octadecatrienoic acid ester (II) and hexadecanoic acid (III). Of these, compound II displayed the most potent algicidal activity with IC50 values of 4.9 and 14.1 µg/mL for H. akashiwo and P. micans, respectively. Compound I showed moderate algicidal activity with IC50 values of 13.4 and 24.7 µg/mL for H. akashiwo and P. micans, respectively. These findings suggested that certain macroalgae or products therefrom could be used as effective biological control agents against red tide algae.

  18. Alpha-amylase Inhibition and Antioxidant Activity of Marine Green Algae and its Possible Role in Diabetes Management

    PubMed Central

    Unnikrishnan, P. S.; Suthindhiran, K.; Jayasri, M. A.


    Aim: In the continuing search for safe and efficient antidiabetic drug, marine algae become important source which provide several compounds of immense therapeutic potential. Alpha-amylase, alpha-glucosidase inhibitors, and antioxidant compounds are known to manage diabetes and have received much attention recently. In the present study, four green algae (Chaetomorpha aerea, Enteromorpha intestinalis, Chlorodesmis, and Cladophora rupestris) were chosen to evaluate alpha-amylase, alpha-glucosidase inhibitory, and antioxidant activity in vitro. Materials and Methods: The phytochemical constituents of all the extracts were qualitatively determined. Antidiabetic activity was evaluated by inhibitory potential of extracts against alpha-amylase and alpha-glucosidase by spectrophotometric assays. Antioxidant activity was determined by 2,2-diphenyl-1-picrylhydrazyl, hydrogen peroxide (H2O2), and nitric oxide scavenging assay. Gas chromatography-mass spectrometry (GC-MS) analysis was carried out to determine the major compound responsible for its antidiabetic action. Results: Among the various extracts screened, chloroform extract of C. aerea (IC50 − 408.9 μg/ml) and methanol extract of Chlorodesmis (IC50 − 147.6 μg/ml) showed effective inhibition against alpha-amylase. The extracts were also evaluated for alpha-glucosidase inhibition, and no observed activity was found. Methanol extract of C. rupestris showed notable free radical scavenging activity (IC50 – 666.3 μg/ml), followed by H2O2 (34%) and nitric oxide (49%). Further, chemical profiling by GC-MS revealed the presence of major bioactive compounds. Phenol, 2,4-bis (1,1-dimethylethyl) and z, z-6,28-heptatriactontadien-2-one were predominantly found in the methanol extract of C. rupestris and chloroform extract of C. aerea. Conclusion: Our results demonstrate that the selected algae exhibit notable alpha-amylase inhibition and antioxidant activity. Therefore, characterization of active compounds and its in vivo

  19. An original adaptation of photosynthesis in the marine green alga Ostreococcus

    PubMed Central

    Cardol, Pierre; Bailleul, Benjamin; Rappaport, Fabrice; Derelle, Evelyne; Béal, Daniel; Breyton, Cécile; Bailey, Shaun; Wollman, Francis André; Grossman, Arthur; Moreau, Hervé; Finazzi, Giovanni


    Adaptation of photosynthesis in marine environment has been examined in two strains of the green, picoeukaryote Ostreococcus: OTH95, a surface/high-light strain, and RCC809, a deep-sea/low-light strain. Differences between the two strains include changes in the light-harvesting capacity, which is lower in OTH95, and in the photoprotection capacity, which is enhanced in OTH95. Furthermore, RCC809 has a reduced maximum rate of O2 evolution, which is limited by its decreased photosystem I (PSI) level, a possible adaptation to Fe limitation in the open oceans. This decrease is, however, accompanied by a substantial rerouting of the electron flow to establish an H2O-to-H2O cycle, involving PSII and a potential plastid plastoquinol terminal oxidase. This pathway bypasses electron transfer through the cytochrome b6f complex and allows the pumping of “extra” protons into the thylakoid lumen. By promoting the generation of a large ΔpH, it facilitates ATP synthesis and nonphotochemical quenching when RCC809 cells are exposed to excess excitation energy. We propose that the diversion of electrons to oxygen downstream of PSII, but before PSI, reflects a common and compulsory strategy in marine phytoplankton to bypass the constraints imposed by light and/or nutrient limitation and allow successful colonization of the open-ocean marine environment. PMID:18511560

  20. An original adaptation of photosynthesis in the marine green alga Ostreococcus.


    Cardol, Pierre; Bailleul, Benjamin; Rappaport, Fabrice; Derelle, Evelyne; Béal, Daniel; Breyton, Cécile; Bailey, Shaun; Wollman, Francis André; Grossman, Arthur; Moreau, Hervé; Finazzi, Giovanni


    Adaptation of photosynthesis in marine environment has been examined in two strains of the green, picoeukaryote Ostreococcus: OTH95, a surface/high-light strain, and RCC809, a deep-sea/low-light strain. Differences between the two strains include changes in the light-harvesting capacity, which is lower in OTH95, and in the photoprotection capacity, which is enhanced in OTH95. Furthermore, RCC809 has a reduced maximum rate of O(2) evolution, which is limited by its decreased photosystem I (PSI) level, a possible adaptation to Fe limitation in the open oceans. This decrease is, however, accompanied by a substantial rerouting of the electron flow to establish an H(2)O-to-H(2)O cycle, involving PSII and a potential plastid plastoquinol terminal oxidase. This pathway bypasses electron transfer through the cytochrome b(6)f complex and allows the pumping of "extra" protons into the thylakoid lumen. By promoting the generation of a large DeltapH, it facilitates ATP synthesis and nonphotochemical quenching when RCC809 cells are exposed to excess excitation energy. We propose that the diversion of electrons to oxygen downstream of PSII, but before PSI, reflects a common and compulsory strategy in marine phytoplankton to bypass the constraints imposed by light and/or nutrient limitation and allow successful colonization of the open-ocean marine environment. PMID:18511560

  1. Green energy from marine algae: biogas production and composition from the anaerobic digestion of Irish seaweed species.


    Vanegas, C H; Bartlett, J


    Marine algae have emerged as an alternative feedstock for the production of a number of renewable fuels, including biogas. In addition to energy potential, other characteristics make them attractive as an energy source, including their ability to absorb carbon dioxide (CO2), higher productivity rates than land-based crops and the lack of water use or land competition. For Ireland, biofuels from marine algae can play an important role by reducing imports of fossil fuels as well as providing the necessary energy in rural communities. In this study, five potential seaweed species common in Irish waters, Saccorhiza polyschides, Ulva sp., Laminaria digitata, Fucus serratus and Saccharina latissima, were co-digested individually with bovine slurry. Batch reactors of 120ml and 1000ml were set up and incubated at 35 degrees C to investigate their suitability for production of biogas. Digesters fed with S. latissima produced the maximum methane yield (335 ml g volatile solids(-1) (g(VS)(-1) followed by S. polyschides with 255 ml g(VS)(-1). L. digitata produced 246ml g(VS)(-1) and the lowest yields were from the green seaweed Ulva sp. 191ml g(VS)(-1). The methane and CO2 percentages ranged between 50-72% and 10-45%, respectively. The results demonstrated that the seaweed species investigated are good feedstocks candidates for the production of biogas and methane as a source of energy. Their use on a large-scale process will require further investigation to increase yields and reduce production costs.

  2. Neuroprotective Effects of Marine Algae

    PubMed Central

    Pangestuti, Ratih; Kim, Se-Kwon


    The marine environment is known as a rich source of chemical structures with numerous beneficial health effects. Among marine organisms, marine algae have been identified as an under-exploited plant resource, although they have long been recognized as valuable sources of structurally diverse bioactive compounds. Presently, several lines of studies have provided insight into biological activities and neuroprotective effects of marine algae including antioxidant, anti-neuroinflammatory, cholinesterase inhibitory activity and the inhibition of neuronal death. Hence, marine algae have great potential to be used for neuroprotection as part of pharmaceuticals, nutraceuticals and functional foods. This contribution presents an overview of marine algal neuroprotective effects and their potential application in neuroprotection. PMID:21673890

  3. Studies on marine algae for haemagglutinic activity.


    Alam, M T; Usmanghani, K


    Lectins (agglutinins) are important in medical and immunological applications. Phytohaemagglutinins have been found useful in blood banking. Keeping in view of these facts, the marine algae found at Karachi coastal region have been screened for agglutinic activity by using human erythrocytes of A, B, AB and 0 group. Altogether 53 algal samples were collected and subjected to extraction, fractionation serial dilution and titre determinations. The total marine algae screened for haemagglutinic activity were 44 out of these 14, 13 and 17 belonged to Chlorophyta, Phaeophyta, and Rhodophyta respectively. Among these three groups the Rhodophyta showed the highest number of lytic activity. The green marine alga Valoniopsis pachynema showed a titre value between 2(2) and 2(3), which is statistically significant. In case of brown marine algae Colpomenia sinuosa was found to be active (titre 2(3)), while Dictyota dichotoma, D. indica and Iyengaria stellata, furnished week titre value as 2(2). The red marine algae screened were 17, out of these 4 spp. showed significant activity (titre 2(3)), and these are Gelidium usmanghani, Gracilaria foliifera Hypnea pannosa and Hynea valentiae. While Scinaia fascicularis, Scinaia indica and Champia parvula were found to be weak in their onset on human erythrocytes. The results obtained were quite in agreement with those reported in the literature. PMID:16414751

  4. Role of carbonyl cyanide m-chlorophenylhydrazone in enhancing photobiological hydrogen production by marine green alga Platymonas subcordiformis.


    Ran, Chunqiu; Yu, Xingju; Jin, Meifang; Zhang, Wei


    We demonstrated that a significant volume of H(2) gas could be photobiologically produced by a marine green alga Platymonas subcordiformis when an uncoupler of photophosphorylation, carbonyl cyanide m-chlorophenylhydrazone (CCCP), was added after 32 h of anaerobic dark incubation, whereas a negligible volume of H(2) gas was produced without CCCP. The role of CCCP in enhancing photobiological H(2) production was delineated. CCCP as an ADRY agent (agent accelerating the deactivation reactions of water-splitting enzyme system Y) rapidly inhibited the photosystem II (PSII) activity of P. subcordiformis cells, resulting in a markedly decline in the coupled oxygen evolution. The mitochondrial oxidative respiration was only slightly inactivated by CCCP, which depleted O(2) in the light. As a result, anaerobiosis during the stage of photobiological H(2) evolution was established, preventing severe O(2) inactivation of the reversible hydrogenase in P. subcordiformis. The uncoupling effect of CCCP accelerates electron transfer from water due to a disruption of the proton motive force and release of DeltapH across the thylakoid membrane and thus enhances the accessibility of electron and H(+) to hydrogenase. The electrons for hydrogen photoevolution are mainly from the photolysis of water (90%). Upon the addition of CCCP, Chl a/b ratio increased, which implies a decrease in the light-harvesting PSII antennae or an increase in PSII/PSI ratio, possibly resulting in higher efficiency of utilization of light energy. The enhancement of H(2) evolution by the addition of CCCP is mostly due to the combination of the above three mechanisms. However, the disruption of the proton gradient across the thylakoid membrane may prevent a sustained photobiological H(2) evolution due to a shortfall of ATP generation essential for the maintenance and repair functions of the cells.

  5. Role of carbonyl cyanide m-chlorophenylhydrazone in enhancing photobiological hydrogen production by marine green alga Platymonas subcordiformis.


    Ran, Chunqiu; Yu, Xingju; Jin, Meifang; Zhang, Wei


    We demonstrated that a significant volume of H(2) gas could be photobiologically produced by a marine green alga Platymonas subcordiformis when an uncoupler of photophosphorylation, carbonyl cyanide m-chlorophenylhydrazone (CCCP), was added after 32 h of anaerobic dark incubation, whereas a negligible volume of H(2) gas was produced without CCCP. The role of CCCP in enhancing photobiological H(2) production was delineated. CCCP as an ADRY agent (agent accelerating the deactivation reactions of water-splitting enzyme system Y) rapidly inhibited the photosystem II (PSII) activity of P. subcordiformis cells, resulting in a markedly decline in the coupled oxygen evolution. The mitochondrial oxidative respiration was only slightly inactivated by CCCP, which depleted O(2) in the light. As a result, anaerobiosis during the stage of photobiological H(2) evolution was established, preventing severe O(2) inactivation of the reversible hydrogenase in P. subcordiformis. The uncoupling effect of CCCP accelerates electron transfer from water due to a disruption of the proton motive force and release of DeltapH across the thylakoid membrane and thus enhances the accessibility of electron and H(+) to hydrogenase. The electrons for hydrogen photoevolution are mainly from the photolysis of water (90%). Upon the addition of CCCP, Chl a/b ratio increased, which implies a decrease in the light-harvesting PSII antennae or an increase in PSII/PSI ratio, possibly resulting in higher efficiency of utilization of light energy. The enhancement of H(2) evolution by the addition of CCCP is mostly due to the combination of the above three mechanisms. However, the disruption of the proton gradient across the thylakoid membrane may prevent a sustained photobiological H(2) evolution due to a shortfall of ATP generation essential for the maintenance and repair functions of the cells. PMID:16599559

  6. Sulfated polysaccharides as bioactive agents from marine algae.


    Ngo, Dai-Hung; Kim, Se-Kwon


    Recently, much attention has been paid by consumers toward natural bioactive compounds as functional ingredients in nutraceuticals. Marine algae are considered as valuable sources of structurally diverse bioactive compounds. Marine algae are rich in sulfated polysaccharides (SPs) such as carrageenans in red algae, fucoidans in brown algae and ulvans in green algae. These SPs exhibit many health beneficial nutraceutical effects such as antioxidant, anti-allergic, anti-human immunodeficiency virus, anticancer and anticoagulant activities. Therefore, marine algae derived SPs have great potential to be further developed as medicinal food products or nutraceuticals in the food industry. This contribution presents an overview of nutraceutical effects and potential health benefits of SPs derived from marine algae.

  7. Halogenated Compounds from Marine Algae

    PubMed Central

    Cabrita, Maria Teresa; Vale, Carlos; Rauter, Amélia Pilar


    Marine algae produce a cocktail of halogenated metabolites with potential commercial value. Structures exhibited by these compounds go from acyclic entities with a linear chain to complex polycyclic molecules. Their medical and pharmaceutical application has been investigated for a few decades, however other properties, such as antifouling, are not to be discarded. Many compounds were discovered in the last years, although the need for new drugs keeps this field open as many algal species are poorly screened. The ecological role of marine algal halogenated metabolites has somehow been overlooked. This new research field will provide valuable and novel insight into the marine ecosystem dynamics as well as a new approach to comprehending biodiversity. Furthermore, understanding interactions between halogenated compound production by algae and the environment, including anthropogenic or global climate changes, is a challenging target for the coming years. Research of halogenated metabolites has been more focused on macroalgae than on phytoplankton. However, phytoplankton could be a very promising material since it is the base of the marine food chain with quick adaptation to environmental changes, which undoubtedly has consequences on secondary metabolism. This paper reviews recent progress on this field and presents trends on the role of marine algae as producers of halogenated compounds. PMID:20948909

  8. Optimization, equilibrium, kinetic, thermodynamic and desorption studies on the sorption of Cu(II) from an aqueous solution using marine green algae: Halimeda gracilis.


    Jayakumar, R; Rajasimman, M; Karthikeyan, C


    The aptitude of marine green algae Helimeda gracilis for sorption of Cu(II) ions from an aqueous solution was studied in batch experiments. The effect of relevant parameters such as function of pH, sorbent dosage, agitation speed and contact time was evaluated by using Response surface methodology (RSM). A maximum percentage removal of Cu (II) by Halimeda gracilis occurs at pH-4.49, sorbent dosage-1.98g/L, agitation speed-119.43rpm and contact time-60.21min. Further, the sorbent was characterized by using Fourier Transform Infrared Spectroscopy (FTIR) and Scanning electron microscope (SEM) analysis. Experimental data were analyzed in terms of pseudo-first order, pseudo-second order, intraparticle diffusion, power function and elovich kinetic models. The results showed that the sorption process of Cu(II) ions followed well pseudo-second order kinetics. The sorption data of Cu(II) ions at 308.15K are fitted to Langmuir, Freundlich, Dubinin-Radushkevich (D-R), Temkin, Sips and Toth isotherms. Sorption of Cu(II) onto marine green algae Helimeda gracilis followed the Langmuir and Toth isotherm models (R(2)=0.998 and R(2)=0.999) with the maximum sorption capacity of 38.46 and 38.07mg/g. The calculated thermodynamic parameters such as ΔG°, ΔH° and ΔS° showed that the sorption of Cu(II) ions onto Helimeda gracilis biomass was feasible, spontaneous and endothermic. Desorption study shows that the sorbent could be regenerated using 0.2M HCl solution, with up to 89% recovery.

  9. Marine green algae Codium iyengarii as a good bio-sorbent for elimination of reactive black 5 from aqueous solution.


    Azmat, Rafia


    The green seaweeds Codium iyengarii (C. iyengarii) was used to prepare as an adsorbent surface for the deletion of Reactive Black 5 (RB 5) from aqueous solution via adsorption. The batch technique was adopted under the optimal condition of amount of adsorbent, agitation time, concentration of dye, and at neutral and low pH. The depletion in concentration of the dye was monitored by Schimadzo 180 AUV/Visible spectrophotometer. It was initially monolayer adsorption, which showed multilayered formation later on with the passage of time at low and neutral pH. The Results displayed that adsorptive ability of C. iyengarii was 1.95-3.82mg/g with an elevation in primary application of dye contents (50ppm-70 ppm). The elimination data were well stable into the Langmuir and Freundlich adsorption isotherm equations. The Langmuir (R2=0.9848) and Freundlich (R2=0.9441) constants for biosorption of RB 5 on green algae were determined. The coefficient relation values suggested that the Langmuir isotherm was well fitted. It explained the interaction of surface molecules, which helps in well organization of dye molecules in a monolayer formation initially on algal biomass. The pseudo first and second order rate equations were applied to link the investigational statistics and found that the second order rate expression was found to be more suitable for both the models. The absorption spectrum of RB 5 before and after adsorption with respect to time was monitored which clearly indicate that C. iyengarii was much effective surface at very low quantity. PMID:25176238

  10. Green synthesis of silver nanoparticles using marine algae Caulerpa racemosa and their antibacterial activity against some human pathogens

    NASA Astrophysics Data System (ADS)

    Kathiraven, T.; Sundaramanickam, A.; Shanmugam, N.; Balasubramanian, T.


    We present the synthesis and antibacterial activity of silver nanoparticles using Caulerpa racemosa, a marine algae. Fresh C. racemosa was collected from the Gulf of Mannar, Southeast coast of India. The seaweed extract was used for the synthesis of AgNO3 at room temperature. UV-visible spectrometry study revealed surface plasmon resonance at 413 nm. The characterization of silver nanoparticle was carried out using Fourier transform infrared spectroscopy (FT-IR), X-ray diffraction (XRD) and transmission electron microscope (TEM). FT-IR measurements revealed the possible functional groups responsible for reduction and stabilization of the nanoparticles. X-ray diffraction analysis showed that the particles were crystalline in nature with face-centered cubic geometry.TEM micrograph has shown the formation of silver nanoparticles with the size in the range of 5-25 nm. The synthesized AgNPs have shown the best antibacterial activity against human pathogens such as Staphylococcus aureus and Proteus mirabilis. The above eco-friendly synthesis procedure of AgNPs could be easily scaled up in future for the industrial and therapeutic needs.

  11. Photobiological hydrogen production in green algae and photosynthetic bacteria

    SciTech Connect

    Greenbaum, E.


    We have shown that, under appropriate physiological conditions, certain freshwater and marine green algae are capable of splitting water to molecular hydrogen and oxygen in a sustained steady-state reaction. In these algae, the gaseous-fuel-producing reaction can be driven by light throughout the visible portion of the solar emission spectrum, including the long wavelength (red) 700-nm region. No external energy sources are required.

  12. Isolation and characterization of a PSI-LHCI super-complex and its sub-complexes from a siphonaceous marine green alga, Bryopsis Corticulans.


    Qin, Xiaochun; Wang, Wenda; Chang, Lijing; Chen, Jinghua; Wang, Peng; Zhang, Jianping; He, Yikun; Kuang, Tingyun; Shen, Jian-Ren


    A novel super-complex of photosystem I (PSI)-light-harvesting complex I (LHCI) was isolated from a siphonaceous marine green alga, Bryopsis corticulans. The super-complex contained 9-10 Lhca antennas as external LHCI bound to the core complex. The super-complex was further disintegrated into PSI core and LHCI sub-complexes, and analysis of the pigment compositions by high-performance liquid chromatography revealed unique characteristics of the B. corticulans PSI in that one PSI core contained around 14 α-carotenes and 1-2 ε-carotenes. This is in sharp contrast to the PSI core from higher plants and most cyanobacteria where only β-carotenes were present, and is the first report for an α-carotene-type PSI core complex among photosynthetic eukaryotes, suggesting a structural flexibility of the PSI core. Lhca antennas from B. corticulans contained seven kinds of carotenoids (siphonaxanthin, all-trans neoxanthin, 9'-cis neoxanthin, violaxanthin, siphonein, ε-carotene, and α-carotene) and showed a high carotenoid:chlorophyll ratio of around 7.5:13. PSI-LHCI super-complex and PSI core showed fluorescence emission peaks at 716 and 718 nm at 77 K, respectively; whereas two Lhca oligomers had fluorescence peaks at 681 and 684 nm, respectively. By comparison with spinach PSI preparations, it was found that B. corticulans PSI had less red chlorophylls, most of them are present in the core complex but not in the outer light-harvesting systems. These characteristics may contribute to the fine tuning of the energy transfer network, and to acclimate to the ever-changing light conditions under which the unique green alga inhabits. PMID:25214185

  13. Isolation and characterization of a PSI-LHCI super-complex and its sub-complexes from a siphonaceous marine green alga, Bryopsis Corticulans.


    Qin, Xiaochun; Wang, Wenda; Chang, Lijing; Chen, Jinghua; Wang, Peng; Zhang, Jianping; He, Yikun; Kuang, Tingyun; Shen, Jian-Ren


    A novel super-complex of photosystem I (PSI)-light-harvesting complex I (LHCI) was isolated from a siphonaceous marine green alga, Bryopsis corticulans. The super-complex contained 9-10 Lhca antennas as external LHCI bound to the core complex. The super-complex was further disintegrated into PSI core and LHCI sub-complexes, and analysis of the pigment compositions by high-performance liquid chromatography revealed unique characteristics of the B. corticulans PSI in that one PSI core contained around 14 α-carotenes and 1-2 ε-carotenes. This is in sharp contrast to the PSI core from higher plants and most cyanobacteria where only β-carotenes were present, and is the first report for an α-carotene-type PSI core complex among photosynthetic eukaryotes, suggesting a structural flexibility of the PSI core. Lhca antennas from B. corticulans contained seven kinds of carotenoids (siphonaxanthin, all-trans neoxanthin, 9'-cis neoxanthin, violaxanthin, siphonein, ε-carotene, and α-carotene) and showed a high carotenoid:chlorophyll ratio of around 7.5:13. PSI-LHCI super-complex and PSI core showed fluorescence emission peaks at 716 and 718 nm at 77 K, respectively; whereas two Lhca oligomers had fluorescence peaks at 681 and 684 nm, respectively. By comparison with spinach PSI preparations, it was found that B. corticulans PSI had less red chlorophylls, most of them are present in the core complex but not in the outer light-harvesting systems. These characteristics may contribute to the fine tuning of the energy transfer network, and to acclimate to the ever-changing light conditions under which the unique green alga inhabits.

  14. New records of marine algae in Vietnam

    NASA Astrophysics Data System (ADS)

    Le Hau, Nhu; Ly, Bui Minh; Van Huynh, Tran; Trung, Vo Thanh


    In May, 2013, a scientific expedition was organized by the Vietnam Academy of Science and Technology (VAST) and the Far Eastern Branch of the Russian Academy of Sciences (FEBRAS) through the frame of the VAST-FEBRAS International Collaboration Program. The expedition went along the coast of Vietnam from Quang Ninh to Kien Giang. The objective was to collect natural resources to investigate the biological and biochemical diversity of the territorial waters of Vietnam. Among the collected algae, six taxa are new records for the Vietnam algal flora. They are the red algae Titanophora pikeana (Dickie) Feldmann from Cu Lao Xanh Island, Laurencia natalensis Kylin from Tho Chu Island, Coelothrix irregularis (Harvey) Børgesen from Con Dao Island, the green algae Caulerpa oligophylla Montagne, Caulerpa andamanensis (W.R. Taylor) Draisma, Prudhomme et Sauvage from Phu Quy Island, and Caulerpa falcifolia Harvey & Bailey from Ly Son Island. The seaweed flora of Vietnam now counts 833 marine algal taxa, including 415 Rhodophyta, 147 Phaeophyceae, 183 Chlorophyta, and 88 Cyanobacteria.

  15. Cultivation of macroscopic marine algae

    SciTech Connect

    Ryther, J.H.


    The red alga Gracilaria tikvahiae may be grown outdoors year-round in central Florida with yields averaging 35.5 g dry wt/m/sup 2/.day, greater than the most productive terrestrial plants. This occurs only when the plants are in a suspended culture, with vigorous aeration and an exchange of 25 or more culture volumes of enriched seawater per day, which is not cost-effective. A culture system was designed in which Gracilaria, stocked at a density of 2 kg wet wt/m/sup 2/, grows to double its biomass in one to two weeks; it is then harvested to its starting density, and anaerobically digested to methane. The biomass is soaked for 6 hours in the digester residue, storing enough nutrients for two weeks' growth in unenriched seawater. The methane is combusted for energy and the waste gas is fed to the culture to provide mixing and CO/sub 2/, eliminating the need for aeration and seawater exchange. The green alga Ulva lactuca, unlike Gracilaria, uses bicarbonate as a photosynthesis carbon source, and can grow at high pH, with little or no free CO/sub 2/. It can therefore produce higher yields than Gracilaria in low water exchange conditions. It is also more efficiently converted to methane than is Gracilaria, but cannot tolerate Florida's summer temperatures so cannot be grown year-round. Attempts are being made to locate or produce a high-temperature tolerant strain.

  16. PPR proteins of green algae.


    Tourasse, Nicolas J; Choquet, Yves; Vallon, Olivier


    Using the repeat finding algorithm FT-Rep, we have identified 154 pentatricopeptide repeat (PPR) proteins in nine fully sequenced genomes from green algae (with a total of 1201 repeats) and grouped them in 47 orthologous groups. All data are available in a database, PPRdb, accessible online at Based on phylogenetic trees generated from the repeats, we propose evolutionary scenarios for PPR proteins. Two PPRs are clearly conserved in the entire green lineage: MRL1 is a stabilization factor for the rbcL mRNA, while HCF152 binds in plants to the psbH-petB intergenic region. MCA1 (the stabilization factor for petA) and PPR7 (a short PPR also acting on chloroplast mRNAs) are conserved across the entire Chlorophyta. The other PPRs are clade-specific, with evidence for gene losses, duplications, and horizontal transfer. In some PPR proteins, an additional domain found at the C terminus provides clues as to possible functions. PPR19 and PPR26 possess a methyltransferase_4 domain suggesting involvement in RNA guanosine methylation. PPR18 contains a C-terminal CBS domain, similar to the CBSPPR1 protein found in nucleoids. PPR16, PPR29, PPR37, and PPR38 harbor a SmR (MutS-related) domain similar to that found in land plants pTAC2, GUN1, and SVR7. The PPR-cyclins PPR3, PPR4, and PPR6, in addition, contain a cyclin domain C-terminal to their SmR domain. PPR31 is an unusual PPR-cyclin containing at its N terminus an OctotricoPeptide Repeat (OPR) and a RAP domain. We consider the possibility that PPR proteins with a SmR domain can introduce single-stranded nicks in the plastid chromosome.

  17. PPR proteins of green algae

    PubMed Central

    Tourasse, Nicolas J; Choquet, Yves; Vallon, Olivier


    Using the repeat finding algorithm FT-Rep, we have identified 154 pentatricopeptide repeat (PPR) proteins in nine fully sequenced genomes from green algae (with a total of 1201 repeats) and grouped them in 47 orthologous groups. All data are available in a database, PPRdb, accessible online at Based on phylogenetic trees generated from the repeats, we propose evolutionary scenarios for PPR proteins. Two PPRs are clearly conserved in the entire green lineage: MRL1 is a stabilization factor for the rbcL mRNA, while HCF152 binds in plants to the psbH-petB intergenic region. MCA1 (the stabilization factor for petA) and PPR7 (a short PPR also acting on chloroplast mRNAs) are conserved across the entire Chlorophyta. The other PPRs are clade-specific, with evidence for gene losses, duplications, and horizontal transfer. In some PPR proteins, an additional domain found at the C terminus provides clues as to possible functions. PPR19 and PPR26 possess a methyltransferase_4 domain suggesting involvement in RNA guanosine methylation. PPR18 contains a C-terminal CBS domain, similar to the CBSPPR1 protein found in nucleoids. PPR16, PPR29, PPR37, and PPR38 harbor a SmR (MutS-related) domain similar to that found in land plants pTAC2, GUN1, and SVR7. The PPR-cyclins PPR3, PPR4, and PPR6, in addition, contain a cyclin domain C-terminal to their SmR domain. PPR31 is an unusual PPR-cyclin containing at its N terminus an OctotricoPeptide Repeat (OPR) and a RAP domain. We consider the possibility that PPR proteins with a SmR domain can introduce single-stranded nicks in the plastid chromosome. PMID:24021981

  18. [Marine algae of Baja California Sur, Mexico: nutritional value].


    Carrillo Domínguez, Silvia; Casas Valdez, Margarita; Ramos Ramos, Felipe; Pérez-Gil, Fernando; Sánchez Rodríguez, Ignacio


    The Baja California Peninsula is one of the richest regions of seaweed resources in México. The objective of this study was to determine the chemical composition of some marine algae species of Baja California Sur, with an economical potential due to their abundance and distribution, and to promote their use as food for human consumption and animal feeding. The algae studied were Green (Ulva spp., Enteromorpha intestinalis, Caulerpa sertularoides, Bryopsis hypnoides), Red (Laurencia johnstonii, Spyridia filamentosa, Hypnea valentiae) and Brown (Sargassum herporizum, S. sinicola, Padina durvillaei, Hydroclathrus clathrathus, Colpomenia sinuosa). The algae were dried and ground before analysis. In general, the results showed that algae had a protein level less than 11%, except L. johnstonii with 18% and low energy content. The ether extract content was lower than 1%. However, the algae were a good source of carbohydrates and inorganic matter.

  19. Collection, Isolation and Culture of Marine Algae.

    ERIC Educational Resources Information Center

    James, Daniel E.


    Methods of collecting, isolating, and culturing microscopic and macroscopic marine algae are described. Three different culture media list of chemicals needed and procedures for preparing Erdschreiber's and Provasoli's E. S. media. (BC)

  20. Peroxisomal targeting signals in green algae.


    Shinozaki, Akiko; Sato, Nagisa; Hayashi, Yasuko


    Peroxisomal enzymatic proteins contain targeting signals (PTS) to enable their import into peroxisomes. These targeting signals have been identified as PTS1 and PTS2 in mammalian, yeast, and higher plant cells; however, no PTS2-like amino acid sequences have been observed in enzymes from the genome database of Cyanidiochyzon merolae (Bangiophyceae), a primitive red algae. In studies on the evolution of PTS, it is important to know when their sequences came to be the peroxisomal targeting signals for all living organisms. To this end, we identified a number of genes in the genome database of the green algae Chlamydomonas reinhardtii, which contains amino acid sequences similar to those found in plant PTS. In order to determine whether these sequences function as PTS in green algae, we expressed modified green fluorescent proteins (GFP) fused to these putative PTS peptides under the cauliflower mosaic virus 35S promoter. To confirm whether granular structures containing GFP-PTS fusion proteins accumulated in the peroxisomes of Closterium ehrenbergii, we observed these cells after the peroxisomes were stained with 3, 3'-diaminobenzidine. Our results confirm that the GFP-PTS fusion proteins indeed accumulated in the peroxisomes of these green algae. These findings suggest that the peroxisomal transport system for PTS1 and PTS2 is conserved in green algal cells and that our fusion proteins can be used to visualize peroxisomes in live cells.

  1. Photooxidative Death in Blue-Green Algae

    PubMed Central

    Abeliovich, A.; Shilo, M.


    When incubated in the light under 100% oxygen, wild-type blue-green algae (Anacystis nidulans, Synechococcus cedrorum) die out rapidly at temperatures of 4 to 15 C, and at 35 C (or at 26 C in the case of S. cedrorum) in the absence of CO2. Photosynthesis is impaired in these cells long before they die. Blocking of photosystem II at high temperatures in the presence of CO2 sensitizes the algae to photooxidative death. Photooxidative death and bleaching of photosynthetic pigments are separable phenomena. Photooxidative conditions were demonstrated in Israeli fish ponds using A. nidulans as the test organism during dense summer blooms, when dissolved CO2 is low, and in winter, when water temperatures generally drop below 15 C. This finding suggests that photooxidative death may be responsible for the sudden decomposition of blue-green blooms in summer, and may be a factor in the absence of blue-green blooms in winter. PMID:4626540

  2. Toxicity of chlorinated benzenes to marine algae

    NASA Astrophysics Data System (ADS)

    Ma, Yan-Jun; Wang, Xiu-Lin; Yu, Wei-Jun; Zhang, Li-Jun; Sun, Han-Zhang


    Growth of Chlorella marine, Nannochloropsis oculata, Pyramidomonas sp., Platymonas subcordiformis and Phaeodactylum tricornutum exposed to monochlorobenzene (MCB), 1,2-dichlorobenzene (1,2-DCB), 1, 2, 3, 4-tetrachlorobenzene (1, 2, 3, 4-TeCB) and pentachlorobenzene (PeCB) was tested. Tests of 72 h- EC 50 values showed that the toxicity ranged in the order: MCB<1,2-DCB<1,2,3,4-TeCBmarine algae was almost in the order: Pyramidomonas sp. < Platymonas subcordiformis < Nannochloropsis oculata < Chlorella marine < Phaeodactylum tricomutum. Study of the QSAR (Quantitative Structure-Activity Relationship) between K OW and toxicity of CBs to marine algae showed good relationships between -log EC 50 and log K OW.

  3. Plasticity predicts evolution in a marine alga.


    Schaum, C Elisa; Collins, Sinéad


    Under global change, populations have four possible responses: 'migrate, acclimate, adapt or die' (Gienapp et al. 2008 Climate change and evolution: disentangling environmental and genetic response. Mol. Ecol. 17, 167-178. (doi:10.1111/j.1365-294X.2007.03413.x)). The challenge is to predict how much migration, acclimatization or adaptation populations are capable of. We have previously shown that populations from more variable environments are more plastic (Schaum et al. 2013 Variation in plastic responses of a globally distributed picoplankton species to ocean acidification. Nature 3, 298-230. (doi:10.1038/nclimate1774)), and here we use experimental evolution with a marine microbe to learn that plastic responses predict the extent of adaptation in the face of elevated partial pressure of CO2 (pCO2). Specifically, plastic populations evolve more, and plastic responses in traits other than growth can predict changes in growth in a marine microbe. The relationship between plasticity and evolution is strongest when populations evolve in fluctuating environments, which favour the evolution and maintenance of plasticity. Strikingly, plasticity predicts the extent, but not direction of phenotypic evolution. The plastic response to elevated pCO2 in green algae is to increase cell division rates, but the evolutionary response here is to decrease cell division rates over 400 generations until cells are dividing at the same rate their ancestors did in ambient CO2. Slow-growing cells have higher mitochondrial potential and withstand further environmental change better than faster growing cells. Based on this, we hypothesize that slow growth is adaptive under CO2 enrichment when associated with the production of higher quality daughter cells.

  4. Phycobilisomes in Blue-Green Algae

    PubMed Central

    Wildman, Ruth B.; Bowen, C. C.


    Fifteen species of freshwater blue-green algae, including unicellular, filamentous, and colonial forms, were subjected to a variety of fixatives, fixation conditions, and stains for comparison of the preservation of phycobilisomes. Absorption spectra of the corresponding in vivo and released photosynthetic pigments, in 10 of the species that were maintained in culture, demonstrated the presence of phycocyanin in all 10 species and phycoerythrin in only 2 of them. Spectroscope and electron microscope evidence was obtained for localization of phycobiliproteins in phycobilisomes of Nostoc muscorum. Phycobilisomes were observed in all species examined in situ, strenghening the hypothesis that phycobilisomes are common to all phycobiliprotein-containing photosynthetic blue-green algae. Images PMID:4204443

  5. Bioconcentration of tetrachlorobenzene in marine algae

    NASA Astrophysics Data System (ADS)

    Wang, Xiu-Lin; Ma, Yan-Jun; Cheng, Gang; Yu, Wei-Jun; Zhang, Li-Jun


    Bioconcentration of tetrachlorobenzene (TeCB) in Chlorella marine, Nannochloropsis oculata, Pyramidomonas sp., Platymonas subcordiformis, and Phaeodactylum tricornutum; and toxicity of TeCB to the marine algae were tested. Values of bioconcentration potential parameters, including uptake rate constant k 1, elimination rate constant k 2 and bioconcentration factor BCF, were obtained not only from the time course of TeCB uptake by the marine algae by using a bioconcentration model, but also from the acute toxicity test data for percent inhibition PI(%)˜exposure concentration of TeCB-time by using a combined bioconcentration and probability model. The results showed good relationship between k 1(TOXIC) and k 1(UPTAKE) and k 2(TOXIC), k 2(UPTAKE), and BCF D(IOXIC) and BCF D(UPTAKE). Especially, the values of BCF D(TOXIC) were well consistent with those of BCF D(UPTAKE).

  6. Antioxidant Activity of Hawaiian Marine Algae

    PubMed Central

    Kelman, Dovi; Posner, Ellen Kromkowski; McDermid, Karla J.; Tabandera, Nicole K.; Wright, Patrick R.; Wright, Anthony D.


    Marine algae are known to contain a wide variety of bioactive compounds, many of which have commercial applications in pharmaceutical, medical, cosmetic, nutraceutical, food and agricultural industries. Natural antioxidants, found in many algae, are important bioactive compounds that play an important role against various diseases and ageing processes through protection of cells from oxidative damage. In this respect, relatively little is known about the bioactivity of Hawaiian algae that could be a potential natural source of such antioxidants. The total antioxidant activity of organic extracts of 37 algal samples, comprising of 30 species of Hawaiian algae from 27 different genera was determined. The activity was determined by employing the FRAP (Ferric Reducing Antioxidant Power) assays. Of the algae tested, the extract of Turbinaria ornata was found to be the most active. Bioassay-guided fractionation of this extract led to the isolation of a variety of different carotenoids as the active principles. The major bioactive antioxidant compound was identified as the carotenoid fucoxanthin. These results show, for the first time, that numerous Hawaiian algae exhibit significant antioxidant activity, a property that could lead to their application in one of many useful healthcare or related products as well as in chemoprevention of a variety of diseases including cancer. PMID:22412808

  7. Chloroplast Phylogenomic Inference of Green Algae Relationships

    PubMed Central

    Sun, Linhua; Fang, Ling; Zhang, Zhenhua; Chang, Xin; Penny, David; Zhong, Bojian


    The green algal phylum Chlorophyta has six diverse classes, but the phylogenetic relationship of the classes within Chlorophyta remains uncertain. In order to better understand the ancient Chlorophyta evolution, we have applied a site pattern sorting method to study compositional heterogeneity and the model fit in the green algal chloroplast genomic data. We show that the fastest-evolving sites are significantly correlated with among-site compositional heterogeneity, and these sites have a much poorer fit to the evolutionary model. Our phylogenomic analyses suggest that the class Chlorophyceae is a monophyletic group, and the classes Ulvophyceae, Trebouxiophyceae and Prasinophyceae are non-monophyletic groups. Our proposed phylogenetic tree of Chlorophyta will offer new insights to investigate ancient green algae evolution, and our analytical framework will provide a useful approach for evaluating and mitigating the potential errors of phylogenomic inferences. PMID:26846729

  8. Settlement of marine periphytic algae in a tropical estuary

    NASA Astrophysics Data System (ADS)

    Nayar, S.; Goh, B. P. L.; Chou, L. M.


    This note describes settlement studies of marine periphytic algae on glass substrata in a tropical estuary in Singapore. The rates of production in terms of 14C radiotracer uptake, biomass in terms of chlorophyll a, community structure and cell abundance were measured from the settled periphytic algae at various depths in the water column and compared with the prevailing hydrographical conditions. Relatively higher periphytic algal settlement was observed at 1 m depth, even though it was not statistically different from other depths. Diatoms such as Skeletonema costatum and Thalassiosira rotula dominated the assemblage, together with the marine cyanobacteria Synechococcus sp. The three settlement parameters viz., periphytic algal production, chlorophyll a and cell counts showed significant differences between the days of settlement, with no significant differences observed for different depths. The periphytic algal community in this study comprised 30 microalgal species, dominated by diatoms (78%), followed by cyanobacteria (19% - primarily Synechococcus sp.), green flagellates (1%), dinoflagellates (1%) and other forms accounting for the remaining 1% of the total cell counts. Correlation studies and principal component analysis (PCA) revealed significant influence of silicate concentrations in the water column with the settlement of periphytic algae in this estuary. Though photoinhibited at the surface, photosynthetically available radiation did not seem to influence the overall settlement of periphytic algae. Diatoms and Synechococcus in the periphytic algal community were influenced by water temperature, PAR, pH and dissolved oxygen as seen in the PCA plots.

  9. Selenium Uptake and Volatilization by Marine Algae

    NASA Astrophysics Data System (ADS)

    Luxem, Katja E.; Vriens, Bas; Wagner, Bettina; Behra, Renata; Winkel, Lenny H. E.


    Selenium (Se) is an essential trace nutrient for humans. An estimated one half to one billion people worldwide suffer from Se deficiency, which is due to low concentrations and bioavailability of Se in soils where crops are grown. It has been hypothesized that more than half of the atmospheric Se deposition to soils is derived from the marine system, where microorganisms methylate and volatilize Se. Based on model results from the late 1980s, the atmospheric flux of these biogenic volatile Se compounds is around 9 Gt/year, with two thirds coming from the marine biosphere. Algae, fungi, and bacteria are known to methylate Se. Although algal Se uptake, metabolism, and methylation influence the speciation and bioavailability of Se in the oceans, these processes have not been quantified under environmentally relevant conditions and are likely to differ among organisms. Therefore, we are investigating the uptake and methylation of the two main inorganic Se species (selenate and selenite) by three globally relevant microalgae: Phaeocystis globosa, the coccolithophorid Emiliania huxleyi, and the diatom Thalassiosira oceanica. Selenium uptake and methylation were quantified in a batch experiment, where parallel gas-tight microcosms in a climate chamber were coupled to a gas-trapping system. For E. huxleyi, selenite uptake was strongly dependent on aqueous phosphate concentrations, which agrees with prior evidence that selenite uptake by phosphate transporters is a significant Se source for marine algae. Selenate uptake was much lower than selenite uptake. The most important volatile Se compounds produced were dimethyl selenide, dimethyl diselenide, and dimethyl selenyl sulfide. Production rates of volatile Se species were larger with increasing intracellular Se concentration and in the decline phase of the alga. Similar experiments are being carried out with P. globosa and T. oceanica. Our results indicate that marine algae are important for the global cycling of Se

  10. Pheromones in marine algae: A technical approach

    NASA Astrophysics Data System (ADS)

    Gassmann, G.; Müller, D. G.; Fritz, P.


    It is now well known that many marine organisms use low-molecular volatile substances as signals, in order to coordinate activities between different individuals. The study of such pheromones requires the isolation and enrichment of the secretions from undisturbed living cells or organisms over extended periods of time. The Grob-Hersch extraction device, which we describe here, avoids adverse factors for the biological materials such as strong water currents, rising gas bubbles or chemical solvents. Furthermore, the formation of sea-water spray is greatly reduced. The application of this technique for the isolation of pheromones of marine algae and animals is described.


    PubMed Central

    Emerson, Robert; Green, Lowell


    A manometric method for measuring photosynthesis in marine algae is described. Photosynthesis in the red alga Gigartina harveyana is shown to be similar in all important respects to photosynthesis in Chlorella and other Chlorophyceae. PMID:19872816

  12. Antibody Production in Plants and Green Algae.


    Yusibov, Vidadi; Kushnir, Natasha; Streatfield, Stephen J


    Monoclonal antibodies (mAbs) have a wide range of modern applications, including research, diagnostic, therapeutic, and industrial uses. Market demand for mAbs is high and continues to grow. Although mammalian systems, which currently dominate the biomanufacturing industry, produce effective and safe recombinant mAbs, they have a limited manufacturing capacity and high costs. Bacteria, yeast, and insect cell systems are highly scalable and cost effective but vary in their ability to produce appropriate posttranslationally modified mAbs. Plants and green algae are emerging as promising production platforms because of their time and cost efficiencies, scalability, lack of mammalian pathogens, and eukaryotic posttranslational protein modification machinery. So far, plant- and algae-derived mAbs have been produced predominantly as candidate therapeutics for infectious diseases and cancer. These candidates have been extensively evaluated in animal models, and some have shown efficacy in clinical trials. Here, we review ongoing efforts to advance the production of mAbs in plants and algae. PMID:26905655

  13. Antibody Production in Plants and Green Algae.


    Yusibov, Vidadi; Kushnir, Natasha; Streatfield, Stephen J


    Monoclonal antibodies (mAbs) have a wide range of modern applications, including research, diagnostic, therapeutic, and industrial uses. Market demand for mAbs is high and continues to grow. Although mammalian systems, which currently dominate the biomanufacturing industry, produce effective and safe recombinant mAbs, they have a limited manufacturing capacity and high costs. Bacteria, yeast, and insect cell systems are highly scalable and cost effective but vary in their ability to produce appropriate posttranslationally modified mAbs. Plants and green algae are emerging as promising production platforms because of their time and cost efficiencies, scalability, lack of mammalian pathogens, and eukaryotic posttranslational protein modification machinery. So far, plant- and algae-derived mAbs have been produced predominantly as candidate therapeutics for infectious diseases and cancer. These candidates have been extensively evaluated in animal models, and some have shown efficacy in clinical trials. Here, we review ongoing efforts to advance the production of mAbs in plants and algae.

  14. Antibiotic activity of lectins from marine algae against marine vibrios.


    Liao, W-R; Lin, J-Y; Shieh, W-Y; Jeng, W-L; Huang, R


    Saline and aqueous ethanol extracts of marine algae and the lectins from two red algal species were assayed for their antibiotic activity against marine vibrios. Experimental studies were also carried out on the influence of environmental factors on such activity, using batch cultures. The results indicated that many of the saline extracts of the algal species were active and that the activity was selective against those vibrios assayed. The algal extracts were active against Vibrio pelagius and the fish pathogen V. vulnificus, but inactive against V. neresis. Algal lectins from Eucheuma serra (ESA) and Galaxaura marginata (GMA) strongly inhibited V. vulnificus but were inactive against the other two vibrios. The antibacterial activity of algal extracts was inhibited by pretreatment with various sugars and glycoprotein. Extracts of the two red algae, E. serra and Pterocladia capillacea, in saline and aqueous ethanol, inhibited markedly the growth rate of V. vulnificus at very low concentrations. Culture results indicated that metabolites active against V. vulnificus were invariably produced in P. capillacea over a wide range of temperature, light intensity, and nutritional conditions. Enhanced antibacterial activity occurred when P. capillacea was grown under higher irradiance, severe nutrient stress and moderate temperature (20 degrees C), reflecting the specific antibiotic characteristics of this alga. The strong antibiotic activity of lectins towards fish pathogenic bacteria reveals one of the important roles played by algal lectins, as well as the potential high economic value of those marine algae assayed for aquaculture and for biomedical purposes. PMID:12884128

  15. Bromophenols from marine algae with potential anti-diabetic activities

    NASA Astrophysics Data System (ADS)

    Lin, Xiukun; Liu, Ming


    Marine algae contain various bromophenols with a variety of biological activities, including antimicrobial, anticancer, and anti-diabetic effects. Here, we briefly review the recent progress in researches on the biomaterials from marine algae, emphasizing the relationship between the structure and the potential anti-diabetic applications. Bromophenols from marine algae display their hyperglycemic effects by inhibiting the activities of protein tyrosine phosphatase 1B, α-glucosidase, as well as other mechanisms.

  16. Life-Cycle and Genome of OtV5, a Large DNA Virus of the Pelagic Marine Unicellular Green Alga Ostreococcus tauri

    PubMed Central

    Derelle, Evelyne; Ferraz, Conchita; Escande, Marie-Line; Eychenié, Sophie; Cooke, Richard; Piganeau, Gwenaël; Desdevises, Yves; Bellec, Laure; Moreau, Hervé; Grimsley, Nigel


    Large DNA viruses are ubiquitous, infecting diverse organisms ranging from algae to man, and have probably evolved from an ancient common ancestor. In aquatic environments, such algal viruses control blooms and shape the evolution of biodiversity in phytoplankton, but little is known about their biological functions. We show that Ostreococcus tauri, the smallest known marine photosynthetic eukaryote, whose genome is completely characterized, is a host for large DNA viruses, and present an analysis of the life-cycle and 186,234 bp long linear genome of OtV5. OtV5 is a lytic phycodnavirus which unexpectedly does not degrade its host chromosomes before the host cell bursts. Analysis of its complete genome sequence confirmed that it lacks expected site-specific endonucleases, and revealed the presence of 16 genes whose predicted functions are novel to this group of viruses. OtV5 carries at least one predicted gene whose protein closely resembles its host counterpart and several other host-like sequences, suggesting that horizontal gene transfers between host and viral genomes may occur frequently on an evolutionary scale. Fifty seven percent of the 268 predicted proteins present no similarities with any known protein in Genbank, underlining the wealth of undiscovered biological diversity present in oceanic viruses, which are estimated to harbour 200Mt of carbon. PMID:18509524

  17. Phosphorus-limited growth of a green alga and a blue-green alga

    SciTech Connect

    Lang, D.S.; Brown, E.J.


    The phosphorus-limited growth kinetics of the chlorophyte Scenedesmus quadricauda and the cyanophyte Synechococcus Nageli were studied by using batch and continuous culturing techniques. The steady-state phosphate transport capability and the phosphorus storage capacity is higher in S. Nageli than in S. quadricauda. Synechococcus Nageli can also deplete phosphate to much lower levels than can S. quadricauda. These results, along with their morphological characteristics, were used to construct partial physiological profiles for each organism. The profiles indicate that this unicellular cyanophyte (cyanobacterium) is better suited for growth in phosphorus-limited oligotrophic niches than is this chlorophyte (green alga). (Refs. 44).

  18. Marine algae and land plants share conserved phytochrome signaling systems

    PubMed Central

    Duanmu, Deqiang; Bachy, Charles; Sudek, Sebastian; Wong, Chee-Hong; Jiménez, Valeria; Rockwell, Nathan C.; Martin, Shelley S.; Ngan, Chew Yee; Reistetter, Emily N.; van Baren, Marijke J.; Price, Dana C.; Wei, Chia-Lin; Reyes-Prieto, Adrian; Lagarias, J. Clark; Worden, Alexandra Z.


    Phytochrome photosensors control a vast gene network in streptophyte plants, acting as master regulators of diverse growth and developmental processes throughout the life cycle. In contrast with their absence in known chlorophyte algal genomes and most sequenced prasinophyte algal genomes, a phytochrome is found in Micromonas pusilla, a widely distributed marine picoprasinophyte (<2 µm cell diameter). Together with phytochromes identified from other prasinophyte lineages, we establish that prasinophyte and streptophyte phytochromes share core light-input and signaling-output domain architectures except for the loss of C-terminal response regulator receiver domains in the streptophyte phytochrome lineage. Phylogenetic reconstructions robustly support the presence of phytochrome in the common progenitor of green algae and land plants. These analyses reveal a monophyletic clade containing streptophyte, prasinophyte, cryptophyte, and glaucophyte phytochromes implying an origin in the eukaryotic ancestor of the Archaeplastida. Transcriptomic measurements reveal diurnal regulation of phytochrome and bilin chromophore biosynthetic genes in Micromonas. Expression of these genes precedes both light-mediated phytochrome redistribution from the cytoplasm to the nucleus and increased expression of photosynthesis-associated genes. Prasinophyte phytochromes perceive wavelengths of light transmitted farther through seawater than the red/far-red light sensed by land plant phytochromes. Prasinophyte phytochromes also retain light-regulated histidine kinase activity lost in the streptophyte phytochrome lineage. Our studies demonstrate that light-mediated nuclear translocation of phytochrome predates the emergence of land plants and likely represents a widespread signaling mechanism in unicellular algae. PMID:25267653

  19. Marine algae and land plants share conserved phytochrome signaling systems


    Duanmu, Deqiang; Bachy, Charles; Sudek, Sebastian; Wong, Chee -Hong; Jimenez, Valeria; Rockwell, Nathan C.; Martin, Shelley S.; Ngan, Chew Yee; Reistetter, Emily N.; van Baren, Marijke J.; et al


    Phytochrome photosensors control a vast gene network in streptophyte plants, acting as master regulators of diverse growth and developmental processes throughout the life cycle. In contrast with their absence in known chlorophyte algal genomes and most sequenced prasinophyte algal genomes, a phytochrome is found in Micromonas pusilla, a widely distributed marine picoprasinophyte (<2 µm cell diameter). Together with phytochromes identified from other prasinophyte lineages, we establish that prasinophyte and streptophyte phytochromes share core light-input and signaling-output domain architectures except for the loss of C-terminal response regulator receiver domains in the streptophyte phytochrome lineage. Phylogenetic reconstructions robustly support the presence ofmore » phytochrome in the common progenitor of green algae and land plants. These analyses reveal a monophyletic clade containing streptophyte, prasinophyte, cryptophyte, and glaucophyte phytochromes implying an origin in the eukaryotic ancestor of the Archaeplastida. Transcriptomic measurements reveal diurnal regulation of phytochrome and bilin chromophore biosynthetic genes in Micromonas. The expression of these genes precedes both light-mediated phytochrome redistribution from the cytoplasm to the nucleus and increased expression of photosynthesis-associated genes. Prasinophyte phytochromes perceive wavelengths of light transmitted farther through seawater than the red/far-red light sensed by land plant phytochromes. Prasinophyte phytochromes also retain light-regulated histidine kinase activity lost in the streptophyte phytochrome lineage. Our studies demonstrate that light-mediated nuclear translocation of phytochrome predates the emergence of land plants and likely represents a widespread signaling mechanism in unicellular algae.« less

  20. Marine algae and land plants share conserved phytochrome signaling systems

    SciTech Connect

    Duanmu, Deqiang; Bachy, Charles; Sudek, Sebastian; Wong, Chee -Hong; Jimenez, Valeria; Rockwell, Nathan C.; Martin, Shelley S.; Ngan, Chew Yee; Reistetter, Emily N.; van Baren, Marijke J.; Price, Dana C.; Wei, Chia -Lin; Reyes-Prieto, Adrian; Lagarias, J. Clark; Worden, Alexandra Z.


    Phytochrome photosensors control a vast gene network in streptophyte plants, acting as master regulators of diverse growth and developmental processes throughout the life cycle. In contrast with their absence in known chlorophyte algal genomes and most sequenced prasinophyte algal genomes, a phytochrome is found in Micromonas pusilla, a widely distributed marine picoprasinophyte (<2 µm cell diameter). Together with phytochromes identified from other prasinophyte lineages, we establish that prasinophyte and streptophyte phytochromes share core light-input and signaling-output domain architectures except for the loss of C-terminal response regulator receiver domains in the streptophyte phytochrome lineage. Phylogenetic reconstructions robustly support the presence of phytochrome in the common progenitor of green algae and land plants. These analyses reveal a monophyletic clade containing streptophyte, prasinophyte, cryptophyte, and glaucophyte phytochromes implying an origin in the eukaryotic ancestor of the Archaeplastida. Transcriptomic measurements reveal diurnal regulation of phytochrome and bilin chromophore biosynthetic genes in Micromonas. The expression of these genes precedes both light-mediated phytochrome redistribution from the cytoplasm to the nucleus and increased expression of photosynthesis-associated genes. Prasinophyte phytochromes perceive wavelengths of light transmitted farther through seawater than the red/far-red light sensed by land plant phytochromes. Prasinophyte phytochromes also retain light-regulated histidine kinase activity lost in the streptophyte phytochrome lineage. Our studies demonstrate that light-mediated nuclear translocation of phytochrome predates the emergence of land plants and likely represents a widespread signaling mechanism in unicellular algae.

  1. Hyperspectral imaging of snow algae and green algae from aeroterrestrial habitats

    PubMed Central

    Holzinger, Andreas; Allen, Michael C.; Deheyn, Dimitri D.


    Snow algae and green algae living in aeroterrestrial habitats are ideal obbjects to study adaptation to high light irradiation. Here, we used a detailed description of the spectral properties as a proxy for photo-acclimation/protection in snow algae (Chlamydomonas nivalis, Chlainomonas sp. and Chloromonas sp.) and charopyhte green algae (Zygnema sp., Zygogonium ericetorum and Klebsormidium crenulatum). The hyperspectral microscopic mapping and imaging technique allowed us to acquire total absorbance spectra of these microalgae in the waveband of 400-900 nm. Particularly in Chlamydomonas nivalis and Chlainomonas sp., a high absorbance in the wave band of 400-550 nm was observed, due to naturally occurring secondary carotenoids; in Chloromonas sp. and in the charopyhte algae this was missing, the latter being close relatives to land plants. To investigate if cellular water loss has an influence on the spectral properties, the cells were plasmolysed in sorbitol or desiccated at ambient air. While in snow algae, these treatments did not change the spectral properties, in the charopyhte algae the condensation of the cytoplasm and plastids increased the absorbance in the lower waveband of 400 – 500 nm. These changes might be ecologically relevant and photoprotective, as aeroterrestrial algae are naturally exposed to occasional water limitation, leading to desiccation, which are conditions usually occurring together with higher irradiation. PMID:27442511

  2. Hyperspectral imaging of snow algae and green algae from aeroterrestrial habitats.


    Holzinger, Andreas; Allen, Michael C; Deheyn, Dimitri D


    Snow algae and green algae living in aeroterrestrial habitats are ideal objects to study adaptation to high light irradiation. Here, we used a detailed description of the spectral properties as a proxy for photo-acclimation/protection in snow algae (Chlamydomonas nivalis, Chlainomonas sp. and Chloromonas sp.) and charophyte green algae (Zygnema sp., Zygogonium ericetorum and Klebsormidium crenulatum). The hyperspectral microscopic mapping and imaging technique allowed us to acquire total absorption spectra of these microalgae in the waveband of 400-900nm. Particularly in Chlamydomonas nivalis and Chlainomonas sp., a high absorbance between 400-550nm was observed, due to naturally occurring secondary carotenoids; in Chloromonas sp. and in the charopyhte algae this high absorbance was missing, the latter being close relatives to land plants. To investigate if cellular water loss has an influence on the spectral properties, the cells were plasmolysed in sorbitol or desiccated at ambient air. While in snow algae, these treatments did hardly change the spectral properties, in the charopyhte algae the condensation of the cytoplasm and plastids increased the absorbance in the lower waveband of 400-500nm. These changes might be ecologically relevant and photoprotective, as aeroterrestrial algae are naturally exposed to occasional water limitation, leading to desiccation, which are conditions usually occurring together with higher irradiation. PMID:27442511

  3. Hyperspectral imaging of snow algae and green algae from aeroterrestrial habitats.


    Holzinger, Andreas; Allen, Michael C; Deheyn, Dimitri D


    Snow algae and green algae living in aeroterrestrial habitats are ideal objects to study adaptation to high light irradiation. Here, we used a detailed description of the spectral properties as a proxy for photo-acclimation/protection in snow algae (Chlamydomonas nivalis, Chlainomonas sp. and Chloromonas sp.) and charophyte green algae (Zygnema sp., Zygogonium ericetorum and Klebsormidium crenulatum). The hyperspectral microscopic mapping and imaging technique allowed us to acquire total absorption spectra of these microalgae in the waveband of 400-900nm. Particularly in Chlamydomonas nivalis and Chlainomonas sp., a high absorbance between 400-550nm was observed, due to naturally occurring secondary carotenoids; in Chloromonas sp. and in the charopyhte algae this high absorbance was missing, the latter being close relatives to land plants. To investigate if cellular water loss has an influence on the spectral properties, the cells were plasmolysed in sorbitol or desiccated at ambient air. While in snow algae, these treatments did hardly change the spectral properties, in the charopyhte algae the condensation of the cytoplasm and plastids increased the absorbance in the lower waveband of 400-500nm. These changes might be ecologically relevant and photoprotective, as aeroterrestrial algae are naturally exposed to occasional water limitation, leading to desiccation, which are conditions usually occurring together with higher irradiation.

  4. Evaluation of filamentous green algae as feedstocks for biofuel production.


    Zhang, Wei; Zhao, Yonggang; Cui, Binjie; Wang, Hui; Liu, Tianzhong


    Compared with unicellular microalgae, filamentous algae have high resistance to grazer-predation and low-cost recovery in large-scale production. Green algae, as the most diverse group of algae, included numerous filamentous genera and species. In this study, records of filamentous genera and species in green algae were firstly censused and classified. Then, seven filamentous strains subordinated in different genera were cultivated in bubbled-column to investigate their growth rate and energy molecular (lipid and starch) capacity. Four strains including Stigeoclonium sp., Oedogonium nodulosum, Hormidium sp. and Zygnema extenue were screened out due to their robust growth. And they all could accumulate triacylglycerols and starch in their biomass, but with different capacity. After nitrogen starvation, Hormidium sp. and Oedogonium nodulosum respectively exhibited high capacity of lipid (45.38% in dry weight) and starch (46.19% in dry weight) accumulation, which could be of high potential as feedstocks for biodiesel and bioethanol production. PMID:27598569

  5. Evaluation of filamentous green algae as feedstocks for biofuel production.


    Zhang, Wei; Zhao, Yonggang; Cui, Binjie; Wang, Hui; Liu, Tianzhong


    Compared with unicellular microalgae, filamentous algae have high resistance to grazer-predation and low-cost recovery in large-scale production. Green algae, as the most diverse group of algae, included numerous filamentous genera and species. In this study, records of filamentous genera and species in green algae were firstly censused and classified. Then, seven filamentous strains subordinated in different genera were cultivated in bubbled-column to investigate their growth rate and energy molecular (lipid and starch) capacity. Four strains including Stigeoclonium sp., Oedogonium nodulosum, Hormidium sp. and Zygnema extenue were screened out due to their robust growth. And they all could accumulate triacylglycerols and starch in their biomass, but with different capacity. After nitrogen starvation, Hormidium sp. and Oedogonium nodulosum respectively exhibited high capacity of lipid (45.38% in dry weight) and starch (46.19% in dry weight) accumulation, which could be of high potential as feedstocks for biodiesel and bioethanol production.

  6. Some properties and amino acid sequence of plastocyanin from a green alga, Ulva arasakii.


    Yoshizaki, F; Fukazawa, T; Mishina, Y; Sugimura, Y


    Plastocyanin was purified from a multicellular, marine green alga, Ulva arasakii, by conventional methods to homogeneity. The oxidized plastocyanin showed absorption maxima at 252, 276.8, 460, 595.3, and 775 nm, and shoulders at 259, 265, 269, and 282.5 nm; the ratio A276.8/A595.3 was 1.5. The midpoint redox potential was determined to be 0.356 V at pH 7.0 with a ferri- and ferrocyanide system. The molecular weight was estimated to be 10,200 and 11,000 by SDS-PAGE and by gel filtration, respectively. U. arasakii also has a small amount of cytochrome c6, like Enteromorpha prolifera. The amino acid sequence of U. arasakii plastocyanin was determined by Edman degradation and by carboxypeptidase digestion of the plastocyanin, six tryptic peptides, and five staphylococcal protease peptides. The plastocyanin contained 98 amino acid residues, giving a molecular weight of 10,236 including one copper atom. The complete sequence is as follows: AQIVKLGGDDGALAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETV VRKLSTPGVY G VYCEPHAGAGMKMTITVQ. The sequence of U. arasakii plastocyanin is closet to that of the E. prolifera protein (85% homology). A phylogenetic tree of five algal and two higher plant plastocyanins was constructed by comparing the amino acid differences. The branching order is considered to be as follows: a blue-green alga, unicellular green algae, multicellular green algae, and higher plants. PMID:2509442

  7. MicroRNAs in a multicellular green alga Volvox carteri.


    Li, Jingrui; Wu, Yang; Qi, Yijun


    microRNAs (miRNAs) have emerged as key components in the eukaryotic gene regulatory network. We and others have previously identified many miRNAs in a unicellular green alga, Chlamydomonas reinhardtii. To investigate whether miRNA-mediated gene regulation is a general mechanism in green algae and how miRNAs have been evolved in the green algal lineage, we examined small RNAs in Volvox carteri, a multicellular species in the same family with Chlamydomonas reinhardtii. We identified 174 miRNAs in Volvox, with many of them being highly enriched in gonidia or somatic cells. The targets of the miRNAs were predicted and many of them were subjected to miRNA-mediated cleavage in vivo, suggesting that miRNAs play regulatory roles in the biology of green algae. Our catalog of miRNAs and their targets provides a resource for further studies on the evolution, biological functions, and genomic properties of miRNAs in green algae. PMID:24369344

  8. Algae.


    Raven, John A; Giordano, Mario


    Algae frequently get a bad press. Pond slime is a problem in garden pools, algal blooms can produce toxins that incapacitate or kill animals and humans and even the term seaweed is pejorative - a weed being a plant growing in what humans consider to be the wrong place. Positive aspects of algae are generally less newsworthy - they are the basis of marine food webs, supporting fisheries and charismatic marine megafauna from albatrosses to whales, as well as consuming carbon dioxide and producing oxygen. Here we consider what algae are, their diversity in terms of evolutionary origin, size, shape and life cycles, and their role in the natural environment and in human affairs.

  9. Development of Green Fuels From Algae - The University of Tulsa

    SciTech Connect

    Crunkleton, Daniel; Price, Geoffrey; Johannes, Tyler; Cremaschi, Selen


    The general public has become increasingly aware of the pitfalls encountered with the continued reliance on fossil fuels in the industrialized world. In response, the scientific community is in the process of developing non-fossil fuel technologies that can supply adequate energy while also being environmentally friendly. In this project, we concentrate on green fuels which we define as those capable of being produced from renewable and sustainable resources in a way that is compatible with the current transportation fuel infrastructure. One route to green fuels that has received relatively little attention begins with algae as a feedstock. Algae are a diverse group of aquatic, photosynthetic organisms, generally categorized as either macroalgae (i.e. seaweed) or microalgae. Microalgae constitute a spectacularly diverse group of prokaryotic and eukaryotic unicellular organisms and account for approximately 50% of global organic carbon fixation. The PI's have subdivided the proposed research program into three main research areas, all of which are essential to the development of commercially viable algae fuels compatible with current energy infrastructure. In the fuel development focus, catalytic cracking reactions of algae oils is optimized. In the species development project, genetic engineering is used to create microalgae strains that are capable of high-level hydrocarbon production. For the modeling effort, the construction of multi-scaled models of algae production was prioritized, including integrating small-scale hydrodynamic models of algae production and reactor design and large-scale design optimization models.

  10. Photosynthetic H2 metabolism in Chlamydomonas reinhardtii (unicellular green algae).


    Melis, Anastasios


    Unicellular green algae have the ability to operate in two distinctly different environments (aerobic and anaerobic), and to photosynthetically generate molecular hydrogen (H2). A recently developed metabolic protocol in the green alga Chlamydomonas reinhardtii permitted separation of photosynthetic O2-evolution and carbon accumulation from anaerobic consumption of cellular metabolites and concomitant photosynthetic H2-evolution. The H2 evolution process was induced upon sulfate nutrient deprivation of the cells, which reversibly inhibits photosystem-II and O2-evolution in their chloroplast. In the absence of O2, and in order to generate ATP, green algae resorted to anaerobic photosynthetic metabolism, evolved H2 in the light and consumed endogenous substrate. This study summarizes recent advances on green algal hydrogen metabolism and discusses avenues of research for the further development of this method. Included is the mechanism of a substantial tenfold starch accumulation in the cells, observed promptly upon S-deprivation, and the regulated starch and protein catabolism during the subsequent H2-evolution. Also discussed is the function of a chloroplast envelope-localized sulfate permease, and the photosynthesis-respiration relationship in green algae as potential tools by which to stabilize and enhance H2 metabolism. In addition to potential practical applications of H2, approaches discussed in this work are beginning to address the biochemistry of anaerobic H2 photoproduction, its genes, proteins, regulation, and communication with other metabolic pathways in microalgae. Photosynthetic H2 production by green algae may hold the promise of generating a renewable fuel from nature's most plentiful resources, sunlight and water. The process potentially concerns global warming and the question of energy supply and demand. PMID:17721788

  11. [Immunostimulating activity of the lipopolysaccharides of blue-green algae].


    Besednova, N N; Smolina, T P; Mikheĭskaia, L V; Ovodova, R G


    The whole cells of blue-gree algae and lipopolysaccharides isolated from these cells were shown to stimulate the production of macro-(mainly) and microglobulin antibodies in rabbits. The macro- and microphage indices in rabbits increased significantly after the injection of LPS isolated from blue-green algae 24--48 hours before infecting the animals with a virulent Y. pseudotuberculosis strain. Besides, the inhibiting action of this strain on the migration of phagocytes to the site of infection was abolished immediately after the injection. The use of the indirect hemagglutination test allowed to prove the absence of close antigenic interrelations between blue-green algae and the following organisms: Spirulina platensis, Microcystis aeruginosa, Phormidium africanum and P. uncinatum. PMID:117655

  12. Fatty acid amides from freshwater green alga Rhizoclonium hieroglyphicum.


    Dembitsky, V M; Shkrob, I; Rozentsvet, O A


    Freshwater green algae Rhizoclonium hieroglyphicum growing in the Ural Mountains were examined for their fatty acid amides using capillary gas chromatography-mass spectrometry (GC-MS). Eight fatty acid amides were identified by GC-MS. (Z)-9-octadecenamide was found to be the major component (2.26%).

  13. [Phycobiliproteins of blue-green, red and cryptophytic algae].


    Stadnichuk, I N; Gusev, M V


    The present-day concepts on phycobiliproteins, the protein pigments of blue-green, red and cryptophyte algae are reviewed. The functions, distribution, localization, physico-chemical, spectral and immunochemical properties of phycobiliproteins are described. The properties of the polypeptide protein subunits and the composition and chemical structure of chromophores as well as their binding to the apoprotein molecules are discussed.

  14. Fatty acid amides from freshwater green alga Rhizoclonium hieroglyphicum.


    Dembitsky, V M; Shkrob, I; Rozentsvet, O A


    Freshwater green algae Rhizoclonium hieroglyphicum growing in the Ural Mountains were examined for their fatty acid amides using capillary gas chromatography-mass spectrometry (GC-MS). Eight fatty acid amides were identified by GC-MS. (Z)-9-octadecenamide was found to be the major component (2.26%). PMID:11014298

  15. Complete Chloroplast Genome Sequence of Phagomixotrophic Green Alga Cymbomonas tetramitiformis

    PubMed Central

    Paasch, Amber E.; Graham, Linda E.; Kim, Eunsoo


    We report here the complete chloroplast genome sequence of Cymbomonas tetramitiformis strain PLY262, which is a prasinophycean green alga that retains a phagomixotrophic mode of nutrition. The genome is 84,524 bp in length, with a G+C content of 37%, and contains 3 rRNAs, 26 tRNAs, and 76 protein-coding genes. PMID:27313295

  16. Oleosin of subcellular lipid droplets evolved in green algae.


    Huang, Nan-Lan; Huang, Ming-Der; Chen, Tung-Ling L; Huang, Anthony H C


    In primitive and higher plants, intracellular storage lipid droplets (LDs) of triacylglycerols are stabilized with a surface layer of phospholipids and oleosin. In chlorophytes (green algae), a protein termed major lipid-droplet protein (MLDP) rather than oleosin on LDs was recently reported. We explored whether MLDP was present directly on algal LDs and whether algae had oleosin genes and oleosins. Immunofluorescence microscopy revealed that MLDP in the chlorophyte Chlamydomonas reinhardtii was associated with endoplasmic reticulum subdomains adjacent to but not directly on LDs. In C. reinhardtii, low levels of a transcript encoding an oleosin-like protein (oleolike) in zygotes-tetrads and a transcript encoding oleosin in vegetative cells transferred to an acetate-enriched medium were found in transcriptomes and by reverse transcription-polymerase chain reaction. The C. reinhardtii LD fraction contained minimal proteins with no detectable oleolike or oleosin. Several charophytes (advanced green algae) possessed low levels of transcripts encoding oleosin but not oleolike. In the charophyte Spirogyra grevilleana, levels of oleosin transcripts increased greatly in cells undergoing conjugation for zygote formation, and the LD fraction from these cells contained minimal proteins, two of which were oleosins identified via proteomics. Because the minimal oleolike and oleosins in algae were difficult to detect, we tested their subcellular locations in Physcomitrella patens transformed with the respective algal genes tagged with a Green Fluorescent Protein gene and localized the algal proteins on P. patens LDs. Overall, oleosin genes having weak and cell/development-specific expression were present in green algae. We present a hypothesis for the evolution of oleosins from algae to plants. PMID:23391579

  17. Oleosin of subcellular lipid droplets evolved in green algae.


    Huang, Nan-Lan; Huang, Ming-Der; Chen, Tung-Ling L; Huang, Anthony H C


    In primitive and higher plants, intracellular storage lipid droplets (LDs) of triacylglycerols are stabilized with a surface layer of phospholipids and oleosin. In chlorophytes (green algae), a protein termed major lipid-droplet protein (MLDP) rather than oleosin on LDs was recently reported. We explored whether MLDP was present directly on algal LDs and whether algae had oleosin genes and oleosins. Immunofluorescence microscopy revealed that MLDP in the chlorophyte Chlamydomonas reinhardtii was associated with endoplasmic reticulum subdomains adjacent to but not directly on LDs. In C. reinhardtii, low levels of a transcript encoding an oleosin-like protein (oleolike) in zygotes-tetrads and a transcript encoding oleosin in vegetative cells transferred to an acetate-enriched medium were found in transcriptomes and by reverse transcription-polymerase chain reaction. The C. reinhardtii LD fraction contained minimal proteins with no detectable oleolike or oleosin. Several charophytes (advanced green algae) possessed low levels of transcripts encoding oleosin but not oleolike. In the charophyte Spirogyra grevilleana, levels of oleosin transcripts increased greatly in cells undergoing conjugation for zygote formation, and the LD fraction from these cells contained minimal proteins, two of which were oleosins identified via proteomics. Because the minimal oleolike and oleosins in algae were difficult to detect, we tested their subcellular locations in Physcomitrella patens transformed with the respective algal genes tagged with a Green Fluorescent Protein gene and localized the algal proteins on P. patens LDs. Overall, oleosin genes having weak and cell/development-specific expression were present in green algae. We present a hypothesis for the evolution of oleosins from algae to plants.

  18. Higher plant origins and the phylogeny of green algae.


    Devereux, R; Loeblich, A R; Fox, G E


    5S rRNA sequences from six additional green algae lend strong molecular support for the major outlines of higher plant and green algae phylogeny that have been proposed under varying naming conventions by several authors. In particular, the molecular evidence now available unequivocally supports the existence of at least two well-separated divisions of the Chlorobionta: the Chlorophyta and the Streptophyta (i.e., charophytes) (according to the nomenclature of Bremer). The chlamydomonad 5S rRNAs are, however, sufficiently distinct from both clusters that it may ultimately prove preferable to establish a third taxon for them. In support of these conclusions 5S rRNA sequence data now exist for members of four diverse classes of chlorophytes. These sequences all exhibit considerably more phylogenetic affinity to one another than any of them show toward members of the other cluster, the Streptophyta, or the two Chlamydomonas strains. Among the Charophyceae, new 5S rRNA sequences are provided herein for three genera, Spirogyra, Klebsormidium, and Coleochaete. All of these sequences and the previously published Nitella sequence show greater resemblance among themselves and to the higher plants than they do to any of the other green algae examined to date. These results demonstrate that an appropriately named taxon that includes these green algae and the higher plants is strongly justified. The 5S rRNA data lack the resolution needed, however, to unequivocally determine which of several subdivisions of the charophytes is the sister group of the land plants. The evolutionary diversity of Chlamydomonas relative to the other green algae was recognized in earlier 5S rRNA studies but was unanticipated by ultrastructural work.(ABSTRACT TRUNCATED AT 250 WORDS)

  19. Laser-fluorescence measurement of marine algae

    NASA Technical Reports Server (NTRS)

    Browell, E. V.


    Progress in remote sensing of algae by laser-induced fluorescence is subject of comprehensive report. Existing single-wavelength and four-wavelength systems are reviewed, and new expression for power received by airborne sensor is derived. Result differs by as much as factor of 10 from those previously reported. Detailed error analysis evluates factors affecting accuracy of laser-fluorosensor systems.

  20. Boron uptake, localization, and speciation in marine brown algae.


    Miller, Eric P; Wu, Youxian; Carrano, Carl J


    In contrast to the generally boron-poor terrestrial environment, the concentration of boron in the marine environment is relatively high (0.4 mM) and while there has been extensive interest in its use as a surrogate of pH in paleoclimate studies in the context of climate change-related questions, the relatively depth independent, and the generally non-nutrient-like concentration profile of this element have led to boron being neglected as a potentially biologically relevant element in the ocean. Among the marine plant-like organisms the brown algae (Phaeophyta) are one of only five lineages of photosynthetic eukaryotes to have evolved complex multicellularity. Many of unusual and often unique features of brown algae are attributable to this singular evolutionary history. These adaptations are a reflection of the marine coastal environment which brown algae dominate in terms of biomass. Consequently, brown algae are of fundamental importance to oceanic ecology, geochemistry, and coastal industry. Our results indicate that boron is taken up by a facilitated diffusion mechanism against a considerable concentration gradient. Furthermore, in both Ectocarpus and Macrocystis some boron is most likely bound to cell wall constituent alginate and the photoassimilate mannitol located in sieve cells. Herein, we describe boron uptake, speciation, localization and possible biological function in two species of brown algae, Macrocystis pyrifera and Ectocarpus siliculosus. PMID:26679972

  1. Boron uptake, localization, and speciation in marine brown algae.


    Miller, Eric P; Wu, Youxian; Carrano, Carl J


    In contrast to the generally boron-poor terrestrial environment, the concentration of boron in the marine environment is relatively high (0.4 mM) and while there has been extensive interest in its use as a surrogate of pH in paleoclimate studies in the context of climate change-related questions, the relatively depth independent, and the generally non-nutrient-like concentration profile of this element have led to boron being neglected as a potentially biologically relevant element in the ocean. Among the marine plant-like organisms the brown algae (Phaeophyta) are one of only five lineages of photosynthetic eukaryotes to have evolved complex multicellularity. Many of unusual and often unique features of brown algae are attributable to this singular evolutionary history. These adaptations are a reflection of the marine coastal environment which brown algae dominate in terms of biomass. Consequently, brown algae are of fundamental importance to oceanic ecology, geochemistry, and coastal industry. Our results indicate that boron is taken up by a facilitated diffusion mechanism against a considerable concentration gradient. Furthermore, in both Ectocarpus and Macrocystis some boron is most likely bound to cell wall constituent alginate and the photoassimilate mannitol located in sieve cells. Herein, we describe boron uptake, speciation, localization and possible biological function in two species of brown algae, Macrocystis pyrifera and Ectocarpus siliculosus.

  2. The xanthophyll cycle and NPQ in diverse desert and aquatic green algae.


    Lunch, Claire K; Lafountain, Amy M; Thomas, Suzanne; Frank, Harry A; Lewis, Louise A; Cardon, Zoe G


    It has long been suspected that photoprotective mechanisms in green algae are similar to those in seed plants. However, exceptions have recently surfaced among aquatic and marine green algae in several taxonomic classes. Green algae are highly diverse genetically, falling into 13 named classes, and they are diverse ecologically, with many lineages including members from freshwater, marine, and terrestrial habitats. Genetically similar species living in dramatically different environments are potentially a rich source of information about variations in photoprotective function. Using aquatic and desert-derived species from three classes of green algae, we examined the induction of photoprotection under high light, exploring the relationship between nonphotochemical quenching and the xanthophyll cycle. In liquid culture, behavior of aquatic Entransia fimbriata (Klebsormidiophyceae) generally matched patterns observed in seed plants. Nonphotochemical quenching was lowest after overnight dark adaptation, increased with light intensity, and the extent of nonphotochemical quenching correlated with the extent of deepoxidation of xanthophyll cycle pigments. In contrast, overnight dark adaptation did not minimize nonphotochemical quenching in the other species studied: desert Klebsormidium sp. (Klebsormidiophyceae), desert and aquatic Cylindrocystis sp. (Zygnematophyceae), and desert Stichococcus sp. (Trebouxiophyceae). Instead, exposure to low light reduced nonphotochemical quenching below dark-adapted levels. De-epoxidation of xanthophyll cycle pigments paralleled light-induced changes in nonphotochemical quenching for species within Klebsormidiophyceae and Trebouxiophyceae, but not Zygnematophyceae. Inhibition of violaxanthin-zeaxanthin conversion by dithiothreitol reduced high-light-associated nonphotochemical quenching in all species (Zygnematophyceae the least), indicating that zeaxanthin can contribute to photoprotection as in seed plants but to different extents

  3. A sweet new wave: structures and mechanisms of enzymes that digest polysaccharides from marine algae.


    Hehemann, Jan-Hendrik; Boraston, Alisdair B; Czjzek, Mirjam


    Marine algae contribute approximately half of the global primary production. The large amounts of polysaccharides synthesized by these algae are degraded and consumed by microbes that utilize carbohydrate-active enzymes (CAZymes), thus creating one of the largest and most dynamic components of the Earth's carbon cycle. Over the last decade, structural and functional characterizations of marine CAZymes have revealed a diverse set of scaffolds and mechanisms that are used to degrade agars, carrageenan, alginate and ulvan-polysaccharides from red, brown and green seaweeds, respectively. The analysis of these CAZymes is not only expanding our understanding of their functions but is enabling the enhanced annotation of (meta)-genomic data sets, thus promoting an improved understanding of microbes that drive this marine component of the carbon cycle. Furthermore, this information is setting a foundation that will enable marine algae to be harnessed as a novel resource for biorefineries. In this review, we cover the most recent structural and functional analyses of marine CAZymes that are specialized in the digestion of macro-algal polysaccharides.

  4. The use of Design of Experiments and Response Surface Methodology to optimize biomass and lipid production by the oleaginous marine green alga, Nannochloropsis gaditana in response to light intensity, inoculum size and CO2.


    Hallenbeck, Patrick C; Grogger, Melanie; Mraz, Megan; Veverka, Donald


    Biodiesel produced from microalgal lipids is being considered as a potential source of renewable energy. However, a number of hurdles will have to be overcome if such a process is to become practical. One important factor is the volumetric production of biomass and lipid that can be achieved. The marine alga Nannochloropsis gaditana is under study since it is known to be highly oleaginous and has a number of other attractive properties. Factors that might be important in biomass and lipid production by this alga are light intensity, inoculum size and CO2. Here we have carried out for the first time a RSM-DOE study of the influence of these important culture variables and define conditions that maximize biomass production, lipid content (BODIPY® fluorescence) and total lipid production. Moreover, flow cytometry allowed the examination on a cellular level of changes that occur in cellular populations as they age and accumulate lipids.

  5. The use of Design of Experiments and Response Surface Methodology to optimize biomass and lipid production by the oleaginous marine green alga, Nannochloropsis gaditana in response to light intensity, inoculum size and CO2.


    Hallenbeck, Patrick C; Grogger, Melanie; Mraz, Megan; Veverka, Donald


    Biodiesel produced from microalgal lipids is being considered as a potential source of renewable energy. However, a number of hurdles will have to be overcome if such a process is to become practical. One important factor is the volumetric production of biomass and lipid that can be achieved. The marine alga Nannochloropsis gaditana is under study since it is known to be highly oleaginous and has a number of other attractive properties. Factors that might be important in biomass and lipid production by this alga are light intensity, inoculum size and CO2. Here we have carried out for the first time a RSM-DOE study of the influence of these important culture variables and define conditions that maximize biomass production, lipid content (BODIPY® fluorescence) and total lipid production. Moreover, flow cytometry allowed the examination on a cellular level of changes that occur in cellular populations as they age and accumulate lipids. PMID:25304731

  6. Hydrogenases in green algae: do they save the algae's life and solve our energy problems?


    Happe, Thomas; Hemschemeier, Anja; Winkler, Martin; Kaminski, Annette


    Green algae are the only known eukaryotes with both oxygenic photosynthesis and a hydrogen metabolism. Recent physiological and genetic discoveries indicate a close connection between these metabolic pathways. The anaerobically inducible hydA genes of algae encode a special type of highly active [Fe]-hydrogenase. Electrons from reducing equivalents generated during fermentation enter the photosynthetic electron transport chain via the plastoquinone pool. They are transferred to the hydrogenase by photosystem I and ferredoxin. Thus, the [Fe]-hydrogenase is an electron 'valve' that enables the algae to survive under anaerobic conditions. During sulfur deprivation, illuminated algal cultures evolve large quantities of hydrogen gas, and this promises to be an alternative future energy source. PMID:12049920

  7. Green Algae as Model Organisms for Biological Fluid Dynamics*

    PubMed Central

    Goldstein, Raymond E.


    In the past decade the volvocine green algae, spanning from the unicellular Chlamydomonas to multicellular Volvox, have emerged as model organisms for a number of problems in biological fluid dynamics. These include flagellar propulsion, nutrient uptake by swimming organisms, hydrodynamic interactions mediated by walls, collective dynamics and transport within suspensions of microswimmers, the mechanism of phototaxis, and the stochastic dynamics of flagellar synchronization. Green algae are well suited to the study of such problems because of their range of sizes (from 10 μm to several millimetres), their geometric regularity, the ease with which they can be cultured and the availability of many mutants that allow for connections between molecular details and organism-level behavior. This review summarizes these recent developments and highlights promising future directions in the study of biological fluid dynamics, especially in the context of evolutionary biology, that can take advantage of these remarkable organisms. PMID:26594068

  8. Green Algae as Model Organisms for Biological Fluid Dynamics

    NASA Astrophysics Data System (ADS)

    Goldstein, Raymond E.


    In the past decade, the volvocine green algae, spanning from the unicellular Chlamydomonas to multicellular Volvox, have emerged as model organisms for a number of problems in biological fluid dynamics. These include flagellar propulsion, nutrient uptake by swimming organisms, hydrodynamic interactions mediated by walls, collective dynamics and transport within suspensions of microswimmers, the mechanism of phototaxis, and the stochastic dynamics of flagellar synchronization. Green algae are well suited to the study of such problems because of their range of sizes (from 10 μm to several millimeters), their geometric regularity, the ease with which they can be cultured, and the availability of many mutants that allow for connections between molecular details and organism-level behavior. This review summarizes these recent developments and highlights promising future directions in the study of biological fluid dynamics, especially in the context of evolutionary biology, that can take advantage of these remarkable organisms.

  9. Marine Polysaccharides from Algae with Potential Biomedical Applications

    PubMed Central

    de Jesus Raposo, Maria Filomena; de Morais, Alcina Maria Bernardo; de Morais, Rui Manuel Santos Costa


    There is a current tendency towards bioactive natural products with applications in various industries, such as pharmaceutical, biomedical, cosmetics and food. This has put some emphasis in research on marine organisms, including macroalgae and microalgae, among others. Polysaccharides with marine origin constitute one type of these biochemical compounds that have already proved to have several important properties, such as anticoagulant and/or antithrombotic, immunomodulatory ability, antitumor and cancer preventive, antilipidaemic and hypoglycaemic, antibiotics and anti-inflammatory and antioxidant, making them promising bioactive products and biomaterials with a wide range of applications. Their properties are mainly due to their structure and physicochemical characteristics, which depend on the organism they are produced by. In the biomedical field, the polysaccharides from algae can be used in controlled drug delivery, wound management, and regenerative medicine. This review will focus on the biomedical applications of marine polysaccharides from algae. PMID:25988519

  10. The problems of Prochloron. [evolution of green algae

    NASA Technical Reports Server (NTRS)

    Lewin, R. A.


    Prokaryotic green algae (prochlorophytes), which contain chlorophylls a and b but no bilin pigments, may be phylogenetically related to ancestral chloroplasts if symbiogenesis occurred. They may be otherwise related to eukaryotic chlorophytes. They could have evolved from cyanophytes by loss of phycobilin and gain of chlorophyll b synthesis. These possibilities are briefly discussed. Relevant evidence from biochemical studies in many collaborative laboratories is now becoming available for the resolution of such questions.

  11. Subunit structure of the phycobiliproteins of blue-green algae.


    Glazer, A N; Cohen-Bazire, G


    The phycobiliproteins of the blue-green algae Synechococcus sp. and Aphanocapsu sp. were characterized with respect to homogeneity, isoelectric point, and subunit composition. Each of the biliproteins consisted of two different noncovalently associated subunits, with molecular weights of about 20,000 and 16,000 for phycocyanin, 17,500 and 15,500 for allophycocyanin, and 22,000 and 20,000 for phycoerythrin. Covalently bound chromophore was associated with each subunit.

  12. Multicellularity in green algae: upsizing in a walled complex.


    Domozych, David S; Domozych, Catherine E


    Modern green algae constitute a large and diverse taxonomic assemblage that encompasses many multicellular phenotypes including colonial, filamentous, and parenchymatous forms. In all multicellular green algae, each cell is surrounded by an extracellular matrix (ECM), most often in the form of a cell wall. Volvocalean taxa like Volvox have an elaborate, gel-like, hydroxyproline rich glycoprotein covering that contains the cells of the colony. In "ulvophytes," uronic acid-rich and sulfated polysaccharides are the likely adhesion agents that maintain the multicellular habit. Charophytes also produce polysaccharide-rich cell walls and in late divergent taxa, pectin plays a critical role in cell adhesion in the multicellular complex. Cell walls are products of coordinated interaction of membrane trafficking, cytoskeletal dynamics and the cell's signal transduction machinery responding both to precise internal clocks and external environmental cues. Most often, these activities must be synchronized with the secretion, deposition and remodeling of the polymers of the ECM. Rapid advances in molecular genetics, cell biology and cell wall biochemistry of green algae will soon provide new insights into the evolution and subcellular processes leading to multicellularity. PMID:25477895

  13. Multicellularity in green algae: upsizing in a walled complex

    PubMed Central

    Domozych, David S.; Domozych, Catherine E.


    Modern green algae constitute a large and diverse taxonomic assemblage that encompasses many multicellular phenotypes including colonial, filamentous, and parenchymatous forms. In all multicellular green algae, each cell is surrounded by an extracellular matrix (ECM), most often in the form of a cell wall. Volvocalean taxa like Volvox have an elaborate, gel-like, hydroxyproline rich glycoprotein covering that contains the cells of the colony. In “ulvophytes,” uronic acid-rich and sulfated polysaccharides are the likely adhesion agents that maintain the multicellular habit. Charophytes also produce polysaccharide-rich cell walls and in late divergent taxa, pectin plays a critical role in cell adhesion in the multicellular complex. Cell walls are products of coordinated interaction of membrane trafficking, cytoskeletal dynamics and the cell’s signal transduction machinery responding both to precise internal clocks and external environmental cues. Most often, these activities must be synchronized with the secretion, deposition and remodeling of the polymers of the ECM. Rapid advances in molecular genetics, cell biology and cell wall biochemistry of green algae will soon provide new insights into the evolution and subcellular processes leading to multicellularity. PMID:25477895

  14. Effect of selenium on the lipids of two unicellular marine algae

    SciTech Connect

    Gennity, J.M.


    The incorporation of selenium into the lipids of two unicellar marine algae has been investigated. Axenic cultures of the green algae Dunaliella primolecta and the red algae Porphyridium cruentum were grown in the presence of sublethal quantities of selenium (10 ppm) as selenite. Both algae were found to contain selenium bound to all purified lipids, except for saturated hydrocarbons. Of the lipids which contain selenium, carotenoid pigments show the greatest selenium concentration (..beta..-carotene: lipid; zeaxanthin: lipid) in both algae. P. cruentum contains about ten times as much lipid-associated selenium as D. primolecta, even though the lipids of both algae were very similar. This selenium has been shown to be incorporated non-metabolically into the lipid molecule. The lipid-associated selenium is probably non-covalently bound to the lipid molecule and may interact with double bonds. Selenite does not affect the lipid composition of D. primolecta, as compared with algae grown in the absence of added selenium. A selenium-induced 40% decrease in the cell content of eicosapentaenoic acid (20:5omega3) and 20% decrease in arachidonic acid (20:4omega6) in polar lipids (glycolipids plus phospholipids) was observed in P. cruentum. A 25% decrease in the chlorophyll a content of this red algae also occurred. The cell content of other fatty acids, phospholipids and glycolipids was unaltered by selenium. These results are consistent with a selenite-induced oxidation of P. cruentum lipids. Selenium is able to increase the antioxidant potential of algal cells. However, no in vivo selenium-induced protection of algal lipids from oxidation was apparent.

  15. Antibacterial substances from marine algae isolated from Jeddah coast of Red sea, Saudi Arabia.


    Al-Saif, Sarah Saleh Abdu-Llah; Abdel-Raouf, Nevein; El-Wazanani, Hend A; Aref, Ibrahim A


    Marine algae are known to produce a wide variety of bioactive secondary metabolites and several compounds have been derived from them for prospective development of novel drugs by the pharmaceutical industries. However algae of the Red sea have not been adequately explored for their potential as a source of bioactive substances. In this context Ulva reticulata, Caulerpa occidentalis, Cladophora socialis, Dictyota ciliolata, and Gracilaria dendroides isolated from Red sea coastal waters of Jeddah, Saudi Arabia, were evaluated for their potential for bioactivity. Extracts of the algae selected for the study were prepared using ethanol, chloroform, petroleum ether and water, and assayed for antibacterial activity against Escherichia coli ATCC 25322, Pseudomonas aeruginosa ATCC 27853, Stapylococcus aureus ATCC 29213, and Enterococcus faecalis ATCC 29212. It was found that chloroform was most effective followed by ethanol, petroleum ether and water for the preparation of algal extract with significant antibacterial activities, respectively. Results also indicated that the extracts of red alga G. dendroides were more efficient against the tested bacterial strains followed by green alga U. reticulata, and brown algae D. ciliolata. Chemical analyses showed that G. dendroides recorded the highest percentages of the total fats and total proteins, followed by U. reticulata, and D. ciliolate. Among the bioflavonoids determined Rutin, Quercetin and Kaempherol were present in high percentages in G. dendroides, U. reticulata, and D. ciliolate. Estimation of saturated and unsaturated fatty acids revealed that palmitic acid was present in highest percentage in all the algal species analyzed. Amino acid analyses indicated the presence of free amino acids in moderate contents in all the species of algae. The results indicated scope for utilizing these algae as a source of antibacterial substances.

  16. Antibacterial substances from marine algae isolated from Jeddah coast of Red sea, Saudi Arabia

    PubMed Central

    Al-Saif, Sarah Saleh Abdu-llah; Abdel-Raouf, Nevein; El-Wazanani, Hend A.; Aref, Ibrahim A.


    Marine algae are known to produce a wide variety of bioactive secondary metabolites and several compounds have been derived from them for prospective development of novel drugs by the pharmaceutical industries. However algae of the Red sea have not been adequately explored for their potential as a source of bioactive substances. In this context Ulva reticulata, Caulerpa occidentalis, Cladophora socialis, Dictyota ciliolata, and Gracilaria dendroides isolated from Red sea coastal waters of Jeddah, Saudi Arabia, were evaluated for their potential for bioactivity. Extracts of the algae selected for the study were prepared using ethanol, chloroform, petroleum ether and water, and assayed for antibacterial activity against Escherichia coli ATCC 25322, Pseudomonas aeruginosa ATCC 27853, Stapylococcus aureus ATCC 29213, and Enterococcus faecalis ATCC 29212. It was found that chloroform was most effective followed by ethanol, petroleum ether and water for the preparation of algal extract with significant antibacterial activities, respectively. Results also indicated that the extracts of red alga G. dendroides were more efficient against the tested bacterial strains followed by green alga U. reticulata, and brown algae D. ciliolata. Chemical analyses showed that G. dendroides recorded the highest percentages of the total fats and total proteins, followed by U. reticulata, and D. ciliolate. Among the bioflavonoids determined Rutin, Quercetin and Kaempherol were present in high percentages in G. dendroides, U. reticulata, and D. ciliolate. Estimation of saturated and unsaturated fatty acids revealed that palmitic acid was present in highest percentage in all the algal species analyzed. Amino acid analyses indicated the presence of free amino acids in moderate contents in all the species of algae. The results indicated scope for utilizing these algae as a source of antibacterial substances. PMID:24596500

  17. Algae.


    Raven, John A; Giordano, Mario


    Algae frequently get a bad press. Pond slime is a problem in garden pools, algal blooms can produce toxins that incapacitate or kill animals and humans and even the term seaweed is pejorative - a weed being a plant growing in what humans consider to be the wrong place. Positive aspects of algae are generally less newsworthy - they are the basis of marine food webs, supporting fisheries and charismatic marine megafauna from albatrosses to whales, as well as consuming carbon dioxide and producing oxygen. Here we consider what algae are, their diversity in terms of evolutionary origin, size, shape and life cycles, and their role in the natural environment and in human affairs. PMID:25004359

  18. Intracellular invasion of green algae in a salamander host

    PubMed Central

    Kerney, Ryan; Kim, Eunsoo; Hangarter, Roger P.; Heiss, Aaron A.; Bishop, Cory D.; Hall, Brian K.


    The association between embryos of the spotted salamander (Ambystoma maculatum) and green algae (“Oophila amblystomatis” Lamber ex Printz) has been considered an ectosymbiotic mutualism. We show here, however, that this symbiosis is more intimate than previously reported. A combination of imaging and algal 18S rDNA amplification reveals algal invasion of embryonic salamander tissues and cells during development. Algal cells are detectable from embryonic and larval Stages 26–44 through chlorophyll autofluorescence and algal 18S rDNA amplification. Algal cell ultrastructure indicates both degradation and putative encystment during the process of tissue and cellular invasion. Fewer algal cells were detected in later-stage larvae through FISH, suggesting that the decline in autofluorescent cells is primarily due to algal cell death within the host. However, early embryonic egg capsules also contained encysted algal cells on the inner capsule wall, and algal 18S rDNA was amplified from adult reproductive tracts, consistent with oviductal transmission of algae from one salamander generation to the next. The invasion of algae into salamander host tissues and cells represents a unique association between a vertebrate and a eukaryotic alga, with implications for research into cell–cell recognition, possible exchange of metabolites or DNA, and potential congruence between host and symbiont population structures. PMID:21464324

  19. The effects of graphene oxide on green algae Raphidocelis subcapitata.


    Nogueira, P F M; Nakabayashi, D; Zucolotto, V


    Graphene represents a new class of nanomaterials that has attracted great interest due to its unique electrical, thermal, and mechanical properties. Once disposed in the environment, graphene can interact with biological systems and is expected to exhibit toxicological effects. The ecotoxicity of graphene and its derivatives, viz.: graphene oxide (GO) depends on their physicochemical properties, including purity, diameter, length, surface charge, functionalization and aggregation state. In this study we evaluated the effects of graphene oxide (GO) on green algae Raphidocelis subcapitata. The algae were exposed to different concentrations of GO pre-equilibrated for 24h with oligotrophic freshwater medium (20ml) during incubation in a growth chamber under controlled conditions: 120μEm(-2)s(-1) illumination; 12:12h light dark cycle and constant temperature of 22±2°C. Algal growth was monitored daily for 96h by direct cell counting. Reactive oxygen species level (ROS), membrane damage (cell viability) and autofluorescence (chl-a fluorescence) were evaluated using fluorescent staining and further analyzed by flow cytometry. The toxic effects from GO, as observed in algal density and autofluorescence, started at concentrations from 20 and 10μgmL(-1), respectively. Such toxicity is probably the result of ROS generation and membrane damage (cell viability). The shading effect caused by GO agglomeration in culture medium may also contribute to reduce algal density. The results reported here provide knowledge regarding the GO toxicity on green algae, contributing to a better understanding of its environmental behavior and impacts. PMID:26204245

  20. The effects of graphene oxide on green algae Raphidocelis subcapitata.


    Nogueira, P F M; Nakabayashi, D; Zucolotto, V


    Graphene represents a new class of nanomaterials that has attracted great interest due to its unique electrical, thermal, and mechanical properties. Once disposed in the environment, graphene can interact with biological systems and is expected to exhibit toxicological effects. The ecotoxicity of graphene and its derivatives, viz.: graphene oxide (GO) depends on their physicochemical properties, including purity, diameter, length, surface charge, functionalization and aggregation state. In this study we evaluated the effects of graphene oxide (GO) on green algae Raphidocelis subcapitata. The algae were exposed to different concentrations of GO pre-equilibrated for 24h with oligotrophic freshwater medium (20ml) during incubation in a growth chamber under controlled conditions: 120μEm(-2)s(-1) illumination; 12:12h light dark cycle and constant temperature of 22±2°C. Algal growth was monitored daily for 96h by direct cell counting. Reactive oxygen species level (ROS), membrane damage (cell viability) and autofluorescence (chl-a fluorescence) were evaluated using fluorescent staining and further analyzed by flow cytometry. The toxic effects from GO, as observed in algal density and autofluorescence, started at concentrations from 20 and 10μgmL(-1), respectively. Such toxicity is probably the result of ROS generation and membrane damage (cell viability). The shading effect caused by GO agglomeration in culture medium may also contribute to reduce algal density. The results reported here provide knowledge regarding the GO toxicity on green algae, contributing to a better understanding of its environmental behavior and impacts.

  1. Towards tradable permits for filamentous green algae pollution.


    de Lange, W J; Botha, A M; Oberholster, P J


    Water pollution permit systems are challenging to design and implement. Operational systems that has maintained functionality remains few and far between, particularly in developing countries. We present current progress towards developing such a system for nutrient enrichment based water pollution, mainly from commercial agriculture. We applied a production function approach to first estimate the monetary value of the impact of the pollution, which is then used as reference point for establishing a reserve price for pollution permits. The subsequent market making process is explained according to five steps including permit design, terms, conditions and transactional protocol, the monitoring system, piloting and implementation. The monetary value of the impact of pollution was estimated at R1887 per hectare per year, which not only provide a "management budget" for filamentous green algae mitigation strategies in the study area, but also enabled the calculation of a reserve price for filamentous green algae pollution permits, which was estimated between R2.25 and R111 per gram filamentous algae and R8.99 per gram at the preferred state.

  2. Biosorption of lead and nickel by biomass of marine algae

    SciTech Connect

    Holan, Z.R.; Volesky, B. . Dept. of Chemical Engineering)


    Screening tests of different marine algae biomass types revealed a high passive biosorptive uptake of lead up to 270 mg Pb/g of biomass in some brown marine algae. Members of the order Fucales performed particularly well in this descending sequence: Fucus > Ascophyllum > Sargassum. Although decreasing the swelling of wetted biomass particles, their reinforcement by crosslinking may significantly affect the biosorption performance. Lead uptakes up to 370 mg Pb/g were observed in crosslinked Fucus vesiculosus and Ascophyllum nodosum. At low equilibrium residual concentrations of lead in solution, however, ion exchange resin Amberlite IR-120 had a higher lead uptake than the biosorbent materials. An order-of-magnitude lower uptake of nickel was observed in all of the sorbent materials examined.

  3. Biosorption of lead and nickel by biomass of marine algae.


    Holan, Z R; Volesky, B


    Screening tests of different marine algae biomas types revealed a high passive biosorptive uptake of lead up to 270 mg Pb/g of biomass in some brown marine algae. Members of the order Fucales perfomed particularly well in this descending sequence: Fucus > Ascophyllum > Sargassum. Although decreasing the swelling of wetted biomass particles, their reinforcement by crosslinking may significantly affect the biosorption performance. Lead uptakes up to 370 mg Pb/g were observed in crosslinked Fucus vesiculosus and Ascophyllum nodosum. At low equilibrium residual concentrations of lead in solution, however, ion exchange resin Amberlite IR-120 had a higher lead uptake than the biosorbent materials. An order-of-magnitude lower uptake of nickel was observed in all of the sorbent materials examined. (c) 1994 John Wiley & Sons, Inc. PMID:18615510

  4. Genetic transformation of the model green alga Chlamydomonas reinhardtii.


    Neupert, Juliane; Shao, Ning; Lu, Yinghong; Bock, Ralph


    Over the past three decades, the single-celled green alga Chlamydomonas reinhardtii has become an invaluable model organism in plant biology and an attractive production host in biotechnology. The genetic transformation of Chlamydomonas is relatively simple and efficient, but achieving high expression levels of foreign genes has remained challenging. Here, we provide working protocols for algal cultivation and transformation as well as for selection and analysis of transgenic algal clones. We focus on two commonly used transformation methods for Chlamydomonas: glass bead-assisted transformation and particle gun-mediated (biolistic) transformation. In addition, we describe available tools for promoting efficient transgene expression and highlight important considerations for designing transformation vectors.

  5. Interaction of organic solvents with the green alga Chlorella pyrenoidosa

    SciTech Connect

    Stratton, G.W.; Smith, T.M. )


    Solvents are often a component of bioassay systems when water-insoluble toxicants are being tested. These solvents must also be considered as xenobiotics and therefore, as potential toxicants in the bioassay. However, the effects of solvents on the organisms being tested and their possible interaction with the test compound are often overlooked by researchers. The purpose of the present study was to compare the inhibitory effects of six solvents commonly used in pesticide bioassays towards growth of the common green alga Chlorella pyrenoidosa, and to examine the occurrence of solvent-pesticide interactions with this organism.

  6. Sulfated phenolic acids from Dasycladales siphonous green algae.


    Kurth, Caroline; Welling, Matthew; Pohnert, Georg


    Sulfated aromatic acids play a central role as mediators of chemical interactions and physiological processes in marine algae and seagrass. Among others, Dasycladus vermicularis (Scopoli) Krasser 1898 uses a sulfated hydroxylated coumarin derivative as storage metabolite for a protein cross linker that can be activated upon mechanical disruption of the alga. We introduce a comprehensive monitoring technique for sulfated metabolites based on fragmentation patterns in liquid chromatography/mass spectrometry and applied it to Dasycladales. This allowed the identification of two new aromatic sulfate esters 4-(sulfooxy)phenylacetic acid and 4-(sulfooxy)benzoic acid. The two metabolites were synthesized to prove the mass spectrometry-based structure elucidation in co-injections. We show that both metabolites are transformed to the corresponding desulfated phenols by sulfatases of bacteria. In biofouling experiments with Escherichia coli and Vibrio natriegens the desulfated forms were more active than the sulfated ones. Sulfatation might thus represent a measure of detoxification that enables the algae to store inactive forms of metabolites that are activated by settling organisms and then act as defense. PMID:26188914

  7. Toxicity testing with the marine algae, Symbiodinium kawagutii (Dinophyceae)

    SciTech Connect

    Gorrie, J.R.; Bidwell, J.R.; Rippingale, R.J.


    The dinoflagellate, Symbiodinium kawagutii, is among the algal taxa which exist in symbiosis with a range of marine invertebrates. S. kawagutii is commonly found in association with the Hawaiian stony coral, Montipora verrucosa. The algae has been successfully cultured in the laboratory using a common marine algal growth media (Guillard f/2), and sufficient cell densities were achieved in a 96-hr bioassay to allow statistical evaluation of toxicity data. A 96-hr EC{sub 50} of 6.47 mg/L (95% C.I.: 3.54--9.88 mg/L) was calculated after exposure to potassium dichromate. Wide distribution of the coral host and ecological importance of the symbiosis make S. kawagutii an excellent candidate species for hazard evaluation in tropical marine ecosystems. Continuing research will seek to further refine the bioassay, including the use of a microplate technique for more rapid testing.

  8. Gain and loss of elongation factor genes in green algae

    PubMed Central

    Cocquyt, Ellen; Verbruggen, Heroen; Leliaert, Frederik; Zechman, Frederick W; Sabbe, Koen; De Clerck, Olivier


    Background Two key genes of the translational apparatus, elongation factor-1 alpha (EF-1α) and elongation factor-like (EFL) have an almost mutually exclusive distribution in eukaryotes. In the green plant lineage, the Chlorophyta encode EFL except Acetabularia where EF-1α is found, and the Streptophyta possess EF-1α except Mesostigma, which has EFL. These results raise questions about evolutionary patterns of gain and loss of EF-1α and EFL. A previous study launched the hypothesis that EF-1α was the primitive state and that EFL was gained once in the ancestor of the green plants, followed by differential loss of EF-1α or EFL in the principal clades of the Viridiplantae. In order to gain more insight in the distribution of EF-1α and EFL in green plants and test this hypothesis we screened the presence of the genes in a large sample of green algae and analyzed their gain-loss dynamics in a maximum likelihood framework using continuous-time Markov models. Results Within the Chlorophyta, EF-1α is shown to be present in three ulvophycean orders (i.e., Dasycladales, Bryopsidales, Siphonocladales) and the genus Ignatius. Models describing gene gain-loss dynamics revealed that the presence of EF-1α, EFL or both genes along the backbone of the green plant phylogeny is highly uncertain due to sensitivity to branch lengths and lack of prior knowledge about ancestral states or rates of gene gain and loss. Model refinements based on insights gained from the EF-1α phylogeny reduce uncertainty but still imply several equally likely possibilities: a primitive EF-1α state with multiple independent EFL gains or coexistence of both genes in the ancestor of the Viridiplantae or Chlorophyta followed by differential loss of one or the other gene in the various lineages. Conclusion EF-1α is much more common among green algae than previously thought. The mutually exclusive distribution of EF-1α and EFL is confirmed in a large sample of green plants. Hypotheses about the gain

  9. Solar-driven hydrogen production in green algae.


    Burgess, Steven J; Tamburic, Bojan; Zemichael, Fessehaye; Hellgardt, Klaus; Nixon, Peter J


    The twin problems of energy security and global warming make hydrogen an attractive alternative to traditional fossil fuels with its combustion resulting only in the release of water vapor. Biological hydrogen production represents a renewable source of the gas and can be performed by a diverse range of microorganisms from strict anaerobic bacteria to eukaryotic green algae. Compared to conventional methods for generating H(2), biological systems can operate at ambient temperatures and pressures without the need for rare metals and could potentially be coupled to a variety of biotechnological processes ranging from desalination and waste water treatment to pharmaceutical production. Photobiological hydrogen production by microalgae is particularly attractive as the main inputs for the process (water and solar energy) are plentiful. This chapter focuses on recent developments in solar-driven H(2) production in green algae with emphasis on the model organism Chlamydomonas reinhardtii. We review the current methods used to achieve sustained H(2) evolution and discuss possible approaches to improve H(2) yields, including the optimization of culturing conditions, reducing light-harvesting antennae and targeting auxiliary electron transport and fermentative pathways that compete with the hydrogenase for reductant. Finally, industrial scale-up is discussed in the context of photobioreactor design and the future prospects of the field are considered within the broader context of a biorefinery concept.

  10. Photosynthetic hydrogen and oxygen production by green algae

    SciTech Connect

    Greenbaum, E.; Lee, J.W.


    An overview of photosynthetic hydrogen and oxygen production by green algae in the context of its potential as a renewable chemical feed stock and energy carrier is presented. Beginning with its discovery by Gaffron and Rubin in 1942, motivated by curiosity-driven laboratory research, studies were initiated in the early 1970s that focused on photosynthetic hydrogen production from an applied perspective. From a scientific and technical point of view, current research is focused on optimizing net thermodynamic conversion efficiencies represented by the Gibbs Free Energy of molecular hydrogen. The key research questions of maximizing hydrogen and oxygen production by light-activated water splitting in green algae are (1) removing the oxygen sensitivity of algal hydrogenases; (2) linearizing the light saturation curves of photosynthesis throughout the entire range of terrestrial solar irradiance--including the role of bicarbonate and carbon dioxide in optimization of photosynthetic electron transport and (3) the minimum number of light reactions that are required to split water to elemental hydrogen and oxygen. Each of these research topics is being actively addressed by the photobiological hydrogen research community.

  11. Photosynthetic Hydrogen and Oxygen Production by Green Algae

    SciTech Connect

    Greenbaum, E.; Lee, J.W.


    Photosynthesis research at Oak Ridge National Laboratory is focused on hydrogen and oxygen production by green algae in the context of its potential as a renewable fuel and chemical feed stock. Beginning with its discovery by Gaffron and Rubin in 1942, motivated by curiosity-driven laboratory research, studies were initiated in the early 1970s that focused on photosynthetic hydrogen production from an applied perspective. From a scientific and technical point of view, current research is focused on optimizing net thermodynamic conversion efficiencies represented by the Gibbs Free Energy of molecular hydrogen. The key research questions of maximizing hydrogen and oxygen production by light-activated water splitting in green algae are: (1) removing the oxygen sensitivity of algal hydrogenases; (2) linearizing the light saturation curves of hotosynthesis throughout the entire range of terrestrial solar irradiance-including the role of bicarbonate and carbon dioxide in optimization of photosynthetic electron transpor;t and (3) constructing real-world bioreactors, including the generation of hydrogen and oxygen against workable back pressures of the photoproduced gases.

  12. Solar-driven hydrogen production in green algae.


    Burgess, Steven J; Tamburic, Bojan; Zemichael, Fessehaye; Hellgardt, Klaus; Nixon, Peter J


    The twin problems of energy security and global warming make hydrogen an attractive alternative to traditional fossil fuels with its combustion resulting only in the release of water vapor. Biological hydrogen production represents a renewable source of the gas and can be performed by a diverse range of microorganisms from strict anaerobic bacteria to eukaryotic green algae. Compared to conventional methods for generating H(2), biological systems can operate at ambient temperatures and pressures without the need for rare metals and could potentially be coupled to a variety of biotechnological processes ranging from desalination and waste water treatment to pharmaceutical production. Photobiological hydrogen production by microalgae is particularly attractive as the main inputs for the process (water and solar energy) are plentiful. This chapter focuses on recent developments in solar-driven H(2) production in green algae with emphasis on the model organism Chlamydomonas reinhardtii. We review the current methods used to achieve sustained H(2) evolution and discuss possible approaches to improve H(2) yields, including the optimization of culturing conditions, reducing light-harvesting antennae and targeting auxiliary electron transport and fermentative pathways that compete with the hydrogenase for reductant. Finally, industrial scale-up is discussed in the context of photobioreactor design and the future prospects of the field are considered within the broader context of a biorefinery concept. PMID:21807246

  13. Analytical approaches to photobiological hydrogen production in unicellular green algae.


    Hemschemeier, Anja; Melis, Anastasios; Happe, Thomas


    Several species of unicellular green algae, such as the model green microalga Chlamydomonas reinhardtii, can operate under either aerobic photosynthesis or anaerobic metabolism conditions. A particularly interesting metabolic condition is that of "anaerobic oxygenic photosynthesis", whereby photosynthetically generated oxygen is consumed by the cell's own respiration, causing anaerobiosis in the culture in the light, and induction of the cellular "hydrogen metabolism" process. The latter entails an alternative photosynthetic electron transport pathway, through the oxygen-sensitive FeFe-hydrogenase, leading to the light-dependent generation of molecular hydrogen in the chloroplast. The FeFe-hydrogenase is coupled to the reducing site of photosystem-I via ferredoxin and is employed as an electron-pressure valve, through which electrons are dissipated, thus permitting a sustained electron transport in the thylakoid membrane of photosynthesis. This hydrogen gas generating process in the cells offers testimony to the unique photosynthetic metabolism that can be found in many species of green microalgae. Moreover, it has attracted interest by the biotechnology and bioenergy sectors, as it promises utilization of green microalgae and the process of photosynthesis in renewable energy production. This article provides an overview of the principles of photobiological hydrogen production in microalgae and addresses in detail the process of induction and analysis of the hydrogen metabolism in the cells. Furthermore, methods are discussed by which the interaction of photosynthesis, respiration, cellular metabolism, and H(2) production in Chlamydomonas can be monitored and regulated. PMID:19291418

  14. Microwave-Assisted Extraction of Fucoidan from Marine Algae.


    Mussatto, Solange I


    Microwave-assisted extraction (MAE) is a technique that can be applied to extract compounds from different natural resources. In this chapter, the use of this technique to extract fucoidan from marine algae is described. The method involves a closed MAE system, ultrapure water as extraction solvent, and suitable conditions of time, pressure, and algal biomass/water ratio. By using this procedure under the specified conditions, the penetration of the electromagnetic waves into the material structure occurs in an efficient manner, generating a distributed heat source that promotes the fucoidan extraction from the algal biomass. PMID:26108504

  15. The auxin concentration in sixteen Chinese marine algae

    NASA Astrophysics Data System (ADS)

    Han, Lijun


    The author determined the occurrence of indole-3-acetic acid in sixteen Chinese marine algae collected from the east coast of China with fluorescence spectrophotometry (FS) and wheat coleoptile bioanalysis methods (WCB). The concentration of indole-3-acetic acid (IAA) presented was from 1.1 46.9 ng/g Fw (fresh weight) with FS and 5.3 110.2 ng/g Fw with WCB. The results by the two methods were in the orders of 10-3 103 ng/g Fw reported previously from multiple references.

  16. Uptake and distribution of technetium in several marine algae

    SciTech Connect

    Bonotto, S.; Gerber, G.B.; Garten, C.T. Jr.; Vandecasteele, C.M.; Myttenaere, C.; Van Baelen, J.; Cogneau, M.; van der Ben, D.


    The uptake or chemical form of technetium in different marine algae (Acetabularia, Cystoseira, Fucus) has been examined and a simple model to explain the uptake of technetium in the unicellular alga, Acetabularia, has been conceptualized. At low concentrations in the external medium, Acetabularia can rapidly concentrate technetium. Concentration factors in excess of 400 can be attained after a time of about 3 weeks. At higher mass concentrations in the medium, uptake of technetium by Acetabularia becomes saturated resulting in a decreased concentration factor (approximately 10 after 4 weeks). Approximately 69% of the total radioactivity present in /sup 95m/Tc labelled Acetabularia is found in the cell cytosol. In Fucus vesiculosus, labelled with /sup 95m/Tc, a high percentage of technetium is present in soluble ionic forms while approximately 40% is bound, in this brown alga, in proteins and polysaccharides associated with cell walls. In the algal cytosol of Fucus vesiculosus, about 45% of the /sup 95m/Tc appears to be present as anionic TcO/sup -//sub 4/ and the remainder is bound to small molecules. 8 references, 5 figures, 1 table.

  17. Molecular characterization of epiphytic bacterial communities on charophycean green algae


    Fisher; Wilcox; Graham


    Epiphytic bacterial communities within the sheath material of three filamentous green algae, Desmidium grevillii, Hyalotheca dissiliens, and Spondylosium pulchrum (class Charophyceae, order Zygnematales), collected from a Sphagnum bog were characterized by PCR amplification, cloning, and sequencing of 16S ribosomal DNA. A total of 20 partial sequences and nine different sequence types were obtained, and one sequence type was recovered from the bacterial communities on all three algae. By phylogenetic analysis, the cloned sequences were placed into several major lineages of the Bacteria domain: the Flexibacter/Cytophaga/Bacteroides phylum and the alpha, beta, and gamma subdivisions of the phylum Proteobacteria. Analysis at the subphylum level revealed that the majority of our sequences were not closely affiliated with those of known, cultured taxa, although the estimated evolutionary distances between our sequences and their nearest neighbors were always less than 0.1 (i.e., greater than 90% similar). This result suggests that the majority of sequences obtained in this study represent as yet phenotypically undescribed bacterial species and that the range of bacterial-algal interactions that occur in nature has not yet been fully described.

  18. Amidic and acetonic cryoprotectants improve cryopreservation of volvocine green algae.


    Nakazawa, A; Nishii, I


    A number of volvocalean green algae species were subjected to a two-step cryopreservation protocol with various cryoprotectants. Potential cryoprotectants were methanol (DMSO), N,N-dimethylformamide (DMF), N,N-dimethylacetamide, N-methylformamide, and hydroxyacetone (HA). We confirmed prior reports that MeOH was effective for cryopreserving Chlamydomonas, but did not work well for larger volvocaleans such as Volvox. In contrast, DMF and HA were effective for both unicellular and multicellular representatives. When we used a cold-inducible transposon to probe Southern blots of Volvox DNA samples taken before and after storage for one month in LN, we could detect no differences, indicating that the genome had remained relatively stable and that the transposon had not been induced by the cryopreservation procedure. We believe these methods will facilitate long-term storage of several volvocine algal species, including Volvox strains harboring transposon-induced mutations of developmental interest. PMID:22825787

  19. Enhanced genetic tools for engineering multigene traits into green algae.


    Rasala, Beth A; Chao, Syh-Shiuan; Pier, Matthew; Barrera, Daniel J; Mayfield, Stephen P


    Transgenic microalgae have the potential to impact many diverse biotechnological industries including energy, human and animal nutrition, pharmaceuticals, health and beauty, and specialty chemicals. However, major obstacles to sophisticated genetic and metabolic engineering in algae have been the lack of well-characterized transformation vectors to direct engineered gene products to specific subcellular locations, and the inability to robustly express multiple nuclear-encoded transgenes within a single cell. Here we validate a set of genetic tools that enable protein targeting to distinct subcellular locations, and present two complementary methods for multigene engineering in the eukaryotic green microalga Chlamydomonas reinhardtii. The tools described here will enable advanced metabolic and genetic engineering to promote microalgae biotechnology and product commercialization. PMID:24710110

  20. Contribution of arsenic species in unicellular algae to the cycling of arsenic in marine ecosystems.


    Duncan, Elliott G; Maher, William A; Foster, Simon D


    This review investigates the arsenic species produced by and found in marine unicellular algae to determine if unicellular algae contribute to the formation of arsenobetaine (AB) in higher marine organisms. A wide variety of arsenic species have been found in marine unicellular algae including inorganic species (mainly arsenate--As(V)), methylated species (mainly dimethylarsenate (DMA)), arsenoribosides (glycerol, phosphate, and sulfate) and metabolites (dimethylarsenoethanol (DMAE)). Subtle differences in arsenic species distributions exist between chlorophyte and heterokontophyte species with As(V) commonly found in water-soluble cell fractions of chlorophyte species, while DMA is more common in heterokontophyte species. Additionally, different arsenoriboside species are found in each phyla with glycerol and phosphate arsenoribosides produced by chlorophytes, whereas glycerol, phosphate, and sulfate arsenoribosides are produced by heterokontophytes, which is similar to existing data for marine macro-algae. Although arsenoribosides are the major arsenic species in many marine unicellular algal species, AB has not been detected in unicellular algae which supports the hypothesis that AB is formed in marine animals via the ingestion and further metabolism of arsenoribosides. The observation of significant DMAE concentrations in some unicellular algal cultures suggests that unicellular algae-based detritus contains arsenic species that can be further metabolized to form AB in higher marine organisms. Future research establishing how environmental variability influences the production of arsenic species by marine unicellular algae and what effect this has on arsenic cycling within marine food webs is essential to clarify the role of these organisms in marine arsenic cycling. PMID:25443092

  1. Contribution of arsenic species in unicellular algae to the cycling of arsenic in marine ecosystems.


    Duncan, Elliott G; Maher, William A; Foster, Simon D


    This review investigates the arsenic species produced by and found in marine unicellular algae to determine if unicellular algae contribute to the formation of arsenobetaine (AB) in higher marine organisms. A wide variety of arsenic species have been found in marine unicellular algae including inorganic species (mainly arsenate--As(V)), methylated species (mainly dimethylarsenate (DMA)), arsenoribosides (glycerol, phosphate, and sulfate) and metabolites (dimethylarsenoethanol (DMAE)). Subtle differences in arsenic species distributions exist between chlorophyte and heterokontophyte species with As(V) commonly found in water-soluble cell fractions of chlorophyte species, while DMA is more common in heterokontophyte species. Additionally, different arsenoriboside species are found in each phyla with glycerol and phosphate arsenoribosides produced by chlorophytes, whereas glycerol, phosphate, and sulfate arsenoribosides are produced by heterokontophytes, which is similar to existing data for marine macro-algae. Although arsenoribosides are the major arsenic species in many marine unicellular algal species, AB has not been detected in unicellular algae which supports the hypothesis that AB is formed in marine animals via the ingestion and further metabolism of arsenoribosides. The observation of significant DMAE concentrations in some unicellular algal cultures suggests that unicellular algae-based detritus contains arsenic species that can be further metabolized to form AB in higher marine organisms. Future research establishing how environmental variability influences the production of arsenic species by marine unicellular algae and what effect this has on arsenic cycling within marine food webs is essential to clarify the role of these organisms in marine arsenic cycling.

  2. Evidence for methane production by the marine algae Emiliania huxleyi

    NASA Astrophysics Data System (ADS)

    Lenhart, Katharina; Klintzsch, Thomas; Langer, Gerald; Nehrke, Gernot; Bunge, Michael; Schnell, Sylvia; Keppler, Frank


    Methane (CH4), an important greenhouse gas that affects radiation balance and consequently the earth's climate, still has uncertainties in its sinks and sources. The world's oceans are considered to be a source of CH4 to the atmosphere, although the biogeochemical processes involved in its formation are not fully understood. Several recent studies provided strong evidence of CH4 production in oxic marine and freshwaters, but its source is still a topic of debate. Studies of CH4 dynamics in surface waters of oceans and large lakes have concluded that pelagic CH4 supersaturation cannot be sustained either by lateral inputs from littoral or benthic inputs alone. However, regional and temporal oversaturation of surface waters occurs frequently. This comprises the observation of a CH4 oversaturating state within the surface mixed layer, sometimes also termed the "oceanic methane paradox". In this study we considered marine algae as a possible direct source of CH4. Therefore, the coccolithophore Emiliania huxleyi was grown under controlled laboratory conditions and supplemented with two 13C-labeled carbon substrates, namely bicarbonate and a position-specific 13C-labeled methionine (R-S-13CH3). The CH4 production was 0.7 µg particular organic carbon (POC) g-1 d-1, or 30 ng g-1 POC h-1. After supplementation of the cultures with the 13C-labeled substrate, the isotope label was observed in headspace CH4. Moreover, the absence of methanogenic archaea within the algal culture and the oxic conditions during CH4 formation suggest that the widespread marine algae Emiliania huxleyi might contribute to the observed spatially and temporally restricted CH4 oversaturation in ocean surface waters.

  3. Culture observation and molecular phylogenetic analysis on the blooming green alga Chaetomorpha valida (Cladophorales, Chlorophyta) from China

    NASA Astrophysics Data System (ADS)

    Deng, Yunyan; Tang, Xiaorong; Zhan, Zifeng; Teng, Linhong; Ding, Lanping; Huang, Bingxin


    The marine green alga Chaetomorpha valida fouls aquaculture ponds along the coastal cities of Dalian and Rongcheng, China. Unialgal cultures were observed under a microscope to determine the developmental morphological characters of C. valida. Results reveal that gametophytic filaments often produce lateral branches under laboratory culture conditions, suggesting an atypical heteromorphic life cycle of C. valida between unbranched sporophytes and branched gametophytes, which differs from typical isomorphic alternation of Chaetomorpha species. The shape of the basal attachment cell, an important taxonomic character within the genus, was found variable depending on environmental conditions. The 18S rDNA and 28S rDNA regions were used to explore the phylogenetic affinity of the taxa. Inferred trees from 18S rDNA sequences revealed a close relationship between C. valida and Chaetomorpha moniligera. These results would enrich information in general biology and morphological plasticity of C. valida and provided a basis for future identification of green tide forming algae.

  4. Ocean acidification alters the calcareous microstructure of the green macro-alga Halimeda opuntia

    NASA Astrophysics Data System (ADS)

    Wizemann, André; Meyer, Friedrich W.; Hofmann, Laurie C.; Wild, Christian; Westphal, Hildegard


    Decreases in seawater pH and carbonate saturation state ( Ω) following the continuous increase in atmospheric CO2 represent a process termed ocean acidification, which is predicted to become a main threat to marine calcifiers in the near future. Segmented, tropical, marine green macro-algae of the genus Halimeda form a calcareous skeleton that involves biotically initiated and induced calcification processes influenced by cell physiology. As Halimeda is an important habitat provider and major carbonate sediment producer in tropical shallow areas, alterations of these processes due to ocean acidification may cause changes in the skeletal microstructure that have major consequences for the alga and its environment, but related knowledge is scarce. This study used scanning electron microscopy to examine changes of the CaCO3 segment microstructure of Halimeda opuntia specimens that had been exposed to artificially elevated seawater pCO2 of ~650 µatm for 45 d. In spite of elevated seawater pCO2, the calcification of needles, located at the former utricle walls, was not reduced as frequent initiation of new needle-shaped crystals was observed. Abundance of the needles was ~22 % µm-2 higher and needle crystal dimensions ~14 % longer. However, those needles were ~42 % thinner compared with the control treatment. Moreover, lifetime cementation of the segments decreased under elevated seawater pCO2 due to a loss in micro-anhedral carbonate as indicated by significantly thinner calcified rims of central utricles (35-173 % compared with the control treatment). Decreased micro-anhedral carbonate suggests that seawater within the inter-utricular space becomes CaCO3 undersaturated ( Ω < 1) during nighttime under conditions of elevated seawater pCO2, thereby favoring CaCO3 dissolution over micro-anhedral carbonate accretion. Less-cemented segments of H. opuntia may impair the environmental success of the alga, its carbonate sediment contribution, and the temporal storage of

  5. Marine Algae: a Source of Biomass for Biotechnological Applications.


    Stengel, Dagmar B; Connan, Solène


    Biomass derived from marine microalgae and macroalgae is globally recognized as a source of valuable chemical constituents with applications in the agri-horticultural sector (including animal feeds and health and plant stimulants), as human food and food ingredients as well as in the nutraceutical, cosmeceutical, and pharmaceutical industries. Algal biomass supply of sufficient quality and quantity however remains a concern with increasing environmental pressures conflicting with the growing demand. Recent attempts in supplying consistent, safe and environmentally acceptable biomass through cultivation of (macro- and micro-) algal biomass have concentrated on characterizing natural variability in bioactives, and optimizing cultivated materials through strain selection and hybridization, as well as breeding and, more recently, genetic improvements of biomass. Biotechnological tools including metabolomics, transcriptomics, and genomics have recently been extended to algae but, in comparison to microbial or plant biomass, still remain underdeveloped. Current progress in algal biotechnology is driven by an increased demand for new sources of biomass due to several global challenges, new discoveries and technologies available as well as an increased global awareness of the many applications of algae. Algal diversity and complexity provides significant potential provided that shortages in suitable and safe biomass can be met, and consumer demands are matched by commercial investment in product development.

  6. Green Algae and the Origins of Multicellularity in the Plant Kingdom

    PubMed Central

    Umen, James G.


    The green lineage of chlorophyte algae and streptophytes form a large and diverse clade with multiple independent transitions to produce multicellular and/or macroscopically complex organization. In this review, I focus on two of the best-studied multicellular groups of green algae: charophytes and volvocines. Charophyte algae are the closest relatives of land plants and encompass the transition from unicellularity to simple multicellularity. Many of the innovations present in land plants have their roots in the cell and developmental biology of charophyte algae. Volvocine algae evolved an independent route to multicellularity that is captured by a graded series of increasing cell-type specialization and developmental complexity. The study of volvocine algae has provided unprecedented insights into the innovations required to achieve multicellularity. PMID:25324214

  7. Green algae and the origins of multicellularity in the plant kingdom.


    Umen, James G


    The green lineage of chlorophyte algae and streptophytes form a large and diverse clade with multiple independent transitions to produce multicellular and/or macroscopically complex organization. In this review, I focus on two of the best-studied multicellular groups of green algae: charophytes and volvocines. Charophyte algae are the closest relatives of land plants and encompass the transition from unicellularity to simple multicellularity. Many of the innovations present in land plants have their roots in the cell and developmental biology of charophyte algae. Volvocine algae evolved an independent route to multicellularity that is captured by a graded series of increasing cell-type specialization and developmental complexity. The study of volvocine algae has provided unprecedented insights into the innovations required to achieve multicellularity.

  8. Aluminum bioavailability to the green alga Chlorella pyrenoidosa in acidified synthetic soft water

    SciTech Connect

    Parent, L.; Campbell, P.G.C. )


    A unicellular green alga, Chlorella pyrenoidosa, was exposed to inorganic Al under controlled experimental conditions to determine whether the biological response elicited by the dissolved metal could be predicted from the free-metal ion concentration, [Al[sup 3+

  9. Homogentisate phytyltransferase from the unicellular green alga Chlamydomonas reinhardtii.


    Gálvez-Valdivieso, Gregorio; Cardeñosa, Rosa; Pineda, Manuel; Aguilar, Miguel


    Homogentisate phytyltransferase (HPT) (EC 2.5.1.-) catalyzes the first committed step of tocopherol biosynthesis in all photosynthetic organisms. This paper presents the molecular characterization and expression analysis of HPT1 gene, and a study on the accumulation of tocopherols under different environmental conditions in the unicellular green alga Chlamydomonas reinhardtii. The Chlamydomonas HPT1 protein conserves all the prenylphosphate- and divalent cation-binding sites that are found in polyprenyltransferases and all the amino acids that are essential for its catalytic activity. Its hydrophobicity profile confirms that HPT is a membrane-bound protein. Chlamydomonas genomic DNA analysis suggests that HPT is encoded by a single gene, HPT1, whose promoter region contains multiple motifs related to regulation by jasmonate, abscisic acid, low temperature and light, and an ATCTA motif presents in genes involved in tocopherol biosynthesis and some photosynthesis-related genes. Expression analysis revealed that HPT1 is strongly regulated by dark and low-temperature. Under the same treatments, α-tocopherol increased in cultures exposed to darkness or heat, whereas γ-tocopherol did it in low temperature. The regulatory expression pattern of HPT1 and the changes of tocopherol abundance support the idea that different tocopherols play specific functions, and suggest a role for γ-tocopherol in the adaptation to growth under low-temperature.

  10. Combined toxicity of pesticide mixtures on green algae and photobacteria.


    Liu, Shu-Shen; Wang, Cheng-Lin; Zhang, Jin; Zhu, Xiang-Wei; Li, Wei-Ying


    Different organisms have diverse responses to the same chemicals or mixtures. In this paper, we selected the green algae Chlorella pyrenoidosa (C. pyrenoidosa) and photobacteria Vibrio qinghaiensis sp.-Q67 (V. qinghaiensis) as target organisms and determined the toxicities of six pesticides, including three herbicides (simetryn, bromacil and hexazinone), two fungicides (dodine and metalaxyl) and one insecticide (propoxur), and their mixtures by using the microplate toxicity analysis. The toxicities of three herbicides to C. pyrenoidosa are much higher than those to V. qinghaiensis, and the toxicities of metalaxyl and propoxur to V. qinghaiensis are higher than those to C. pyrenoidosa, while the toxicity of dodine to C. pyrenoidosa is similar to those to V. qinghaiensis. Using the concentration addition as an additive reference model, the binary pesticide mixtures exhibited different toxicity interactions, i.e., displayed antagonism to C. pyrenoidosa but synergism to V. qinghaiensis. However, the toxicities of the multi-component mixtures of more than two components are additive and can be predicted by the concentration addition model.

  11. Toxicity Assessment of Expired Pesticides to Green Algae Pseudokirchneriella subcapitata

    PubMed Central

    Satyavani, G.; Chandrasehar, G.; Varma, K. Krishna; Goparaju, A.; Ayyappan, S.; Reddy, P. Neelakanta; Murthy, P. Balakrishna


    In order to investigate the effect of expired pesticides on the yield and growth rate of green algae Pseudokirchneriella subcapitata, a study was conducted as per the Organisation for Economic Cooperation and Development (OECD) guideline number 201. Fifteen expired pesticide formulations, most commonly used in Indian agriculture, were tested in comparison with their unexpired counterparts. The expired pesticide formulations studied belonged to various class and functional groups: organophosphate, pyrethroid-based insecticides; azole-based fungicides; acetamide, propionate, acetic acid-based herbicides; fungicides mixtures containing two actives—azole and dithiocarbamate. The toxicity endpoints of yield (EyC50: 0–72 h) and growth rate (ErC50: 0–72 h) of Pseudokirchneriella subcapitata for each pesticide formulation (both expired and unexpired pesticides) were determined statistically using TOXSTAT 3.5 version software. The results pointed out that some expired pesticide formulations exhibited higher toxicity to tested algal species, as compared to the corresponding unexpired pesticides. These data thus stress the need for greater care to dispose expired pesticides to water bodies, to avoid the effects on aquatic ecospecies tested. PMID:23762633

  12. Production of carbonate sediments by a unicellular green alga

    USGS Publications Warehouse

    Yates, K.K.; Robbins, L.L.


    This study investigates the ability of the unicellular green alga Natmochloris atoimis to precipitate CaCO3, quantifies mineral precipitation rates, estimates sediment production in a N. atomiis bloom, and discusses the implications of microbial calcification for carbonate sediment deposition. A series of N. atomus cultures, isolated from Lake Reeve, Australia, were incubated at various pH and calcium concentrations to determine environmental parameters for calcification. Rates of calcification were calculated from initial and postincubation alkalinity, pH, and calcium measurements. Replicate experiments and controls consisting of non-calcifying cultures, uninoculated media, and dead cell cultures were performed using environmental culture parameters determined in series cultures. Average calcification rates from replicate experiments were used to predict daily sediment production rates in a small bloom of N. atomus. N. atomus precipitates 0.138 g/L of calcite in approximately 4 h when incubated at pH 8.5, 14.24 mM calcium concentration, 33 ??C, 100 ??E/m2/s light intensity, and a cell population density of 107 cells/mL. Assuming continuous precipitation, this corresponds to a maximum estimated sediment production rate of 1.6 ?? 106 kg of CaCO3, per 12 h day in a single bloom of 3.2 ?? 109 L. Our results suggest that microbial calcification contributes significantly to the carbonate sediment budget.

  13. Phylogenetic and molecular analysis of hydrogen-producing green algae

    PubMed Central

    Timmins, Matthew; Thomas-Hall, Skye R.; Darling, Aaron; Zhang, Eugene; Hankamer, Ben; Marx, Ute C.; Schenk, Peer M.


    A select set of microalgae are reported to be able to catalyse photobiological H2 production from water. Based on the model organism Chlamydomonas reinhardtii, a method was developed for the screening of naturally occurring H2-producing microalgae. By purging algal cultures with N2 in the dark and subsequent illumination, it is possible to rapidly induce photobiological H2 evolution. Using NMR spectroscopy for metabolic profiling in C. reinhardtii, acetate, formate, and ethanol were found to be key compounds contributing to metabolic variance during the assay. This procedure can be used to test algal species existing as axenic or mixed cultures for their ability to produce H2. Using this system, five algal isolates capable of H2 production were identified in various aquatic systems. A phylogenetic tree was constructed using ribosomal sequence data of green unicellular algae to determine if there were taxonomic patterns of H2 production. H2-producing algal species were seen to be dispersed amongst most clades, indicating an H2-producing capacity preceded evolution of the phylum Chlorophyta. PMID:19342428

  14. Natural Abundance 14C Content of Dibutyl Phthalate (DBP) from Three Marine Algae

    PubMed Central

    Namikoshi, Michio; Fujiwara, Takeshi; Nishikawa, Teruaki; Ukai, Kazuyo


    Analysis of the natural abundance 14C content of dibutyl phthalate (DBP) from two edible brown algae, Undaria pinnatifida and Laminaria japonica, and a green alga, Ulva sp., revealed that the DBP was naturally produced. The natural abundance 14C content of di-(2-ethylhexyl) phthalate (DEHP) obtained from the same algae was about 50–80% of the standard sample and the 14C content of the petrochemical (industrial) products of DBP and DEHP were below the detection limit.

  15. How the green alga Chlamydomonas reinhardtii keeps time.


    Schulze, Thomas; Prager, Katja; Dathe, Hannes; Kelm, Juliane; Kiessling, Peter; Mittag, Maria


    The unicellular green alga Chlamydomonas reinhardtii has two flagella and a primitive visual system, the eyespot apparatus, which allows the cell to phototax. About 40 years ago, it was shown that the circadian clock controls its phototactic movement. Since then, several circadian rhythms such as chemotaxis, cell division, UV sensitivity, adherence to glass, or starch metabolism have been characterized. The availability of its entire genome sequence along with homology studies and the analysis of several sub-proteomes render C. reinhardtii as an excellent eukaryotic model organism to study its circadian clock at different levels of organization. Previous studies point to several potential photoreceptors that may be involved in forwarding light information to entrain its clock. However, experimental data are still missing toward this end. In the past years, several components have been functionally characterized that are likely to be part of the oscillatory machinery of C. reinhardtii since alterations in their expression levels or insertional mutagenesis of the genes resulted in defects in phase, period, or amplitude of at least two independent measured rhythms. These include several RHYTHM OF CHLOROPLAST (ROC) proteins, a CONSTANS protein (CrCO) that is involved in parallel in photoperiodic control, as well as the two subunits of the circadian RNA-binding protein CHLAMY1. The latter is also tightly connected to circadian output processes. Several candidates including a significant number of ROCs, CrCO, and CASEIN KINASE1 whose alterations of expression affect the circadian clock have in parallel severe effects on the release of daughter cells, flagellar formation, and/or movement, indicating that these processes are interconnected in C. reinhardtii. The challenging task for the future will be to get insights into the clock network and to find out how the clock-related factors are functionally connected. In this respect, system biology approaches will certainly

  16. Hidden genetic diversity in the green alga Spirogyra (Zygnematophyceae, Streptophyta)

    PubMed Central


    Background The unbranched filamentous green alga Spirogyra (Streptophyta, Zygnemataceae) is easily recognizable based on its vegetative morphology, which shows one to several spiral chloroplasts. This simple structure falsely points to a low genetic diversity: Spirogyra is commonly excluded from phylogenetic analyses because the genus is known as a long-branch taxon caused by a high evolutionary rate. Results We focused on this genetic diversity and sequenced 130 Spirogyra small subunit nuclear ribosomal DNA (SSU rDNA) strands of different origin. The resulting SSU rDNA sequences were used for phylogenetic analyses using complex evolutionary models (posterior probability, maximum likelihood, neighbor joining, and maximum parsimony methods). The sequences were between 1672 and 1779 nucleotides long. Sequence comparisons revealed 53 individual clones, but our results still support monophyly of the genus. Our data set did not contain a single slow-evolving taxon that would have been placed on a shorter branch compared to the remaining sequences. Out of 130 accessions analyzed, 72 showed a secondary loss of the 1506 group I intron, which formed a long-branched group within the genus. The phylogenetic relationship to the genus Spirotaenia was not resolved satisfactorily. The genetic distance within the genus Spirogyra exceeded the distances measured within any other genus of the remaining Zygnemataceae included in this study. Conclusion Overall, we define eight distinct clades of Spirogyra, one of them including the genus Sirogonium. A large number of non-homoplasious synapomorphies (NHS; 114 NHS in total) was found for Spirogyra (41 NHS) and for each clade (totaling 73 NHS). This emphasizes the high genetic diversity of this genus and the distance to the remaining Zygnematophyceae. PMID:22655677

  17. Biosorption of cadmium by biomass of marine algae

    SciTech Connect

    Holan, Z.R.; Volesky, B.; Prasetyo, I. )


    Biomass of nonliving, dried brown marine algae Sargassum natans, Fucus vesiculosus, and Ascophyllum nodosum demonstrated high equilibrium uptake of cadmium from aqueous solutions. The metal uptake by these materials was quantitatively evaluated using sorption isotherms. Biomass of A. nodosum accumulated the highest amount of cadmium exceeding 100 mg Cd[sup 2+]/g (at the residual concentration of 100 mg Cd/L and pH 3.5), outperforming a commercial ion exchange resin DUOLITE GT-73. A new biosorbent material based on A. nodosum biomass was obtained by reinforcing the algal biomass by formaldehyde cross-linking. The prepared sorbent possessed good mechanical properties, chemical stability of the cell wall polysaccharides and low swelling volume. Desorption of deposited cadmium with 0.1-0.5 M HCl resulted in no changes of the biosorbent metal uptake capacity through five subsequent adsorption/desorption cycles. There was no damage to the biosorbent which retained its macroscopic appearance and performance in repeated metal uptake/elution cycles.

  18. H+ -pumping rhodopsin from the marine alga Acetabularia.


    Tsunoda, Satoshi P; Ewers, David; Gazzarrini, Sabrina; Moroni, Anna; Gradmann, Dietrich; Hegemann, Peter


    An opsin-encoding cDNA was cloned from the marine alga Acetabularia acetabulum. The cDNA was expressed in Xenopus oocytes into functional Acetabularia rhodopsin (AR) mediating H+ carried outward photocurrents of up to 1.2 microA with an action spectrum maximum at 518 nm (AR518). AR is the first ion-pumping rhodopsin found in a plant organism. Steady-state photocurrents of AR are always positive and rise sigmoidally from negative to positive transmembrane voltages. Numerous kinetic details (amplitudes and time constants), including voltage-dependent recovery of the dark state after light-off, are documented with respect to their sensitivities to light, internal and external pH, and the transmembrane voltage. The results are analyzed by enzyme kinetic formalisms using a simplified version of the known photocycle of bacteriorhodopsin (BR). Blue-light causes a shunt of the photocycle under H+ reuptake from the extracellular side. Similarities and differences of AR with BR are pointed out. This detailed electrophysiological characterization highlights voltage dependencies in catalytic membrane processes of this eukaryotic, H+ -pumping rhodopsin and of microbial-type rhodopsins in general.

  19. Fucoidan from Marine Brown Algae Inhibits Lipid Accumulation

    PubMed Central

    Park, Min-Kyoung; Jung, Uhee; Roh, Changhyun


    In this study, we elucidated the inhibitory effect of fucoidan from marine brown algae on the lipid accumulation in differentiated 3T3-L1 adipocytes and its mechanism. The treatment of fucoidan in a dose-dependent manner was examined on lipid inhibition in 3T3-L1 cells by using Oil Red O staining. Fucoidan showed high lipid inhibition activity at 200 μg/mL concentration (P < 0.001). Lipolytic activity in adipocytes is highly dependent on hormone sensitive lipase (HSL), which is one of the most important targets of lipolytic regulation. Here, we examined the biological response of fucoidan on the protein level of lipolysis pathway. The expressed protein levels of total hormone sensitive lipase (HSL) and its activated form, phosphorylated-HSL were significantly increased at concentration of 200 μg/mL fucoidan. Furthermore, insulin-induced 2-deoxy-d-[3H] glucose uptake was decreased up to 51% in fucoidan-treated cells as compared to control. Since increase of HSL and p-HSL expression and decrease of glucose uptake into adipocytes are known to lead to stimulation of lipolysis, our results suggest that fucoidan reduces lipid accumulation by stimulating lipolysis. Therefore, these results suggest that fucoidan can be useful for the prevention or treatment of obesity due to its stimulatory lipolysis. PMID:21892350

  20. Development of Singlet Oxygen Luminescence Kinetics during the Photodynamic Inactivation of Green Algae.


    Bornhütter, Tobias; Pohl, Judith; Fischer, Christian; Saltsman, Irena; Mahammed, Atif; Gross, Zeev; Röder, Beate


    Recent studies show the feasibility of photodynamic inactivation of green algae as a vital step towards an effective photodynamic suppression of biofilms by using functionalized surfaces. The investigation of the intrinsic mechanisms of photodynamic inactivation in green algae represents the next step in order to determine optimization parameters. The observation of singlet oxygen luminescence kinetics proved to be a very effective approach towards understanding mechanisms on a cellular level. In this study, the first two-dimensional measurement of singlet oxygen kinetics in phototrophic microorganisms on surfaces during photodynamic inactivation is presented. We established a system of reproducible algae samples on surfaces, incubated with two different cationic, antimicrobial potent photosensitizers. Fluorescence microscopy images indicate that one photosensitizer localizes inside the green algae while the other accumulates along the outer algae cell wall. A newly developed setup allows for the measurement of singlet oxygen luminescence on the green algae sample surfaces over several days. The kinetics of the singlet oxygen luminescence of both photosensitizers show different developments and a distinct change over time, corresponding with the differences in their localization as well as their photosensitization potential. While the complexity of the signal reveals a challenge for the future, this study incontrovertibly marks a crucial, inevitable step in the investigation of photodynamic inactivation of biofilms: it shows the feasibility of using the singlet oxygen luminescence kinetics to investigate photodynamic effects on surfaces and thus opens a field for numerous investigations.

  1. Isoprenoid biosynthesis authenticates the classification of the green alga Mesostigma viride as an ancient streptophyte.


    Grauvogel, Carina; Petersen, Jörn


    Land plants harbor two essential and completely different metabolic pathways for isoprenoid synthesis. The cytosolic mevalonate pathway (MVA) is shared with heterotrophic eukaryotes, whereas the plastidial 2-C-methyl-d-erythritol 4-phosphate (MEP) pathway has a cyanobacterial origin and was recruited after primary endosymbiosis. Terrestrial plants and green algae have a common evolutionary ancestry, but biochemical as well as genome analyses indicate that the cytosolic MVA pathway is generally absent from Chlorophyta. We investigated the distribution of genes for both pathways in the green alga Mesostigma viride, a key species at the basis of streptophycean (charophycean green algae, land plant) evolution. Ten of altogether twelve generally weakly expressed genes for isoprenoid biosynthesis, including three for the cytosolic MVA pathway, were amplified using a reverse transcription PCR approach with individually designed degenerate primers. Two full length cDNA clones for the first enzyme of the MVA pathway (HMGS) were additionally established from the charophycean green alga Chara vulgaris by library screening. The presence of the MVA pathway in these advanced green algae indicates a universal distribution among Streptophyta, and our phylogenetic HMGS analyses substantiate the recent classification of Mesostigma basal to charophytes and land plants. We identified each of the five cytosolic MVA genes/cDNAs in the genome of the rhodophyte Galdieria sulphuraria and, furthermore, amplified four of them from the glaucophyte Cyanophora paradoxa. Our data indicate that the MVA pathway is a characteristic trait of Plantae in general and propose that it was specifically lost in a common ancestor of Chlorophyta.

  2. Tracing floating green algae blooms in the Yellow Sea and the East China Sea using Lagrangian transport simulations

    NASA Astrophysics Data System (ADS)

    Park, Young-Gyu; Son, Young Baek; Choi, Byoung-Ju; Kim, Yong Hoon


    Lagrangian particle tracking experiments were conducted to understand the pathway of the floating green algae patches observed in the Yellow Sea (YS) and East China Sea (ECS) in summer 2011. The numerical simulation results indicated that dominant southerly winds during June and July 2011 were related to offshore movement of the floating green algae, especially their eastward extension in the YS/ECS. An infrequent and unusual event occurred in June 2011: a severe Tropical Strom MEARI, caused the green algae to detach from the coast and initiated movement to the east. After the typhoon event, sea surface temperature recovered rapidly enough to grow the floating green algae, and wind and local current controlled the movement of the massive floating algae patches (coastal accumulation or offshore advection in the area). Analysis of the floating green algae movement using satellite images during passage of Typhoon MAON in July 2011 revealed that the floating green algae patches were significantly controlled by both ocean currents and enhanced winds. These findings suggest that the floating green algae bloom off Qingdao, China and in the middle of the YS and ECS in the summer of 2011 occurred due to the combined effects of recent rapid expansion of seaweed aquaculture, strong winds, and the wind patterns in blooming regions. Our combined approach, using satellite data and numerical simulations, provides a robust estimate for tracing and monitoring changes in green algae blooms on a regional scale.

  3. Surface-bound iron: a metal ion buffer in the marine brown alga Ectocarpus siliculosus?

    PubMed Central

    Carrano, Carl J.


    Although the iron uptake and storage mechanisms of terrestrial/higher plants have been well studied, the corresponding systems in marine algae have received far less attention. Studies have shown that while some species of unicellular algae utilize unique mechanisms of iron uptake, many acquire iron through the same general mechanisms as higher plants. In contrast, the iron acquisition strategies of the multicellular macroalgae remain largely unknown. This is especially surprising since many of these organisms represent important ecological and evolutionary niches in the coastal marine environment. It has been well established in both laboratory and environmentally derived samples, that a large amount of iron can be ‘non-specifically’ adsorbed to the surface of marine algae. While this phenomenon is widely recognized and has prompted the development of experimental protocols to eliminate its contribution to iron uptake studies, its potential biological significance as a concentrated iron source for marine algae is only now being recognized. This study used an interdisciplinary array of techniques to explore the nature of the extensive and powerful iron binding on the surface of both laboratory and environmental samples of the marine brown alga Ectocarpus siliculosus and shows that some of this surface-bound iron is eventually internalized. It is proposed that the surface-binding properties of E. siliculosus allow it to function as a quasibiological metal ion ‘buffer’, allowing iron uptake under the widely varying external iron concentrations found in coastal marine environments. PMID:24368501

  4. Extraction and Analysis of Mycosporine-Like Amino Acids in Marine Algae.


    Rosic, Nedeljka N; Braun, Christoph; Kvaskoff, David


    Marine organisms use mycosporine-like amino acids (MAAs) as biological sunscreens for the protection from damaging ultraviolet (UV) radiation and the prevention of oxidative stress. MAAs have been discovered in many different marine and freshwater species including cyanobacteria, fungi, and algae, but also in animals like cnidarian and fishes. Here, we describe a general method for the isolation and characterization of MAA compounds from red algae and symbiotic dinoflagellates isolated from coral hosts. This method is also suitable for the extraction and analyses of MAAs from a range of other algal and marine biota. PMID:26108501

  5. Photosynthetic recovery following desiccation of desert green algae (Chlorophyta) and their aquatic relatives.


    Gray, Dennis W; Lewis, Louise A; Cardon, Zoe G


    Recent molecular data suggest that desert green algae have evolved from freshwater ancestors at least 14 times in three major classes (Chlorophyceae, Trebouxiophyceae and Charophyceae), offering a unique opportunity to study the adaptation of photosynthetic organisms to life on land in a comparative phylogenetic framework. We examined the photorecovery of phylogenetically matched desert and aquatic algae after desiccation in darkness and under illumination. Desert algae survived desiccation for at least 4 weeks when dried in darkness, and recovered high levels of photosynthetic quantum yield within 1 h of rehydration in darkness. However, when 4 weeks of desiccation was accompanied by illumination, three of six desert taxa lost their ability to recover quantum yield during rehydration in the dark. Aquatic algae, in contrast, recovered very little during dark rehydration following even just 24 h of desiccation. Re-illuminating rehydrated algae produced a nearly complete recovery of quantum yield in all desert and two of five aquatic taxa. These contrasts provide physiological evidence that desert green algae possess mechanisms for photosynthetic recovery after desiccation distinct from those in aquatic relatives, corroborating molecular evidence that they are not happenstance, short-term visitors from aquatic environments. Photosensitivity during desiccation among desert algae further suggests that they may reside in protected microsites within crusts, and species specificity of photosensitivity suggests that disturbances physically disrupting crusts could lead to shifts or losses of taxonomic diversity within these habitats.

  6. Acclimation of green algae to sulfur deficiency: underlying mechanisms and application for hydrogen production.


    Antal, Taras K; Krendeleva, Tatyana E; Rubin, Andrew B


    Hydrogen is definitely one of the most acceptable fuels in the future. Some photosynthetic microorganisms, such as green algae and cyanobacteria, can produce hydrogen gas from water by using solar energy. In green algae, hydrogen evolution is coupled to the photosynthetic electron transport in thylakoid membranes via reaction catalyzed by the specific enzyme, (FeFe)-hydrogenase. However, this enzyme is highly sensitive to oxygen and can be quickly inhibited when water splitting is active. A problem of incompatibility between the water splitting and hydrogenase reaction can be overcome by depletion of algal cells of sulfur which is essential element for life. In this review the mechanisms underlying sustained hydrogen photoproduction in sulfur deprived C. reinhardtii and the recent achievements in studying of this process are discussed. The attention is focused on the biophysical and physiological aspects of photosynthetic response to sulfur deficiency in green algae. PMID:20878321

  7. Isolation and cultivation of endosymbiotic algae from green hydra and phylogenetic analysis of 18S rDNA sequences.


    Kovacević, Goran; Franjević, Damjan; Jelencić, Biserka; Kalafatić, Mirjana


    Symbiotic associations are of wide significance in evolution and biodiversity. The green hydra is a typical example of endosymbiosis. In its gastrodermal myoepithelial cells it harbors the individuals of a unicellular green algae. Endosymbiotic algae from green hydra have been successfully isolated and permanently maintained in a stable clean lab culture for the first time. We reconstructed the phylogeny of isolated endosymbiotic algae using the 18S rRNA gene to clarify its current status and to validate the traditional inclusion of these endosymbiotic algae within the Chlorella genus. Molecular analyses established that different genera and species of unicellular green algae could be present as symbionts in green hydra, depending on the natural habitat of a particular strain of green hydra.

  8. High iron content and bioavailability in humans from four species of marine algae.


    García-Casal, Maria N; Pereira, Ana C; Leets, Irene; Ramírez, José; Quiroga, Maria F


    Searching for economical, nonconventional sources of iron is important in underdeveloped countries to combat iron deficiency and anemia. Our objective was to study iron, vitamin C, and phytic acid composition and also iron bioavailability from 4 species of marine algae included in a rice-based meal. Marine algae (Ulva sp, Sargassum sp, Porphyra sp, and Gracilariopsis sp) were analyzed for monthly variations in iron and for ascorbic acid and phytic acid concentrations. A total of 96 subjects received rice-based meals containing the 4 species of marine algae in different proportions, raw or cooked. All meals contained radioactive iron. Absorption was evaluated by calculating the radioactive iron incorporation in subjects' blood. Iron concentrations in algae were high and varied widely, depending on the species and time of year. The highest iron concentrations were found in Sargassum (157 mg/100 g) and Gracilariopsis (196 mg/100 g). Phytates were not detected in the algae and ascorbic acid concentration fluctuated between 38 microg/g dry weight (Ulva) and 362 microg/g dry weight (Sargassum). Algae significantly increased iron absorption in rice-based meals. Cooking did not affect iron absorption compared with raw algae. Results indicate that Ulva sp, Sargassum sp, Porphyra sp, and Gracilariopsis sp are good sources of ascorbic acid and bioavailable iron. The percentage of iron absorption was similar among all algae tested, although Sargassum sp resulted in the highest iron intake. Based on these results, and on the high reproduction rates of algae during certain seasons, promoting algae consumption in some countries could help to improve iron nutrition.

  9. Green algae in alpine biological soil crust communities: acclimation strategies against ultraviolet radiation and dehydration.


    Karsten, Ulf; Holzinger, Andreas


    Green algae are major components of biological soil crusts in alpine habitats. Together with cyanobacteria, fungi and lichens, green algae form a pioneer community important for the organisms that will succeed them. In their high altitudinal habitat these algae are exposed to harsh and strongly fluctuating environmental conditions, mainly intense irradiation, including ultraviolet radiation, and lack of water leading to desiccation. Therefore, green algae surviving in these environments must have evolved with either avoidance or protective strategies, as well as repair mechanisms for damage. In this review we have highlighted these mechanisms, which include photoprotection, photochemical quenching, and high osmotic values to avoid water loss, and in some groups flexibility of secondary cell walls to maintain turgor pressure even in water-limited situations. These highly specialized green algae will serve as good model organisms to study desiccation tolerance or photoprotective mechanisms, due to their natural capacity to withstand unfavorable conditions. We point out the urgent need for modern phylogenetic approaches in characterizing these organisms, and molecular methods for analyzing the metabolic changes involved in their adaptive strategies.

  10. Uptake and Retention of Cs137 by a Blue-Green Alga in Continuous Flow and Batch Culture Systems

    SciTech Connect

    Watts, J.R.


    Since routine monitoring data show that blue-green algae concentrate radioactivity from water by factors as great as 10,000, this study was initiated to investigate the uptake and retention patterns of specific radionuclides by the dominant genera of blue-green algae in the reactor effluents. Plectonema purpureum was selected for this study.

  11. The rapid quantitation of the filamentous blue-green alga plectonema boryanum by the luciferase assay for ATP

    NASA Technical Reports Server (NTRS)

    Bush, V. N.


    Plectonema boryanum is a filamentous blue green alga. Blue green algae have a procaryotic cellular organization similar to bacteria, but are usually obligate photoautotrophs, obtaining their carbon and energy from photosynthetic mechanism similar to higher plants. This research deals with a comparison of three methods of quantitating filamentous populations: microscopic cell counts, the luciferase assay for ATP and optical density measurements.

  12. Modeling the Role of Zebra Mussels in the Proliferation of Blue-green Algae in Saginaw Bay, Lake Huron

    EPA Science Inventory

    Under model assumptions from Saginaw Bay 1991, selective rejection of blue-green algae by zebra mussels appears to be a necessary factor in the enhancement of blue-green algae production in the presence of zebra mussels. Enhancement also appears to depend on the increased sedime...

  13. Preliminary observations on the benthic marine algae of the Gorringe seabank (northeast Atlantic Ocean)

    NASA Astrophysics Data System (ADS)

    Tittley, Ian; da Silva Vaz Álvaro, Nuno Miguel; de Melo Azevedo Neto, Ana Isabel


    Examination of marine samples collected in 2006 from the Gettysburg and Ormonde seamounts on the Gorringe seabank southwest of Portugal has revealed 29 benthic Chlorophyta, Phaeophyceae (Ochrophyta), and Rhodophyta that were identified provisionally to genus and to species. Combining lists for the present and a previous expedition brings the total of algae thus far recorded to 48. The brown alga Zonaria tournefourtii and the red alga Cryptopleura ramosa were the most abundant species in the present collections. The kelp Laminaria ochroleuca was present only in the Gettysburg samples while Saccorhiza polyschides was observed only on the Ormonde seamount. Comparisons with the benthic marine algae recorded on seamounts in the mid-Atlantic Azores archipelago show features in common, notably kelp forests of L. ochroleuca at depths below 30 m and Z. tournefortii dominance in shallower waters.

  14. Comparison of ESTs from juvenile and adult phases of the giant unicellular green alga Acetabularia acetabulum

    PubMed Central

    Henry, Isabelle M; Wilkinson, Mark D; Hernandez, J Marcela; Schwarz-Sommer, Zsuzsanna; Grotewold, Erich; Mandoli, Dina F


    Background Acetabularia acetabulum is a giant unicellular green alga whose size and complex life cycle make it an attractive model for understanding morphogenesis and subcellular compartmentalization. The life cycle of this marine unicell is composed of several developmental phases. Juvenile and adult phases are temporally sequential but physiologically and morphologically distinct. To identify genes specific to juvenile and adult phases, we created two subtracted cDNA libraries, one adult-specific and one juvenile-specific, and analyzed 941 randomly chosen ESTs from them. Results Clustering analysis suggests virtually no overlap between the two libraries. Preliminary expression data also suggests that we were successful at isolating transcripts differentially expressed between the two developmental phases and that many transcripts are specific to one phase or the other. Comparison of our EST sequences against publicly available sequence databases indicates that ESTs from the adult and the juvenile libraries partition into different functional classes. Three conserved sequence elements were common to several of the ESTs and were also found within the genomic sequence of the carbonic anhydrase1 gene from A. acetabulum. To date, these conserved elements are specific to A. acetabulum. Conclusions Our data provide strong evidence that adult and juvenile phases in A. acetabulum vary significantly in gene expression. We discuss their possible roles in cell growth and morphogenesis as well as in phase change. We also discuss the potential role of the conserved elements found within the EST sequences in post-transcriptional regulation, particularly mRNA localization and/or stability. PMID:15070428

  15. Resurrection kinetics of photosynthesis in desiccation-tolerant terrestrial green algae (Chlorophyta) on tree bark.


    Lüttge, U; Büdel, B


    The rough bark of orchard trees (Malus) around Darmstadt is predominantly covered in red to purple-brown layers (biofilms) of epiphytic terrestrial alga of Trentepohlia umbrina. The smooth bark of forest trees (Fagus sylvatica L. and Acer sp.) in the same area is covered by bright green biofilms composed of the green algae Desmococcus, Apatococcus and Trebouxia, with a few cells of Coccomyxa and 'Chlorella' trebouxioides between them. These algae are desiccation tolerant. After samples of bark with the biofilms were kept in dry air in darkness for various periods of time, potential quantum yield of PSII, F(v)/F(m), recovered during rehydration upon rewetting. The kinetics and degree of recovery depended on the length of time that the algae were kept in dry air in the desiccated state. Recovery was better for green biofilm samples, i.e. quite good even after 80 days of desiccation (F(v)/F(m) = ca. 50% of initial value), than the red samples, where recovery was only adequate up to ca. 30-40 days of desiccation (F(v)/F(m) = ca. 20-55% of initial value). It is concluded that the different bark types constitute different ecophysiological niches that can be occupied by the algae and that can be distinguished by their capacity to recover from desiccation after different times in the dry state.

  16. Evaluation of marine sediments as microbial sources for methane production from brown algae under high salinity.


    Miura, Toyokazu; Kita, Akihisa; Okamura, Yoshiko; Aki, Tsunehiro; Matsumura, Yukihiko; Tajima, Takahisa; Kato, Junichi; Nakashimada, Yutaka


    Various marine sediments were evaluated as promising microbial sources for methane fermentation of Saccharina japonica, a brown alga, at seawater salinity. All marine sediments tested produced mainly acetate among volatile fatty acids. One marine sediment completely converted the produced volatile fatty acids to methane in a short period. Archaeal community analysis revealed that acetoclastic methanogens belonging to the Methanosarcina genus dominated after cultivation. Measurement of the specific conversion rate at each step of methane production under saline conditions demonstrated that the marine sediments had higher conversion rates of butyrate and acetate than mesophilic methanogenic granules. These results clearly show that marine sediments can be used as microbial sources for methane production from algae under high-salt conditions without dilution.

  17. Genome-wide analysis of tandem repeats in plants and green algae.


    Zhao, Zhixin; Guo, Cheng; Sutharzan, Sreeskandarajan; Li, Pei; Echt, Craig S; Zhang, Jie; Liang, Chun


    Tandem repeats (TRs) extensively exist in the genomes of prokaryotes and eukaryotes. Based on the sequenced genomes and gene annotations of 31 plant and algal species in Phytozome version 8.0 (, we examined TRs in a genome-wide scale, characterized their distributions and motif features, and explored their putative biological functions. Among the 31 species, no significant correlation was detected between the TR density and genome size. Interestingly, green alga Chlamydomonas reinhardtii (42,059 bp/Mbp) and castor bean Ricinus communis (55,454 bp/Mbp) showed much higher TR densities than all other species (13,209 bp/Mbp on average). In the 29 land plants, including 22 dicots, 5 monocots, and 2 bryophytes, 5'-UTR and upstream intergenic 200-nt (UI200) regions had the first and second highest TR densities, whereas in the two green algae (C. reinhardtii and Volvox carteri) the first and second highest densities were found in intron and coding sequence (CDS) regions, respectively. In CDS regions, trinucleotide and hexanucleotide motifs were those most frequently represented in all species. In intron regions, especially in the two green algae, significantly more TRs were detected near the intron-exon junctions. Within intergenic regions in dicots and monocots, more TRs were found near both the 5' and 3' ends of genes. GO annotation in two green algae revealed that the genes with TRs in introns are significantly involved in transcriptional and translational processing. As the first systematic examination of TRs in plant and green algal genomes, our study showed that TRs displayed nonrandom distribution for both intragenic and intergenic regions, suggesting that they have potential roles in transcriptional or translational regulation in plants and green algae. PMID:24192840

  18. Desiccation stress and tolerance in green algae: consequences for ultrastructure, physiological and molecular mechanisms

    PubMed Central

    Holzinger, Andreas; Karsten, Ulf


    Although most green algae typically occur in aquatic ecosystems, many species also live partly or permanently under aeroterrestrial conditions, where the cells are exposed to the atmosphere and hence regularly experience dehydration. The ability of algal cells to survive in an air-dried state is termed desiccation tolerance. The mechanisms involved in desiccation tolerance of green algae are still poorly understood, and hence the aim of this review is to summarize recent findings on the effects of desiccation and osmotic water loss. Starting from structural changes, physiological, and biochemical consequences of desiccation will be addressed in different green-algal lineages. The available data clearly indicate a range of strategies, which are rather different in streptophycean and non-streptophycean green algae. While members of the Trebouxiophyceae exhibit effective water loss-prevention mechanisms based on the biosynthesis and accumulation of particular organic osmolytes such as polyols, these compounds are so far not reported in representatives of the Streptophyta. In members of the Streptophyta such as Klebsormidium, the most striking observation is the appearance of cross-walls in desiccated samples, which are strongly undulating, suggesting a high degree of mechanical flexibility. This aids in maintaining structural integrity in the dried state and allows the cell to maintain turgor pressure for a prolonged period of time during the dehydration process. Physiological strategies in aeroterrestrial green algae generally include a rapid reduction of photosynthesis during desiccation, but also a rather quick recovery after rewetting, whereas aquatic species are sensitive to drying. The underlying mechanisms such as the affected molecular components of the photosynthetic machinery are poorly understood in green algae. Therefore, modern approaches based on transcriptomics, proteomics, and/or metabolomics are urgently needed to better understand the molecular

  19. Desiccation stress and tolerance in green algae: consequences for ultrastructure, physiological and molecular mechanisms.


    Holzinger, Andreas; Karsten, Ulf


    Although most green algae typically occur in aquatic ecosystems, many species also live partly or permanently under aeroterrestrial conditions, where the cells are exposed to the atmosphere and hence regularly experience dehydration. The ability of algal cells to survive in an air-dried state is termed desiccation tolerance. The mechanisms involved in desiccation tolerance of green algae are still poorly understood, and hence the aim of this review is to summarize recent findings on the effects of desiccation and osmotic water loss. Starting from structural changes, physiological, and biochemical consequences of desiccation will be addressed in different green-algal lineages. The available data clearly indicate a range of strategies, which are rather different in streptophycean and non-streptophycean green algae. While members of the Trebouxiophyceae exhibit effective water loss-prevention mechanisms based on the biosynthesis and accumulation of particular organic osmolytes such as polyols, these compounds are so far not reported in representatives of the Streptophyta. In members of the Streptophyta such as Klebsormidium, the most striking observation is the appearance of cross-walls in desiccated samples, which are strongly undulating, suggesting a high degree of mechanical flexibility. This aids in maintaining structural integrity in the dried state and allows the cell to maintain turgor pressure for a prolonged period of time during the dehydration process. Physiological strategies in aeroterrestrial green algae generally include a rapid reduction of photosynthesis during desiccation, but also a rather quick recovery after rewetting, whereas aquatic species are sensitive to drying. The underlying mechanisms such as the affected molecular components of the photosynthetic machinery are poorly understood in green algae. Therefore, modern approaches based on transcriptomics, proteomics, and/or metabolomics are urgently needed to better understand the molecular

  20. Comparative Genomics of a Bacterivorous Green Alga Reveals Evolutionary Causalities and Consequences of Phago-Mixotrophic Mode of Nutrition.


    Burns, John A; Paasch, Amber; Narechania, Apurva; Kim, Eunsoo


    Cymbomonas tetramitiformis-a marine prasinophyte-is one of only a few green algae that still retain an ancestral particulate-feeding mechanism while harvesting energy through photosynthesis. The genome of the alga is estimated to be 850 Mb-1.2 Gb in size-the bulk of which is filled with repetitive sequences-and is annotated with 37,366 protein-coding gene models. A number of unusual metabolic pathways (for the Chloroplastida) are predicted for C. tetramitiformis, including pathways for Lipid-A and peptidoglycan metabolism. Comparative analyses of the predicted peptides of C. tetramitiformis to sets of other eukaryotes revealed that nonphagocytes are depleted in a number of genes, a proportion of which have known function in feeding. In addition, our analysis suggests that obligatory phagotrophy is associated with the loss of genes that function in biosynthesis of small molecules (e.g., amino acids). Further, C. tetramitiformis and at least one other phago-mixotrophic alga are thus unique, compared with obligatory heterotrophs and nonphagocytes, in that both feeding and small molecule synthesis-related genes are retained in their genomes. These results suggest that early, ancestral host eukaryotes that gave rise to phototrophs had the capacity to assimilate building block molecules from inorganic substances (i.e., prototrophy). The loss of biosynthesis genes, thus, may at least partially explain the apparent lack of instances of permanent incorporation of photosynthetic endosymbionts in later-divergent, auxotrophic eukaryotic lineages, such as metazoans and ciliates. PMID:26224703

  1. Harvesting green algae from eutrophic reservoir by electroflocculation and post-use for biodiesel production.


    Valero, Enrique; Álvarez, Xana; Cancela, Ángeles; Sánchez, Ángel


    Each year there are more frequent blooms of green algae and cyanobacteria, representing a serious environmental problem of eutrophication. Electroflocculation (EF) was studied to harvest the algae which are present in reservoirs, as well as different factors which may influence on the effectiveness of the process: the voltage applied to the culture medium, run times, electrodes separation and natural sedimentation. Finally, the viability of its use to obtain biodiesel was studied by direct transesterification. The EF process carried out at 10V for 1min, with an electrode separation of 5.5cm and a height of 4cm in culture vessel, obtained a recovery efficiency greater than 95%, and octadecenoic and palmitic acids were obtained as the fatty acid methyl esters (FAMEs). EF is an effective method to harvest green algae during the blooms, obtaining the greatest amount of biomass for subsequent use as a source of biodiesel.

  2. Evaluation of sample extraction methods for proteomics analysis of green algae Chlorella vulgaris.


    Gao, Yan; Lim, Teck Kwang; Lin, Qingsong; Li, Sam Fong Yau


    Many protein extraction methods have been developed for plant proteome analysis but information is limited on the optimal protein extraction method from algae species. This study evaluated four protein extraction methods, i.e. direct lysis buffer method, TCA-acetone method, phenol method, and phenol/TCA-acetone method, using green algae Chlorella vulgaris for proteome analysis. The data presented showed that phenol/TCA-acetone method was superior to the other three tested methods with regards to shotgun proteomics. Proteins identified using shotgun proteomics were validated using sequential window acquisition of all theoretical fragment-ion spectra (SWATH) technique. Additionally, SWATH provides protein quantitation information from different methods and protein abundance using different protein extraction methods was evaluated. These results highlight the importance of green algae protein extraction method for subsequent MS analysis and identification.

  3. Final technical report [Molecular genetic analysis of biophotolytic hydrogen production in green algae

    SciTech Connect

    Mets, Laurens


    The principal objective of this project was to identify genes necessary for biophotolytic hydrogen production in green algae, using Chlamydomonas reinhardtii as an experimental organism. The main strategy was to isolate mutants that are selectively deficient in hydrogen production and to genetically map, physically isolate, and ultimately sequence the affected genes.

  4. Effects of p-Cresol on photosynthetic and respiration rates of a filamentous green alga (spirogyra)

    SciTech Connect

    Stout, J.; Kilham, S.S.


    The effects of spilled phenols and cresols from coal gasification plants on the green alga SPIROYRA was investigated in experimental streams built by the US EPA near Monticello, Minnesota. P-Cresol at low concentrations inhibited photosynthesis and increased algal respiration rates. (JMT)

  5. Utilizing the green alga Chlamydomonas reinhardtii for microbial electricity generation: a living solar cell.


    Rosenbaum, Miriam; Schröder, Uwe; Scholz, Fritz


    By employing living cells of the green alga Chlamydomonas reinhardtii, we demonstrate the possibility of direct electricity generation from microbial photosynthetic activity. The presented concept is based on an in situ oxidative depletion of hydrogen, photosynthetically produced by C. reinhardtii under sulfur-deprived conditions, by polymer-coated electrocatalytic electrodes. PMID:15696280

  6. Identifying Aspects of the Post-Transcriptional Program Governing the Proteome of the Green Alga Micromonas pusilla

    PubMed Central

    Waltman, Peter H.; Guo, Jian; Reistetter, Emily Nahas; Purvine, Samuel; Ansong, Charles K.; van Baren, Marijke J.; Wong, Chee-Hong; Wei, Chia-Lin; Smith, Richard D.; Callister, Stephen J.; Stuart, Joshua M.; Worden, Alexandra Z.


    Micromonas is a unicellular motile alga within the Prasinophyceae, a green algal group that is related to land plants. This picoeukaryote (<2 μm diameter) is widespread in the marine environment but is not well understood at the cellular level. Here, we examine shifts in mRNA and protein expression over the course of the day-night cycle using triplicated mid-exponential, nutrient replete cultures of Micromonas pusilla CCMP1545. Samples were collected at key transition points during the diel cycle for evaluation using high-throughput LC-MS proteomics. In conjunction, matched mRNA samples from the same time points were sequenced using pair-ended directional Illumina RNA-Seq to investigate the dynamics and relationship between the mRNA and protein expression programs of M. pusilla. Similar to a prior study of the marine cyanobacterium Prochlorococcus, we found significant divergence in the mRNA and proteomics expression dynamics in response to the light:dark cycle. Additionally, expressional responses of genes and the proteins they encoded could also be variable within the same metabolic pathway, such as we observed in the oxygenic photosynthesis pathway. A regression framework was used to predict protein levels from both mRNA expression and gene-specific sequence-based features. Several features in the genome sequence were found to influence protein abundance including codon usage as well as 3’ UTR length and structure. Collectively, our studies provide insights into the regulation of the proteome over a diel cycle as well as the relationships between transcriptional and translational programs in the widespread marine green alga Micromonas. PMID:27434306

  7. Identifying Aspects of the Post-Transcriptional Program Governing the Proteome of the Green Alga Micromonas pusilla.


    Waltman, Peter H; Guo, Jian; Reistetter, Emily Nahas; Purvine, Samuel; Ansong, Charles K; van Baren, Marijke J; Wong, Chee-Hong; Wei, Chia-Lin; Smith, Richard D; Callister, Stephen J; Stuart, Joshua M; Worden, Alexandra Z


    Micromonas is a unicellular motile alga within the Prasinophyceae, a green algal group that is related to land plants. This picoeukaryote (<2 μm diameter) is widespread in the marine environment but is not well understood at the cellular level. Here, we examine shifts in mRNA and protein expression over the course of the day-night cycle using triplicated mid-exponential, nutrient replete cultures of Micromonas pusilla CCMP1545. Samples were collected at key transition points during the diel cycle for evaluation using high-throughput LC-MS proteomics. In conjunction, matched mRNA samples from the same time points were sequenced using pair-ended directional Illumina RNA-Seq to investigate the dynamics and relationship between the mRNA and protein expression programs of M. pusilla. Similar to a prior study of the marine cyanobacterium Prochlorococcus, we found significant divergence in the mRNA and proteomics expression dynamics in response to the light:dark cycle. Additionally, expressional responses of genes and the proteins they encoded could also be variable within the same metabolic pathway, such as we observed in the oxygenic photosynthesis pathway. A regression framework was used to predict protein levels from both mRNA expression and gene-specific sequence-based features. Several features in the genome sequence were found to influence protein abundance including codon usage as well as 3' UTR length and structure. Collectively, our studies provide insights into the regulation of the proteome over a diel cycle as well as the relationships between transcriptional and translational programs in the widespread marine green alga Micromonas. PMID:27434306

  8. Extraction and Purification of R-phycoerythrin from Marine Red Algae.


    Dumay, Justine; Morançais, Michèle; Nguyen, Huu Phuo Trang; Fleurence, Joël


    This chapter focuses on the recovery of an R-Phycoerythrin (R-PE)-enriched fraction from marine algae. Since R-PE is a proteinaceous pigment, we have developed a simple and rapid two-step method devoted to the extraction and purification of R-PE from marine red algae. Here we describe a phosphate buffer extraction followed by anion exchange chromatography carried on a DEAE Sepharose Fast Flow column. To ensure the quality and quantity of R-PE recovery, we also indicate different methods to monitor each fraction obtained, such as spectrophotometric indicators, gel filtration, and SDS-PAGE analysis.

  9. Extraction and Purification of R-phycoerythrin from Marine Red Algae.


    Dumay, Justine; Morançais, Michèle; Nguyen, Huu Phuo Trang; Fleurence, Joël


    This chapter focuses on the recovery of an R-Phycoerythrin (R-PE)-enriched fraction from marine algae. Since R-PE is a proteinaceous pigment, we have developed a simple and rapid two-step method devoted to the extraction and purification of R-PE from marine red algae. Here we describe a phosphate buffer extraction followed by anion exchange chromatography carried on a DEAE Sepharose Fast Flow column. To ensure the quality and quantity of R-PE recovery, we also indicate different methods to monitor each fraction obtained, such as spectrophotometric indicators, gel filtration, and SDS-PAGE analysis. PMID:26108500

  10. Grazing on green algae by the periwinkle Littorina littorea in the Wadden Sea

    NASA Astrophysics Data System (ADS)

    Wilhelmsen, U.; Reise, K.


    On sedimentary tidal flats in the Wadden Sea near the Island of Sylt, the periwinkle Littorina littorea occurred preferentially on clusters and beds of mussels and on shell beds (100 to 350 m-2), achieved moderate densities on green algal patches or mats (20 to 50 m-2), and remained rare on bare sediments (<5 m-2). Green algae covering>10% of sediment surface appeared in summer on approximately one third of the tidal zone, mainly in the upper and sheltered parts and almost never on mussel and shell beds. In feeding experiments, L. littorea ingested more of the dominant alge, Enteromorpha, than of Ulva, irrespective of whether or not algae were fresh or decaying. The tough thalli of Chaetomorpha were hardly consumed. Snails feeding on Enteromorpha produced fecal pellets from which new growth of Enteromorpha started. In the absence of periwinkles, Enteromorpha developed on mussels and the attached fucoids. Experimentally increased snail densities on sediments prevented green algal development, but the snails were unable to graze down established algal mats. It is concluded that natural densities of L. littorea hardly affect the ephemeral mass development of green algae on sediments. However, where the snails occur at high densities, i.e. on mussel beds, green algal development may be prevented.

  11. Bacterial diversity in surface water of the Yellow Sea during and after a green alga tide in 2008

    NASA Astrophysics Data System (ADS)

    Guo, Cong; Li, Fuchao; Jiang, Peng; Liu, Zhaopu; Qin, Song


    From May to August 2008, a large "green tide", consisting of the alga Ulva ( Enteromorpha) prolifera, occurred in the Yellow Sea, China, affecting the local marine ecosystem and human activities. We investigated the influence of the green tide on the microbial community in the surface seawater, at four sites from July to August 2008, using bacterial 16S rRNA gene clone libraries. We sequenced 228 clones of unique patterns identified by restriction fragment length polymorphism (RFLP) techniques. The results show that 228 sequenced clones fell into six bacterial phyla: Proteobacteria, Bacteroidetes, Cyanobacteria, Verrucomicrobia, Actinobacteria, and Planctomycetes. Alphaproteobacteria (33%), Gammaproteobacteria (25%), Bacteroidetes (23%) and Cyanobacteria (9%) dominated the assemblage. Comparison between samples collected in July (during the tide) and those collected in August (after the tide) showed that, in the microbial community, diversities of Alphaproteobacteria and Cyanobacteria increased after the tide, while those of Gammaproteobacteria and Bacteroidetes decreased. These results indicate that the green tide influenced the growth of some bacteria, and provide information for further studies on the interactions and relationships between U. prolifera and the bacterial community. This study suggests that microbial community analysis is a good approach to monitoring green tides.

  12. Mixotrophy in the terrestrial green alga Apatococcus lobatus (Trebouxiophyceae, Chlorophyta).


    Gustavs, Lydia; Schumann, Rhena; Karsten, Ulf; Lorenz, Maike


    The green microalga Apatococcus lobatus is widely distributed in terrestrial habitats throughout many climatic zones. It dominates green biofilms on natural and artificial substrata in temperate latitudes and is regarded as a key genus of obligate terrestrial consortia. Until now, its isolation, cultivation and application as a terrestrial model organism has been hampered by slow growth rates and low growth capacities. A mixotrophic culturing approach clearly enhanced the accumulation of biomass, thereby permitting the future application of A. lobatus in different types of bio-assays necessary for material and biofilm research. The ability of A. lobatus to grow mixotrophically is assumed as a competitive advantage in terrestrial habitats.

  13. Identification of cypermethrin induced protein changes in green algae by iTRAQ quantitative proteomics.


    Gao, Yan; Lim, Teck Kwang; Lin, Qingsong; Li, Sam Fong Yau


    Cypermethrin (CYP) is one of the most widely used pesticides in large scale for agricultural and domestic purpose and the residue often seriously affects aquatic system. Environmental pollutant-induced protein changes in organisms could be detected by proteomics, leading to discovery of potential biomarkers and understanding of mode of action. While proteomics investigations of CYP stress in some animal models have been well studied, few reports about the effects of exposure to CYP on algae proteome were published. To determine CYP effect in algae, the impact of various dosages (0.001μg/L, 0.01μg/L and 1μg/L) of CYP on green algae Chlorella vulgaris for 24h and 96h was investigated by using iTRAQ quantitative proteomics technique. A total of 162 and 198 proteins were significantly altered after CYP exposure for 24h and 96h, respectively. Overview of iTRAQ results indicated that the influence of CYP on algae protein might be dosage-dependent. Functional analysis of differentially expressed proteins showed that CYP could induce protein alterations related to photosynthesis, stress responses and carbohydrate metabolism. This study provides a comprehensive view of complex mode of action of algae under CYP stress and highlights several potential biomarkers for further investigation of pesticide-exposed plant and algae. PMID:26961939

  14. Identification of cypermethrin induced protein changes in green algae by iTRAQ quantitative proteomics.


    Gao, Yan; Lim, Teck Kwang; Lin, Qingsong; Li, Sam Fong Yau


    Cypermethrin (CYP) is one of the most widely used pesticides in large scale for agricultural and domestic purpose and the residue often seriously affects aquatic system. Environmental pollutant-induced protein changes in organisms could be detected by proteomics, leading to discovery of potential biomarkers and understanding of mode of action. While proteomics investigations of CYP stress in some animal models have been well studied, few reports about the effects of exposure to CYP on algae proteome were published. To determine CYP effect in algae, the impact of various dosages (0.001μg/L, 0.01μg/L and 1μg/L) of CYP on green algae Chlorella vulgaris for 24h and 96h was investigated by using iTRAQ quantitative proteomics technique. A total of 162 and 198 proteins were significantly altered after CYP exposure for 24h and 96h, respectively. Overview of iTRAQ results indicated that the influence of CYP on algae protein might be dosage-dependent. Functional analysis of differentially expressed proteins showed that CYP could induce protein alterations related to photosynthesis, stress responses and carbohydrate metabolism. This study provides a comprehensive view of complex mode of action of algae under CYP stress and highlights several potential biomarkers for further investigation of pesticide-exposed plant and algae.

  15. Relationship between water solubility of chlorobenzenes and their effects on a freshwater green alga

    SciTech Connect

    Wong, P.T.S.; Chau, Y.K.; Rhamey, J.S.; Docker, M.


    The effective concentrations of benzene and 12 chlorobenzenes that reduced 50% of the primary productivity (EC/sub 50/) of a freshwater green alga, Ankistrodesmus falcatus, were determined. Benzene was the least toxic chemical and the toxicity increased as the degree of chlorine substitution in the aromatic ring increased. No EC/sub 50/ value could be obtained for HCB. A quantitative relationship was found to exist between water solubility, lipophilicity and the EC/sub 50/. A good correlation was also observed between the EC/sub 50/ for this alga and other toxicity data for various aquatic biota.

  16. Water Collective Dynamics in Whole Photosynthetic Green Algae as Affected by Protein Single Mutation.


    Russo, Daniela; Rea, Giuseppina; Lambreva, Maya D; Haertlein, Michael; Moulin, Martine; De Francesco, Alessio; Campi, Gaetano


    In the context of the importance of water molecules for protein function/dynamics relationship, the role of water collective dynamics in Chlamydomonas green algae carrying both native and mutated photosynthetic proteins has been investigated by neutron Brillouin scattering spectroscopy. Results show that single point genetic mutation may notably affect collective density fluctuations in hydrating water providing important insight on the transmission of information possibly correlated to biological functionality. In particular, we highlight that the damping factor of the excitations is larger in the native compared to the mutant algae as a signature of a different plasticity and structure of the hydrogen bond network. PMID:27300078

  17. Coralline algae as a globally significant pool of marine dimethylated sulfur

    NASA Astrophysics Data System (ADS)

    Burdett, Heidi L.; Hatton, Angela D.; Kamenos, Nicholas A.


    Marine algae are key sources of the biogenic sulfur compound dimethylsulphoniopropionate (DMSP), a vital component of the marine sulfur cycle. Autotrophic ecosystem engineers such as red coralline algae support highly diverse and biogeochemically active ecosystems and are known to be high DMSP producers, but their importance in the global marine sulfur cycle has not yet been appreciated. Using a global sampling approach, we show that red coralline algae are a globally significant pool of DMSP in the oceans, estimated to be ~110 × 1012 moles worldwide during the summer months. Latitude was a major driver of observed regional-scale variations, with peaks in polar and tropical climate regimes, reflecting the varied cellular functions for DMSP (e.g., as a cryoprotectant and antioxidant). A temperate coralline algal bed was investigated in more detail to also identify local-scale temporal variations. Here, water column DMSP was driven by water temperature, and to a lesser extent, cloud cover; two factors which are also vital in controlling coralline algal growth. This study demonstrates that coralline algae harbor a large pool of dimethylated sulfur, thereby playing a significant role in both the sulfur and carbon marine biogeochemical cycles. However, coralline algal habitats are severely threatened by projected climate change; a loss of this habitat may thus detrimentally impact oceanic sulfur and carbon biogeochemical cycling.


    EPA Science Inventory

    Two green algal morphotypes, filamentous species (e.g., Chaetomorpha spp.) and flattened or tubular (e.g.,Ulva spp. and Enteromorpha spp.) were collected from 63 sites within the Yaquina Bay estuary (Newport, OR) and used to compare an in situ volumetric biomass estimator to the...

  19. The effect of low temperature on Antarctic endolithic green algae.


    Meyer, M A; Huang G-H; Morris, G J; Friedmann, E I


    Laboratory experiments show that undercooling to about -5 degrees C occurs in colonized Beacon sandstones of the Ross Desert, Antarctica. High-frequency temperature oscillations between 5 degrees C and -5 degrees C or -10 degrees C (which occur in nature on the rock surface) did not damage Hemichloris antarctica. In a cryomicroscope, H. antarctica appeared to be undamaged after slow or rapid cooling to -50 degrees C. 14CO2 incorporation after freezing to -20 degrees C was unaffected in H. antarctica or in Trebouxia sp. but slightly depressed in Stichococcus sp. (isolated from a less extreme Antarctic habitat). These results suggest that the freezing regime in the Antarctic desert is not injurious to endolithic algae. It is likely that the freezing-point depression inside the rock makes available liquid water for metabolic activity at subzero temperatures. Freezing may occur more frequently on the rock surface and contribute to the abiotic nature of the surface.

  20. The effect of low temperature on Antarctic endolithic green algae

    NASA Technical Reports Server (NTRS)

    Meyer, M. A.; Morris, G. J.; Friedmann, E. I.


    Laboratory experiments show that undercooling to about -5 degrees C occurs in colonized Beacon sandstones of the Ross Desert, Antarctica. High-frequency temperature oscillations between 5 degrees C and -5 degrees C or -10 degrees C (which occur in nature on the rock surface) did not damage Hemichloris antarctica. In a cryomicroscope, H. antarctica appeared to be undamaged after slow or rapid cooling to -50 degrees C. 14CO2 incorporation after freezing to -20 degrees C was unaffected in H. antarctica or in Trebouxia sp. but slightly depressed in Stichococcus sp. (isolated from a less extreme Antarctic habitat). These results suggest that the freezing regime in the Antarctic desert is not injurious to endolithic algae. It is likely that the freezing-point depression inside the rock makes available liquid water for metabolic activity at subzero temperatures. Freezing may occur more frequently on the rock surface and contribute to the abiotic nature of the surface.

  1. [Evolutional relationships of endemic green algae Draparnaldioides simplex from Lake Baikal with nonbaicalian taxa of family Chaetoforaceae (Chlorophyta)].


    Mincheva, E V; Peretolchina, T E; Izhboldina, L A; Kravtsova, L S; Shcherbakov, D Iu


    Phylogenetic relationships between the endemic baicalian green algae Draparnaldioides simplex C. meyer et Skabitsch, 1976 and holarctic taxa of green algae were studied using the fragment of 18S rDNA and internal transcribed spacers ITS1 and ITS2 of nuclear DNA. We showed that the baicalian genus Draparnaldioides is a separate taxon. The genetic difference between Draparnaldioides and nonbaicalian taxa of the sister groups of the green algae are small enough to indicate relative youth of the genus Draparnaldioides and its recent radiation from a common ancestor with Draparnaldia and Chaetophora.

  2. The complete mitochondrial DNA sequences of Nephroselmis olivacea and Pedinomonas minor. Two radically different evolutionary patterns within green algae.


    Turmel, M; Lemieux, C; Burger, G; Lang, B F; Otis, C; Plante, I; Gray, M W


    Green plants appear to comprise two sister lineages, Chlorophyta (classes Chlorophyceae, Ulvophyceae, Trebouxiophyceae, and Prasinophyceae) and Streptophyta (Charophyceae and Embryophyta, or land plants). To gain insight into the nature of the ancestral green plant mitochondrial genome, we have sequenced the mitochondrial DNAs (mtDNAs) of Nephroselmis olivacea and Pedinomonas minor. These two green algae are presumptive members of the Prasinophyceae. This class is thought to include descendants of the earliest diverging green algae. We find that Nephroselmis and Pedinomonas mtDNAs differ markedly in size, gene content, and gene organization. Of the green algal mtDNAs sequenced so far, that of Nephroselmis (45,223 bp) is the most ancestral (minimally diverged) and occupies the phylogenetically most basal position within the Chlorophyta. Its repertoire of 69 genes closely resembles that in the mtDNA of Prototheca wickerhamii, a later diverging trebouxiophycean green alga. Three of the Nephroselmis genes (nad10, rpl14, and rnpB) have not been identified in previously sequenced mtDNAs of green algae and land plants. In contrast, the 25,137-bp Pedinomonas mtDNA contains only 22 genes and retains few recognizably ancestral features. In several respects, including gene content and rate of sequence divergence, Pedinomonas mtDNA resembles the reduced mtDNAs of chlamydomonad algae, with which it is robustly affiliated in phylogenetic analyses. Our results confirm the existence of two radically different patterns of mitochondrial genome evolution within the green algae.

  3. The complete mitochondrial DNA sequences of Nephroselmis olivacea and Pedinomonas minor. Two radically different evolutionary patterns within green algae.

    PubMed Central

    Turmel, M; Lemieux, C; Burger, G; Lang, B F; Otis, C; Plante, I; Gray, M W


    Green plants appear to comprise two sister lineages, Chlorophyta (classes Chlorophyceae, Ulvophyceae, Trebouxiophyceae, and Prasinophyceae) and Streptophyta (Charophyceae and Embryophyta, or land plants). To gain insight into the nature of the ancestral green plant mitochondrial genome, we have sequenced the mitochondrial DNAs (mtDNAs) of Nephroselmis olivacea and Pedinomonas minor. These two green algae are presumptive members of the Prasinophyceae. This class is thought to include descendants of the earliest diverging green algae. We find that Nephroselmis and Pedinomonas mtDNAs differ markedly in size, gene content, and gene organization. Of the green algal mtDNAs sequenced so far, that of Nephroselmis (45,223 bp) is the most ancestral (minimally diverged) and occupies the phylogenetically most basal position within the Chlorophyta. Its repertoire of 69 genes closely resembles that in the mtDNA of Prototheca wickerhamii, a later diverging trebouxiophycean green alga. Three of the Nephroselmis genes (nad10, rpl14, and rnpB) have not been identified in previously sequenced mtDNAs of green algae and land plants. In contrast, the 25,137-bp Pedinomonas mtDNA contains only 22 genes and retains few recognizably ancestral features. In several respects, including gene content and rate of sequence divergence, Pedinomonas mtDNA resembles the reduced mtDNAs of chlamydomonad algae, with which it is robustly affiliated in phylogenetic analyses. Our results confirm the existence of two radically different patterns of mitochondrial genome evolution within the green algae. PMID:10488238

  4. Increased temperature mitigates the effects of ocean acidification in calcified green algae ( Halimeda spp.)

    NASA Astrophysics Data System (ADS)

    Campbell, Justin E.; Fisch, Jay; Langdon, Chris; Paul, Valerie J.


    The singular and interactive effects of ocean acidification and temperature on the physiology of calcified green algae ( Halimeda incrassata, H. opuntia, and H. simulans) were investigated in a fully factorial, 4-week mesocosm experiment. Individual aquaria replicated treatment combinations of two pH levels (7.6 and 8.0) and two temperatures (28 and 31 °C). Rates of photosynthesis, respiration, and calcification were measured for all species both prior to and after treatment exposure. Pre-treatment measurements revealed that H. incrassata displayed higher biomass-normalized rates of photosynthesis and calcification (by 55 and 81 %, respectively) relative to H. simulans and H. opuntia. Furthermore, prior to treatment exposure, photosynthesis was positively correlated to calcification, suggesting that the latter process may be controlled by photosynthetic activity in this group. After treatment exposure, net photosynthesis was unaltered by pH, yet significantly increased with elevated temperature by 58, 38, and 37 % for H. incrassata, H. simulans, and H. opuntia, respectively. Both pH and temperature influenced calcification, but in opposing directions. On average, calcification declined by 41 % in response to pH reduction, but increased by 49 % in response to elevated temperature. Within each pH treatment, elevated temperature increased calcification by 23 % (at pH 8.0) and 74 % (at pH 7.6). Interactions between pH, temperature, and/or species were not observed. This work demonstrates that, in contrast to prior studies, increased temperature may serve to enhance the metabolic performance (photosynthesis and calcification) of some marine calcifiers, despite elevated carbon dioxide concentrations. Thus, in certain cases, ocean warming may mitigate the negative effects of acidification.

  5. Mixotrophy in the terrestrial green alga Apatococcus lobatus (Trebouxiophyceae, Chlorophyta).


    Gustavs, Lydia; Schumann, Rhena; Karsten, Ulf; Lorenz, Maike


    The green microalga Apatococcus lobatus is widely distributed in terrestrial habitats throughout many climatic zones. It dominates green biofilms on natural and artificial substrata in temperate latitudes and is regarded as a key genus of obligate terrestrial consortia. Until now, its isolation, cultivation and application as a terrestrial model organism has been hampered by slow growth rates and low growth capacities. A mixotrophic culturing approach clearly enhanced the accumulation of biomass, thereby permitting the future application of A. lobatus in different types of bio-assays necessary for material and biofilm research. The ability of A. lobatus to grow mixotrophically is assumed as a competitive advantage in terrestrial habitats. PMID:27037595

  6. Structure of PSI, PSII and antennae complexes from yellow-green alga Xanthonema debile.


    Gardian, Zdenko; Tichý, Josef; Vácha, František


    Photosynthetic carbon fixation by Chromophytes is one of the significant components of a carbon cycle on the Earth. Their photosynthetic apparatus is different in pigment composition from that of green plants and algae. In this work we report structural maps of photosystem I, photosystem II and light harvesting antenna complexes isolated from a soil chromophytic alga Xanthonema debile (class Xanthophyceae). Electron microscopy of negatively stained preparations followed by single particle analysis revealed that the overall structure of Xanthophytes' PSI and PSII complexes is similar to that known from higher plants or algae. Averaged top-view projections of Xanthophytes' light harvesting antenna complexes (XLH) showed two groups of particles. Smaller ones that correspond to a trimeric form of XLH, bigger particles resemble higher oligomeric form of XLH. PMID:21455629

  7. Toxicity of surfactants to green microalgae Pseudokirchneriella subcapitata and Scenedesmus subspicatus and to marine diatoms Phaeodactylum tricornutum and Skeletonema costatum.


    Pavlić, Zelimira; Vidaković-Cifrek, Zeljka; Puntarić, Dinko


    Ecotoxicity of different commercial surfactants (six anionic, two amphoteric and one nonionic), essential constituents of cleansing hair products (shampoos), as well as ecotoxicity of eight shampoos containing different combinations of these surfactants, were tested in order to evaluate their possible toxic effects on microalgae. Specific objective of this research was to compare the sensitivity of selected freshwater and marine microalgae to these widely used surfactants and well-known pollutants in surface waters. Internationally validated methods (ISO standards) for the determination of toxic effects on the growth of planktonic freshwater green algae Pseudokirchneriella subcapitata and Scenedesmus subspicatus and marine diatoms Skeletonema costatum and Phaeodactylum tricornutum, were used. The obtained results showed that the concentrations of tested surfactants and shampoos, which resulted in 50% growth reduction of planktonic freshwater green algae, when compared to the controls without test substances (EC50), were in the range from 0.32 to 4.4 mg l(-1) for surfactants and from 2.1 to 8.5 mg l(-1) for shampoos expressed as active substance. Marine diatoms were significantly more sensitive to the tested surfactants than freshwater green algae (EC50 0.14-1.7 mg l(-1) for surfactants and 0.35-1.25 mg l(-1) for shampoos). According to the classification on the basis of environmental effects, the obtained results suggested that all tested surfactants can be classified as having toxic effects on freshwater green alga Pseudokirchneriella subcapitata. Some of them indicated that they have a very toxic effect on Scenedesmus subspicatus and marine diatoms Skeletonema costatum and Phaeodactylum tricornutum.

  8. Marine algae sulfated polysaccharides for tissue engineering and drug delivery approaches

    PubMed Central

    Silva, Tiago H.; Alves, Anabela; Popa, Elena G.; Reys, Lara L.; Gomes, Manuela E.; Sousa, Rui A.; Silva, Simone S.; Mano, João F.; Reis, Rui L.


    Biomedical field is constantly requesting for new biomaterials, with innovative properties. Natural polymers appear as materials of election for this goal due to their biocompatibility and biodegradability. In particular, materials found in marine environment are of great interest since the chemical and biological diversity found in this environment is almost uncountable and continuously growing with the research in deeper waters. Moreover, there is also a slower risk of these materials to pose illnesses to humans. In particular, sulfated polysaccharides can be found in marine environment, in different algae species. These polysaccharides don’t have equivalent in the terrestrial plants and resembles the chemical and biological properties of mammalian glycosaminoglycans. In this perspective, are receiving growing interest for application on health-related fields. On this review, we will focus on the biomedical applications of marine algae sulfated polymers, in particular on the development of innovative systems for tissue engineering and drug delivery approaches. PMID:23507892

  9. Interactions between marine facultative epiphyte Chlamydomonas sp. (Chlamydomonadales, Chlorophyta) and ceramiaceaen algae (Rhodophyta).


    Klochkova, Tatyana A; Cho, Ga Youn; Boo, Sung Min; Chung, Ki Wha; Kim, Song Ja; Kim, Gwang Hoon


    Previously unrecorded marine Chlamydomonas that grew epiphytic on ceramiaceaen algae was collected from the western coast of Korea and isolated into a unialgal culture. The isolate was subjected to 18S rDNA phylogenetic analysis as well as ultrastructure and life cycle studies. It had an affinity with the marine Chlamydomonas species and was less related to freshwater/terrestrial representatives of this genus. It had flagella shorter than the cell body two-layered cell wall with striated outer surface and abundant mucilaginous material beneath the innermost layer and no contractile vacuoles. This alga grew faster in mixed cultures with ceramiaceaen algae rather than in any tested unialgal culture condition; the cells looked healthier and zoosporangia and motile flagellated vegetative cells appeared more often. These results suggested that this Chlamydomonas might be a facultative epiphyte benefiting from its hosts. Several ceramiaceaen algae were tested as host plants. Meanwhile, cell deformation or collapse of the whole thallus was caused to Aglaothamnion byssoides, and preliminary study suggested that a substance released from Chlamydomonas caused the response. This is first report on harmful epiphytic interactions between Chlamydomonas species and red ceramiaceaen algae.

  10. Bioactivities from Marine Algae of the Genus Gracilaria

    PubMed Central

    de Almeida, Cynthia Layse F.; Falcão, Heloina de S.; Lima, Gedson R. de M.; Montenegro, Camila de A.; Lira, Narlize S.; de Athayde-Filho, Petrônio F.; Rodrigues, Luis C.; de Souza, Maria de Fátima V.; Barbosa-Filho, José M.; Batista, Leônia M.


    Seaweeds are an important source of bioactive metabolites for the pharmaceutical industry in drug development. Many of these compounds are used to treat diseases like cancer, acquired immune-deficiency syndrome (AIDS), inflammation, pain, arthritis, as well as viral, bacterial, and fungal infections. This paper offers a survey of the literature for Gracilaria algae extracts with biological activity, and identifies avenues for future research. Nineteen species of this genus that were tested for antibacterial, antiviral, antifungal, antihypertensive, cytotoxic, spermicidal, embriotoxic, and anti-inflammatory activities are cited from the 121 references consulted. PMID:21845096

  11. Laccase-like enzyme activities from chlorophycean green algae with potential for bioconversion of phenolic pollutants.


    Otto, Benjamin; Beuchel, Carl; Liers, Christiane; Reisser, Werner; Harms, Hauke; Schlosser, Dietmar


    In order to explore the abundance and potential environmental functions of green algal laccases, we screened various algae for extracellular laccase-like activities, characterized basic features of these activities in selected species and exemplarily studied the transformation of environmental pollutants and complex natural compounds by the laccase of Tetracystis aeria. Oxidation of the classical laccase substrate ABTS was found to be widespread in chlorophycean algae. The oxidation activity detected in members of the 'Scenedesmus' clade was caused by an unknown thermostable low-molecular-mass compound. In contrast, species of the Moewusinia, including Chlamydomonas moewusii and T. aeria, excreted putative 'true' laccases. Phenolic substrates were oxidized by these enzymes optimally at neutral to alkaline pH. The Tetracystis laccase efficiently transformed bisphenol A, 17α-ethinylestradiol, nonylphenol and triclosan in the presence of ABTS as redox mediator, while anthracene, veratrylalcohol and adlerol were not attacked. Lignosulfonate and humic acid underwent slight (de)polymerization reactions in the presence of the laccase and mediator(s), probably involving the oxidation of phenolic constituents. Possible natural functions of the enzymes, such as the synthesis of complex polymers or detoxification processes, may assist the survival of the algae in adverse environments. In contaminated surface waters, laccase-producing green algae might contribute to the environmental breakdown of phenolic pollutants.

  12. Strong tolerance of blue-green alga Microcystis flos-aquae to very high pressure

    NASA Astrophysics Data System (ADS)

    Ono, F.; Nishihira, N.; Hada, Y.; Mori, Y.; Takarabe, K.; Saigusa, M.; Matsushima, Y.; Yamazaki, D.; Ito, E.


    It was shown in our previous reports that a few spores of moss Venturiella could tolerate the very high pressure of 20 GPa for 30 min and germinated a protonema to the length of 30 μm. However, these spores did not grow any further, and disappeared at around 30 days of incubation after seeded. On the other hand, colonies of blue-green alga Microcystis flos-aquae came to appear about 76 days after the moss spores were seeded. Many of these colonies appeared at the places where the moss spores had disappeared. These colonies were formed by the algae that had adhered to the spore cases of the moss and survived after exposure to the very high pressure of 20 GPa. Though the appearance of the colonies of high pressure exposed algae was delayed by about 50 days compared with that of the control group which was not exposed to high pressure, there seems no difference in their shape and color from those of the control group. The pressure tolerance of blue-green alga is found to be enormously strong, and it can survive after exposure to the high pressure which corresponds to the depth of about 550-600 km from the surface of the Earth, just above the lower mantle.

  13. The adsorption potential and recovery of thallium using green micro-algae from eutrophic water sources.


    Birungi, Z S; Chirwa, E M N


    Thallium (Tl) is a highly volatile and toxic heavy metal regarded to cause pollution even at very low concentrations of several parts per million. Despite the extremely high risk of Tl in the environment, limited information on removal/recovery exists. The study focussed on the use of green algae to determine the sorption potential and recovery of Tl. From the study, removal efficiency was achieved at 100% for lower concentrations of ≥150 mg/L of Tl. At higher concentrations in a range of 250-500 mg/L, the performance of algae was still higher with sorption capacity (qmax) between 830 and 1000 mg/g. Generally, Chlorella vulgaris was the best adsorbent with a high qmax and lower affinity of 1000 mg/g and 1.11 L/g, respectively. When compared to other studies on Tl adsorption, the tested algae showed a better qmax than most adsorbents. The kinetic studies showed better correlation co-efficient of ≤0.99 for Pseudo-second order model than the first order model. Recovery was achieved highest for C. vulgaris using nitric acid at 93.3%. The strongest functional groups responsible for Tl binding on the algal cell wall were carboxyl and phenols. Green algae from freshwater bodies showed significant potential for Tl removal/recovery from industrial wastewater.

  14. Laccase-like enzyme activities from chlorophycean green algae with potential for bioconversion of phenolic pollutants.


    Otto, Benjamin; Beuchel, Carl; Liers, Christiane; Reisser, Werner; Harms, Hauke; Schlosser, Dietmar


    In order to explore the abundance and potential environmental functions of green algal laccases, we screened various algae for extracellular laccase-like activities, characterized basic features of these activities in selected species and exemplarily studied the transformation of environmental pollutants and complex natural compounds by the laccase of Tetracystis aeria. Oxidation of the classical laccase substrate ABTS was found to be widespread in chlorophycean algae. The oxidation activity detected in members of the 'Scenedesmus' clade was caused by an unknown thermostable low-molecular-mass compound. In contrast, species of the Moewusinia, including Chlamydomonas moewusii and T. aeria, excreted putative 'true' laccases. Phenolic substrates were oxidized by these enzymes optimally at neutral to alkaline pH. The Tetracystis laccase efficiently transformed bisphenol A, 17α-ethinylestradiol, nonylphenol and triclosan in the presence of ABTS as redox mediator, while anthracene, veratrylalcohol and adlerol were not attacked. Lignosulfonate and humic acid underwent slight (de)polymerization reactions in the presence of the laccase and mediator(s), probably involving the oxidation of phenolic constituents. Possible natural functions of the enzymes, such as the synthesis of complex polymers or detoxification processes, may assist the survival of the algae in adverse environments. In contaminated surface waters, laccase-producing green algae might contribute to the environmental breakdown of phenolic pollutants. PMID:25926529

  15. Substitution rate calibration of small subunit ribosomal RNA identifies chlorarachniophyte endosymbionts as remnants of green algae.

    PubMed Central

    Van de Peer, Y; Rensing, S A; Maier, U G; De Wachter, R


    Chlorarachniophytes are amoeboid algae with chlorophyll a and b containing plastids that are surrounded by four membranes instead of two as in plants and green algae. These extra membranes form important support for the hypothesis that chlorarachniophytes have acquired their plastids by the ingestion of another eukaryotic plastid-containing alga. Chlorarachniophytes also contain a small nucleus-like structure called the nucleomorph situated between the two inner and the two outer membranes surrounding the plastid. This nucleomorph is a remnant of the endosymbiont's nucleus and encodes, among other molecules, small subunit ribosomal RNA. Previous phylogenetic analyses on the basis of this molecule provided unexpected and contradictory evidence for the origin of the chlorarachniophyte endosymbiont. We developed a new method for measuring the substitution rates of the individual nucleotides of small subunit ribosomal RNA. From the resulting substitution rate distribution, we derived an equation that gives a more realistic relationship between sequence dissimilarity and evolutionary distance than equations previously available. Phylogenetic trees constructed on the basis of evolutionary distances computed by this new method clearly situate the chlorarachniophyte nucleomorphs among the green algae. Moreover, this relationship is confirmed by transversion analysis of the Chlorarachnion plastid small subunit ribosomal RNA. PMID:8755544

  16. When the lights go out: the evolutionary fate of free-living colorless green algae.


    Figueroa-Martinez, Francisco; Nedelcu, Aurora M; Smith, David R; Adrian, Reyes-Prieto


    The endosymbiotic origin of plastids was a launching point for eukaryotic evolution. The autotrophic abilities bestowed by plastids are responsible for much of the eukaryotic diversity we observe today. But despite its many advantages, photosynthesis has been lost numerous times and in disparate lineages throughout eukaryote evolution. For example, among green algae, several groups have lost photosynthesis independently and in response to different selective pressures; these include the parasitic/pathogenic trebouxiophyte genera Helicosporidium and Prototheca, and the free-living chlamydomonadalean genera Polytomella and Polytoma. Here, we examine the published data on colorless green algae and argue that investigations into the different evolutionary routes leading to their current nonphotosynthetic lifestyles provide exceptional opportunities to understand the ecological and genomic factors involved in the loss of photosynthesis. PMID:26042246

  17. Growth of Legionella pneumophila in association with blue-green algae (Cyanobacteria)

    SciTech Connect

    Tison, D.L.; Pope, D.H.; Cherry, W.B.; Fliermans, C.B.


    Legionella pneumophila (Legionnaires disease bacterium) of serogroup 1 was isolated from an algal-bacterial mat community growing at 45/sup 0/C in a man-made thermal effluent. This isolate was grown in mineral salts medium at 45/sup 0/C in association with the blue-green alga (cyanobacterium) Fischerella sp. over a pH range of 6.9 to 7.6. L. pneumophila was apparently using algal extracellular products as its carbon and energy sources. These observations indicate that the temperature, pH, and nutritional requirements of L. pneumophila are not as stringent as those previously observed when cultured on complex media. This association between L. pneumophila and certain blue-green algae suggests an explanation for the apparent widespread distribution of the bacterium in nature.

  18. Ulvan, a Sulfated Polysaccharide from Green Algae, Activates Plant Immunity through the Jasmonic Acid Signaling Pathway

    PubMed Central

    Jaulneau, Valérie; Lafitte, Claude; Jacquet, Christophe; Fournier, Sylvie; Salamagne, Sylvie; Briand, Xavier; Esquerré-Tugayé, Marie-Thérèse; Dumas, Bernard


    The industrial use of elicitors as alternative tools for disease control needs the identification of abundant sources of them. We report on an elicitor obtained from the green algae Ulva spp. A fraction containing most exclusively the sulfated polysaccharide known as ulvan-induced expression of a GUS gene placed under the control of a lipoxygenase gene promoter. Gene expression profiling was performed upon ulvan treatments on Medicago truncatula and compared to phytohormone effects. Ulvan induced a gene expression signature similar to that observed upon methyl jasmonate treatment (MeJA). Involvement of jasmonic acid (JA) in ulvan response was confirmed by detecting induction of protease inhibitory activity and by hormonal profiling of JA, salicylic acid (SA) and abscisic acid (ABA). Ulvan activity on the hormonal pathway was further consolidated by using Arabidopsis hormonal mutants. Altogether, our results demonstrate that green algae are a potential reservoir of ulvan elicitor which acts through the JA pathway. PMID:20445752

  19. Purification, properties and complete amino acid sequence of the ferredoxin from a green alga, Chlamydomonas reinhardtii.


    Schmitter, J M; Jacquot, J P; de Lamotte-Guéry, F; Beauvallet, C; Dutka, S; Gadal, P; Decottignies, P


    The ferredoxin was purified from the green alga, Chlamydomonas reinhardtii. The protein showed typical absorption and circular dichroism spectra of a [2Fe-2S] ferredoxin. When compared with spinach ferredoxin, the C. reinhardtii protein was less effective in the catalysis of NADP+ photoreduction, but its activity was higher in the light activation of C. reinhardtii malate dehydrogenase (NADP). The complete amino acid sequence was determined by automated Edman degradation of the whole protein and of peptides obtained by trypsin and chymotrypsin digestions and by CNBr cleavage. The protein consists of 94 residues, with Tyr at both NH2 and COOH termini. The positions of the four cysteines binding the two iron atoms are similar to those found in other [2Fe-2S] ferredoxins. The primary structure of C. reinhardtii ferredoxin showed a great homology (about 80%) with ferredoxins from two other green algae.

  20. A green algae mixture of Scenedesmus and Schroederiella attenuates obesity-linked metabolic syndrome in rats.


    Kumar, Senthil Arun; Magnusson, Marie; Ward, Leigh C; Paul, Nicholas A; Brown, Lindsay


    This study investigated the responses to a green algae mixture of Scenedesmus dimorphus and Schroederiella apiculata (SC) containing protein (46.1% of dry algae), insoluble fibre (19.6% of dry algae), minerals (3.7% of dry algae) and omega-3 fatty acids (2.8% of dry algae) as a dietary intervention in a high carbohydrate, high fat diet-induced metabolic syndrome model in four groups of male Wistar rats. Two groups were fed with a corn starch diet containing 68% carbohydrates as polysaccharides, while the other two groups were fed a diet high in simple carbohydrates (fructose and sucrose in food, 25% fructose in drinking water, total 68%) and fats (saturated and trans fats from beef tallow, total 24%). High carbohydrate, high fat-fed rats showed visceral obesity with hypertension, insulin resistance, cardiovascular remodelling, and nonalcoholic fatty liver disease. SC supplementation (5% of food) lowered total body and abdominal fat mass, increased lean mass, and attenuated hypertension, impaired glucose and insulin tolerance, endothelial dysfunction, infiltration of inflammatory cells into heart and liver, fibrosis, increased cardiac stiffness, and nonalcoholic fatty liver disease in the high carbohydrate, high fat diet-fed rats. This study suggests that the insoluble fibre or protein in SC helps reverse diet-induced metabolic syndrome.

  1. A Green Algae Mixture of Scenedesmus and Schroederiella Attenuates Obesity-Linked Metabolic Syndrome in Rats

    PubMed Central

    Kumar, Senthil Arun; Magnusson, Marie; Ward, Leigh C.; Paul, Nicholas A.; Brown, Lindsay


    This study investigated the responses to a green algae mixture of Scenedesmus dimorphus and Schroederiella apiculata (SC) containing protein (46.1% of dry algae), insoluble fibre (19.6% of dry algae), minerals (3.7% of dry algae) and omega-3 fatty acids (2.8% of dry algae) as a dietary intervention in a high carbohydrate, high fat diet-induced metabolic syndrome model in four groups of male Wistar rats. Two groups were fed with a corn starch diet containing 68% carbohydrates as polysaccharides, while the other two groups were fed a diet high in simple carbohydrates (fructose and sucrose in food, 25% fructose in drinking water, total 68%) and fats (saturated and trans fats from beef tallow, total 24%). High carbohydrate, high fat-fed rats showed visceral obesity with hypertension, insulin resistance, cardiovascular remodelling, and nonalcoholic fatty liver disease. SC supplementation (5% of food) lowered total body and abdominal fat mass, increased lean mass, and attenuated hypertension, impaired glucose and insulin tolerance, endothelial dysfunction, infiltration of inflammatory cells into heart and liver, fibrosis, increased cardiac stiffness, and nonalcoholic fatty liver disease in the high carbohydrate, high fat diet-fed rats. This study suggests that the insoluble fibre or protein in SC helps reverse diet-induced metabolic syndrome. PMID:25875119

  2. Viruses of eukaryotic green algae. Progress report, August 1, 1982-July 1, 1984

    SciTech Connect

    Van Etten, J.L.


    The virus, PBCV-1, which infects the eukaryotic, green alga, Chlorella-NC64A has been characterized and we have begun to look at detailed events associated with its growth cycle. In addition, we have recently discovered other dsDNA viruses from natural sources which replicate in Chlorella NC64A. These viruses can be distinguished from PBCV-1 and from each other by plaque morphology, DNA restriction patterns, and by their resistance to certain restriction endonucleases.

  3. Production of Recombinant Proteins in the Chloroplast of the Green Alga Chlamydomonas reinhardtii.


    Guzmán-Zapata, Daniel; Macedo-Osorio, Karla Soledad; Almaraz-Delgado, Alma Lorena; Durán-Figueroa, Noé; Badillo-Corona, Jesus Agustín


    Chloroplast transformation in the green algae Chlamydomonas reinhardtii can be used for the production of valuable recombinant proteins. Here, we describe chloroplast transformation of C. reinhardtii followed by protein detection. Genes of interest integrate stably by homologous recombination into the chloroplast genome following introduction by particle bombardment. Genes are inherited and expressed in lines recovered after selection in the presence of an antibiotic. Recombinant proteins can be detected by conventional techniques like immunoblotting and purified from liquid cultures.

  4. Viruses of eukaryotic green algae. Final technical report, June 1, 1989--February 1, 1992

    SciTech Connect

    Van Etten, J.L.


    We have isolated and partially characterized many large, polyhedral, DNA containing, plaque forming viruses which infect certain unicellular, eukaryotic, chlorella-like green algae. These viruses have several unique features, including the fact that they code for DNA site-specific endonucleases and DNA methyltransferases. The primary objectives of this study were to identify, clone, and characterize some of the virus-encoded DNA methyltransferases and DNA restriction endonucleases in order to understand their biological function.

  5. Production of Recombinant Proteins in the Chloroplast of the Green Alga Chlamydomonas reinhardtii.


    Guzmán-Zapata, Daniel; Macedo-Osorio, Karla Soledad; Almaraz-Delgado, Alma Lorena; Durán-Figueroa, Noé; Badillo-Corona, Jesus Agustín


    Chloroplast transformation in the green algae Chlamydomonas reinhardtii can be used for the production of valuable recombinant proteins. Here, we describe chloroplast transformation of C. reinhardtii followed by protein detection. Genes of interest integrate stably by homologous recombination into the chloroplast genome following introduction by particle bombardment. Genes are inherited and expressed in lines recovered after selection in the presence of an antibiotic. Recombinant proteins can be detected by conventional techniques like immunoblotting and purified from liquid cultures. PMID:26614282

  6. Crystallization and preliminary X-ray diffraction analysis of HML, a lectin from the red marine alga Hypnea musciformis

    SciTech Connect

    Nagano, Celso S.; Gallego del Sol, Francisca; Cavada, Benildo S.; Nascimento, Kyria Santiago Do; Nunes, Eudismar Vale; Sampaio, Alexandre H.; Calvete, Juan J.


    The crystallization and preliminary X-ray diffraction analysis of a red marine alga lectin isolated from H. musciformis is reported. HML, a lectin from the red marine alga Hypnea musciformis, defines a novel lectin family. Orthorhombic crystals of HML belonging to space group P2{sub 1}2{sub 1}2{sub 1} grew within three weeks at 293 K using the hanging-drop vapour-diffusion method. A complete data set was collected at 2.4 Å resolution. HML is the first marine alga lectin to be crystallized.

  7. Multiple regulatory mechanisms in the chloroplast of green algae: relation to hydrogen production.


    Antal, Taras K; Krendeleva, Tatyana E; Tyystjärvi, Esa


    A complex regulatory network in the chloroplast of green algae provides an efficient tool for maintenance of energy and redox balance in the cell under aerobic and anaerobic conditions. In this review, we discuss the structural and functional organizations of electron transport pathways in the chloroplast, and regulation of photosynthesis in the green microalga Chlamydomonas reinhardtii. The focus is on the regulatory mechanisms induced in response to nutrient deficiency stress and anoxia and especially on the role of a hydrogenase-mediated reaction in adaptation to highly reducing conditions and ATP deficiency in the cell. PMID:25986411

  8. Cell-cycle regulation in green algae dividing by multiple fission.


    Bišová, Kateřina; Zachleder, Vilém


    Green algae dividing by multiple fission comprise unrelated genera but are connected by one common feature: under optimal growth conditions, they can divide into more than two daughter cells. The number of daughter cells, also known as the division number, is relatively stable for most species and usually ranges from 4 to 16. The number of daughter cells is dictated by growth rate and is modulated by light and temperature. Green algae dividing by multiple fission can thus be used to study coordination of growth and progression of the cell cycle. Algal cultures can be synchronized naturally by alternating light/dark periods so that growth occurs in the light and DNA replication(s) and nuclear and cellular division(s) occur in the dark; synchrony in such cultures is almost 100% and can be maintained indefinitely. Moreover, the pattern of cell-cycle progression can be easily altered by differing growth conditions, allowing for detailed studies of coordination between individual cell-cycle events. Since the 1950s, green algae dividing by multiple fission have been studied as a unique model for cell-cycle regulation. Future sequencing of algal genomes will provide additional, high precision tools for physiological, taxonomic, structural, and molecular studies in these organisms.

  9. Heterotrimeric G proteins in green algae: an early innovation in the evolution of the plant lineage.


    Hackenberg, Dieter; Pandey, Sona


    Heterotrimeric G-proteins (G-proteins, hereafter) are important signaling components in all eukaryotes. The absence of these proteins in the sequenced genomes of Chlorophyaceaen green algae has raised questions about their evolutionary origin and prevalence in the plant lineage. The existence of G-proteins has often been correlated with the acquisition of embryophytic life-cycle and/or terrestrial habitats of plants which occurred around 450 million years ago. Our discovery of functional G-proteins in Chara braunii, a representative of the Charophycean green algae, establishes the existence of this conserved signaling pathway in the most basal plants and dates it even further back to 1-1.5 billion years ago. We have now identified the sequence homologs of G-proteins in additional algal families and propose that green algae represent a model system for one of the most basal forms of G-protein signaling known to exist to date. Given the possible differences that exist between plant and metazoan G-protein signaling mechanisms, such basal organisms will serve as important resources to trace the evolutionary origin of proposed mechanistic differences between the systems as well as their plant-specific functions. PMID:24614119

  10. Unique regulation of the Calvin cycle in the ultrasmall green alga Ostreococcus.


    Robbens, Steven; Petersen, Jörn; Brinkmann, Henner; Rouzé, Pierre; Van de Peer, Yves


    Glyceraldehyde-3-phosphate dehydrogenase (GapAB) and CP12 are two major players in controlling the inactivation of the Calvin cycle in land plants at night. GapB originated from a GapA gene duplication and differs from GapA by the presence of a specific C-terminal extension that was recruited from CP12. While GapA and CP12 are assumed to be generally present in the Plantae (glaucophytes, red and green algae, and plants), up to now GapB was exclusively found in Streptophyta, including the enigmatic green alga Mesostigma viride. However, here we show that two closely related prasinophycean green algae, Ostreococcus tauri and Ostreococcus lucimarinus, also possess a GapB gene, while CP12 is missing. This remarkable finding either antedates the GapA/B gene duplication or indicates a lateral recruitment. Moreover, Ostreococcus is the first case where the crucial CP12 function may be completely replaced by GapB-mediated GapA/B aggregation.

  11. Heterotrimeric G proteins in green algae: an early innovation in the evolution of the plant lineage.


    Hackenberg, Dieter; Pandey, Sona


    Heterotrimeric G-proteins (G-proteins, hereafter) are important signaling components in all eukaryotes. The absence of these proteins in the sequenced genomes of Chlorophyaceaen green algae has raised questions about their evolutionary origin and prevalence in the plant lineage. The existence of G-proteins has often been correlated with the acquisition of embryophytic life-cycle and/or terrestrial habitats of plants which occurred around 450 million years ago. Our discovery of functional G-proteins in Chara braunii, a representative of the Charophycean green algae, establishes the existence of this conserved signaling pathway in the most basal plants and dates it even further back to 1-1.5 billion years ago. We have now identified the sequence homologs of G-proteins in additional algal families and propose that green algae represent a model system for one of the most basal forms of G-protein signaling known to exist to date. Given the possible differences that exist between plant and metazoan G-protein signaling mechanisms, such basal organisms will serve as important resources to trace the evolutionary origin of proposed mechanistic differences between the systems as well as their plant-specific functions.

  12. Iron Utilization in Marine Cyanobacteria and Eukaryotic Algae

    PubMed Central

    Morrissey, Joe; Bowler, Chris


    Iron is essential for aerobic organisms. Additionally, photosynthetic organisms must maintain the iron-rich photosynthetic electron transport chain, which likely evolved in the iron-replete Proterozoic ocean. The subsequent rise in oxygen since those times has drastically decreased the levels of bioavailable iron, indicating that adaptations have been made to maintain sufficient cellular iron levels in the midst of scarcity. In combination with physiological studies, the recent sequencing of marine microorganism genomes and transcriptomes has begun to reveal the mechanisms of iron acquisition and utilization that allow marine microalgae to persist in iron limited environments. PMID:22408637

  13. Chemical Structures and Bioactivities of Sulfated Polysaccharides from Marine Algae

    PubMed Central

    Jiao, Guangling; Yu, Guangli; Zhang, Junzeng; Ewart, H. Stephen


    Sulfated polysaccharides and their lower molecular weight oligosaccharide derivatives from marine macroalgae have been shown to possess a variety of biological activities. The present paper will review the recent progress in research on the structural chemistry and the bioactivities of these marine algal biomaterials. In particular, it will provide an update on the structural chemistry of the major sulfated polysaccharides synthesized by seaweeds including the galactans (e.g., agarans and carrageenans), ulvans, and fucans. It will then review the recent findings on the anticoagulant/antithrombotic, antiviral, immuno-inflammatory, antilipidemic and antioxidant activities of sulfated polysaccharides and their potential for therapeutic application. PMID:21566795

  14. The prospect function of terrestrial nitrogen-fixing blue-green algae on the fixation of desert

    NASA Astrophysics Data System (ADS)

    Yang, Yusuo; Lei, Jiaqiang


    The Terrestrial Nitrogen-fixing Blue-green Algae, which are possessed of both photosynthesis and nitrogen fixation, are the leading organisms in the adverse circumstances. With their typical cell structures and physiological abilities, they are strongly resistant to drought, infertility etc. The growth of Terrestrial Nitrogen-fixing Blue-green Algae can rich the soils in nitrogen and organic compounds, which are benefit to other microbes and plants. Terrestrial Nitrogen-fixing Blue-green Algae are widely distributed in Gurbantunggut Desert. It was estimated that about 40% of the surface of the desert are covered by the "Black Crust". "Black Crust" is mainly occupied by Terrestrial Nitrogen-fixing Blue-green Algae. It is Terrestrial Nitrogen-fixing Blue-green Algae that construct the mechanical crust with a little other algae and fungi through biological, chemical and physical actions. So Terrestrial Nitrogen-fixing Blue-green Algae play an important part in desert fixation. It was analyzed that there are three species of the blue-greens in the "Black Crust": Microcoleus vaginatus(Vauch)Gom.,Scytonema ocellatum Lynbye and Schizothrix mella Gardner. We had isolated Microcoleus vaginatus(Vauch)Gom. and Scytonema ocellatum Lynbye. Some tests had been made to prove the feasibility of the desert fixation of the Blue-greens. Under experiment conditions, the blue-greens grown on the surface of sand, covered the sand quickly after the inoculation, and formed a mechanical fixed surface layer (7 days for Microcoleus vaginatus, 15-21 days for Scytonema ocellatum).

  15. The marine algae Sargassum spp. (Sargassaceae) as feed for sheep in tropical and subtropical regions.


    Marín, Alejandro; Casas-Valdez, Margarita; Carrillo, Silvia; Hernández, Hugo; Monroy, Alberto; Sanginés, Leonor; Pérez-Gil, Fernando


    The objective of this study was to evaluate Sargassum meal as feed for sheep through the measures of in vivo digestibility, dry matter degradability, pH, ammonia and volatile fatty acids in rumen. The Sargassum algae used in this experiment were collected at the end of spring, when they are more abundant, bigger, and have completed their reproductive cycle. Four tons (wet weigth) were collected manually from the intertidal zone of La Paz bay, Baja California Sur, Mexico. These algae were sun-dried and ground in a hammer mill to obtain the Sargassum meal. Four fistulated Pelibuey sheep, were fed daily with diets containing the marine algae (MA) at different levels (0, 10, 20 and 30 %), using a 4 x 4 Latin-square design experiment. Feed intake was not affected (p>0.05). Water consumption and urine excretion increased with MA (p<0.05; r2=0.54 and r2=0.74, respectively). In all treatments dry matter digestibility was of 74%-79%, and crude protein digestibility was of 85%-88%. Acid detergent fiber (59%-65%) and neutral detergent fiber (55%-66%) digestibility were greater in all treatments with MA. Ruminal pH was greater in all groups fed with MA (p<0.05). Ammonium concentration was not influenced (p>0.05) by MA. Ruminal volatile fatty acids decreased in all MA groups (p<0.05). The marine algae Sargassum spp. can be used as a feed supplement for sheep, especially in tropical and subtropical regions where these marine algae are available.

  16. Characterization and optimization of hydrogen production by a salt water blue-green alga Oscillatoria sp. Miami BG 7. II - Use of immobilization for enhancement of hydrogen production

    NASA Technical Reports Server (NTRS)

    Phlips, E. J.; Mitsui, A.


    The technique of cellular immobilization was applied to the process of hydrogen photoproduction of nonheterocystous, filamentous marine blue-green alga, Oscillatoria sp. Miami BG 7. Immobilization with agar significantly improved the rate and longevity of hydrogen production, compared to free cell suspensions. Rates of H2 production in excess of 13 microliters H2 mg dry/wt h were observed and hydrogen production was sustained for three weeks. Immobilization also provided some stabilization to environmental variability and was adaptable to outdoor light conditions. In general, immobilization provides significant advantages for the production and maintenance of hydrogen photoproduction for this strain.

  17. Acute toxicity of live and decomposing green alga Ulva ( Enteromorpha) prolifera to abalone Haliotis discus hannai

    NASA Astrophysics Data System (ADS)

    Wang, Chao; Yu, Rencheng; Zhou, Mingjiang


    From 2007 to 2009, large-scale blooms of green algae (the so-called "green tides") occurred every summer in the Yellow Sea, China. In June 2008, huge amounts of floating green algae accumulated along the coast of Qingdao and led to mass mortality of cultured abalone and sea cucumber. However, the mechanism for the mass mortality of cultured animals remains undetermined. This study examined the toxic effects of Ulva ( Enteromorpha) prolifera, the causative species of green tides in the Yellow Sea during the last three years. The acute toxicity of fresh culture medium and decomposing algal effluent of U. prolifera to the cultured abalone Haliotis discus hannai were tested. It was found that both fresh culture medium and decomposing algal effluent had toxic effects to abalone, and decomposing algal effluent was more toxic than fresh culture medium. The acute toxicity of decomposing algal effluent could be attributed to the ammonia and sulfide presented in the effluent, as well as the hypoxia caused by the decomposition process.

  18. Antioxidant marine algae phlorotannins and radioprotection: a review of experimental evidence.


    Shin, Taekyun; Ahn, Meejung; Hyun, Jin Won; Kim, Sung Ho; Moon, Changjong


    Radiation has been widely used for cancer therapy in human medicine. However, the side effects of radiation are problematic and can limit its application. Radiation generates reactive oxygen species, leading to cell death via multiple signaling pathways. The blocking of certain signaling cascades using antioxidants represents a compensatory therapy of radiation-induced tissue injury. Although synthetic chemicals have been investigated in recent decades, anti-oxidants from natural resources have been searched for continuously. Among them, phlorotannins from marine algae, including Ecklonia cava, have been shown to protect cells from radiation-induced injury as well as oxidative stress. In the present review, the radioprotective capacity of phlorotannins derived from marine algae and the mechanisms involved are discussed.

  19. Antibacterial Derivatives of Marine Algae: An Overview of Pharmacological Mechanisms and Applications

    PubMed Central

    Shannon, Emer; Abu-Ghannam, Nissreen


    The marine environment is home to a taxonomically diverse ecosystem. Organisms such as algae, molluscs, sponges, corals, and tunicates have evolved to survive the high concentrations of infectious and surface-fouling bacteria that are indigenous to ocean waters. Both macroalgae (seaweeds) and microalgae (diatoms) contain pharmacologically active compounds such as phlorotannins, fatty acids, polysaccharides, peptides, and terpenes which combat bacterial invasion. The resistance of pathogenic bacteria to existing antibiotics has become a global epidemic. Marine algae derivatives have shown promise as candidates in novel, antibacterial drug discovery. The efficacy of these compounds, their mechanism of action, applications as antibiotics, disinfectants, and inhibitors of foodborne pathogenic and spoilage bacteria are reviewed in this article. PMID:27110798

  20. Antibacterial Derivatives of Marine Algae: An Overview of Pharmacological Mechanisms and Applications.


    Shannon, Emer; Abu-Ghannam, Nissreen


    The marine environment is home to a taxonomically diverse ecosystem. Organisms such as algae, molluscs, sponges, corals, and tunicates have evolved to survive the high concentrations of infectious and surface-fouling bacteria that are indigenous to ocean waters. Both macroalgae (seaweeds) and microalgae (diatoms) contain pharmacologically active compounds such as phlorotannins, fatty acids, polysaccharides, peptides, and terpenes which combat bacterial invasion. The resistance of pathogenic bacteria to existing antibiotics has become a global epidemic. Marine algae derivatives have shown promise as candidates in novel, antibacterial drug discovery. The efficacy of these compounds, their mechanism of action, applications as antibiotics, disinfectants, and inhibitors of foodborne pathogenic and spoilage bacteria are reviewed in this article. PMID:27110798

  1. Sedimentary 12-n-Propylcholestanes, Molecular Fossils Diagnostic of Marine Algae.


    Moldowan, J M; Fago, F J; Lee, C Y; Jacobson, S R; Watt, D S; Slougui, N E; Jeganathan, A; Young, D C


    Certain C(30)-steranes have been used for identifying sedimentary rocks and crude oils derived from organic matter deposited in marine environments. Analysis of a C(30)-sterane from Prudhoe Bay oil indicates that these C(30)-steranes are 24-n-propylcholestanes that apparently are derived from precursor sterols 24-n-propylidene-cholesterols and 24-n-propylcholesterol. These widely occurring sterols are biochemically synthesized in modern oceans by members of an order (Sarcinochrysidales) of chrysophyte algae. These data thus imply that C(30)-sterane biomarkers in sedimentary rocks and crude oils have a marine origin. Screening of a few organic-rich sedimentary rocks and oils from throughout the Phanerozoic suggests that these C(30)-steranes first appeared and, therefore, their source algae evolved between Early Ordovician and Devonian.

  2. Development of a UV laser-induced fluorescence lidar for monitoring blue-green algae in Lake Suwa.


    Saito, Yasunori; Takano, Kengo; Kobayashi, Fumitoshi; Kobayashi, Kazuki; Park, Ho-Dong


    We developed a UV (355 nm) laser-induced fluorescence (LIF) lidar for monitoring the real-time status of blue-green algae. Since the fluorescence spectrum of blue-green algae excited by 355 nm showed the specific fluorescence at 650 nm, the lidar was designed to be able to detect the 650 nm fluorescence as a surveillance method for the algae. The usefulness was confirmed by observation at Lake Suwa over four years (2005-2008). The detection limit of the LIF lidar was 16.65 mg/L for the blue-green algae, which is the range of concentrations in the safe level set by the World Health Organization.

  3. A cryptic intracellular green alga in Ginkgo biloba: ribosomal DNA markers reveal worldwide distribution.


    Trémouillaux-Guiller, Jocelyne; Huss, Volker A R


    Intracellular symbioses involving eukaryotic microalgae and a variety of heterotrophic protists and invertebrates are widespread, but are unknown in higher plants. Recently, we reported the isolation and molecular identification of a Coccomyxa-like green alga from in vitro cell cultures of Ginkgo biloba L. This alga resides intracellularly in an immature "precursor" form with a nonfunctional chloroplast, implying that algal photosynthetic activity has no role in this endosymbiosis. In necrotizing Ginkgo cells, precursors evolved into mature algae, proliferated, and were liberated into the culture medium after host cell bursting. In the present paper we demonstrate by molecular methods a worldwide distribution of the alga in planta. Endosymbiont-specific sequences of ribosomal DNA could be traced in Ginkgo tissues of each specimen examined from different geographic locations in Europe, North America, and Asia. The Ginkgo/Coccomyca association represents a new kind of intracellular, vertically inherited symbiosis. Storage bodies, probably of lipid nature, present in the cytoplasm of each partner suggest a possible involvement of the endosymbiont in metabolic pathways of its host.

  4. The effect of natural organic matter on bioaccumulation and toxicity of chlorobenzenes to green algae.


    Zhang, Shuai; Lin, Daohui; Wu, Fengchang


    The effect of natural organic matter (NOM) on toxicity and bioavailability of hydrophobic organic contaminants (HOCs) to aquatic organisms has been investigated with conflicting results and undefined mechanisms, and few studies have been conducted on volatile HOCs. In this study, six volatile chlorobenzenes (CBs) with 1-6 chlorine substitutions were investigated for their bioaccumulation in an acute toxicity to a green alga (Chlorella pyrenoidosa) in the presence/absence of Suwannee River NOM (SRNOM). The fluorescence quenching efficiency of SRNOM increased as the number of chlorine substitutions of CBs increased. SRNOM increased the cell-surface hydrophobicity of algae and decreased the release rates of algae-accumulated CBs, thus increasing the concentration factor (CF) and accumulation of the CBs in the algae. SRNOM increased the toxicity of monochlorobenzene and 1,2-dichlorobenzene, decreased the toxicity of pentachlorobenzene and hexachlorobenzene, and had no significant effect on the toxicity of 1,2,3-trichlorobenzene and 1,2,3,4-tetrachlorobenzene. Relationships between the 96 h CF/IC50 (i.e., the CB concentration leading to a 50% algal growth reduction compared with the control) and physicochemical properties of CBs with/without SRNOM were established, providing reasonable explanations for the experimental results. These findings will help with the accurate assessment of ecological risks of organic pollutants in the presence of NOM.

  5. In vitro anti-HMPV activity of meroditerpenoids from marine alga Stypopodium zonale (Dictyotales).


    Mendes, Gabriella; Soares, Angélica Ribeiro; Sigiliano, Lorena; Machado, Fernanda; Kaiser, Carlos; Romeiro, Nelilma; Gestinari, Lísia; Santos, Norma; Romanos, Maria Teresa Villela


    In this paper, we evaluated the antiviral activity against HMPV replication of crude extract of the marine algae Stypopodium zonale and of two meroditerpenoids obtained from it, atomaric acid and epitaondiol, and a methyl ester derivative of atomaric acid. Their selectivity indexes were 20.78, >56.81, 49.26 and 12.82, respectively. Compared to ribavirin, the substances showed a relatively low cytotoxicity on LLC-MK2 cells, with a significant antiviral activity, inhibiting at least 90% of viral replication in vitro, which demonstrates the potential of these marine natural products to combat infections caused by HMPV in vitro. PMID:21986522

  6. Dereplication and Chemotaxonomical Studies of Marine Algae of the Ochrophyta and Rhodophyta Phyla

    PubMed Central

    Brkljača, Robert; Gӧker, Emrehan Semih; Urban, Sylvia


    Dereplication and chemotaxonomic studies of six marine algae of the Ochrophyta and one of the Rhodophyta phyla resulted in the detection of 22 separate compounds. All 16 secondary metabolites, including four new compounds (16–19), could be rapidly dereplicated using HPLC-NMR and HPLC-MS methodologies in conjunction with the MarinLit database. This study highlights the advantages of using NMR data (acquired via HPLC-NMR) for database searching and for the overall dereplication of natural products. PMID:25942092

  7. Conventional and Unconventional Antimicrobials from Fish, Marine Invertebrates and Micro-algae

    PubMed Central

    Smith, Valerie J.; Desbois, Andrew P.; Dyrynda, Elisabeth A.


    All eukaryotic organisms, single-celled or multi-cellular, produce a diverse array of natural anti-infective agents that, in addition to conventional antimicrobial peptides, also include proteins and other molecules often not regarded as part of the innate defences. Examples range from histones, fatty acids, and other structural components of cells to pigments and regulatory proteins. These probably represent very ancient defence factors that have been re-used in new ways during evolution. This review discusses the nature, biological role in host protection and potential biotechnological uses of some of these compounds, focusing on those from fish, marine invertebrates and marine micro-algae. PMID:20479976

  8. Conventional and unconventional antimicrobials from fish, marine invertebrates and micro-algae.


    Smith, Valerie J; Desbois, Andrew P; Dyrynda, Elisabeth A


    All eukaryotic organisms, single-celled or multi-cellular, produce a diverse array of natural anti-infective agents that, in addition to conventional antimicrobial peptides, also include proteins and other molecules often not regarded as part of the innate defences. Examples range from histones, fatty acids, and other structural components of cells to pigments and regulatory proteins. These probably represent very ancient defence factors that have been re-used in new ways during evolution. This review discusses the nature, biological role in host protection and potential biotechnological uses of some of these compounds, focusing on those from fish, marine invertebrates and marine micro-algae.

  9. Identification of phytochelatins in the cadmium-stressed conjugating green alga Micrasterias denticulata.


    Volland, Stefanie; Schaumlöffel, Dirk; Dobritzsch, Dirk; Krauss, Gerd-Joachim; Lütz-Meindl, Ursula


    Aquatic environments like peat bogs are affected by anthropogenic metal input into the environment. These ecosystems are inhabited by unicellular green algae of the class Zygnematophyceae. In this study the desmid Micrasterias denticulata was stressed with 600 nM Cd, 10 μM Cr and 300 nM Cu for 3 weeks. GSH levels were measured with HPLC and did not differ between the different treatments or the control. According to the metallo-thiolomics concept, mass spectrometry was used as a method for unambiguous thiol peptide identification. PC2, PC3 and PC4 were clearly identified in the Cd stressed sample with UPLC-MS by their MS spectrum and molecular masses. PC2 and PC3 were determined to be the main thiol compounds, while PC4 was only abundant in traces in Micrasterias. In addition, the identity of PC2 and PC3 was confirmed by MS/MS. No PCs were detected in the Cu stressed algae sample. However, in the Cr stressed sample traces of PC2 were indicated by a peak in UPLC-MS at the retention time of the PC2 standard, but the intensity was too low to acquire reliable MS and MS/MS spectra. In this study PCs have been detected for the first time in a green alga of the division Streptophyta, a close relative to higher plants. PMID:23266414

  10. Effect of endocrine disrupters on photosystem II energy fluxes of green algae and cyanobacteria.


    Perron, Marie-Claude; Juneau, Philippe


    Among the numerous toxics found in the aquatic environment, endocrine disrupters can interfere with the normal functioning of the endocrine system of several organisms, leading to important consequences. Even if algae and cyanobacteria are non-target organisms without endocrine system, our goals were to verify if endocrine disrupters can affect photosynthetic activity and how energy flows through photosystem II (PSII) were altered. To reach these objectives, we exposed, for 15 min, two green algae (Chlamydomonas reinhardtii strain CC125, Pseudokirchneriella subcapitata strain CPCC37) and a toxic and a non-toxic strain of Microcystis aeruginosa (CPCC299 and CPCC632 respectively) to 4-octylphenol, 4-nonylphenol and β-estradiol at concentrations ranging from 0.1 to 5 μg/mL. We have shown for the first time that endocrine disrupters may have drastic effects on PSII energy fluxes. Furthermore, we showed that various species have different sensitivity to endocrine disrupters. P. subcapitata was tolerant to each endocrine disrupter tested, while flows of energy through PSII were affected similarly, but at different extent, for the other species. Cyanobacterial PSII energy fluxes were more affected than green algae, suggesting that the prokaryotic characteristics of these organisms are responsible of their high sensitivity.

  11. Identification of phytochelatins in the cadmium-stressed conjugating green alga Micrasterias denticulata.


    Volland, Stefanie; Schaumlöffel, Dirk; Dobritzsch, Dirk; Krauss, Gerd-Joachim; Lütz-Meindl, Ursula


    Aquatic environments like peat bogs are affected by anthropogenic metal input into the environment. These ecosystems are inhabited by unicellular green algae of the class Zygnematophyceae. In this study the desmid Micrasterias denticulata was stressed with 600 nM Cd, 10 μM Cr and 300 nM Cu for 3 weeks. GSH levels were measured with HPLC and did not differ between the different treatments or the control. According to the metallo-thiolomics concept, mass spectrometry was used as a method for unambiguous thiol peptide identification. PC2, PC3 and PC4 were clearly identified in the Cd stressed sample with UPLC-MS by their MS spectrum and molecular masses. PC2 and PC3 were determined to be the main thiol compounds, while PC4 was only abundant in traces in Micrasterias. In addition, the identity of PC2 and PC3 was confirmed by MS/MS. No PCs were detected in the Cu stressed algae sample. However, in the Cr stressed sample traces of PC2 were indicated by a peak in UPLC-MS at the retention time of the PC2 standard, but the intensity was too low to acquire reliable MS and MS/MS spectra. In this study PCs have been detected for the first time in a green alga of the division Streptophyta, a close relative to higher plants.

  12. Genomic analysis of organismal complexity in the multicellular green alga Volvox carteri

    SciTech Connect

    Prochnik, Simon E.; Umen, James; Nedelcu, Aurora; Hallmann, Armin; Miller, Stephen M.; Nishii, Ichiro; Ferris, Patrick; Kuo, Alan; Mitros, Therese; Fritz-Laylin, Lillian K.; Hellsten, Uffe; Chapman, Jarrod; Simakov, Oleg; Rensing, Stefan A.; Terry, Astrid; Pangilinan, Jasmyn; Kapitonov, Vladimir; Jurka, Jerzy; Salamov, Asaf; Shapiro, Harris; Schmutz, Jeremy; Grimwood, Jane; Lindquist, Erika; Lucas, Susan; Grigoriev, Igor V.; Schmitt, Rudiger; Kirk, David; Rokhsar, Daniel S.


    Analysis of the Volvox carteri genome reveals that this green alga's increased organismal complexity and multicellularity are associated with modifications in protein families shared with its unicellular ancestor, and not with large-scale innovations in protein coding capacity. The multicellular green alga Volvox carteri and its morphologically diverse close relatives (the volvocine algae) are uniquely suited for investigating the evolution of multicellularity and development. We sequenced the 138 Mb genome of V. carteri and compared its {approx}14,500 predicted proteins to those of its unicellular relative, Chlamydomonas reinhardtii. Despite fundamental differences in organismal complexity and life history, the two species have similar protein-coding potentials, and few species-specific protein-coding gene predictions. Interestingly, volvocine algal-specific proteins are enriched in Volvox, including those associated with an expanded and highly compartmentalized extracellular matrix. Our analysis shows that increases in organismal complexity can be associated with modifications of lineage-specific proteins rather than large-scale invention of protein-coding capacity.

  13. Evaluation of antigenotoxic effects of carotenoids from green algae Chlorococcum humicola using human lymphocytes

    PubMed Central

    Bhagavathy, S; Sumathi, P


    Objective To identify the available phytochemicals and carotenoids in the selected green algae and evaluate the potential genotoxic/antigenotoxic effect using lymphocytes. Methods Organic solvent extracts of Chlorococcum humicola (C. humicola) were used for the phytochemical analysis. The available carotenoids were assessed by HPLC, and LC-MS analysis. The genotoxicity was induced by the benzo(a)pyrene in the lymphocyte culture, the genotoxic and antigenotoxic effects of algal carotenoids with and without genotoxic inducer were evaluated by chromosomal aberration (CA), sister chromatid exchange (SCE) and micronucleus assay (MN). Results The results of the analysis showed that the algae were rich in carotenoids and fatty acids. In the total carotenoids lutein, β-carotene and α-carotene were found to be present in higher concentration. The frequency of CA and SCE increased by benzo(a)pyrene were significantly decreased by the carotenoids (P<0.05 for CA, P<0.001 for SCE). The MN frequencies of the cells were significantly decreased by the treatment with carotenoids when compared with the positive controls (P<0.05). Conclusions The findings of the present study demonstrate that, the green algae C. humicola is a rich source of bioactive compounds especially carotenoids which effectively fight against environmental genotoxic agents, the carotenoids itself is not a genotoxic substance and should be further considered for its beneficial effects. PMID:23569879

  14. Flagellar apparatus absolute orientations and the phylogeny of the green algae.


    O'Kelly, C J; Floyd, G L

    The absolute orientation of the flagellar apparatus in green algal motile cells is a feature of considerable value in studies of green algal systematics and phylogeny. The absolute orientation patterns found in those algae for which this feature is known or can be deduced are reviewed. Counterclockwise absolute orientation occurs in all classes except the Chlorophyceae and is considered primitive, while the clockwise absolute orientation present in most members of the Chlorophyceae is the result of progressive clockwise rotation of components during evolution. Extant intermediates documenting this rotation include Hafniomonas vegetative cells, which show counterclockwise absolute orientation, and Chaetopeltis quadriflagellate zoospores, in which the flagellar apparatus is strictly cruciate except for a slight clockwise offset of the microtubular rootlets. The V-shaped arrangement of the basal bodies in the flagellar apparatus, as well as the presence of proximal sheaths and of two layers of scales on the cell body, further identifies the Chaetopeltis zoospore as a primitive cell type within the Chlorophyceae . Trends towards the exsertion of basal bodies from a flagellar pit, either apically or laterally, the elimination of quadriflagellate cells, and, in the Chlorophyceae , an increasing amount of basal body offset, indicate advancement within the classes. Absolute orientation is conserved during flagellar apparatus replication and development. Events after flagellar apparatus division in the algae studied may be subdivided into component assembly, which is universal and preserves phylogenetically-useful features, and component reorientation, which occurs in relatively few green algae and adapts the flagellar apparatus to specialized functions. From these flagellar apparatus orientation studies, a major reevaluation of evolution within the Chlorophyceae is proposed, with weakly- thalloid algae possessing desmoschisis (e.g. Chaetopeltis ) considered primitive, and

  15. Agrobacterium-mediated transformation of promising oil-bearing marine algae Parachlorella kessleri.


    Rathod, Jayant Pralhad; Prakash, Gunjan; Pandit, Reena; Lali, Arvind M


    Parachlorella kessleri is a unicellular alga which grows in fresh as well as marine water and is commercially important as biomass/lipid feedstock and in bioremediation. The present study describes the successful transformation of marine P. kessleri with the help of Agrobacterium tumefaciens. Transformed marine P. kessleri was able to tolerate more than 10 mg l(-1) hygromycin concentration. Co-cultivation conditions were modulated to allow the simultaneous growth of both marine P. kessleri and A. tumefaciens. For co-cultivation, P. kessleri was shifted from Walne's to tris acetate phosphate medium to reduce the antibiotic requirement during selection. In the present study, the transfer of T-DNA was successful without using acetosyringone. Biochemical and genetic analyses were performed for expression of transgenes by GUS assay and PCR in transformants. Establishment of this protocol would be useful in further genetic modification of oil-bearing Parachlorella species.

  16. Mechanisms Influencing the Spread of a Native Marine Alga

    PubMed Central

    Zhang, Dilys; Glasby, Tim M.; Ralph, Peter J.; Gribben, Paul E.


    Like invasive macrophytes, some native macrophytes are spreading rapidly with consequences for community structure. There is evidence that the native alga Caulerpa filiformis is spreading along intertidal rocky shores in New South Wales, Australia, seemingly at the expense of native Sargassum spp. We experimentally investigated the role physical disturbance plays in the spread of C. filiformis and its possible consequences for Sargassum spp. Cleared patches within beds of C. filiformis (Caulerpa habitat) or Sargassum spp. (Sargassum habitat) at multiple sites showed that C. filiformis had significantly higher recruitment (via propagules) into its own habitat. The recruitment of Sargassum spp. to Caulerpa habitat was rare, possibly due in part to sediment accretion within Caulerpa habitat. Diversity of newly recruited epibiotic assemblages within Caulerpa habitat was significantly less than in Sargassum habitat. In addition, more C. filiformis than Sargassum spp. recruited to Sargassum habitat at some sites. On common boundaries between these two macroalgae, the vegetative growth of adjacent C. filiformis into cleared patches was significantly higher than for adjacent Sargassum spp. In both experiments, results were largely independent of the size of disturbance (clearing). Lastly, we used PAM fluorometry to show that the photosynthetic condition of Sargassum spp. fronds adjacent to C. filiformis was generally suppressed relative to those distant from C. filiformis. Thus, physical disturbance, combined with invasive traits (e.g. high levels of recruitment and vegetative growth) most likely facilitate the spread of C. filiformis, with the ramifications being lower epibiotic diversity and possibly reduced photosynthetic condition of co-occurring native macrophytes. PMID:24722520

  17. Growth of the green algae Chlamydomonas reinhardtii under red and blue lasers

    NASA Astrophysics Data System (ADS)

    Kuwahara, Sara S.; Cuello, Joel L.; Myhre, Graham; Pau, Stanley


    Red and blue lasers, holding promise as an electric light source for photosynthetic systems on account of being true monochromatic, high-power, and having high electrical-conversion efficiency, were employed in growing a green alga, Chlamydomonas reinhardtii. The laser treatments tested included: 655-nm Red; 680-nm Red; 655-nm Red+474-nm Blue and 680-nm Red+474-nm Blue. A white cold cathode lamp with spectral output similar to that of white fluorescent lamp served as control. C. reinhardtii successfully grew and divided under the 655 and 680-nm red lasers as well as under the white-light control. Supplementing either red with blue laser, however, resulted in increased algae cell count that significantly exceeded those under both red lasers and the white-light control on average by 241%.

  18. Genomic analysis of organismal complexity in the multicellular green alga Volvox carteri.


    Prochnik, Simon E; Umen, James; Nedelcu, Aurora M; Hallmann, Armin; Miller, Stephen M; Nishii, Ichiro; Ferris, Patrick; Kuo, Alan; Mitros, Therese; Fritz-Laylin, Lillian K; Hellsten, Uffe; Chapman, Jarrod; Simakov, Oleg; Rensing, Stefan A; Terry, Astrid; Pangilinan, Jasmyn; Kapitonov, Vladimir; Jurka, Jerzy; Salamov, Asaf; Shapiro, Harris; Schmutz, Jeremy; Grimwood, Jane; Lindquist, Erika; Lucas, Susan; Grigoriev, Igor V; Schmitt, Rüdiger; Kirk, David; Rokhsar, Daniel S


    The multicellular green alga Volvox carteri and its morphologically diverse close relatives (the volvocine algae) are well suited for the investigation of the evolution of multicellularity and development. We sequenced the 138-mega-base pair genome of V. carteri and compared its approximately 14,500 predicted proteins to those of its unicellular relative Chlamydomonas reinhardtii. Despite fundamental differences in organismal complexity and life history, the two species have similar protein-coding potentials and few species-specific protein-coding gene predictions. Volvox is enriched in volvocine-algal-specific proteins, including those associated with an expanded and highly compartmentalized extracellular matrix. Our analysis shows that increases in organismal complexity can be associated with modifications of lineage-specific proteins rather than large-scale invention of protein-coding capacity. PMID:20616280

  19. Organelle genome complexity scales positively with organism size in volvocine green algae.


    Smith, David Roy; Hamaji, Takashi; Olson, Bradley J S C; Durand, Pierre M; Ferris, Patrick; Michod, Richard E; Featherston, Jonathan; Nozaki, Hisayoshi; Keeling, Patrick J


    It has been argued that for certain lineages, noncoding DNA expansion is a consequence of the increased random genetic drift associated with long-term escalations in organism size. But a lack of data has prevented the investigation of this hypothesis in most plastid-bearing protists. Here, using newly sequenced mitochondrial and plastid genomes, we explore the relationship between organelle DNA noncoding content and organism size within volvocine green algae. By looking at unicellular, colonial, and differentiated multicellular algae, we show that organelle DNA complexity scales positively with species size and cell number across the volvocine lineage. Moreover, silent-site genetic diversity data suggest that the volvocine species with the largest cell numbers and most bloated organelle genomes have the smallest effective population sizes. Together, these findings support the view that nonadaptive processes, like random genetic drift, promote the expansion of noncoding regions in organelle genomes.

  20. DNA barcoding of a new record of epi-endophytic green algae Ulvella leptochaete (Ulvellaceae, Chlorophyta) in India.


    Bast, Felix; Bhushan, Satej; John, Aijaz Ahmad


    Epi-endophytic green algae comprise one of the most diverse and phylogenetically primitive groups of green algae and are considered to be ubiquitous in the world's oceans; however, no reports of these algae exist from India. Here we report the serendipitous discovery of Ulvella growing on intertidal green algae Cladophora glomerata and benthic red algae Laurencia obtusa collected from India. DNA barcodes at nuclear ribosomal DNA Internal Transcriber Spacer (nrDNA ITS) 1 and 2 regions for Indian isolates from the west and east coasts have been generated for the first time. Based on morphology and DNA barcoding, isolates were identified as Ulvella leptochaete. Phylogenetic reconstruction of concatenated dataset using Maximum Likelihood method differentiated Indian isolates from other accessions of this alga available in Genbank, albeit with low bootstrap support. Monophyly of Ulvella leptochaete was obvious in both of our phylogenetic analyses. With this first report of epi-endophytic algae from Indian territorial waters, the dire need to catalogue its cryptic diversity is highlighted and avenues of future research are discussed.

  1. A lack of parasitic reduction in the obligate parasitic green alga Helicosporidium.


    Pombert, Jean-François; Blouin, Nicolas Achille; Lane, Chris; Boucias, Drion; Keeling, Patrick J


    The evolution of an obligate parasitic lifestyle is often associated with genomic reduction, in particular with the loss of functions associated with increasing host-dependence. This is evident in many parasites, but perhaps the most extreme transitions are from free-living autotrophic algae to obligate parasites. The best-known examples of this are the apicomplexans such as Plasmodium, which evolved from algae with red secondary plastids. However, an analogous transition also took place independently in the Helicosporidia, where an obligate parasite of animals with an intracellular infection mechanism evolved from algae with green primary plastids. We characterised the nuclear genome of Helicosporidium to compare its transition to parasitism with that of apicomplexans. The Helicosporidium genome is small and compact, even by comparison with the relatively small genomes of the closely related green algae Chlorella and Coccomyxa, but at the functional level we find almost no evidence for reduction. Nearly all ancestral metabolic functions are retained, with the single major exception of photosynthesis, and even here reduction is not complete. The great majority of genes for light-harvesting complexes, photosystems, and pigment biosynthesis have been lost, but those for other photosynthesis-related functions, such as Calvin cycle, are retained. Rather than loss of whole function categories, the predominant reductive force in the Helicosporidium genome is a contraction of gene family complexity, but even here most losses affect families associated with genome maintenance and expression, not functions associated with host-dependence. Other gene families appear to have expanded in response to parasitism, in particular chitinases, including those predicted to digest the chitinous barriers of the insect host or remodel the cell wall of Helicosporidium. Overall, the Helicosporidium genome presents a fascinating picture of the early stages of a transition from free

  2. A Lack of Parasitic Reduction in the Obligate Parasitic Green Alga Helicosporidium

    PubMed Central

    Pombert, Jean-François; Blouin, Nicolas Achille; Lane, Chris; Boucias, Drion; Keeling, Patrick J.


    The evolution of an obligate parasitic lifestyle is often associated with genomic reduction, in particular with the loss of functions associated with increasing host-dependence. This is evident in many parasites, but perhaps the most extreme transitions are from free-living autotrophic algae to obligate parasites. The best-known examples of this are the apicomplexans such as Plasmodium, which evolved from algae with red secondary plastids. However, an analogous transition also took place independently in the Helicosporidia, where an obligate parasite of animals with an intracellular infection mechanism evolved from algae with green primary plastids. We characterised the nuclear genome of Helicosporidium to compare its transition to parasitism with that of apicomplexans. The Helicosporidium genome is small and compact, even by comparison with the relatively small genomes of the closely related green algae Chlorella and Coccomyxa, but at the functional level we find almost no evidence for reduction. Nearly all ancestral metabolic functions are retained, with the single major exception of photosynthesis, and even here reduction is not complete. The great majority of genes for light-harvesting complexes, photosystems, and pigment biosynthesis have been lost, but those for other photosynthesis-related functions, such as Calvin cycle, are retained. Rather than loss of whole function categories, the predominant reductive force in the Helicosporidium genome is a contraction of gene family complexity, but even here most losses affect families associated with genome maintenance and expression, not functions associated with host-dependence. Other gene families appear to have expanded in response to parasitism, in particular chitinases, including those predicted to digest the chitinous barriers of the insect host or remodel the cell wall of Helicosporidium. Overall, the Helicosporidium genome presents a fascinating picture of the early stages of a transition from free

  3. The first symbiont-free genome sequence of marine red alga, Susabi-nori (Pyropia yezoensis).


    Nakamura, Yoji; Sasaki, Naobumi; Kobayashi, Masahiro; Ojima, Nobuhiko; Yasuike, Motoshige; Shigenobu, Yuya; Satomi, Masataka; Fukuma, Yoshiya; Shiwaku, Koji; Tsujimoto, Atsumi; Kobayashi, Takanori; Nakayama, Ichiro; Ito, Fuminari; Nakajima, Kazuhiro; Sano, Motohiko; Wada, Tokio; Kuhara, Satoru; Inouye, Kiyoshi; Gojobori, Takashi; Ikeo, Kazuho


    Nori, a marine red alga, is one of the most profitable mariculture crops in the world. However, the biological properties of this macroalga are poorly understood at the molecular level. In this study, we determined the draft genome sequence of susabi-nori (Pyropia yezoensis) using next-generation sequencing platforms. For sequencing, thalli of P. yezoensis were washed to remove bacteria attached on the cell surface and enzymatically prepared as purified protoplasts. The assembled contig size of the P. yezoensis nuclear genome was approximately 43 megabases (Mb), which is an order of magnitude smaller than the previously estimated genome size. A total of 10,327 gene models were predicted and about 60% of the genes validated lack introns and the other genes have shorter introns compared to large-genome algae, which is consistent with the compact size of the P. yezoensis genome. A sequence homology search showed that 3,611 genes (35%) are functionally unknown and only 2,069 gene groups are in common with those of the unicellular red alga, Cyanidioschyzon merolae. As color trait determinants of red algae, light-harvesting genes involved in the phycobilisome were predicted from the P. yezoensis nuclear genome. In particular, we found a second homolog of phycobilisome-degradation gene, which is usually chloroplast-encoded, possibly providing a novel target for color fading of susabi-nori in aquaculture. These findings shed light on unexplained features of macroalgal genes and genomes, and suggest that the genome of P. yezoensis is a promising model genome of marine red algae.

  4. Common Ancestry Is a Poor Predictor of Competitive Traits in Freshwater Green Algae.


    Narwani, Anita; Alexandrou, Markos A; Herrin, James; Vouaux, Alaina; Zhou, Charles; Oakley, Todd H; Cardinale, Bradley J


    Phytoplankton species traits have been used to successfully predict the outcome of competition, but these traits are notoriously laborious to measure. If these traits display a phylogenetic signal, phylogenetic distance (PD) can be used as a proxy for trait variation. We provide the first investigation of the degree of phylogenetic signal in traits related to competition in freshwater green phytoplankton. We measured 17 traits related to competition and tested whether they displayed a phylogenetic signal across a molecular phylogeny of 59 species of green algae. We also assessed the fit of five models of trait evolution to trait variation across the phylogeny. There was no significant phylogenetic signal for 13 out of 17 ecological traits. For 7 traits, a non-phylogenetic model provided the best fit. For another 7 traits, a phylogenetic model was selected, but parameter values indicated that trait variation evolved recently, diminishing the importance of common ancestry. This study suggests that traits related to competition in freshwater green algae are not generally well-predicted by patterns of common ancestry. We discuss the mechanisms by which the link between phylogenetic distance and phenotypic differentiation may be broken. PMID:26348482

  5. Photosynthetic biomanufacturing in green algae; production of recombinant proteins for industrial, nutritional, and medical uses.


    Rasala, Beth A; Mayfield, Stephen P


    Recombinant proteins are widely used for industrial, nutritional, and medical applications. Green microalgae have attracted considerable attention recently as a biomanufacturing platform for the production of recombinant proteins for a number of reasons. These photosynthetic eukaryotic microorganisms are safe, scalable, easy to genetically modify through transformation, mutagenesis, or breeding, and inexpensive to grow. Many microalgae species are genetically transformable, but the green alga Chlamydomonas reinhardtii is the most widely used host for recombinant protein expression. An extensive suite of molecular genetic tools has been developed for C. reinhardtii over the last 25 years, including a fully sequenced genome, well-established methods for transformation, mutagenesis and breeding, and transformation vectors for high levels of recombinant protein accumulation and secretion. Here, we review recent successes in the development of C. reinhardtii as a biomanufacturing host for recombinant proteins, including antibodies and immunotoxins, hormones, industrial enzymes, an orally-active colostral protein for gastrointestinal health, and subunit vaccines. In addition, we review the biomanufacturing potential of other green algae from the genera Dunaliella and Chlorella.

  6. Common Ancestry Is a Poor Predictor of Competitive Traits in Freshwater Green Algae

    PubMed Central

    Narwani, Anita; Alexandrou, Markos A.; Herrin, James; Vouaux, Alaina; Zhou, Charles; Oakley, Todd H.; Cardinale, Bradley J.


    Phytoplankton species traits have been used to successfully predict the outcome of competition, but these traits are notoriously laborious to measure. If these traits display a phylogenetic signal, phylogenetic distance (PD) can be used as a proxy for trait variation. We provide the first investigation of the degree of phylogenetic signal in traits related to competition in freshwater green phytoplankton. We measured 17 traits related to competition and tested whether they displayed a phylogenetic signal across a molecular phylogeny of 59 species of green algae. We also assessed the fit of five models of trait evolution to trait variation across the phylogeny. There was no significant phylogenetic signal for 13 out of 17 ecological traits. For 7 traits, a non-phylogenetic model provided the best fit. For another 7 traits, a phylogenetic model was selected, but parameter values indicated that trait variation evolved recently, diminishing the importance of common ancestry. This study suggests that traits related to competition in freshwater green algae are not generally well-predicted by patterns of common ancestry. We discuss the mechanisms by which the link between phylogenetic distance and phenotypic differentiation may be broken. PMID:26348482

  7. The identification of putative RNA polymerase II C-terminal domain associated proteins in red and green algae.


    Yang, Chunlin; Hager, Paul W; Stiller, John W


    A tandemly repeated C-terminal domain (CTD) of the largest subunit of RNA polymerase II is functionally essential and strongly conserved in many organisms, including animal, yeast and plant models. Although present in simple, ancestral red algae, CTD tandem repeats have undergone extensive modifications and degeneration during the evolutionary transition to developmentally complex rhodophytes. In contrast, CTD repeats are conserved in both green algae and their more complex land plant relatives. Understanding the mechanistic differences that underlie these variant patterns of CTD evolution requires knowledge of CTD-associated proteins in these 2 lineages. To provide an initial baseline comparison, we bound potential phospho-CTD associated proteins (PCAPs) to artificially synthesized and phosphorylated CTD repeats from the unicellular red alga Cyanidioschyzon merolae and green alga Chlamydomonas reinhardtii. Our results indicate that red and green algae share a number of PCAPs, including kinases and proteins involved in mRNA export. There also are important taxon-specific differences, including mRNA splicing-related PCAPs recovered from Chlamydomonas but not Cyanidioschyzon, consistent with the relative intron densities in green and red algae. Our results also offer the first experimental indication that different proteins bind 2 distinct types of repeats in Cyanidioschyzon, suggesting a division of function between the proximal and distal CTD, similar to patterns identified in more developmentally complex model organisms.

  8. Recovery of photosynthesis and growth rate in green, blue-green, and diatom algae after exposure to atrazine.


    Brain, Richard A; Arnie, Joshua R; Porch, John R; Hosmer, Alan J


    We evaluated the recovery of photosynthesis and growth rate in green (Pseudokirchneriella subcapitata), blue-green (Anabaena flos-aquae), and diatom (Navicula pelliculosa) algae after pulsed exposure to atrazine. Subsequent to a grow-up period of 24 to 72 h to establish requisite cell density for adequate signal strength to measure photosystem II (PSII) quantum yield, algae were exposed to a pulse of atrazine for 48 h followed by a 48-h recovery period in control media. Photosynthesis was measured at 0, 3, 6, 12, 24, and 48 h of the exposure and recovery phases using pulse amplitude modulation fluorometry; growth rate and cell density were also concomitantly measured at these time points. Exposure to atrazine resulted in immediate, but temporary, inhibition of photosynthesis and growth; however, these effects were transient and fully reversible in the tested species of algae. For all three algal species, no statistically significant reductions (p ≤ 0.05) in growth rate or PSII quantum yield were detected at any of the treatment concentrations 48 h after atrazine was removed from the test system. Effects at test levels up to the highest tested exposure levels were consequently determined to be algistatic (reversible). Both biochemically and physiologically, recovery of photosynthesis and growth rate occur immediately, reaching control levels within hours following exposure. Therefore, pulsed exposure profiles of atrazine typically measured in Midwestern U.S. streams are unlikely to result in biologically meaningful changes in primary production given that the effects of atrazine are temporary and fully reversible in species representative of native populations.

  9. Refuge function of marine algae complicates selection in an intertidal snail.


    Kemppainen, Petri; van Nes, Solveig; Ceder, Christofer; Johannesson, Kerstin


    Species with restricted gene flow often show trait-shifts from one type of environment to another. In those rock-dwelling marine gastropods that lack larval dispersal, size generally decreases in wave-exposed habitats reducing risk of dislodgement, while increases in less exposed habitats to resist crab-crushing. In Littorina fabalis, however, snails of moderately exposed shores are generally much larger (11-14 mm) than snails of sheltered shores (5-8 mm). Observations from the White Sea (where crabs are not present) indicate that in the absence of crabs snails are small (6-7 mm) in both habitats. We assumed that the optimal size for L. fabalis in the absence of crabs is less than 8 mm, and thus that increased size in moderately exposed habitats in areas with crabs might be a response to crab predation. In a crab-rich area (Sweden) we showed that crab predation is an important mortality factor for this snail species in both sheltered and moderately exposed habitats. In sheltered habitats, snails were relatively more protected from crab-predation when dwelling on their habitual substrate, fucoid algae, than if experimentally tethered to rocks below the algae. This showed that algae function as snail refuges. Snail dislodgement increased, however, with wave exposure but tethering snails in moderately exposed habitats showed that large snails survived equally well on rocks under the algae as in the canopy of the algae. Thus in sheltered habitats a small snail size is favored, probably due to life-history reasons, while increased risk of being dislodged from the algae refuges promotes a large size in moderately exposed habitats. This study shows an example of selection of a trait depends on complex interactions of different factors (life-history optimization, crab predation, wave induced dislodgement and algal refuges). PMID:15711994

  10. Abiotic Stress Tolerance of Charophyte Green Algae: New Challenges for Omics Techniques.


    Holzinger, Andreas; Pichrtová, Martina


    Charophyte green algae are a paraphyletic group of freshwater and terrestrial green algae, comprising the classes of Chlorokybophyceae, Coleochaetophyceae, Klebsormidiophyceae, Zygnematophyceae, Mesostigmatophyceae, and Charo- phyceae. Zygnematophyceae (Conjugating green algae) are considered to be closest algal relatives to land plants (Embryophyta). Therefore, they are ideal model organisms for studying stress tolerance mechanisms connected with transition to land, one of the most important events in plant evolution and the Earth's history. In Zygnematophyceae, but also in Coleochaetophyceae, Chlorokybophyceae, and Klebsormidiophyceae terrestrial members are found which are frequently exposed to naturally occurring abiotic stress scenarios like desiccation, freezing and high photosynthetic active (PAR) as well as ultraviolet (UV) irradiation. Here, we summarize current knowledge about various stress tolerance mechanisms including insight provided by pioneer transcriptomic and proteomic studies. While formation of dormant spores is a typical strategy of freshwater classes, true terrestrial groups are stress tolerant in vegetative state. Aggregation of cells, flexible cell walls, mucilage production and accumulation of osmotically active compounds are the most common desiccation tolerance strategies. In addition, high photophysiological plasticity and accumulation of UV-screening compounds are important protective mechanisms in conditions with high irradiation. Now a shift from classical chemical analysis to next-generation genome sequencing, gene reconstruction and annotation, genome-scale molecular analysis using omics technologies followed by computer-assisted analysis will give new insights in a systems biology approach. For example, changes in transcriptome and role of phytohormone signaling in Klebsormidium during desiccation were recently described. Application of these modern approaches will deeply enhance our understanding of stress reactions in an

  11. Abiotic Stress Tolerance of Charophyte Green Algae: New Challenges for Omics Techniques

    PubMed Central

    Holzinger, Andreas; Pichrtová, Martina


    Charophyte green algae are a paraphyletic group of freshwater and terrestrial green algae, comprising the classes of Chlorokybophyceae, Coleochaetophyceae, Klebsormidiophyceae, Zygnematophyceae, Mesostigmatophyceae, and Charo- phyceae. Zygnematophyceae (Conjugating green algae) are considered to be closest algal relatives to land plants (Embryophyta). Therefore, they are ideal model organisms for studying stress tolerance mechanisms connected with transition to land, one of the most important events in plant evolution and the Earth’s history. In Zygnematophyceae, but also in Coleochaetophyceae, Chlorokybophyceae, and Klebsormidiophyceae terrestrial members are found which are frequently exposed to naturally occurring abiotic stress scenarios like desiccation, freezing and high photosynthetic active (PAR) as well as ultraviolet (UV) irradiation. Here, we summarize current knowledge about various stress tolerance mechanisms including insight provided by pioneer transcriptomic and proteomic studies. While formation of dormant spores is a typical strategy of freshwater classes, true terrestrial groups are stress tolerant in vegetative state. Aggregation of cells, flexible cell walls, mucilage production and accumulation of osmotically active compounds are the most common desiccation tolerance strategies. In addition, high photophysiological plasticity and accumulation of UV-screening compounds are important protective mechanisms in conditions with high irradiation. Now a shift from classical chemical analysis to next-generation genome sequencing, gene reconstruction and annotation, genome-scale molecular analysis using omics technologies followed by computer-assisted analysis will give new insights in a systems biology approach. For example, changes in transcriptome and role of phytohormone signaling in Klebsormidium during desiccation were recently described. Application of these modern approaches will deeply enhance our understanding of stress reactions in an

  12. Abiotic Stress Tolerance of Charophyte Green Algae: New Challenges for Omics Techniques.


    Holzinger, Andreas; Pichrtová, Martina


    Charophyte green algae are a paraphyletic group of freshwater and terrestrial green algae, comprising the classes of Chlorokybophyceae, Coleochaetophyceae, Klebsormidiophyceae, Zygnematophyceae, Mesostigmatophyceae, and Charo- phyceae. Zygnematophyceae (Conjugating green algae) are considered to be closest algal relatives to land plants (Embryophyta). Therefore, they are ideal model organisms for studying stress tolerance mechanisms connected with transition to land, one of the most important events in plant evolution and the Earth's history. In Zygnematophyceae, but also in Coleochaetophyceae, Chlorokybophyceae, and Klebsormidiophyceae terrestrial members are found which are frequently exposed to naturally occurring abiotic stress scenarios like desiccation, freezing and high photosynthetic active (PAR) as well as ultraviolet (UV) irradiation. Here, we summarize current knowledge about various stress tolerance mechanisms including insight provided by pioneer transcriptomic and proteomic studies. While formation of dormant spores is a typical strategy of freshwater classes, true terrestrial groups are stress tolerant in vegetative state. Aggregation of cells, flexible cell walls, mucilage production and accumulation of osmotically active compounds are the most common desiccation tolerance strategies. In addition, high photophysiological plasticity and accumulation of UV-screening compounds are important protective mechanisms in conditions with high irradiation. Now a shift from classical chemical analysis to next-generation genome sequencing, gene reconstruction and annotation, genome-scale molecular analysis using omics technologies followed by computer-assisted analysis will give new insights in a systems biology approach. For example, changes in transcriptome and role of phytohormone signaling in Klebsormidium during desiccation were recently described. Application of these modern approaches will deeply enhance our understanding of stress reactions in an

  13. Optofluidic characterization of marine algae using a microflow cytometer.


    Hashemi, Nastaran; Erickson, Jeffrey S; Golden, Joel P; Ligler, Frances S


    The effects of global warming, pollution in river effluents, and changing ocean currents can be studied by characterizing variations in phytoplankton populations. We demonstrate the design and fabrication of a Microflow Cytometer for characterization of phytoplankton. Guided by chevron-shaped grooves on the top and bottom of a microfluidic channel, two symmetric sheath streams wrap around a central sample stream and hydrodynamically focus it in the center of the channel. The lasers are carefully chosen to provide excitation light close to the maximum absorbance wavelengths for the intrinsic fluorophores chlorophyll and phycoerythrin, and the excitation light is coupled to the flow cytometer through the use of an optical fiber. Fluorescence and light scatter are collected using two multimode optical fibers placed at 90-degree angles with respect to the excitation fiber. Light emerging from these collection fibers is directed through optical bandpass filters into photomultiplier tubes. The cytometer measured the optical and side scatter properties of Karenia b., Synechococcus sp., Pseudo-Nitzchia, and Alexandrium. The effect of the sheath-to-sample flow-rate ratio on the light scatter and fluorescence of these marine microorganisms was investigated. Reducing the sample flow rate from 200 μL/min to 10 μL/min produced a more tightly focused sample stream and less heterogeneous signals.

  14. Optofluidic characterization of marine algae using a microflow cytometer

    PubMed Central

    Hashemi, Nastaran; Erickson, Jeffrey S.; Golden, Joel P.; Ligler, Frances S.


    The effects of global warming, pollution in river effluents, and changing ocean currents can be studied by characterizing variations in phytoplankton populations. We demonstrate the design and fabrication of a Microflow Cytometer for characterization of phytoplankton. Guided by chevron-shaped grooves on the top and bottom of a microfluidic channel, two symmetric sheath streams wrap around a central sample stream and hydrodynamically focus it in the center of the channel. The lasers are carefully chosen to provide excitation light close to the maximum absorbance wavelengths for the intrinsic fluorophores chlorophyll and phycoerythrin, and the excitation light is coupled to the flow cytometer through the use of an optical fiber. Fluorescence and light scatter are collected using two multimode optical fibers placed at 90-degree angles with respect to the excitation fiber. Light emerging from these collection fibers is directed through optical bandpass filters into photomultiplier tubes. The cytometer measured the optical and side scatter properties of Karenia b., Synechococcus sp., Pseudo-Nitzchia, and Alexandrium. The effect of the sheath-to-sample flow-rate ratio on the light scatter and fluorescence of these marine microorganisms was investigated. Reducing the sample flow rate from 200 μL/min to 10 μL/min produced a more tightly focused sample stream and less heterogeneous signals. PMID:22662031

  15. Inhibitory effects of terpene alcohols and aldehydes on growth of green alga Chlorella pyrenoidosa

    SciTech Connect

    Ikawa, Miyoshi; Mosley, S.P.; Barbero, L.J. )


    The growth of the green alga Chlorella pyrenoidosa was inhibited by terpene alcohols and the terpene aldehyde citral. The strongest activity was shown by citral. Nerol, geraniol, and citronellol also showed pronounced activity. Strong inhibition was linked to acyclic terpenes containing a primary alcohol or aldehyde function. Inhibition appeared to be taking place through the vapor phase rather than by diffusion through the agar medium from the terpene-treated paper disks used in the system. Inhibition through agar diffusion was shown by certain aged samples of terpene hydrocarbons but not by recently purchased samples.

  16. Viruses of eukaryotic green algae. Progress report, August 1, 1984-March 1, 1986

    SciTech Connect

    Van Etten, J.L.


    PBCV-1 is a large dsDNA-containing, plaque forming virus that replicates in a unicellular, eukaryotic Chlorella-like green alga strain NC64A. We have discovered that PBCV-1 infection results in the appearance of a restriction and modification system in the host. Furthermore, we have isolated and partially characterized 30 additional large, dsDNA-containing viruses which replicate in the same host. Some, if not all, of these viruses probably induce the synthesis of modification and restriction systems which are different from that induced by PBCV-1. 16 refs.

  17. Cloning and sequencing of the ferredoxin gene of blue-green alga Anabaena siamensis

    NASA Astrophysics Data System (ADS)

    Li, Shou-Dong; Song, Li-Rong; Liu, Yong-Ding; Zhao, Jin-Dong


    The structure gene for ferredoxin, petFI, from Anabaena siamensis has been amplified by polymerase chain reaction(PCR) and cloned into cloning vector pGEM-3zf(+). The nucleotide sequence of petFI has been determined with silver staining sequencing method. There is 96.8% homology between coding region of petFI from A. siamensis and that of petFI from A. sp. 7120. Amino acid sequences of seven strains of blue-green algae are compared.

  18. Post-coital contraceptive activity of crude extracts of Sri Lankan marine red algae.


    Ratnasooriya, W D; Premakumara, G A; Tillekeratne, L M


    This study investigates the potential of marine red algae as a source for post-coital contraceptive agents using three varieties: Gracilaria corticata, Gelidiella acerosa and Jania sp. Methanol: methylene chloride (1:1) extracts of these red algae were made and were orally administered (500 or 1000 mg/kg/day) to female rats from day 1 to day 7 of pregnancy. The higher dose of Gracilaria corticata and both doses of Gelidiella acerosa extracts produced significant post-coital contraceptive activities without any marked side effects. Furthermore, the post-coital contraceptive activity of the latter extract was dose-dependent. On the other hand, extract made from Jania sp. had no significant post-coital contraceptive action. The post-coital contraceptive activity of Gracilaria corticata was due to enhanced pre-implantation loss and of Gelidiella acerosa was due to elevated post-implantation loss. These findings indicate that marine red algae is a useful source to be harvested for potential post-coital contraceptive drugs. PMID:7805379

  19. Evaluation of the contamination of marine algae (seaweed) from the St. Lawrence River and likely to be consumed by humans

    SciTech Connect

    Phaneuf, D.; Cote, I.; Dumas, P.; Ferron, L.A.; LeBlanc, A.


    The goal of the study was to assess the contamination of marine algae (seaweeds) growing in the St. Lawrence River estuary and Gulf of St. Lawrence and to evaluate the risks to human health from the consumption of these algae. Algae were collected by hand at low tide. A total of 10 sites on the north and south shores of the St. Lawrence as well as in Baie des Chaleurs were sampled. The most frequently collected species of algae were Fucus vesiculosus, Ascophyllum nodosum, Laminaria Longicruris, Palmaria palmata, Ulva lactuca, and Fucus distichus. Alga samples were analyzed for metals iodine, and organochlorines. A risk assessment was performed using risk factors. In general, concentrations in St. Lawrence algae were not very high. Consequently, health risks associated with these compounds in St. Lawrence algae were very low. Iodine concentration, on the other hand, could be of concern with regard to human health. Regular consumption of algae, especially of Laminaria sp., could result in levels of iodine sufficient to cause thyroid problems. For regular consumers, it would be preferable to choose species with low iodine concentrations, such as U. lactuca and P. palmata, in order to prevent potential problems. Furthermore, it would also be important to assess whether preparation for consumption or cooking affects the iodine content of algae. Algae consumption may also have beneficial health effects. Scientific literature has shown that it is a good source of fiber and vitamins, especially vitamin B{sub 12}.

  20. Quorum Sensing Inhibition by Asparagopsis taxiformis, a Marine Macro Alga: Separation of the Compound that Interrupts Bacterial Communication

    PubMed Central

    Jha, Bhavanath; Kavita, Kumari; Westphal, Jenny; Hartmann, Anton; Schmitt-Kopplin, Philippe


    The majority of the marine algal species, though completing their life cycle in seawater, are rarely susceptible to fouling, making them an important source of quorum sensing (QS) inhibitory substances. The separation and characterization of QS inhibitors are crucial for any potential application. Thirty marine macroalgae were tested for QS inhibition activity by using Chromobacterium violaceum CV026 as the reporter strain, and among them, Asparagopsis taxiformis showed antibacterial, as well as antiquorum, sensing activities. Cinnamaldehyde (75 mM) and methanol were used as positive and negative controls, respectively. The antiquorum sensing activity of A. taxiformis was further confirmed using the sensor strain, Serratia liquefaciens MG44, having green fluorescent protein (gfp). Methanolic extract of the alga was fractionated by solid phase extraction (SPE), and each fraction was tested for QS inhibition. Two types of activities were observed—zone of clearance (antibacterial activity) and zone of inhibition with or without finger-like projections (QS inhibition). Out of five SPE cartridges, Bond Elut PH showed clear separation of these two fractions. The Ion Cyclotron Resonance Fourier Transformation Mass Spectrometer (ICR-FT/MS) analysis of the fractions further supported the bioassay results. The presence of strong QS inhibitory compound in A. taxiformis indicates its potential use in antifouling preparations. PMID:23344114

  1. Cytotoxicity and antimicrobial activity of marine macro algae (Dictyotaceae and Ulvaceae) from the Persian Gulf.


    Mashjoor, Sakineh; Yousefzadi, Morteza; Esmaeili, Mohamad Ali; Rafiee, Roya


    Pharmaceutical industry now accept the worlds ocean which contains a vast array of organisms with unique biological properties, as a major frontier for medical investigation. Bioactive compounds with different modes of action, such as, antiproliferative, antioxidant, antimicrotubule, have been isolated from marine sources, specifically macro and micro algae, and cyanobacteria. The aim of this work was to investigate antimicrobial and cytotoxic activities of the extracts of marine macro algae Ulva flexuosa, Padina antillarum and Padina boergeseni from the northern coasts of the Persian Gulf, Qeshm Island, Iran, against three cell lines including MCF7, HeLa and Vero, as well as their inhibitory effects against a wide array (i.e. n = 11) of pathogenic bacteria and fungi. Antimicrobial activity of the marine macro algal extracts was assessed using a disc diffusion method; an MTT cytotoxicity assay was employed to test the effects of the extracts on each cancer cell line. The algal extracts showed considerable antimicrobial activity against the majority of the tested bacteria and fungi. Both ethyl acetate and methanol extracts at the highest concentration (100 µg/ml) caused cell death, with the IC50 values calculated for each cell type and each algal extracts. Results are exhibited a higher decrease in the viability of the cells treated at the highest concentration of marine macro algal ethyl acetate extracts compared to the methanol extracts (78.9 % death in Vero cells by ethyl acetate extracts from U. flexuosa). Despite, the ethyl acetate extracts with lower dose- response of cells, exhibited better cytotoxic activity than methanol extracts (IC50: 55.26 μg/ml in Vero cells by ethyl acetate extracts from U. flexuosa). Based on the findings, it is concluded that the marine macro algal extracts from the Persian Gulf possess antibacterial and cytotoxic potential, which could be considered for future applications in medicine and identifying novel drugs from the

  2. Molecular identification of green algae from the rafts based infrastructure of Porphyra yezoensis.


    Shen, Qi; Li, Hongye; Li, Yan; Wang, Zongling; Liu, Jiesheng; Yang, Weidong


    To provide more information on the origin of the Ulva prolifera bloom in Qingdao sea area in China from 2007 to 2011, the diversity of green algae growing on the rafts of Porphyra yezoensis on the coast in Jiangsu Province was investigated based on ITS, rbcL and 5S sequences. Eighty-four of green algal samples from various sites and cruises in 2010 and 2011 were collected. According to ITS and rbcL sequences, samples from the rafts of P. yezoensis fell into four clades: Ulva linza-procera-prolifera (LPP) complex, Ulva flexuosa, Blidingia sp. and Urospora spp. However, based on the 5S rDNA, a more resolved DNA marker, only one of the 84 samples belonged to U. prolifera. Combined with the previous reports, it is likely that U. prolifera bloom in Qingdao sea area might consist of more than one origin, and Porphyra cultivation rafts might be one of the causes. PMID:22858010

  3. Comparative analyses of chloroplast genome data representing nine green algae in Sphaeropleales (Chlorophyceae, Chlorophyta).


    Fučíková, Karolina; Lewis, Louise A; Lewis, Paul O


    The chloroplast genomes of green algae are highly variable in their architecture. In this article we summarize gene content across newly obtained and published chloroplast genomes in Chlorophyceae, including new data from nine of species in Sphaeropleales (Chlorophyceae, Chlorophyta). We present genome architecture information, including genome synteny analysis across two groups of species. Also, we provide a phylogenetic tree obtained from analysis of gene order data for species in Chlorophyceae with fully sequenced chloroplast genomes. Further analyses and interpretation of the data can be found in "Chloroplast phylogenomic data from the green algal order Sphaeropleales (Chlorophyceae, Chlorophyta) reveal complex patterns of sequence evolution" (Fučíková et al., In review) [1]. PMID:27054159

  4. Comparative analyses of chloroplast genome data representing nine green algae in Sphaeropleales (Chlorophyceae, Chlorophyta)

    PubMed Central

    Fučíková, Karolina; Lewis, Louise A.; Lewis, Paul O.


    The chloroplast genomes of green algae are highly variable in their architecture. In this article we summarize gene content across newly obtained and published chloroplast genomes in Chlorophyceae, including new data from nine of species in Sphaeropleales (Chlorophyceae, Chlorophyta). We present genome architecture information, including genome synteny analysis across two groups of species. Also, we provide a phylogenetic tree obtained from analysis of gene order data for species in Chlorophyceae with fully sequenced chloroplast genomes. Further analyses and interpretation of the data can be found in “Chloroplast phylogenomic data from the green algal order Sphaeropleales (Chlorophyceae, Chlorophyta) reveal complex patterns of sequence evolution” (Fučíková et al., In review) [1]. PMID:27054159

  5. Molecular identification of green algae from the rafts based infrastructure of Porphyra yezoensis.


    Shen, Qi; Li, Hongye; Li, Yan; Wang, Zongling; Liu, Jiesheng; Yang, Weidong


    To provide more information on the origin of the Ulva prolifera bloom in Qingdao sea area in China from 2007 to 2011, the diversity of green algae growing on the rafts of Porphyra yezoensis on the coast in Jiangsu Province was investigated based on ITS, rbcL and 5S sequences. Eighty-four of green algal samples from various sites and cruises in 2010 and 2011 were collected. According to ITS and rbcL sequences, samples from the rafts of P. yezoensis fell into four clades: Ulva linza-procera-prolifera (LPP) complex, Ulva flexuosa, Blidingia sp. and Urospora spp. However, based on the 5S rDNA, a more resolved DNA marker, only one of the 84 samples belonged to U. prolifera. Combined with the previous reports, it is likely that U. prolifera bloom in Qingdao sea area might consist of more than one origin, and Porphyra cultivation rafts might be one of the causes.

  6. Spectroscopic investigation of ionizing-radiation tolerance of a Chlorophyceae green micro-alga

    NASA Astrophysics Data System (ADS)

    Farhi, E.; Rivasseau, C.; Gromova, M.; Compagnon, E.; Marzloff, V.; Ollivier, J.; Boisson, A. M.; Bligny, R.; Natali, F.; Russo, D.; Couté, A.


    Micro-organisms living in extreme environments are captivating in the peculiar survival processes they have developed. Deinococcus radiodurans is probably the most famous radio-resistant bacteria. Similarly, a specific ecosystem has grown in a research reactor storage pool, and has selected organisms which may sustain radiative stress. An original green micro-alga which was never studied for its high tolerance to radiations has been isolated. It is the only autotrophic eukaryote that develops in this pool, although contamination possibilities coming from outside are not unusual. Studying what could explain this irradiation tolerance is consequently very interesting. An integrative study of the effects of irradiation on the micro-algae physiology, metabolism, internal dynamics, and genomics was initiated. In the work presented here, micro-algae were stressed with irradiation doses up to 20 kGy (2 Mrad), and studied by means of nuclear magnetic resonance, looking for modifications in the metabolism, and on the IN13 neutron backscattering instrument at the ILL, looking for both dynamics and structural macromolecular changes in the cells.

  7. Nitrogen Fixation by Thermophilic Blue-Green Algae (Cyanobacteria): Temperature Characteristics and Potential Use in Biophotolysis

    PubMed Central

    Miyamoto, Kazuhisa; Hallenbeck, Patrick C.; Benemann, John R.


    Thermophilic, nitrogen-fixing, blue-green algae (cyanobacteria) were investigated for use in biophotolysis. Three strains of Mastigocladus laminosus were tested and were found to be equally effective in biophotolysis as judged by nitrogenase activity. The alga, M. laminosus NZ-86-m, which was chosen for further study, grew well in the temperature range from 35 to 50°C, with optimum growth at 45°C, at which temperature acetylene reduction activity was also greatest. The maximum tolerable temperature was 55°C. Acetylene reduction activity was saturated at a light intensity of 1 × 104 ergs cm−2 s−1. Atmospheric oxygen tension was found to be slightly inhibitory to acetylene reduction of both slowly growing and exponentially growing cultures. Nonsterile continuous cultures, which were conducted to test problems of culture maintenance, could be operated for 2 months without any significant decrease in nitrogenase activity or contamination by other algae. Nitrogen-starved cultures of M. laminosus NZ-86-m produced hydrogen at comparable rates to Anabaena cylindrica. The conversion efficiency of light to hydrogen energy at maximum rates of hydrogen production was 2.7%. PMID:16345353

  8. (Carbon and hydrogen metabolism of green algae in light and dark)

    SciTech Connect

    Not Available


    The focus of this project was the elucidation of anaerobic metabolism in ecuaryotic green algae, chlamydomonas reinhardii. Chlamydomonas is a versatile organism that can grow under disparate conditions such as fresh water lakes and sewage ponds. The cell an photoassimilate CO{sub 2} aerobically and anaerobically, the latter after adaptation'' to a hydrogen metabolism. It can recall the knallgas or oxyhydrogen reaction and utilize hydrogen the simplest of all reducing agents for the dark assimilation of CO{sub 2} by the photosynthetic carbon reduction cycle. The dark reduction with hydrogen lies on the border line between autotrophic and heterotrophic carbon assimilation. Both autotrophic and heterotrophic bacteria are known in which molecular hydrogen can replace either inorganic or organic hydrogen donors. Here the dark reduction of CO{sub 2} acquires a particular importance since it occurs in the same cell that carries on photoreduction and photosynthesis. We will demonstrate here that the alga chloroplast possesses a respiratory capacity. It seems likely that Chlamydomonas may have retained the chloroplastic respiratory pathway because of the selective advantage provided to the algae under a wide range of environmental conditions that the cells experience in nature. The ability to cycle electrons and poise the reduction level of the photosynthetic apparatus under aerobic and microaerobic conditions could allow more efficient CO{sub 2} fixation and enhanced growth under unfavorable conditions or survival under more severe conditions.

  9. Responses of marine unicellular algae to brominated organic compounds in six growth media

    SciTech Connect

    Walsh, G.E.; Yoder, M.J.; McLaughlin, L.L.; Lores, E.M.


    Marine unicellular algae, Skeletonema costatum, Thalassiosira pseudonana, and Chlorella sp. were exposed to the industrial brominated compounds tetrabromobisphenol A, decabromobiphenyloxide (DBBO), hexabromocyclododecane (HBCD), pentabromomethylbenzene (PBMB), pentabromoethylbenzene (PBEB), and the herbicide bromoxynil (BROM), in six algal growth media. High concentrations of DBBO (1 mg liter-1), PBMB (1 mg liter-1), and PBEB (0.5 mg liter-1) reduced growth by less than 50%. EC50s of the other compounds varied with growth medium, with high EC50/low EC50 ratios between 1.3 and 9.9. Lowest EC50s, 9.3 to 12.0 micrograms liter-1, were obtained with S. costatum and HBCD. It is concluded that responses to toxicants in different media are the results of interactions among algae, growth medium, toxicant, and solvent carrier.

  10. Determination of Volatile Compounds in Four Commercial Samples of Japanese Green Algae Using Solid Phase Microextraction Gas Chromatography Mass Spectrometry

    PubMed Central

    Yoshikawa, Keisuke; Fujita, Akira; Mase, Nobuyuki; Watanabe, Naoharu


    Green algae are of great economic importance. Seaweed is consumed fresh or as seasoning in Japan. The commercial value is determined by quality, color, and flavor and is also strongly influenced by the production area. Our research, based on solid phase microextraction gas chromatography mass spectrometry (SPME-GC-MS), has revealed that volatile compounds differ intensely in the four varieties of commercial green algae. Accordingly, 41 major volatile compounds were identified. Heptadecene was the most abundant compound from Okayama (Ulva prolifera), Tokushima (Ulva prolifera), and Ehime prefecture (Ulva linza). Apocarotenoids, such as ionones, and their derivatives were prominent volatiles in algae from Okayama (Ulva prolifera) and Tokushima prefecture (Ulva prolifera). Volatile, short chained apocarotenoids are among the most potent flavor components and contribute to the flavor of fresh, processed algae, and algae-based products. Benzaldehyde was predominant in seaweed from Shizuoka prefecture (Monostroma nitidum). Multivariant statistical analysis (PCA) enabled simple discrimination of the samples based on their volatile profiles. This work shows the potential of SPME-GC-MS coupled with multivariant analysis to discriminate between samples of different geographical and botanical origins and form the basis for development of authentication methods of green algae products, including seasonings. PMID:24592162

  11. Protective effect of edible marine algae, Laminaria japonica and Porphyra haitanensis, on subchronic toxicity in rats induced by inorganic arsenic.


    Jiang, Yanhua; Wang, Lianzhu; Yao, Lin; Liu, Zhantao; Gao, Hua


    Arsenic, a potent environmental toxic agent, causes various hazardous effects on human health. This study was performed to evaluate the protective effects of edible marine algae, Laminaria japonica and Porphyra haitanensis, on subchronic stress of rats induced by arsenic trioxide (As2O3). The co-treatment of marine algae could slightly increase the growth rates of body weights compared to the As2O3-treated group. The marine algae application restored liver and renal function by preventing the increment in the activities of alanine transaminase and alkaline phosphatase, and the levels of total protein, blood urea nitrogen, and creatinine. The increase in the contents of total cholesterol, triglyceride, and low density lipoprotein cholesterol, and decrease in the contents of high density lipoprotein cholesterol were observed in algae co-treated groups which indicated that marine algae could reverse the abnormal lipid metabolisms induced by arsenic. Moreover, these algae could protect the rats from lipid peroxidation by restoring the depletion of superoxide dismutase and glutathione peroxidase activities and sulfhydryl group contents, and lowering the enhanced malondialdehyde contents. Therefore, evidences indicate that L. japonica and P. haitanensis can serve as an effective regimen for treating arsenic poisoning.

  12. Protective effect of edible marine algae, Laminaria japonica and Porphyra haitanensis, on subchronic toxicity in rats induced by inorganic arsenic.


    Jiang, Yanhua; Wang, Lianzhu; Yao, Lin; Liu, Zhantao; Gao, Hua


    Arsenic, a potent environmental toxic agent, causes various hazardous effects on human health. This study was performed to evaluate the protective effects of edible marine algae, Laminaria japonica and Porphyra haitanensis, on subchronic stress of rats induced by arsenic trioxide (As2O3). The co-treatment of marine algae could slightly increase the growth rates of body weights compared to the As2O3-treated group. The marine algae application restored liver and renal function by preventing the increment in the activities of alanine transaminase and alkaline phosphatase, and the levels of total protein, blood urea nitrogen, and creatinine. The increase in the contents of total cholesterol, triglyceride, and low density lipoprotein cholesterol, and decrease in the contents of high density lipoprotein cholesterol were observed in algae co-treated groups which indicated that marine algae could reverse the abnormal lipid metabolisms induced by arsenic. Moreover, these algae could protect the rats from lipid peroxidation by restoring the depletion of superoxide dismutase and glutathione peroxidase activities and sulfhydryl group contents, and lowering the enhanced malondialdehyde contents. Therefore, evidences indicate that L. japonica and P. haitanensis can serve as an effective regimen for treating arsenic poisoning. PMID:23842700

  13. Physiological and biochemical responses of the freshwater green algae Closterium ehrenbergii to the common disinfectant chlorine.


    Sathasivam, Ramaraj; Ebenezer, Vinitha; Guo, Ruoyu; Ki, Jang-Seu


    Chlorine (Cl2) is widely used as a disinfectant in water treatment plants and for cleaning swimming pools; it is finally discharged into aquatic environments, possibly causing damage to the non-target organisms in the receiving water bodies. Present study evaluated the effects of the biocide Cl2 to the green alga Closterium ehrenbergii (C. ehrenbergii). Growth rate, chlorophyll a levels, carotenoids, chlorophyll autofluorescence, and antioxidant enzymes were monitored up to 72-h after Cl2 exposure. C. ehrenbergii showed dose-dependent decrease in growth rate and cell division after exposure to Cl2. By using cell counts, the median effective concentration (EC50)-72-h was calculated to be 0.071mgL(-1). Cl2 significantly decreased the pigment levels and chlorophyll autofluorescence intensity, indicating that the photosystem was damaged in C. ehrenbergii. In addition, it increased the production of reactive oxygen species (ROS) in the cells. This stressor significantly increased the activities of antioxidant enzymes, including superoxide dismutase (SOD), catalase, and glutathione, and affected the physiology of the cells. These results indicate that Cl2 induces oxidative stress in the cellular metabolic process and leads to physiological and biochemical damages in the green algae. Cl2 discharged in industrial effluents and from water treatment plants may cause harmful effects to the C. ehrenbergii a common freshwater microalgae and other non-target organisms.

  14. Phagotrophy by the picoeukaryotic green alga Micromonas: implications for Arctic Oceans.


    McKie-Krisberg, Zaid M; Sanders, Robert W


    Photosynthetic picoeukaryotes (PPE) are recognized as major primary producers and contributors to phytoplankton biomass in oceanic and coastal environments. Molecular surveys indicate a large phylogenetic diversity in the picoeukaryotes, with members of the Prymnesiophyceae and Chrysophyseae tending to be more common in open ocean waters and Prasinophyceae dominating coastal and Arctic waters. In addition to their role as primary producers, PPE have been identified in several studies as mixotrophic and major predators of prokaryotes. Mixotrophy, the combination of photosynthesis and phagotrophy in a single organism, is well established for most photosynthetic lineages. However, green algae, including prasinophytes, were widely considered as a purely photosynthetic group. The prasinophyte Micromonas is perhaps the most common picoeukaryote in coastal and Arctic waters and is one of the relatively few cultured representatives of the picoeukaryotes available for physiological investigations. In this study, we demonstrate phagotrophy by a strain of Micromonas (CCMP2099) isolated from Arctic waters and show that environmental factors (light and nutrient concentration) affect ingestion rates in this mixotroph. In addition, we show size-selective feeding with a preference for smaller particles, and determine P vs I (photosynthesis vs irradiance) responses in different nutrient conditions. If other strains have mixotrophic abilities similar to Micromonas CCMP2099, the widespread distribution and frequently high abundances of Micromonas suggest that these green algae may have significant impact on prokaryote populations in several oceanic regimes. PMID:24553471

  15. The charophycean green algae provide insights into the early origins of plant cell walls.


    Sørensen, Iben; Pettolino, Filomena A; Bacic, Antony; Ralph, John; Lu, Fachuang; O'Neill, Malcolm A; Fei, Zhangzhun; Rose, Jocelyn K C; Domozych, David S; Willats, William G T


    Numerous evolutionary innovations were required to enable freshwater green algae to colonize terrestrial habitats and thereby initiate the evolution of land plants (embryophytes). These adaptations probably included changes in cell-wall composition and architecture that were to become essential for embryophyte development and radiation. However, it is not known to what extent the polymers that are characteristic of embryophyte cell walls, including pectins, hemicelluloses, glycoproteins and lignin, evolved in response to the demands of the terrestrial environment or whether they pre-existed in their algal ancestors. Here we show that members of the advanced charophycean green algae (CGA), including the Charales, Coleochaetales and Zygnematales, but not basal CGA (Klebsormidiales and Chlorokybales), have cell walls that are comparable in several respects to the primary walls of embryophytes. Moreover, we provide both chemical and immunocytochemical evidence that selected Coleochaete species have cell walls that contain small amounts of lignin or lignin-like polymers derived from radical coupling of hydroxycinnamyl alcohols. Thus, the ability to synthesize many of the components that characterize extant embryophyte walls evolved during divergence within CGA. Our study provides new insight into the evolutionary window during which the structurally complex walls of embryophytes originated, and the significance of the advanced CGA during these events. PMID:21707800

  16. Physiological and biochemical responses of the freshwater green algae Closterium ehrenbergii to the common disinfectant chlorine.


    Sathasivam, Ramaraj; Ebenezer, Vinitha; Guo, Ruoyu; Ki, Jang-Seu


    Chlorine (Cl2) is widely used as a disinfectant in water treatment plants and for cleaning swimming pools; it is finally discharged into aquatic environments, possibly causing damage to the non-target organisms in the receiving water bodies. Present study evaluated the effects of the biocide Cl2 to the green alga Closterium ehrenbergii (C. ehrenbergii). Growth rate, chlorophyll a levels, carotenoids, chlorophyll autofluorescence, and antioxidant enzymes were monitored up to 72-h after Cl2 exposure. C. ehrenbergii showed dose-dependent decrease in growth rate and cell division after exposure to Cl2. By using cell counts, the median effective concentration (EC50)-72-h was calculated to be 0.071mgL(-1). Cl2 significantly decreased the pigment levels and chlorophyll autofluorescence intensity, indicating that the photosystem was damaged in C. ehrenbergii. In addition, it increased the production of reactive oxygen species (ROS) in the cells. This stressor significantly increased the activities of antioxidant enzymes, including superoxide dismutase (SOD), catalase, and glutathione, and affected the physiology of the cells. These results indicate that Cl2 induces oxidative stress in the cellular metabolic process and leads to physiological and biochemical damages in the green algae. Cl2 discharged in industrial effluents and from water treatment plants may cause harmful effects to the C. ehrenbergii a common freshwater microalgae and other non-target organisms. PMID:27552343

  17. The system of contractile vacuoles in the green alga Mesostigma viride (Streptophyta).


    Buchmann, Karin; Becker, Burkhard


    The contractile vacuole (CV) is an osmoregulatory organelle which is found in many protists. We have investigated the structure and function of the CV in the green alga Mesostigma viride by light (video) and serial section electron microscopy. Mesostigma is the only known flagellate streptophyte (charophycean green algae and land plants) and therefore of great importance for our understanding of the evolution of streptophytes. The entire CV system of Mesostigma has been reconstructed 3-dimensionally for three cells. Based on light microscopy cells contain an average of 8 CVs. The maximal diameter of a CV in Mesostigma was 1.5 microm and the expulsion interval 24.1s in 10 mosM medium. Video microscopy revealed the system of CVs to be very dynamic with individual CVs connecting temporarily or fusing completely with each other. Electron microscopy confirmed these observations and showed coated vesicles to be predominantly associated with large CVs. No expulsion pore was observed by electron microscopy. Instead we encountered close contact zones of approximately 150 nm diameter, which we propose to be the site of water expulsion. A model for the function of CVs in Mesostigma is presented.



    Zhao, Rui; Cao, Yu; Xu, Hui; Lv, Linfeng; Qiao, Dairong; Cao, Yi


    The unicellular green alga Dunaliella salina (Dunal) Teodor. is a novel model photosynthetic eukaryote for studying photosystems, high salinity acclimation, and carotenoid accumulation. In spite of such significance, there have been limited studies on the Dunaliella genome transcriptome and proteome. To further investigate D. salina, a cDNA library was constructed and sequenced. Here, we present the analysis of the 2,282 expressed sequence tags (ESTs) generated together with 3,990 ESTs from dbEST. A total of 4,148 unique sequences (UniSeqs) were identified, of which 56.1% had sequence similarity with Uniprot entries, suggesting that a large number of unique genes may be harbored by Dunaliella. Additionally, protein family domains were identified to further characterize these sequences. Then, we also compared EST sequences with different complete eukaryotic genomes from several animals, plants, and fungi. We observed notable differences between D. salina and other organisms. This EST collection and its annotation provided a significant resource for basic and applied research on D. salina and laid the foundation for a systematic analysis of the transcriptome basis of green algae development and diversification.

  19. A new microscopic method to analyse desiccation-induced volume changes in aeroterrestrial green algae.


    Lajos, K; Mayr, S; Buchner, O; Blaas, K; Holzinger, A


    Aeroterrestrial green algae are exposed to desiccation in their natural habitat, but their actual volume changes have not been investigated. Here, we measure the relative volume reduction (RVRED ) in Klebsormidium crenulatum and Zygnema sp. under different preset relative air humidities (RH). A new chamber allows monitoring RH during light microscopic observation of the desiccation process. The RHs were set in the range of ∼4 % to ∼95% in 10 steps. RVRED caused by the desiccation process was determined after full acclimation to the respective RHs. In K. crenulatum, RVRED (mean ± SE) was 46.4 ± 1.9%, in Zygnema sp. RVRED was only 34.3 ± 2.4% at the highest RH (∼95%) tested. This indicates a more pronounced water loss at higher RHs in K. crenulatum versus Zygnema sp. By contrast, at the lowest RH (∼4%) tested, RVRED ranged from 75.9 ± 2.7% in K. crenulatum to 83.9 ± 2.2% in Zygnema sp. The final volume reduction is therefore more drastic in Zygnema sp. These data contribute to our understanding of the desiccation process in streptophytic green algae, which are considered the closest ancestors of land plants. PMID:27075881

  20. The charophycean green algae provide insights into the early origins of plant cell walls.


    Sørensen, Iben; Pettolino, Filomena A; Bacic, Antony; Ralph, John; Lu, Fachuang; O'Neill, Malcolm A; Fei, Zhangzhun; Rose, Jocelyn K C; Domozych, David S; Willats, William G T


    Numerous evolutionary innovations were required to enable freshwater green algae to colonize terrestrial habitats and thereby initiate the evolution of land plants (embryophytes). These adaptations probably included changes in cell-wall composition and architecture that were to become essential for embryophyte development and radiation. However, it is not known to what extent the polymers that are characteristic of embryophyte cell walls, including pectins, hemicelluloses, glycoproteins and lignin, evolved in response to the demands of the terrestrial environment or whether they pre-existed in their algal ancestors. Here we show that members of the advanced charophycean green algae (CGA), including the Charales, Coleochaetales and Zygnematales, but not basal CGA (Klebsormidiales and Chlorokybales), have cell walls that are comparable in several respects to the primary walls of embryophytes. Moreover, we provide both chemical and immunocytochemical evidence that selected Coleochaete species have cell walls that contain small amounts of lignin or lignin-like polymers derived from radical coupling of hydroxycinnamyl alcohols. Thus, the ability to synthesize many of the components that characterize extant embryophyte walls evolved during divergence within CGA. Our study provides new insight into the evolutionary window during which the structurally complex walls of embryophytes originated, and the significance of the advanced CGA during these events.

  1. A new microscopic method to analyse desiccation‐induced volume changes in aeroterrestrial green algae

    PubMed Central



    Summary Aeroterrestrial green algae are exposed to desiccation in their natural habitat, but their actual volume changes have not been investigated. Here, we measure the relative volume reduction (RVRED) in Klebsormidium crenulatum and Zygnema sp. under different preset relative air humidities (RH). A new chamber allows monitoring RH during light microscopic observation of the desiccation process. The RHs were set in the range of ∼4 % to ∼95% in 10 steps. RVRED caused by the desiccation process was determined after full acclimation to the respective RHs. In K. crenulatum, RVRED (mean ± SE) was 46.4 ± 1.9%, in Zygnema sp. RVRED was only 34.3 ± 2.4% at the highest RH (∼95%) tested. This indicates a more pronounced water loss at higher RHs in K. crenulatum versus Zygnema sp. By contrast, at the lowest RH (∼4%) tested, RVRED ranged from 75.9 ± 2.7% in K. crenulatum to 83.9 ± 2.2% in Zygnema sp. The final volume reduction is therefore more drastic in Zygnema sp. These data contribute to our understanding of the desiccation process in streptophytic green algae, which are considered the closest ancestors of land plants. PMID:27075881

  2. Toxicity and bioaccumulation kinetics of arsenate in two freshwater green algae under different phosphate regimes.


    Wang, Ning-Xin; Li, Yan; Deng, Xi-Hai; Miao, Ai-Jun; Ji, Rong; Yang, Liu-Yan


    In the present study, the toxicity and bioaccumulation kinetics of arsenate in two green algae Chlamydomonas reinhardtii and Scenedesmus obliquus under phosphate-enriched (+P) and limited (-P) conditions were investigated. P-limitation was found to aggravate arsenate toxicity and S. obliquus was more tolerant than C. reinhardtii. Such phosphate-condition-dependent or algal-species-specific toxicity difference was narrowed when the relative inhibition of cell growth was plotted against intracellular arsenate content instead of its extracellular concentration. The discrepance was further reduced when the intracellular ratio of arsenic to phosphorus was applied. It suggests that both arsenate bioaccumulation and intracellular phosphorus played an important role in arsenate toxicity. On the other hand, arsenate uptake was induced by P-limitation and its variation with ambient arsenate concentration could be well fitted to the Michaelis-Menten model. Arsenate transporters of S. obliquus were found to have a higher affinity but lower capacity than those of C. reinhardtii, which explains its better regulation of arsenate accumulation than the latter species in the toxicity experiment. Further, arsenate depuration was facilitated and more was transformed to arsenite in C. reinhardtii or under -P condition. Intracellular proportion of arsenite was also increased after the algae were transferred from the long-term uptake media to a relatively clean solution in the efflux experiment. Both phenomena imply that algae especially the sensitive species could make physiological adjustments to alleviate the adverse effects of arsenate. Overall, our findings will facilitate the application of algae in arsenate remediation. PMID:23497978

  3. Characterization of arsenate transformation and identification of arsenate reductase in a green alga Chlamydomonas reinhardtii.


    Yin, Xixiang; Wang, Lihong; Duan, Guilan; Sun, Guoxin


    Arsenic (As) is a pervasive and ubiquitous environmental toxin that has created catastrophic human health problems world-wide. Chlamydomonas reinhardtii is a unicellular green alga, which exists ubiquitously in freshwater aquatic systems. Arsenic metabolism processes of this alga through arsenate reduction and sequent store and efflux were investigated. When supplied with 10 micromol/L arsenate, arsenic speciation analysis showed that arsenite concentration increased from 5.7 to 15.7 mg/kg dry weight during a 7-day period, accounting for 18%-24% of the total As in alga. When treated with different levels of arsenate (10, 20, 30, 40, 50 micromol/L) for 7 days, the arsenite concentration increased with increasing external arsenate concentrations, the proportion of arsenite was up to 23%-28% of the total As in alga. In efflux experiments, both arsenate and arsenite could be found in the efflux solutions. Additionally, the efflux of arsenate was more than that of arsenite. Furthermore, two arsenate reductase genes of C. reinhardtii (CrACR2s) were cloned and expressed in Escherichia coli strain WC3110 (deltaarsC) for the first time. The abilities of both CrACR2s genes to complement the arsenate-sensitive strain were examined. CrACR2.1 restored arsenate resistance at 0.8 mmol/L. However, CrACR2.2 showed much less ability to complement. The gene products were demonstrated to reduce arsenate to arsenite in vivo. In agreement with the complementation results, CrACR2.1 showed higher reduction ability than CrACR2.2, when treated with 0.4 mmol/L arsenate for 16 hr incubation.

  4. Iron colloids reduce the bioavailability of phosphorus to the green alga Raphidocelis subcapitata.


    Baken, Stijn; Nawara, Sophie; Van Moorleghem, Christoff; Smolders, Erik


    Phosphorus (P) is a limiting nutrient in many aquatic systems. The bioavailability of P in natural waters strongly depends on its speciation. In this study, structural properties of iron colloids were determined and related to their effect on P sorption and P bioavailability. The freshwater green alga Raphidocelis subcapitata was exposed to media spiked with radiolabelled (33)PO4, and the uptake of (33)P was monitored for 1 h. The media contained various concentrations of synthetic iron colloids with a size between 10 kDa and 0.45 μm. The iron colloids were stabilised by natural organic matter. EXAFS spectroscopy showed that these colloids predominantly consisted of ferrihydrite with small amounts of organically complexed Fe. In colloid-free treatments, the P uptake flux by the algae obeyed Michaelis-Menten kinetics. In the presence of iron colloids at 9 or 90 μM Fe, corresponding to molar P:Fe ratios between 0.02 and 0.17, the truly dissolved P (<10 kDa) was between 4 and 60% of the total dissolved P (<0.45 μm). These colloids reduced the P uptake flux by R. subcapitata compared to colloid-free treatments at the same total dissolved P concentration. However, the P uptake flux from colloid containing solutions equalled that from colloid-free ones when expressed as truly dissolved P. This demonstrates that colloidal P did not contribute to the P uptake flux. It is concluded that, on the short term, phosphate adsorbed to ferrihydrite colloids is not available to the green alga R. subcapitata.

  5. Sterols in red and green algae: quantification, phylogeny, and relevance for the interpretation of geologic steranes.


    Kodner, R B; Pearson, A; Summons, R E; Knoll, A H


    Steroids, a class of triterpenoid lipids with high preservation potential, are widely distributed in sedimentary rocks. All eukaryotes have a physiological requirement for these molecules, making steroids important biomarkers for aiding our understanding of eukaryote molecular evolution and geologic history. C(26)-C(30) sterols are the molecules most commonly incorporated or synthesized by eukaryotes, and correspond to C(26)-C(30) steranes ubiquitously and abundantly preserved in petroleums and sedimentary bitumens. Because these sterols occur in evolutionarily diverse taxa, it can be difficult to associate any particular compound with a single group of organisms. Nevertheless, geochemists have still been able to draw parallels between the empirical patterns in geologic sterane abundances and the age of petroleum source rocks. Paleobiologists have also used sterane data, in particular the patterns in C(29) and C(28) steranes, to support fossil evidence of an early radiation of green algae in latest Proterozoic and Paleozoic and the succession of the major modern phytoplankton groups in the Mesozoic. Although C(29) sterols are found in many eukaryotes, organisms that produce them in proportional abundances comparable to those preserved in Proterozoic and Paleozoic rocks are limited. Based on a large, phylogenetically based survey of sterol profiles from the kingdom Plantae, we conclude that modern ulvophyte and early diverging prasinophyte green algae produce high abundances of C(29) relative to C(27) and C(28) sterols most consistent with the sterane profiles observed in Paleozoic rocks. Our analysis also suggests that ancestral stem groups among the Plantae, including the glaucocystophytes and early divergent red algae are also plausible candidates.

  6. Estrogenic activity in extracts and exudates of cyanobacteria and green algae.


    Sychrová, E; Štěpánková, T; Nováková, K; Bláha, L; Giesy, J P; Hilscherová, K


    Here is presented some of the first information on interactions of compounds produced by cyanobacteria and green algae with estrogen receptor signaling. Estrogenic potency of aqueous extracts and exudates (culture spent media with extracellular products) of seven species of cyanobacteria (10 different laboratory strains) and two algal species were assessed by use of in vitro trans-activation assays. Compounds produced by cyanobacteria and algae, and in particular those excreted from the cells, were estrogenic. Most exudates were estrogenic with potencies expressed at 50% of the maximum response under control of the estrogen receptor ranging from 0.2 to 7.2 ng 17β-estradiol (E(2)) equivalents (EEQ)/L. The greatest estrogenic potency was observed for exudates of Microcystis aerigunosa, a common species that forms water blooms. Aqueous extracts of both green algae, but only one species of cyanobacteria (Aphanizomenon gracile) elicited significant estrogenicity with EEQ ranging from 15 to 280 ng 17β-estradiol (E(2))/g dry weight. Scenedesmus quadricauda exudates and extracts of Aphanizomenon flos-aquae were antagonistic to the ER when coexposed to E(2). The EEQ potency was not correlated with concentrations of cyanotoxins, such as microcystin and cylindrospermopsin, which suggests that the EEQ was comprised of other compounds. The study demonstrates some differences between the estrogenic potency of aqueous extracts prepared from the same species, but of different origin, while the effects of exudates were comparable within species. The observed estrogenic potencies are important namely in relation to the possible mass expansion of cyanobacteria and release of the active compounds into surrounding water. PMID:22208753

  7. Antioxidant system responses in two co-occurring green-tide algae under stress conditions

    NASA Astrophysics Data System (ADS)

    Wang, Ying; Zhao, Xinyu; Tang, Xuexi


    Green tides have occurred every year from 2007 to 2014 in the Yellow Sea. Ulva prolifera (Müller) J. Agardh has been identified as the bloom-forming alga, co-occurring with U. intestinalis. We observed distinct strategies for both algal species during green tides. U. prolifera exhibited a high abundance initially and then decreased dramatically, while U. intestinalis persisted throughout. The antioxidant system responses of these two macroalgae were compared in the late phase of a green tide (in-situ) and after laboratory acclimation. Lipid peroxidation and antioxidant system responses differed significantly between the two. Malondialdehyde and hydrogen peroxide contents increased significantly in-situ in U. prolifera, but not in U. intestinalis. In U. prolifera, we observed a significant decrease in total antioxidant ability (T-AOC), antioxidant enzymes (SOD and Apx), and non-enzyme antioxidants (GSH and AsA) in-situ. U. intestinalis showed the same pattern of T-AOC and SOD, but its Gpx, Apx, and GSH responses did not differ significantly. The results suggest that U. prolifera was more susceptible than U. intestinalis to the harsh environmental changes during the late phase of a Yellow Sea green tide. The boom and bust strategy exhibited by U. prolifera and the persistence of U. intestinalis can be explained by differences in enzyme activity and antioxidant systems.

  8. Rapid Mass Movement of Chloroplasts during Segment Formation of the Calcifying Siphonalean Green Alga, Halimeda macroloba

    PubMed Central

    Larkum, Anthony W. D.; Salih, Anya; Kühl, Michael


    Background The calcifying siphonalean green alga, Halimeda macroloba is abundant on coral reefs and is important in the production of calcium carbonate sediments. The process by which new green segments are formed over-night is revealed here for the first time. Methodology/Principal Findings Growth of new segments was visualised by epifluorescence and confocal microscopy and by pulse amplitude modulation (PAM) fluorimetry. Apical colourless proto-segments were initiated on day 1, and formed a loose network of non-calcified, non-septate filaments, containing no chloroplasts. Rapid greening was initiated at dusk by i) the mass movement of chloroplasts into these filaments from the parent segment and ii) the growth of new filaments containing chloroplasts. Greening was usually complete in 3–5 h and certainly before dawn on day 2 when the first signs of calcification were apparent. Mass chloroplast movement took place at a rate of ∼0.65 µm/s. Photosynthetic yield and rate remained low for a period of 1 to several hours, indicating that the chloroplasts were made de novo. Use of the inhibitors colchicine and cytochalasin d indicated that the movement process is dependent on both microtubules and microfilaments. Significance This unusual process involves the mass movement of chloroplasts at a high rate into new segments during the night and rapid calcification on the following day and may be an adaptation to minimise the impact of herbivorous activity. PMID:21750703

  9. Larvicidal algae.


    Marten, Gerald G


    Although most algae are nutritious food for mosquito larvae, some species kill the larvae when ingested in large quantities. Cyanobacteria (blue-green algae) that kill larvae do so by virtue of toxicity. While blue-green algae toxins may offer possibilities for delivery as larvicides, the toxicity of live blue-green algae does not seem consistent enough for live algae to be useful for mosquito control. Certain species of green algae in the order Chlorococcales kill larvae primarily because they are indigestible. Where these algae are abundant in nature, larvae consume them to the exclusion of other food and then starve. Under the right circumstances, it is possible to introduce indigestible algae into a breeding habitat so they become abundant enough to render it unsuitable for mosquito production. The algae can persist for years, even if the habitat dries periodically. The main limitation of indigestible algae lies in the fact that, under certain conditions, they may not replace all the nutritious algae in the habitat. More research on techniques to ensure complete replacement will be necessary before indigestible algae can go into operational use for mosquito control.

  10. The Effects of Ultraviolet Irradiation on a Coccoid Blue-Green Alga: Survival, Photosynthesis, and Photoreactivation 1

    PubMed Central

    Van Baalen, Chase


    The effects of UV irradiation (254 mμ) on a coccoid blue-green alga Agmenellum quadruplicatum, Strain PR-6, have been examined in terms of the survival curve and measurement of short time photosynthetic rates. From study of survival evidence has been found for a strong photoreactivation centered near 430 mμ. Measurements of photosynthetic rate suggest that there is a correlation between decay of photosynthesis and survival after UV exposure. The UV induced decay in photosynthetic activity is reversed by the identical photoreactivation conditions that increase the survival level. The photosynthetic data are interpreted as demonstrating a photoreactivation of photosynthesis in blue-green algae. PMID:16656955

  11. New α-glucosidase inhibitors from marine algae-derived Streptomyces sp. OUCMDZ-3434

    PubMed Central

    Chen, Zhengbo; Hao, Jiejie; Wang, Liping; Wang, Yi; Kong, Fandong; Zhu, Weiming


    Wailupemycins H (1) and I (2) with a new skeleton coupled two 6-(2-phenylnaphthalene-1-yl)pyrane-2-one nuclei to a –CH2– linkage were identified from the culture of Streptomyces sp. OUCMDZ-3434 associated with the marine algae, Enteromorpha prolifera. Compounds 1 and 2 are two new α-glucosidase inhibitors with the Ki/IC50 values of 16.8/19.7 and 6.0/8.3 μM, respectively. In addition, the absolute configurations of wailupemycins D (3) and E (4) are also resolved in this paper for the first time. PMID:26822662

  12. Rickettsial endosymbiont in the "early-diverging" streptophyte green alga Mesostigma viride.


    Yang, Ashley; Narechania, Apurva; Kim, Eunsoo


    A bacterial endosymbiont was unexpectedly found in the "axenic" culture strain of the streptophyte green alga Mesostigma viride (NIES-995). Phylogenetic analyses based on 16S rRNA gene sequences showed that the symbiont belongs to the order Rickettsiales, specifically to the recently designated clade "Candidatus Megaira," which is closely related to the well-known Rickettsia clade. Rickettsiales bacteria of the "Ca. Megaira" clade are found in a taxonomically diverse array of eukaryotic hosts, including chlorophycean green algae, several ciliate species, and invertebrates such as Hydra. Transmission electron microscopy, fluorescence in situ hybridi-zation, and SYBR Green I staining experiments revealed that the endosymbiont of M. viride NIES-995 is rod shaped, typically occurs in clusters, and is surrounded by a halo-like structure, presumably formed by secretory substances from the bacterium. Two additional M. viride strains (NIES-296 and NIES-475), but not SAG50-1, were found to house the rickettsial endosymbiont. Analyses of strain NIES-995 transcriptome data indicated the presence of at least 91 transcriptionally active genes of symbiont origins. These include genes for surface proteins (e.g., rOmpB) that are known to play key roles in bacterial attachment onto host eukaryotes in related Rickettsia species. The assembled M. viride transcriptome includes transcripts that code for a suite of predicted algal-derived proteins, such as Ku70, WASH, SCAR, and CDC42, which may be important in the formation of the algal-rickettsial association.

  13. Rickettsial endosymbiont in the "early-diverging" streptophyte green alga Mesostigma viride.


    Yang, Ashley; Narechania, Apurva; Kim, Eunsoo


    A bacterial endosymbiont was unexpectedly found in the "axenic" culture strain of the streptophyte green alga Mesostigma viride (NIES-995). Phylogenetic analyses based on 16S rRNA gene sequences showed that the symbiont belongs to the order Rickettsiales, specifically to the recently designated clade "Candidatus Megaira," which is closely related to the well-known Rickettsia clade. Rickettsiales bacteria of the "Ca. Megaira" clade are found in a taxonomically diverse array of eukaryotic hosts, including chlorophycean green algae, several ciliate species, and invertebrates such as Hydra. Transmission electron microscopy, fluorescence in situ hybridi-zation, and SYBR Green I staining experiments revealed that the endosymbiont of M. viride NIES-995 is rod shaped, typically occurs in clusters, and is surrounded by a halo-like structure, presumably formed by secretory substances from the bacterium. Two additional M. viride strains (NIES-296 and NIES-475), but not SAG50-1, were found to house the rickettsial endosymbiont. Analyses of strain NIES-995 transcriptome data indicated the presence of at least 91 transcriptionally active genes of symbiont origins. These include genes for surface proteins (e.g., rOmpB) that are known to play key roles in bacterial attachment onto host eukaryotes in related Rickettsia species. The assembled M. viride transcriptome includes transcripts that code for a suite of predicted algal-derived proteins, such as Ku70, WASH, SCAR, and CDC42, which may be important in the formation of the algal-rickettsial association. PMID:27037587

  14. Ecological niche partitioning in the picoplanktonic green alga Micromonas pusilla: evidence from environmental surveys using phylogenetic probes.


    Foulon, Elodie; Not, Fabrice; Jalabert, Fabienne; Cariou, Thierry; Massana, Ramon; Simon, Nathalie


    Very few studies have analysed the niches of pelagic protist in details. This is because for most protists, both an accurate species definition and methods for routine detection and quantification of cells are lacking. The morphospecies Micromonas pusilla, a marine unicellular green alga, is the most ubiquitous and cosmopolitan picoeukaryote described to date. This species comprises several independent genetic lineages or clades, which are not currently distinguishable based on comparison of their morphology or biogeographical distribution. Molecular probes were used to detect and quantify the genetic clades of M. pusilla in samples from temperate, polar and tropical environments in order to assess potential ecological niche partitioning. The three clades were detected in all biogeographical regions studied and were commonly found in sympatry. Cell abundances recorded for clades A and B were high, especially at coastal stations. Clade C, when detected, was always at low abundances and is suggested to be a low-light clade. Shifts in the contribution of clades to total M. pusilla abundance were observed along environmental gradients, both at local and basin-wide scales. This suggests that the phylogenetic clades occupy specific niches and confirms the existence of cryptic species within the morphospecies M. pusilla. Parameters which can precisely explain the distribution of these cryptic species remain to be elucidated.

  15. Growth and Metabolism of the Green Alga, Chlorella Pyrenoidosa, in Simulated Microgravity

    NASA Technical Reports Server (NTRS)

    Mills, W. Ronald


    The effect of microgravity on living organisms during space flight has been a topic of interest for some time, and a substantial body of knowledge on the subject has accumulated. Despite this, comparatively little information is available regarding the influence of microgravity on algae, even though it has been suggested for long duration flight or occupancy in space that plant growth systems, including both higher plants and algae, are likely to be necessary for bioregenerative life support systems. High-Aspect-Ratio Rotating-Wall Vessel or HARV bioreactors developed at Johnson Space Center provide a laboratory-based approach to investigating the effects of microgravity on cellular reactions. In this study, the HARV bioreactor was used to examine the influence of simulated microgravity on the growth and metabolism of the green alga, Chlorella pyrenoidosa. After the first 2 days of culture, cell numbers increased more slowly in simulated microgravity than in the HARV gravity control; after 7 days, growth in simulated microgravity was just over half (58%) that of the gravity control and at 14 days it was less than half (42%). Chlorophyll and protein were also followed as indices of cell competence and function; as with growth, after 2-3 days, protein and chlorophyll levels were reduced in modeled microgravity compared to gravity controls. Photosynthesis is a sensitive biochemical index of the fitness of photosynthetic organisms; thus, CO2-dependent O2 evolution was tested as a measure of photosynthetic capacity of cells grown in simulated microgravity. When data were expressed with respect to cell number, modeled microgravity appeared to have little effect on CO2 fixation. Thus, even though the overall growth rate was lower for cells cultured in microgravity, the photosynthetic capacity of the cells appears to be unaffected. Cells grown in simulated microgravity formed loose clumps or aggregates within about 2 days of culture, with aggregation increasing over time

  16. Light-driven Uptake of Oxygen, Carbon Dioxide, and Bicarbonate by the Green Alga Scenedesmus12

    PubMed Central

    Radmer, Richard; Ollinger, Otto


    Mass spectrometric techniques were used to study several aspects of the competition between O2 and species of inorganic carbon for photosynthetically generated reducing power in the green alga, Scenedesmus. In contrast to wild type, no appreciable light-driven O2 uptake was observed in a mutant lacking photosystem I. It is concluded that the carbon cycle-independent reduction of O2 occurs at the expense of photosystem I-generated reducing equivalents. The commonly observed differences between CO2-grown and air-grown Scenedesmus with respect to CO2 uptake and glycolate formation cannot be ascribed to differences in their capacity for light-driven O2 uptake. There were no intrinsic differences found in O2 uptake capacity between the two physiological types under conditions in which CO2 was saturating or CO2 uptake was inhibited. It was only under CO2-limited conditions that pronounced differences between the two physiological types were observed. This fact suggests that differences in O2 metabolism and sensitivity between the two types really reflect differences in their capacity to assimilate inorganic carbon; in this respect they are analogous to C3 and C4 plants. The hypothesis that air-grown Scenedesmus can assimilate HCO3− by directly monitoring the time course of dissolved CO2, O2 uptake, and O2 evolution in illuminated algal suspensions at alkaline pH was tested. Inasmuch as the measuring technique employed was fast compared to the nonenzymic equilibration of the inorganic carbon species, it was possible to determine the degree to which the CO2 concentration deviated from equilibrium (with the other inorganic carbon species) during the course of illumination. The observed kinetics in air-grown and CO2-grown algae in the presence and absence of carbonic anhydrase, and a comparison of these kinetics with theoretical (computer-generated) time courses, support the idea that air-adapted algae are able to assimilate HCO3− actively at a high rate. The data

  17. Aniline blue and Calcofluor white staining of callose and cellulose in the streptophyte green algae Zygnema and Klebsormidium

    PubMed Central

    Herburger, Klaus; Holzinger, Andreas


    Plant including green algal cells are surrounded by a cell wall, which is a diverse composite of complex polysaccharides and crucial for their function and survival. Here we describe two simple protocols to visualize callose (β-1→3-glucan) and cellulose (β-1→4-glucan) and related polysaccharides in the cell walls of streptophyte green algae by using standard dyes and epifluorescence microscopy. PMID:27785458

  18. Semi-continuous methane production from undiluted brown algae using a halophilic marine microbial community.


    Miura, Toyokazu; Kita, Akihisa; Okamura, Yoshiko; Aki, Tsunehiro; Matsumura, Yukihiko; Tajima, Takahisa; Kato, Junichi; Nakashimada, Yutaka


    Acclimated marine sediment-derived culture was used for semi-continuous methane production from materials equivalent to raw brown algae, without dilution of salinity and without nutrient supply, under 3 consecutive conditions of varying organic loading rates (OLRs) and hydraulic retention time (HRT). Methane production was stable at 2.0gVS/kg/day (39-day HRT); however, it became unstable at 2.9gVS/kg/day (28-day HRT) due to acetate and propionate accumulation. OLR subsequently decreased to 1.7gVS/kg/day (46-day HRT), stabilizing methane production beyond steady state. Methane yield was above 300mL/g VS at all OLRs. These results indicated that the acclimated marine sediment culture was able to produce methane semi-continuously from raw brown algae without dilution and nutrient supply under steady state. Microbial community analysis suggested that hydrogenotrophic methanogens predominated among archaea during unstable methane production, implying a partial shift of the methanogenic pathway from acetoclastic methanogenesis to acetate oxidation.

  19. Identification of copper-induced genes in the marine alga Ulva compressa (Chlorophyta).


    Contreras-Porcia, Loretto; Dennett, Geraldine; González, Alberto; Vergara, Eva; Medina, Cristóbal; Correa, Juan A; Moenne, Alejandra


    In order to identify genes/proteins involved in copper tolerance, the marine alga Ulva compressa was cultivated with 10 μM copper for 3 days. The activities of antioxidant enzymes ascorbate peroxidase (AP), peroxiredoxin (PRX), thioredoxin (TRX), and glutathione-S-transferase (GST) and the level of lipoperoxides were determined in the alga cultivated with and without copper addition. Antioxidant enzyme activities and lipoperoxides level increased in response to copper excess, indicating that the alga was under oxidative stress. A cDNA library was prepared using U. compressa cultivated with 10 μM copper for 3 days. A total of 3 × 10(4) clones were isolated and 480 clones were sequenced, resulting in 235 non-redundant ESTs, of which 104 encode proteins with known functions. Among them, we identified proteins involved in (1) antioxidant metabolism such as AP, PRX, TRX, GST, and metalothionein (MET), (2) signal transduction, such as calmodulin (CAM), (3) calcium-dependent protein kinase (CDPK) and nucleoside diphosphate kinase (NDK), (4) gene expression, (5) protein synthesis and degradation, and (6) chloroplast and mitochondria electron transport chains. Half of the identified proteins are potentially localized in organelles. The relative level of 18 genes, including those coding for AP, PRX, TRX, GST, MET, CAM, CDPK, and NDK were determined by quantitative RT-PCR in the alga cultivated with 10 μM copper for 0 to 7 days. Transcript levels increased in response to copper stress and most of them reached a maximum at days 3 and 5. Thus, the selected genes are induced by copper stress and they are probably involved in copper acclimation and tolerance.

  20. Late Miocene threshold response of marine algae to carbon dioxide limitation.


    Bolton, Clara T; Stoll, Heather M


    Coccolithophores are marine algae that use carbon for calcification and photosynthesis. The long-term adaptation of these and other marine algae to decreasing carbon dioxide levels during the Cenozoic era has resulted in modern algae capable of actively enhancing carbon dioxide at the site of photosynthesis. This enhancement occurs through the transport of dissolved bicarbonate (HCO3(-)) and with the help of enzymes whose expression can be modulated by variable aqueous carbon dioxide concentration, [CO2], in laboratory cultures. Coccolithophores preserve the geological history of this adaptation because the stable carbon and oxygen isotopic compositions of their calcite plates (coccoliths), which are preserved in the fossil record, are sensitive to active carbon uptake and transport by the cell. Here we use a model of cellular carbon fluxes and show that at low [CO2] the increased demand for HCO3(-) at the site of photosynthesis results in a diminished allocation of HCO3(-) to calcification, which is most pronounced in larger cells. This results in a large divergence between the carbon isotopic compositions of small versus large coccoliths only at low [CO2]. Our evaluation of the oxygen and carbon isotope record of size-separated fossil coccoliths reveals that this isotopic divergence first arose during the late Miocene to the earliest Pliocene epoch (about 7-5 million years ago). We interpret this to be a threshold response of the cells' carbon acquisition strategies to decreasing [CO2]. The documented coccolithophore response is synchronous with a global shift in terrestrial vegetation distribution between 8 and 5 Myr ago, which has been interpreted by some studies as a floral response to decreasing partial pressures of carbon dioxide () in the atmosphere. We infer a global decrease in carbon dioxide levels for this time interval that has not yet been identified in the sparse proxy record but is synchronous with global cooling and progressive glaciations.

  1. Effects of artificial sweeteners on metal bioconcentration and toxicity on a green algae Scenedesmus obliquus.


    Hu, Hongwei; Deng, Yuanyuan; Fan, Yunfei; Zhang, Pengfei; Sun, Hongwen; Gan, Zhiwei; Zhu, Hongkai; Yao, Yiming


    The ecotoxicity of heavy metals depends much on their speciation, which is influenced by other co-existing substances having chelating capacity. In the present study, the toxic effects of Cd(2+) and Cu(2+) on a green algae Scenedesmus obliquus were examined in the presence of two artificial sweeteners (ASs), acesulfame (ACE) and sucralose (SUC) by comparing the cell specific growth rate μ and pulse-amplitude-modulated (PAM) parameters (maximal photosystem II photochemical efficiency Fv/Fm, actual photochemical efficiency Yield, and non-photochemical quenching NPQ) of the algae over a 96-h period. Simultaneously, the bioconcentration of the metals by the algal cells in the presence of the ASs was measured. The presence of ACE enhanced the growth of S. obliquus and promoted the bioconcentration of Cd(2+) in S. obliquus, while the impacts of SUC were not significant. Meanwhile, EC50 values of Cd(2+) on the growth of S. obliquus increased from 0.42 mg/L to 0.54 mg/L and 0.48 mg/L with the addition of 1.0 mg/L ACE and SUC, respectively. As for Cu(2+), EC50 values increased from 0.13 mg/L to 0.17 mg/L and 0.15 mg/L with the addition of 1.0 mg/L ACE and SUC, respectively. In summary, the two ASs reduced the toxicity of the metals on the algae, with ACE showing greater effect than SUC. Although not as sensitive as the cell specific growth rate, PAM parameters could disclose the mechanisms involved in metal toxicity at subcellular levels. This study provides the first evidence for the possible impact of ASs on the ecotoxicity of heavy metals. PMID:26915590

  2. The vegetative arctic freshwater green alga Zygnema is insensitive to experimental UV exposure.


    Holzinger, Andreas; Roleda, Michael Y; Lütz, Cornelius


    The physiological performance and ultrastructural integrity of the vegetative freshwater green alga Zygnema sp., growing under ambient polar day solar radiation and after exposure to experimentally low radiation, but with high UVR:PAR ratio were investigated. In the laboratory, algae were exposed to low photosynthetic active radiation (PAR=P, 400-700 nm, 20 micromol m(-2) s(-1)), PAR + UV-A = PA (320-400 nm, 4.00 W m(-2) = UV-A) and PAR + UV-A + UV-B = PAB (280-320 nm, 0.42 W m(-2) = UV-B) for 24 h at 7 degrees C. Photosynthetic performance and ultrastructure of ambient solar radiation-exposed (field control) and experimentally treated Zygnema samples were assessed using chlorophyll fluorescence, and transmission electron microscopy (TEM). No significant treatment effect was observed in the photosynthesis-irradiance curve parameters. Exclusion of the UV-B spectrum in the laboratory treatment caused significantly lower effective photosynthetic quantum yield compared to samples exposed to the whole radiation spectrum. TEM revealed no obvious differences in the ultrastructure of field control and laboratory P-, PA- and PAB-exposed samples. Substantial amounts of lipid bodies, visualized by Sudan IV staining, were observed in all samples. Chloroplasts contained numerous plastoglobules. Organelles like mitochondria, Golgi bodies and the nucleus remained unaffected by the radiation exposures. Zygnema is well adapted to ambient solar radiation, enabling the alga to cope with experimental UV exposure and it is expected to persist in a scenario with enhanced UV radiation caused by stratospheric ozone depletion.

  3. Effects of artificial sweeteners on metal bioconcentration and toxicity on a green algae Scenedesmus obliquus.


    Hu, Hongwei; Deng, Yuanyuan; Fan, Yunfei; Zhang, Pengfei; Sun, Hongwen; Gan, Zhiwei; Zhu, Hongkai; Yao, Yiming


    The ecotoxicity of heavy metals depends much on their speciation, which is influenced by other co-existing substances having chelating capacity. In the present study, the toxic effects of Cd(2+) and Cu(2+) on a green algae Scenedesmus obliquus were examined in the presence of two artificial sweeteners (ASs), acesulfame (ACE) and sucralose (SUC) by comparing the cell specific growth rate μ and pulse-amplitude-modulated (PAM) parameters (maximal photosystem II photochemical efficiency Fv/Fm, actual photochemical efficiency Yield, and non-photochemical quenching NPQ) of the algae over a 96-h period. Simultaneously, the bioconcentration of the metals by the algal cells in the presence of the ASs was measured. The presence of ACE enhanced the growth of S. obliquus and promoted the bioconcentration of Cd(2+) in S. obliquus, while the impacts of SUC were not significant. Meanwhile, EC50 values of Cd(2+) on the growth of S. obliquus increased from 0.42 mg/L to 0.54 mg/L and 0.48 mg/L with the addition of 1.0 mg/L ACE and SUC, respectively. As for Cu(2+), EC50 values increased from 0.13 mg/L to 0.17 mg/L and 0.15 mg/L with the addition of 1.0 mg/L ACE and SUC, respectively. In summary, the two ASs reduced the toxicity of the metals on the algae, with ACE showing greater effect than SUC. Although not as sensitive as the cell specific growth rate, PAM parameters could disclose the mechanisms involved in metal toxicity at subcellular levels. This study provides the first evidence for the possible impact of ASs on the ecotoxicity of heavy metals.

  4. Cultivation of green algae Chlorella sp. in different wastewaters from municipal wastewater treatment plant.


    Wang, Liang; Min, Min; Li, Yecong; Chen, Paul; Chen, Yifeng; Liu, Yuhuan; Wang, Yingkuan; Ruan, Roger


    The objective of this study was to evaluate the growth of green algae Chlorella sp. on wastewaters sampled from four different points of the treatment process flow of a local municipal wastewater treatment plant (MWTP) and how well the algal growth removed nitrogen, phosphorus, chemical oxygen demand (COD), and metal ions from the wastewaters. The four wastewaters were wastewater before primary settling (#1 wastewater), wastewater after primary settling (#2 wastewater), wastewater after activated sludge tank (#3 wastewater), and centrate (#4 wastewater), which is the wastewater generated in sludge centrifuge. The average specific growth rates in the exponential period were 0.412, 0.429, 0.343, and 0.948 day(-1) for wastewaters #1, #2, #3, and #4, respectively. The removal rates of NH4-N were 82.4%, 74.7%, and 78.3% for wastewaters #1, #2, and #4, respectively. For #3 wastewater, 62.5% of NO3-N, the major inorganic nitrogen form, was removed with 6.3-fold of NO2-N generated. From wastewaters #1, #2, and #4, 83.2%, 90.6%, and 85.6% phosphorus and 50.9%, 56.5%, and 83.0% COD were removed, respectively. Only 4.7% was removed in #3 wastewater and the COD in #3 wastewater increased slightly after algal growth, probably due to the excretion of small photosynthetic organic molecules by algae. Metal ions, especially Al, Ca, Fe, Mg, and Mn in centrate, were found to be removed very efficiently. The results of this study suggest that growing algae in nutrient-rich centrate offers a new option of applying algal process in MWTP to manage the nutrient load for the aeration tank to which the centrate is returned, serving the dual roles of nutrient reduction and valuable biofuel feedstock production.

  5. Extraction of Nutraceuticals from Spirulina (Blue-Green Alga): A Bioorganic Chemistry Practice Using Thin-layer Chromatography

    ERIC Educational Resources Information Center

    Herrera Bravo de Laguna, Irma; Toledo Marante, Francisco J.; Luna-Freire, Kristerson R.; Mioso, Roberto


    Spirulina is a blue-green alga (cyanobacteria) with high nutritive value. This work provides an innovative and original approach to the consideration of a bioorganic chemistry practice, using Spirulina for the separation of phytochemicals with nutraceutical characteristics via thin-layer chromatography (TLC) plates. The aim is to bring together…

  6. Extraction of nutraceuticals from Spirulina (blue-green alga): A bioorganic chemistry practice using thin-layer chromatography.


    Herrera Bravo de Laguna, Irma; Toledo Marante, Francisco J; Luna-Freire, Kristerson R; Mioso, Roberto


    Spirulina is a blue-green alga (cyanobacteria) with high nutritive value. This work provides an innovative and original approach to the consideration of a bioorganic chemistry practice, using Spirulina for the separation of phytochemicals with nutraceutical characteristics via thin-layer chromatography (TLC) plates. The aim is to bring together current research, theory, and practice, and always in accordance with pedagogical ideas.

  7. Introduced rats indirectly change marine rocky intertidal communities from algae- to invertebrate-dominated

    PubMed Central

    Kurle, Carolyn M.; Croll, Donald A.; Tershy, Bernie R.


    It is widely recognized that trophic interactions structure ecological communities, but their effects are usually only demonstrated on a small scale. As a result, landscape-level documentations of trophic cascades that alter entire communities are scarce. Islands invaded by animals provide natural experiment opportunities both to measure general trophic effects across large spatial scales and to determine the trophic roles of invasive species within native ecosystems. Studies addressing the trophic interactions of invasive species most often focus on their direct effects. To investigate both the presence of a landscape-level trophic cascade and the direct and indirect effects of an invasive species, we examined the impacts of Norway rats (Rattus norvegicus) introduced to the Aleutian Islands on marine bird densities and marine rocky intertidal community structures through surveys conducted on invaded and rat-free islands throughout the entire 1,900-km archipelago. Densities of birds that forage in the intertidal were higher on islands without rats. Marine intertidal invertebrates were more abundant on islands with rats, whereas fleshy algal cover was reduced. Our results demonstrate that invasive rats directly reduce bird densities through predation and significantly affect invertebrate and marine algal abundance in the rocky intertidal indirectly via a cross-community trophic cascade, unexpectedly changing the intertidal community structure from an algae- to an invertebrate-dominated system. PMID:18308929

  8. The Unicellular Green Alga Chlamydomonas reinhardtii as an Experimental System to Study Chloroplast RNA Metabolism

    NASA Astrophysics Data System (ADS)

    Nickelsen, J.; Kück, U.

    Chloroplasts are typical organelles of photoautotrophic eukaryotic cells which drive a variety of functions, including photosynthesis. For many years the unicellular green alga Chlamydomonas reinhardtii has served as an experimental organism for studying photosynthetic processes. The recent development of molecular tools for this organism together with efficient methods of genetic analysis and the availability of many photosynthesis mutants has now made this alga a powerful model system for the analysis of chloroplast biogenesis. For example, techniques have been developed to transfer recombinant DNA into both the nuclear and the chloroplast genome. This allows both complementation tests and analyses of gene functions in vivo. Moreover, site-specific DNA recombinations in the chloroplast allow targeted gene disruption experiments which enable a "reverse genetics" to be performed. The potential of the algal system for the study of chloroplast biogenesis is illustrated in this review by the description of regulatory systems of gene expression involved in organelle biogenesis. One example concerns the regulation of trans-splicing of chloroplast mRNAs, a process which is controlled by both multiple nuclear- and chloroplast-encoded factors. The second example involves the stabilization of chloroplast mRNAs. The available data lead us predict distinct RNA elements, which interact with trans-acting factors to protect the RNA against nucleolytic attacks.

  9. Fatty acid profiles of four filamentous green algae under varying culture conditions.


    Liu, Junzhuo; Vanormelingen, Pieter; Vyverman, Wim


    Although benthic filamentous algae are interesting targets for wastewater treatment and biotechnology, relatively little is known about their biochemical composition and variation in response to growth conditions. Fatty acid composition of four benthic filamentous green algae was determined in different culture conditions. Although the response was partly species-dependent, increasing culture age, nitrogen deprivation and dark exposure of stationary phase greatly increased both total fatty acid content (TFA) from 12-35 to 40-173mgg(-1) dry weight (DW) and the relative proportion of polyunsaturated fatty acids (PUFAs) from 21-58% to 55-87% of TFA, with dark exposure having the greatest effect. However, the main variation in fatty acid composition was between species, with Uronema being rich in C16:0 (2.3% of DW), Klebsormidium in C18:2ω6 (5.4% of DW) and Stigeoclonium in C18:3ω3 (11.1% of DW). This indicates the potential of the latter two species as potential sources of these PUFAs.

  10. Inhibition of target of rapamycin signaling by rapamycin in the unicellular green alga Chlamydomonas reinhardtii.


    Crespo, José L; Díaz-Troya, Sandra; Florencio, Francisco J


    The macrolide rapamycin specifically binds the 12-kD FK506-binding protein (FKBP12), and this complex potently inhibits the target of rapamycin (TOR) kinase. The identification of TOR in Arabidopsis (Arabidopsis thaliana) revealed that TOR is conserved in photosynthetic eukaryotes. However, research on TOR signaling in plants has been hampered by the natural resistance of plants to rapamycin. Here, we report TOR inactivation by rapamycin treatment in a photosynthetic organism. We identified and characterized TOR and FKBP12 homologs in the unicellular green alga Chlamydomonas reinhardtii. Whereas growth of wild-type Chlamydomonas cells is sensitive to rapamycin, cells lacking FKBP12 are fully resistant to the drug, indicating that this protein mediates rapamycin action to inhibit cell growth. Unlike its plant homolog, Chlamydomonas FKBP12 exhibits high affinity to rapamycin in vivo, which was increased by mutation of conserved residues in the drug-binding pocket. Furthermore, pull-down assays demonstrated that TOR binds FKBP12 in the presence of rapamycin. Finally, rapamycin treatment resulted in a pronounced increase of vacuole size that resembled autophagic-like processes. Thus, our findings suggest that Chlamydomonas cell growth is positively controlled by a conserved TOR kinase and establish this unicellular alga as a useful model system for studying TOR signaling in photosynthetic eukaryotes.

  11. Effect of Nanohexaconazole on Nitrogen Fixing Blue Green Algae and Bacteria.


    Kumar, Rajesh; Gopal, Madhuban; Pabbi, Sunil; Paul, Sangeeta; Alam, Md Imteyaz; Yadav, Saurabh; Nair, Kishore Kumar; Chauhan, Neetu; Srivastava, Chitra; Gogoi, Robin; Singh, Pradeep Kumar; Goswami, Arunava


    Nanohexaconazole is a highly efficient fungicide against Rhizoctonia solani. Nanoparticles are alleged to adversely affect the non-target organisms. In order to evaluate such concern, the present study was carried out to investigate the effect of nanohexaconazole and its commercial formulation on sensitive nitrogen fixing blue green algae (BGA) and bacteria. Various activities of algae and bacteria namely growth, N-fixation, N-assimilation, Indole acetic acid (IAA) production and phosphate solubilization were differently affected in the presence of hexaconazole. Although, there was stimulatory to slightly inhibitory effect on the growth measurable parameters of the organisms studied at the recommended dose of nanohexaconazole, but its higher dose was inhibitory to all these microorganisms. On the other hand, the recommended as well as higher dose of commercial hexaconazole showed much severe inhibition of growth and metabolic activity of these organisms as compared to the nano preparation. The uses of nanohexazconazole instead of hexaconazole as a fungicide will not only help to control various fungal pathogens but also sustain the growth and activity of these beneficial microorganisms for sustaining soil fertility and productivity. PMID:27398501

  12. Acute toxicity of butachlor and atrazine to freshwater green alga Scenedesmus obliquus and cladoceran Daphnia carinata.


    He, Hongzhi; Yu, Jing; Chen, Guikui; Li, Wenyang; He, Jinbo; Li, Huashou


    Both single and joint toxicity of atrazine and butachlor to freshwater green alga Scenedesmus obliquus and cladoceran Daphnia carinata isolated from South China were investigated in the present study. The 96 h-EC(50) values of atrazine and butachlor to S. obliquus were 0.0147 and 2.31 mg L(-1), while the 48 h-LC(50) values to D. carinata were 60.6 and 3.40 mg L(-1), respectively. These results suggest that atrazine could be highly toxic to S. obliquus and slightly toxic to D. carinata, while butachlor exhibits moderate toxicity to both organisms. The additive indexes of atrazine and butachlor mixtures were -2.68 (-3.02 to -2.32) to S. obliquus and 0.054 (-0.025 to 0.238) to D. carinata, respectively. Therefore, the joint action of two herbicides was significant antagonism to S. obliquus, while significant synergism was not shown to D. carinata. Moreover, significant linear correlation between the natural logarithm of herbicide concentrations and growth rates of alga S. obliquus was observed. Taken together, it is the first study reporting the toxicity endpoints for mixture of atrazine and butachlor against S. obliquus and D. carinata isolated from south China. The present results would be helpful to provide data to assess the ecological risk of both herbicides to aquatic organisms.

  13. Genotoxic effects of commercial formulations of Chlorpyrifos and Tebuconazole on green algae.


    Martinez, Ricardo Santiago; Di Marzio, Walter Darío; Sáenz, María Elena


    The alkaline single-cell gel electrophoresis assay (comet assay) was used for the study of the genotoxic effects of insecticide Chlorpyrifos and fungicide Tebuconazole (commercial formulations) on two freshwater green algae species, Pseudokirchneriella subcapitata and Nannocloris oculata, after 24 h of exposure. The percentage of DNA in tail of migrating nucleoids was taken as an endpoint of DNA impairment. Cell viability was measured by fluorometric detection of chlorophyll "a" in vivo and the determination of cell auto-fluorescence. Only the higher concentration of Chlorpyrifos tested resulted to affect significantly the cell viability of P. subcapitata, whereas cells of N. oculata were not affected. Tebuconazole assayed concentrations (3 and 6 mg/l) did not affect cell viability of both species. The results of comet assay on P. subcapitata showed that Chlorpyrifos concentration evaluated (0.8 mg/l) exerted a genotoxic effects; while for the other specie a concentration of 10 mg/l was needed. Tebuconazole was genotoxic at 3 and 6 mg/l for both species. The comet assay evidenced damage at the level of DNA simple strains molecule at pesticide concentrations were cytotoxicity was not evident, demonstrating that algae are models to take into account in ecological risk assessments for aquatic environments. PMID:25230876

  14. The influence of nitrogen on heterocyst production in blue-green algae

    USGS Publications Warehouse

    Ogawa, Roann E.; Carr, John F.


    A series of experiments on heterocyst production in Anabaena variabilis provides some strong indirect evidence for the role of heterocysts in nitrogen fixation. Of the algae tested (Anabaena variabilis, A. inaequalis, A. cylindrica, A. flos-aquae, Tolypothrix distorta, Gloeotrichia echinulata, Aphanizomenon flos-aquae, Oscillatoria sp., and Microcystis aeruginosa), only those with heterocysts grew in a nitrate-free medium. Growth in the nitrate-free medium was accompanied by an increase in heterocysts. Heterocyst formation in A. variabilis was evident 24 hr after transfer from a nitrate-containing to a nitrate-free medium. The number of heterocysts was altered by changes in the nitrogen source. Numbers were lowest when NH4-N was used as a nitrogen source and highest when nitrogen (N2-N) was derived from the atmosphere. Heterocyst numbers could also be regulated by controlling the concentration of NO3-N in the medium. Heterocyst production depended on the absence of combined nitrogen and the presence of phosphate. Data are presented on the occurrence of blue-green algae (with heterocysts) in Lake Erie and the environmental conditions apparently necessary for them to become dominant.

  15. Biosorption of lead from aqueous solutions by green algae Spirogyra species: kinetics and equilibrium studies.


    Gupta, V K; Rastogi, A


    Biosorption is the effective method for the removal of heavy metal ions from wastewaters. Results are presented showing the sorption of Pb(II) from solutions by biomass of commonly available, filamentous green algae Spirogyra sp. Batch experiments were conducted to determine the biosorption properties of the biomass and it was observed that the maximum adsorption capacity of Pb(II) ion was around 140mgmetal/g of biomass at pH 5.0 in 100min with 200mg/L of initial concentration. Temperature change in the range 20-40 degrees C affected the adsorption capacity and the nature of the reaction was found to be endothermic in nature. Uptake kinetics follows the pseudo-second-order model and equilibrium is well described by Langmuir isotherm. Isotherms have been used to determine thermodynamic parameters of the process, viz., free energy change, enthalpy change and entropy change. Various properties of the algae, as adsorbent, explored in the characterization part were chemical composition of the adsorbent, thermal analysis by TGA, surface area calculation by BET method, surface morphology with scanning electron microscope images and surface functionality by FTIR. FTIR analysis of algal biomass revealed the presence of amino, carboxyl, hydroxyl and carbonyl groups, which are responsible for biosorption of metal ions. The results indicated that the biomass of Spirogyra sp. is an efficient biosorbent for the removal of Pb(II) from aqueous solutions.

  16. Toxic effects of organic solvents on the growth of blue-green algae

    SciTech Connect

    Stratton, G.W.


    Relatively few reports have been published on the comparative toxicity of solvents towards test organisms, and these deal primarily with fish and aquatic invertebrates. Information for microbial systems are more limited with some data available for algae and slightly more for fungi. Aside from direct toxic effects of their own, solvents can interact synergistically and antagonistically with the toxicant in solution. This problem has been well documented with pesticides, and a procedure has been developed to identify and eliminate these effects from bioassays. The first step in choosing a solvent for use in microbial bioassays should be a detailed screening to identify solvents with inherently low toxicity to the test organism, followed by an interaction study to choose the best concentration to use. The purpose of the present study was to compare the inhibitory effects of six solvents commonly used in pesticide bioassays towards five species of blue-green algae (cyanobacteria), in order to identify solvents with low toxicity for use in bioassays.

  17. Purification and some properties of a trehalase from a green alga, Lobosphaera sp.


    Nakano, H; Moriwaki, M; Washino, T; Kino, T; Yoshizumi, H; Kitahata, S


    An unicellular green alga identified as Lobosphaera sp. by morphological observations was selected as a source of trehalase. The alga grew well heterotrophically and produced intracellular trehalase using Polypepton, yeast extract, and glycerol as nutrients. The enzyme was highly purified by ammonium sulfate fractionation, column chromatography on DEAE-Toyopearl, Sepharose CL-4B, and SP-Toyopearl. The molecular mass was estimated to be 400 kDa by gel filtration. SDS-PAGE indicated that the enzyme consisted of two subunits with a molecular mass range of 180-220 kDa and it contained carbohydrates. The enzyme was most active at pH 5.5 and at 65 degrees C and stable between pH 4-9 and below 65 degrees C. Fe3+ inactivated the enzyme. Sucrose was a competitive inhibitor with a Ki of 7.5 mM. The enzyme specifically hydrolyzed trehalase with a Km of 0.6 mM.

  18. Alternative photosynthetic electron transport pathways during anaerobiosis in the green alga Chlamydomonas reinhardtii.


    Hemschemeier, Anja; Happe, Thomas


    Oxygenic photosynthesis uses light as energy source to generate an oxidant powerful enough to oxidize water into oxygen, electrons and protons. Upon linear electron transport, electrons extracted from water are used to reduce NADP(+) to NADPH. The oxygen molecule has been integrated into the cellular metabolism, both as the most efficient electron acceptor during respiratory electron transport and as oxidant and/or "substrate" in a number of biosynthetic pathways. Though photosynthesis of higher plants, algae and cyanobacteria produces oxygen, there are conditions under which this type of photosynthesis operates under hypoxic or anaerobic conditions. In the unicellular green alga Chlamydomonas reinhardtii, this condition is induced by sulfur deficiency, and it results in the production of molecular hydrogen. Research on this biotechnologically relevant phenomenon has contributed largely to new insights into additional pathways of photosynthetic electron transport, which extend the former concept of linear electron flow by far. This review summarizes the recent knowledge about various electron sources and sinks of oxygenic photosynthesis besides water and NADP(+) in the context of their contribution to hydrogen photoproduction by C. reinhardtii. This article is part of a Special Issue entitled: Regulation of Electron Transport in Chloroplasts. PMID:21376011

  19. Effect of aluminum and zinc on enzyme activities in the green Alga Selenastrum capricorutum

    SciTech Connect

    Kong, F.X.; Chen, Y.


    Acid rain produced by atmospheric pollution may decrease the pH value of water and increase the availability and potential toxicity of metals in water which have detrimental effects on aquatic organism, including algae, the important component of the primary production, and, thus, the entire aquatic food chain. Recent reviews of the effects of acid rain on freshwater ecosystems have emphasized research interest in soluble trivalent aluminum, although Al is rated low among trace metals in biological importance. On the other hand, zinc is an important trace element for the growth of phytoplankton and the cofactor of some enzymes. The growth response and tolerance of different species of algae to Al and Zn have been reported by Whitton who showed that algal growth would be stimulated by lower levels of the metals and totally inhibited by higher levels. These is little information, however, on the effect of Al on biochemical processes in aquatic organisms. This study investigates the influence of aluminum and zinc on several physioclogical processes in S. capricournutum, a common species of green algal in lake water. Algal growth (dry weight), ATP levels and the activities of several enzymes in the algal cells were measured after the treatment with various concentrations of Al and Zn in culture medium. Special attention is given to the relation between the enzymatic response and algal growth. 15 refs., 2 figs., 1 tab.

  20. Lineage-specific fragmentation and nuclear relocation of the mitochondrial cox2 gene in chlorophycean green algae (Chlorophyta).


    Rodríguez-Salinas, Elizabeth; Riveros-Rosas, Héctor; Li, Zhongkui; Fucíková, Karolina; Brand, Jerry J; Lewis, Louise A; González-Halphen, Diego


    In most eukaryotes the subunit 2 of cytochrome c oxidase (COX2) is encoded in intact mitochondrial genes. Some green algae, however, exhibit split cox2 genes (cox2a and cox2b) encoding two polypeptides (COX2A and COX2B) that form a heterodimeric COX2 subunit. Here, we analyzed the distribution of intact and split cox2 gene sequences in 39 phylogenetically diverse green algae in phylum Chlorophyta obtained from databases (28 sequences from 22 taxa) and from new cox2 data generated in this work (23 sequences from 18 taxa). Our results support previous observations based on a smaller number of taxa, indicating that algae in classes Prasinophyceae, Ulvophyceae, and Trebouxiophyceae contain orthodox, intact mitochondrial cox2 genes. In contrast, all of the algae in Chlorophyceae that we examined exhibited split cox2 genes, and could be separated into two groups: one that has a mitochondrion-localized cox2a gene and a nucleus-localized cox2b gene ("Scenedesmus-like"), and another that has both cox2a and cox2b genes in the nucleus ("Chlamydomonas-like"). The location of the split cox2a and cox2b genes was inferred using five different criteria: differences in amino acid sequences, codon usage (mitochondrial vs. nuclear), codon preference (third position frequencies), presence of nucleotide sequences encoding mitochondrial targeting sequences and presence of spliceosomal introns. Distinct green algae could be grouped according to the form of cox2 gene they contain: intact or fragmented, mitochondrion- or nucleus-localized, and intron-containing or intron-less. We present a model describing the events that led to mitochondrial cox2 gene fragmentation and the independent and sequential migration of cox2a and cox2b genes to the nucleus in chlorophycean green algae. We also suggest that the distribution of the different forms of the cox2 gene provides important insights into the phylogenetic relationships among major groups of Chlorophyceae.

  1. Vesicular trafficking in characean green algae and the possible involvement of a VAMP72-family protein.


    Hoepflinger, Marion; Hametner, Christina; Ueda, Takashi; Foissner, Ilse


    The RAB5 GTPase ARA6 (AtARA6) of Arabidopsis thaliana is known to be involved in endosomal trafficking by targeting vesicles to the plasma membrane. During this process AtARA6 is working in close relationship with the SNARE protein VAMP727 (vesicle associated membrane protein 727). Recently, ARA6 of the characean green algae Chara australis (CaARA6) was shown to have properties similar to AtARA6, pointing to similar trafficking pathways. In order to gain further insight into the vesicle trafficking machinery of characeae, C. australis was analyzed for homologous proteins of the VAMP72-family. A CaVAMP72 protein was detected and classified by protein sequence alignment and phylogenetic analyses.

  2. Vesicular trafficking in characean green algae and the possible involvement of a VAMP72-family protein.


    Hoepflinger, Marion C; Hametner, Christina; Ueda, Takashi; Foissner, Ilse


    The RAB5 GTPase ARA6 of Arabidopsis thaliana is known to be involved in endosomal trafficking by targeting vesicles to the plasma membrane. During this process AtARA6 is working in close relationship with the SNARE protein VAMP727 (vesicle associated membrane protein 727). Recently, ARA6 of the characean green algae Chara australis (CaARA6) was shown to have properties similar to AtARA6, pointing to similar trafficking pathways. In order to gain further insight into the vesicle trafficking machinery of Characeae, C. australis was analyzed for homologous proteins of the VAMP72-family. A CaVAMP72 protein was detected and classified by protein sequence alignment and phylogenetic analyses.

  3. Multi-Level Light Capture Control in Plants and Green Algae.


    Wobbe, Lutz; Bassi, Roberto; Kruse, Olaf


    Life on Earth relies on photosynthesis, and the ongoing depletion of fossil carbon fuels has renewed interest in phototrophic light-energy conversion processes as a blueprint for the conversion of atmospheric CO2 into various organic compounds. Light-harvesting systems have evolved in plants and green algae, which are adapted to the light intensity and spectral composition encountered in their habitats. These organisms are constantly challenged by a fluctuating light supply and other environmental cues affecting photosynthetic performance. Excess light can be especially harmful, but plants and microalgae are equipped with different acclimation mechanisms to control the processing of sunlight absorbed at both photosystems. We summarize the current knowledge and discuss the potential for optimization of phototrophic light-energy conversion. PMID:26545578

  4. Uptake of Inorganic Carbon by Isolated Chloroplasts of the Unicellular Green Alga Chlorella ellipsoidea1

    PubMed Central

    Rotatore, Caterina; Colman, Brian


    Chloroplasts, isolated from protoplasts of the green alga, Chlorella ellipsoidea, were estimated to be 99% intact by the ferricyanide-reduction assay, and gave CO2 and PGA-dependent rates of O2 evolution of 64.5 to 150 micromoles per milligram of chlorophyll per hour, that is 30 to 70% of the photosynthetic activity of the parent cells. Intact chloroplasts showed no carbonic anhydrase activity, but it was detected in preparations of ruptured organelles. Rates of photosynthesis, measured in a closed system at pH 7.5, were twice the calculated rate of CO2 supply from the uncatalyzed dehydration of HCO3− indicating a direct uptake of bicarbonate by the intact chloroplasts. Mass spectrometric measurements of CO2 depletion from the medium on the illumination of chloroplasts indicate the lack of an active CO2 transport across the chloroplast envelope. PMID:16667662

  5. Predictive modeling studies for the ecotoxicity of ionic liquids towards the green algae Scenedesmus vacuolatus.


    Das, Rudra Narayan; Roy, Kunal


    Hazardous potential of ionic liquids is becoming an issue of high concern with increasing application of these compounds in various industrial processes. Predictive toxicological modeling on ionic liquids provides a rational assessment strategy and aids in developing suitable guidance for designing novel analogues. The present study attempts to explore the chemical features of ionic liquids responsible for their ecotoxicity towards the green algae Scenedesmus vacuolatus by developing mathematical models using extended topochemical atom (ETA) indices along with other categories of chemical descriptors. The entire study has been conducted with reference to the OECD guidelines for QSAR model development using predictive classification and regression modeling strategies. The best models from both the analyses showed that ecotoxicity of ionic liquids can be decreased by reducing chain length of cationic substituents and increasing hydrogen bond donor feature in cations, and replacing bulky unsaturated anions with simple saturated moiety having less lipophilic heteroatoms.

  6. Spirulan from blue-green algae inhibits fibrin and blood clots: its potent antithrombotic effects.


    Choi, Jun-Hui; Kim, Seung; Kim, Sung-Jun


    We investigated in vitro and in vivo fibrinolytic and antithrombotic activity of spirulan and analyzed its partial biochemical properties. Spirulan, a sulfated polysaccharide from the blue-green alga Arthrospira platensis, exhibits antithrombotic potency. Spirulan showed a strong fibrin zymogram lysis band corresponding to its molecular mass. It specifically cleaved Aα and Bβ, the major chains of fibrinogen. Spirulan directly decreased the activity of thrombin and factor X activated (FXa), procoagulant proteins. In vitro assays using human fibrin and mouse blood clots showed fibrinolytic and hemolytic activities of spirulan. Spirulan (2 mg/kg) showed antithrombotic effects in the ferric chloride (FeCl3 )-induced carotid arterial thrombus model and collagen and epinephrine-induced pulmonary thromboembolism mouse model. These results may be attributable to the prevention of thrombus formation and partial lysis of thrombus. Therefore, we suggest that spirulan may be a potential antithrombotic agent for thrombosis-related diseases. PMID:25651404

  7. Total lipid production of the green alga Nannochloropsis sp. QII under different nitrogen regimes

    SciTech Connect

    Suen, Yu.; Hubbard, J.S.; Holzer, G.; Tornabene, T.G.


    The green alga Nannochloropsis sp. QII was cultivated in media with sufficient and growth-limiting levels of nitrogen (nitrate). Nitrogen deficiency promoted lipid synthesis yielding cells with lipids comprising 55% of the biomass. The major lipids were triacylglycerols (79%), polar lipids (9%) and hydrocarbons (2.5%). The polar lipids consisted of a broad range of phospholipids, glycolipids and sulfolipids. Other lipids identified were pigments, free fatty acids, saponifiable and unsaponifiable sterol derivatives, various glycerides, a family of alkyl-1, 4-dioxane derivatives and a series of alkyl- and hydroxy-alkyl-dimethyl-acetals. Experiments in which /sup 14/CO/sub 2/ was provided at different times in the growth cycle demonstrated that enhanced lipid biosynthesis at low nitrogen levels resulted principally from de novo CO/sub 2/ fixation.

  8. Vesicular trafficking in characean green algae and the possible involvement of a VAMP72-family protein.


    Hoepflinger, Marion; Hametner, Christina; Ueda, Takashi; Foissner, Ilse


    The RAB5 GTPase ARA6 (AtARA6) of Arabidopsis thaliana is known to be involved in endosomal trafficking by targeting vesicles to the plasma membrane. During this process AtARA6 is working in close relationship with the SNARE protein VAMP727 (vesicle associated membrane protein 727). Recently, ARA6 of the characean green algae Chara australis (CaARA6) was shown to have properties similar to AtARA6, pointing to similar trafficking pathways. In order to gain further insight into the vesicle trafficking machinery of characeae, C. australis was analyzed for homologous proteins of the VAMP72-family. A CaVAMP72 protein was detected and classified by protein sequence alignment and phylogenetic analyses. PMID:24614164

  9. Vesicular trafficking in characean green algae and the possible involvement of a VAMP72-family protein.


    Hoepflinger, Marion C; Hametner, Christina; Ueda, Takashi; Foissner, Ilse


    The RAB5 GTPase ARA6 of Arabidopsis thaliana is known to be involved in endosomal trafficking by targeting vesicles to the plasma membrane. During this process AtARA6 is working in close relationship with the SNARE protein VAMP727 (vesicle associated membrane protein 727). Recently, ARA6 of the characean green algae Chara australis (CaARA6) was shown to have properties similar to AtARA6, pointing to similar trafficking pathways. In order to gain further insight into the vesicle trafficking machinery of Characeae, C. australis was analyzed for homologous proteins of the VAMP72-family. A CaVAMP72 protein was detected and classified by protein sequence alignment and phylogenetic analyses. PMID:25764429

  10. Assessment of blue-green algae in substantially reducing nitrogen fertilizer requirements for biomass fuel crops

    SciTech Connect

    Anderson, D.B.; Molten, P.M.; Metting, B.


    Laboratory, mass culture, and field studies are being undertaken in order to assess the potential of using blue-green algae (cyanobacteria) as nitrogen biofertilizers on irrigated ground. Of seven candidate strains, two were chosen for application to replicated field plots sown to field corn and the basis of laboratory-scale soil tray experiments and ease of semi-continuous 8000 l culture. Chosen were Anabaena BM-165, isolated from a local soil and Tolypothrix tenuis, imported from India. Using the acetylene reduction method, Anabaena is estimated from laboratory soil experiments to be able to fix from 30 to 62 kg N/ha/y, and has been mass cultured to a density of 1527 mg dry wt/l. T. tenuis is estimated from laboratory experiments to be able to fix from 27 to 65 kg N/ha/y, and has been mass cultured to a density of 1630 mg dry wt/l.

  11. Multi-Level Light Capture Control in Plants and Green Algae.


    Wobbe, Lutz; Bassi, Roberto; Kruse, Olaf


    Life on Earth relies on photosynthesis, and the ongoing depletion of fossil carbon fuels has renewed interest in phototrophic light-energy conversion processes as a blueprint for the conversion of atmospheric CO2 into various organic compounds. Light-harvesting systems have evolved in plants and green algae, which are adapted to the light intensity and spectral composition encountered in their habitats. These organisms are constantly challenged by a fluctuating light supply and other environmental cues affecting photosynthetic performance. Excess light can be especially harmful, but plants and microalgae are equipped with different acclimation mechanisms to control the processing of sunlight absorbed at both photosystems. We summarize the current knowledge and discuss the potential for optimization of phototrophic light-energy conversion.

  12. Blue green alga mediated synthesis of gold nanoparticles and its antibacterial efficacy against Gram positive organisms.


    Suganya, K S Uma; Govindaraju, K; Kumar, V Ganesh; Dhas, T Stalin; Karthick, V; Singaravelu, G; Elanchezhiyan, M


    Biofunctionalized gold nanoparticles (AuNPs) play an important role in design and development of nanomedicine. Synthesis of AuNPs from biogenic materials is environmentally benign and possesses high bacterial inhibition and bactericidal properties. In the present study, blue green alga Spirulina platensis protein mediated synthesis of AuNPs and its antibacterial activity against Gram positive bacteria is discussed. AuNPs were characterized using Ultraviolet-visible (UV-vis) spectroscopy, Fluorescence spectroscopy, Fourier Transform-Infrared (FTIR) spectroscopy, Raman spectroscopy, High Resolution-Transmission Electron Microscopy (HR-TEM) and Energy Dispersive X-ray analysis (EDAX). Stable, well defined AuNPs of smaller and uniform shape with an average size of ~ 5 nm were obtained. The antibacterial efficacy of protein functionalized AuNPs were tested against Gram positive organisms Bacillus subtilis and Staphylococcus aureus. PMID:25492207

  13. Synchronization of Green Algae by Light and Dark Regimes for Cell Cycle and Cell Division Studies.


    Hlavová, Monika; Vítová, Milada; Bišová, Kateřina


    A synchronous population of cells is one of the prerequisites for studying cell cycle processes such as DNA replication, nuclear and cellular division. Green algae dividing by multiple fission represent a unique single cell system enabling the preparation of highly synchronous cultures by application of a light-dark regime similar to what they experience in nature. This chapter provides detailed protocols for synchronization of different algal species by alternating light-dark cycles; all critical points are discussed extensively. Moreover, detailed information on basic analysis of cell cycle progression in such cultures is presented, including analyses of nuclear, cellular, and chloroplast divisions. Modifications of basic protocols that enable changes in cell cycle progression are also suggested so that nuclear or chloroplast divisions can be followed separately.

  14. The non-photosynthetic, pathogenic green alga Helicosporidium sp. has retained a modified, functional plastid genome.


    Tartar, Aurélien; Boucias, Drion G


    A fragment of the Helicosporidium sp. (Chlorophyta: Trebouxiophyceae) plastid genome has been sequenced. The genome architecture was compared to that of both a non-photosynthetic relative (Prototheca wickerhamii) and a photosynthetic relative (Chlorella vulgaris). Comparative genomic analysis indicated that Helicosporidium and Prototheca are closely related genera. The analyses also revealed that the Helicosporidium sp. plastid genome has been rearranged. In particular, two ribosomal protein-encoding genes (rpl19 and rps23) appeared to have been transposed, or lost from the Helicosporidium sp. plastid genome. RT-PCR reactions demonstrated that the retained plastid genes were transcribed, suggesting that, despite rearrangement(s), the Helicosporidium sp. plastid genome has remained functional. The modified plastid genome architecture is a novel apomorphy that indicates that the Helicosporidia are highly derived green algae, more so than Prototheca spp. As such, they represent a promising model to study organellar genome reorganizations in parasitic protists.

  15. Viruses of eukaryotic green algae; Progress report, June 20, 1990--July 1, 1991

    SciTech Connect

    Van Etten, J.L.


    Many large polyhedral, dsDNA containing (ca. 330 kb), plaque forming viruses which infect a unicellular, eukaryotic, chlorella-like green alga have been isolated and characterized. The plaque assay, the ability to synchronously infect the host, the short life cycle, and the ability of the viruses to undergo homologous recombination make them excellent model systems for studying many plant cell functions in the manner that bacterial and animal viruses have been used to study bacterial and animal cell functions. These viruses have several unique features including: (1) coding for DNA methyltransferase and site-specific (restriction) endonucleases and (2) unlike other viruses, these viruses appear to code for the enzymes involved in the glycosylation of their glycoproteins.

  16. Novel shuttle markers for nuclear transformation of the green alga Chlamydomonas reinhardtii.


    Meslet-Cladière, Laurence; Vallon, Olivier


    The green alga Chlamydomonas reinhardtii today is a premier model organism for the study of green algae and plants. Yet the efficient engineering of its nuclear genome requires development of new antibiotic resistance markers. We have recoded, based on codon usage in the nuclear genome, the AadA marker that has been used previously for chloroplast transformation. The recoded AadA gene, placed under the control of the HSP70A-RBCS2 hybrid promoter and preceded by the RbcS2 chloroplast-targeting peptide, can be integrated into the nuclear genome by electroporation, conferring resistance to spectinomycin and streptomycin. Transformation efficiency is markedly increased when vector sequences are completely eliminated from the transforming DNA. Antibiotic resistance is stable for several months in the absence of selection pressure. Shuttle markers allowing selection in both Chlamydomonas and Escherichia coli would also be a useful asset. By placing an artificial bacterial promoter and Shine-Dalgarno sequence in frame within the AadA coding sequence, we generated such a shuttle marker. To our surprise, we found that the classical AphVIII construct already functions as a shuttle marker. Finally, we developed a method to introduce the AadA and AphVIII markers into the vector part of the bacterial artificial chromosomes (BACs) of the Chlamydomonas genomic DNA library. Our aim was to facilitate complementation studies whenever the test gene cannot be selected for directly. After transformation of a petC mutant with a modified BAC carrying the AphVIII marker along with the PETC gene in the insert, almost half of the paromomycin-resistant transformants obtained showed restoration of phototrophy, indicating successful integration of the unselected test gene. With AadA, cotransformation was also observed, but with a lower efficiency.

  17. Pectin metabolism and assembly in the cell wall of the charophyte green alga Penium margaritaceum.


    Domozych, David S; Sørensen, Iben; Popper, Zoë A; Ochs, Julie; Andreas, Amanda; Fangel, Jonatan U; Pielach, Anna; Sacks, Carly; Brechka, Hannah; Ruisi-Besares, Pia; Willats, William G T; Rose, Jocelyn K C


    The pectin polymer homogalacturonan (HG) is a major component of land plant cell walls and is especially abundant in the middle lamella. Current models suggest that HG is deposited into the wall as a highly methylesterified polymer, demethylesterified by pectin methylesterase enzymes and cross-linked by calcium ions to form a gel. However, this idea is based largely on indirect evidence and in vitro studies. We took advantage of the wall architecture of the unicellular alga Penium margaritaceum, which forms an elaborate calcium cross-linked HG-rich lattice on its cell surface, to test this model and other aspects of pectin dynamics. Studies of live cells and microscopic imaging of wall domains confirmed that the degree of methylesterification and sufficient levels of calcium are critical for lattice formation in vivo. Pectinase treatments of live cells and immunological studies suggested the presence of another class of pectin polymer, rhamnogalacturonan I, and indicated its colocalization and structural association with HG. Carbohydrate microarray analysis of the walls of P. margaritaceum, Physcomitrella patens, and Arabidopsis (Arabidopsis thaliana) further suggested the conservation of pectin organization and interpolymer associations in the walls of green plants. The individual constituent HG polymers also have a similar size and branched structure to those of embryophytes. The HG-rich lattice of P. margaritaceum, a member of the charophyte green algae, the immediate ancestors of land plants, was shown to be important for cell adhesion. Therefore, the calcium-HG gel at the cell surface may represent an early evolutionary innovation that paved the way for an adhesive middle lamella in multicellular land plants. PMID:24652345

  18. Novel shuttle markers for nuclear transformation of the green alga Chlamydomonas reinhardtii.


    Meslet-Cladière, Laurence; Vallon, Olivier


    The green alga Chlamydomonas reinhardtii today is a premier model organism for the study of green algae and plants. Yet the efficient engineering of its nuclear genome requires development of new antibiotic resistance markers. We have recoded, based on codon usage in the nuclear genome, the AadA marker that has been used previously for chloroplast transformation. The recoded AadA gene, placed under the control of the HSP70A-RBCS2 hybrid promoter and preceded by the RbcS2 chloroplast-targeting peptide, can be integrated into the nuclear genome by electroporation, conferring resistance to spectinomycin and streptomycin. Transformation efficiency is markedly increased when vector sequences are completely eliminated from the transforming DNA. Antibiotic resistance is stable for several months in the absence of selection pressure. Shuttle markers allowing selection in both Chlamydomonas and Escherichia coli would also be a useful asset. By placing an artificial bacterial promoter and Shine-Dalgarno sequence in frame within the AadA coding sequence, we generated such a shuttle marker. To our surprise, we found that the classical AphVIII construct already functions as a shuttle marker. Finally, we developed a method to introduce the AadA and AphVIII markers into the vector part of the bacterial artificial chromosomes (BACs) of the Chlamydomonas genomic DNA library. Our aim was to facilitate complementation studies whenever the test gene cannot be selected for directly. After transformation of a petC mutant with a modified BAC carrying the AphVIII marker along with the PETC gene in the insert, almost half of the paromomycin-resistant transformants obtained showed restoration of phototrophy, indicating successful integration of the unselected test gene. With AadA, cotransformation was also observed, but with a lower efficiency. PMID:22002656

  19. Transformation of the Green Alga Haematococcus pluvialis with a Phytoene Desaturase for Accelerated Astaxanthin Biosynthesis▿

    PubMed Central

    Steinbrenner, Jens; Sandmann, Gerhard


    Astaxanthin is a high-value carotenoid which is used as a pigmentation source in fish aquaculture. Additionally, a beneficial role of astaxanthin as a food supplement for humans has been suggested. The unicellular alga Haematococcus pluvialis is a suitable biological source for astaxanthin production. In the context of the strong biotechnological relevance of H. pluvialis, we developed a genetic transformation protocol for metabolic engineering of this green alga. First, the gene coding for the carotenoid biosynthesis enzyme phytoene desaturase was isolated from H. pluvialis and modified by site-directed mutagenesis, changing the leucine codon at position 504 to an arginine codon. In an in vitro assay, the modified phytoene desaturase was still active in conversion of phytoene to ζ-carotene and exhibited 43-fold-higher resistance to the bleaching herbicide norflurazon. Upon biolistic transformation using the modified phytoene desaturase gene as a reporter and selection with norflurazon, integration into the nuclear genome of H. pluvialis and phytoene desaturase gene and protein expression were demonstrated by Southern, Northern, and Western blotting, respectively, in 11 transformants. Some of the transformants had a higher carotenoid content in the green state, which correlated with increased nonphotochemical quenching. This measurement of chlorophyll fluorescence can be used as a screening procedure for stable transformants. Stress induction of astaxanthin biosynthesis by high light showed that there was accelerated accumulation of astaxanthin in one of the transformants compared to the accumulation in the wild type. Our results strongly indicate that the modified phytoene desaturase gene is a useful tool for genetic engineering of carotenoid biosynthesis in H. pluvialis. PMID:17012596

  20. Pectin metabolism and assembly in the cell wall of the charophyte green alga Penium margaritaceum.


    Domozych, David S; Sørensen, Iben; Popper, Zoë A; Ochs, Julie; Andreas, Amanda; Fangel, Jonatan U; Pielach, Anna; Sacks, Carly; Brechka, Hannah; Ruisi-Besares, Pia; Willats, William G T; Rose, Jocelyn K C


    The pectin polymer homogalacturonan (HG) is a major component of land plant cell walls and is especially abundant in the middle lamella. Current models suggest that HG is deposited into the wall as a highly methylesterified polymer, demethylesterified by pectin methylesterase enzymes and cross-linked by calcium ions to form a gel. However, this idea is based largely on indirect evidence and in vitro studies. We took advantage of the wall architecture of the unicellular alga Penium margaritaceum, which forms an elaborate calcium cross-linked HG-rich lattice on its cell surface, to test this model and other aspects of pectin dynamics. Studies of live cells and microscopic imaging of wall domains confirmed that the degree of methylesterification and sufficient levels of calcium are critical for lattice formation in vivo. Pectinase treatments of live cells and immunological studies suggested the presence of another class of pectin polymer, rhamnogalacturonan I, and indicated its colocalization and structural association with HG. Carbohydrate microarray analysis of the walls of P. margaritaceum, Physcomitrella patens, and Arabidopsis (Arabidopsis thaliana) further suggested the conservation of pectin organization and interpolymer associations in the walls of green plants. The individual constituent HG polymers also have a similar size and branched structure to those of embryophytes. The HG-rich lattice of P. margaritaceum, a member of the charophyte green algae, the immediate ancestors of land plants, was shown to be important for cell adhesion. Therefore, the calcium-HG gel at the cell surface may represent an early evolutionary innovation that paved the way for an adhesive middle lamella in multicellular land plants.

  1. Triclosan causes toxic effects to algae in marine biofilms, but does not inhibit the metabolic activity of marine biofilm bacteria.


    Johansson, C Henrik; Janmar, Lisa; Backhaus, Thomas


    Effects of the antimicrobial agent triclosan to natural periphyton communities (biofilms, comprising primarily microalgae and bacteria) were assessed in two independent experiments during spring and summer. For that purpose a semi-static test system was used in which periphyton was exposed to a concentration range of 5-9054 nmol/L triclosan. Effects on algae were analyzed as content and composition of photosynthetic pigments. The corresponding EC50 values were 39.25 and 302.45 nmol/L for the spring and summer experiment, respectively. Effects on periphytic bacteria were assessed as effects on carbon utilization patterns, using Biolog Ecoplates. No inhibition of either total carbon utilization or functional diversity was observed, indicating a pronounced triclosan tolerance of the marine bacteria. In contrast, a small stimulation of the total carbon utilization was observed at triclosan concentrations exceeding 100 nmol/L.

  2. Green Marine: An environmental program to establish sustainability in marine transportation.


    Walker, Tony R


    European maritime companies have adopted programs to limit operational impacts on the environment. For maritime companies in North America, the Green Marine Environmental Program (GMEP) offers a framework to establish and reduce environmental footprints. Green Marine (GM) participants demonstrate annual improvements of specific environmental performance indicators (e.g., reductions in air pollution emissions) to maintain certification. Participants complete annual self-evaluations with results determining rankings for performance indicators on a 1-to-5 scale. Self-evaluations are independently verified every two years to ensure rigor and individual results are made publicly available annually to achieve transparency. GM benefits the marine industry across North America by encouraging sustainable development initiatives. GM's credibility is reflected through a diverse network of environmental groups and government agencies that endorse and help shape the program. Merits of this relatively new maritime certification (not previously described in the academic literature), are discussed. PMID:26899158

  3. Do You Know Our Marine Algae? A Marine Education Infusion Unit.

    ERIC Educational Resources Information Center

    Butzow, John W.; Gregory, Charles J.

    Designed to provide teaching materials for middle school and junior high school teachers in northern New England, this marine education unit presents teacher-tested ideas and activities for use in the classroom and in field trips to the shore. Each unit includes ideas and activities drawn from a variety of content areas so that teachers of many…

  4. High-Throughput Genetics Strategies for Identifying New Components of Lipid Metabolism in the Green Alga Chlamydomonas reinhardtii.


    Li, Xiaobo; Jonikas, Martin C


    Microalgal lipid metabolism is of broad interest because microalgae accumulate large amounts of triacylglycerols (TAGs) that can be used for biodiesel production (Durrett et al Plant J 54(4):593-607, 2008; Hu et al Plant J 54(4):621-639, 2008). Additionally, green algae are close relatives of land plants and serve as models to understand conserved lipid metabolism pathways in the green lineage. The green alga Chlamydomonas reinhardtii (Chlamydomonas hereafter) is a powerful model organism for understanding algal lipid metabolism. Various methods have been used to screen Chlamydomonas mutants for lipid amount or composition, and for identification of the mutated loci in mutants of interest. In this chapter, we summarize the advantages and caveats for each of these methods with a focus on screens for mutants with perturbed TAG content. We also discuss technical opportunities and new tools that are becoming available for screens of mutants altered in TAG content or perturbed in other processes in Chlamydomonas.

  5. High-Throughput Genetics Strategies for Identifying New Components of Lipid Metabolism in the Green Alga Chlamydomonas reinhardtii.


    Li, Xiaobo; Jonikas, Martin C


    Microalgal lipid metabolism is of broad interest because microalgae accumulate large amounts of triacylglycerols (TAGs) that can be used for biodiesel production (Durrett et al Plant J 54(4):593-607, 2008; Hu et al Plant J 54(4):621-639, 2008). Additionally, green algae are close relatives of land plants and serve as models to understand conserved lipid metabolism pathways in the green lineage. The green alga Chlamydomonas reinhardtii (Chlamydomonas hereafter) is a powerful model organism for understanding algal lipid metabolism. Various methods have been used to screen Chlamydomonas mutants for lipid amount or composition, and for identification of the mutated loci in mutants of interest. In this chapter, we summarize the advantages and caveats for each of these methods with a focus on screens for mutants with perturbed TAG content. We also discuss technical opportunities and new tools that are becoming available for screens of mutants altered in TAG content or perturbed in other processes in Chlamydomonas. PMID:27023238

  6. [Effect of blue-green alga (Cyanobacteria) and their exometabolites on formation of resting forms and variability of Yersinia pseudotuberculosis].


    Solokhina, L V; Pushkareva, V I; Litvin, V Iu


    Research, carried out with the use of bacteriological methods and polymerase chain reaction, revealed that the transformation of Y. pseudotuberculosis, associated with blue-green algae Anabaena variabilis, into resting (noncultivable) forms took shorter time than in soil extract containing no algae. The exometabolites of "old" cultures of these algae sharply accelerated the formation of resting Y. pseudotuberculosis forms. The influence of the algae and the products of their metabolism was manifested far more intensively at 22 degrees C than at 4 degrees C. After passage through infusoria resting Y. pseudotuberculosis forms, preserved in the mucous covering of cyanobacteria, partially reverted into vegetative forms, capable of growing on solid culture media. The revertants essentially differed from the initial vegetative forms by having lower enzymatic activity, agglutinability and cytopathogenicity, as well as by the loss of plasmid p45. The probable role of blue-green algae, widely spread in soils and water reservoirs, in the processes of reversible transformation of Y. pseudotuberculosis vegetative and resting forms, closely connected with seasonal changes of temperature conditions. PMID:11550552

  7. Evaluation of the Marine Algae Gracilaria salicornia and Sargassum sp. For the Biosorption of Cr (VI) from Aqueous Solutions

    NASA Astrophysics Data System (ADS)

    Shams Khorramabadi, Gh.; Darvishi Cheshmeh Soltani, R.

    In this study, the adsorption properties of two different marine algae (Gracilaria salicornia (red algae) and Sargassum sp. (brown algae) were investigated. Equilibrium isotherms were studied to evaluate the relative ability of the two algae to sequester Cr (VI) from aqueous solutions. The maximum biosorption capacity obtained was 45.959 mg g-1 for G. salicornia and 33.258 mg g-1 for Sargassum sp. at a solution pH of 4 and 50 mg L-1 initial chromium concentration. A significant fraction of the total Cr (VI) uptake was achieved within 60 min. Biosorbed chromium ions concentrations increased with increasing concentrations of biosorbents and increasing pH. The biosorption of Cr (VI) on G. salicornia and Sargassum sp. could best be described by the Langmuir model (R2>0.997 for Sargassum sp. and R2>0.999 for G. salicornia).

  8. Coralline alga reveals first marine record of subarctic North Pacific climate change

    USGS Publications Warehouse

    Halfar, J.; Steneck, R.; Schone, B.; Moore, G.W.K.; Joachimski, M.; Kronz, A.; Fietzke, J.; Estes, James


    While recent changes in subarctic North Pacific climate had dramatic effects on ecosystems and fishery yields, past climate dynamics and teleconnection patterns are poorly understood due to the absence of century-long high-resolution marine records. We present the first 117-year long annually resolved marine climate history from the western Bering Sea/Aleutian Island region using information contained in the calcitic skeleton of the long-lived crustose coralline red alga Clathromorphum nereostratum, a previously unused climate archive. The skeletal ??18O-time series indicates significant warming and/or freshening of surface waters after the middle of the 20th century. Furthermore, the time series is spatiotemporally correlated with Pacific Decadal Oscillation (PDO) and tropical El Nio??-Southern Oscillation (ENSO) indices. Even though the western Bering Sea/Aleutian Island region is believed to be outside the area of significant marine response to ENSO, we propose that an ENSO signal is transmitted via the Alaskan Stream from the Eastern North Pacific, a region of known ENSO teleconnections. Copyright 2007 by the American Geophysical Union.

  9. Diterpenes of marine brown algae of the family Dictyotaceae: their possible role as defense compounds and their use in chemotaxonomy.


    Kelecom, A; Teixeira, V L


    Marine brown algae of the family Dictyotaceae are protected against predation. Their survival strategy is, at least in part, based on the production of chemical defenses. These compounds are diterpenes that seem to establish a specific predator-prey relationship, and which are found as food-chain markers. The use of Dictyotaceae diterpenes in chemotaxonomy is briefly discussed.

  10. Cultivation of microplantlets derived from the marine red alga Agardhiella subulata in a stirred tank photobioreactor.


    Huang, Yao-Ming; Rorrer, Gregory L


    Macrophytic marine red algae are a diverse source of bioactive natural compounds. "Microplantlet" suspension cultures established from red algae are potential platforms for biosynthesis of these compounds, provided suitable bioreactor configurations for mass culture can be identified. The stirred tank bioreactor offers high rates of gas-liquid mass transfer, which may facilitate the delivery of the CO(2) in the aeration gas to the phototrophic microplantlet suspension culture. Therefore, the effects of impeller speed and CO(2) delivery on the long-term production of microplantlet biomass of the model red alga Agardhiella subulata was studied within a stirred tank photobioreactor equipped with a paddle blade impeller (D(i)/D(T) = 0.5). Nutrient medium replacement was required for sustained biomass production, and the biomass yield coefficient based on nitrate consumption was 1.08 +/- 0.09 g dry biomass per mmol N consumed. Biomass production went through two exponential phases of growth, followed by a CO(2) delivery limited growth phase. The CO(2)-limited growth phase was observed only if the specific growth rate in the second exponential phase of growth was at least 0.03 day(-)(1), the CO(2) delivery rate was less than 0.258 mmol CO(2) L(-)(1) culture h(-)(1), and the plantlet density was at least 10 g fresh mass L(-)(1). Increasing the aeration gas CO(2) partial pressure from 0.00035 to 0.0072 atm decreased the cultivation pH from 8.8 to 7.8, prolonged the second exponential phase of growth by increasing the CO(2) delivery rate, and also increased the photosynthetic oxygen evolution rate. Impeller speeds ranging from 60 to 250 rpm, which generated average shear rates of 2-10 s(-)(1), did not have a significant effect on biomass production rate. However, microplantlets cultivated in a stirred tank bioreactor ultimately assumed compact spherical shape, presumably to minimize exposure to hydrodynamic stress.

  11. Production of new cellulose nanomaterial from red algae marine biomass Gelidium elegans.


    Chen, You Wei; Lee, Hwei Voon; Juan, Joon Ching; Phang, Siew-Moi


    Nanocellulose was successfully isolated from Gelidium elegans red algae marine biomass. The red algae fiber was treated in three stages namely alkalization, bleaching treatment and acid hydrolysis treatment. Morphological analysis was performed by field emission scanning electron microscopy (FESEM) and transmission electron microscopy (TEM). TEM results revealed that the isolated nanocellulose had the average diameter and length of 21.8±11.1nm and of 547.3±23.7nm, respectively. Fourier transform infrared (FTIR) spectroscopy proved that the non-cellulosic polysaccharides components were progressively removed during the chemically treatment, and the final derived materials composed of cellulose parent molecular structure. X-ray diffraction (XRD) study showed that the crystallinity of yielded product had been improved after each successive treatments subjected to the treated fiber. The prepared nano-dimensional cellulose demonstrated a network-like structure with higher crystallinity (73%) than that of untreated fiber (33%), and possessed of good thermal stability which is suitable for nanocomposite material.

  12. A serine hydroxymethyltransferase from marine bacterium Shewanella algae: Isolation, purification, characterization and l-serine production.


    Jiang, Wei; Xia, Bingzhao; Liu, Ziduo


    Currently, l-serine is mainly produced by enzymatic conversion, in which serine hydroxymethyltransferase (SHMT) is the key enzyme, suggesting the importance of searching for a SHMT with high activity. Shewanella algae, a methanol-utilizing marine bacterium showing high SHMT activity, was selected based on screening bacterial strains and comparison of the activities of SHMTs. A glyA was isolated from the S. algae through thermal asymmetric interlaced PCR (TAIL-PCR) and it encoded a 417 amino acid polypeptide. The SaSHMT, encoded by the glyA, showed the optimal activity at 50°C and pH 7.0, and retained over 45% of its maximal activity after incubation at 40°C for 3h. The enzyme showed better stability under alkaline environment (pH 6.5-9.0) than Hyphomicrobium methylovorum GM2's SHMT (pH 6.0-7.5). The SaSHMT can produce 77.76mM of l-serine by enzymatic conversion, with the molecular conversion rate in catalyzing glycine to l-serine being 1.41-fold higher than that of Escherichia coli. Therefore, the SaSHMT has the potential for industrial applications due to its tolerance of alkaline environment and a relatively high enzymatic conversion rate. PMID:23632047

  13. Larvicidal Activity against Aedes aegypti and Molluscicidal Activity against Biomphalaria glabrata of Brazilian Marine Algae

    PubMed Central

    Guedes, Elíca Amara Cecília; de Carvalho, Cenira M.; Ribeiro Junior, Karlos Antonio Lisboa; Lisboa Ribeiro, Thyago Fernando; de Barros, Lurdiana Dayse; de Lima, Maria Raquel Ferreira; Prado Moura, Flávia de Barros; Goulart Sant'Ana, Antônio Euzebio


    This study investigated the biological activities of five benthic marine algae collected from Northeastern Region of Brazil. The tested activities included larvicidal activity against Aedes aegypti, molluscicidal activity against Biomphalaria glabrata, and toxicity against Artemia salina. Extracts of Ulva lactuca (Chlorophyta), Padina gymnospora, Sargassum vulgare (Phaeophyta), Hypnea musciformis, and Digenea simplex (Rhodophyta) were prepared using different solvents of increasing polarity, including dichloromethane, methanol, ethanol, and water. Of the extracts screened, the dichloromethane extracts of H. musciformis and P. gymnospora exhibited the highest activities and were subjected to bioassay-guided fractionation in hexane and chloroform. The chloroform fractions of the P. gymnospora and H. musciformis extracts showed molluscicidal activity at values below 40 μg·mL−1 (11.1460 μg·mL−1 and 25.8689 μg·mL−1, resp.), and the chloroform and hexane fractions of P. gymnospora showed larvicidal activity at values below 40 μg·mL−1 (29.018 μg·mL−1 and 17.230 μg·mL−1, resp.). The crude extracts were not toxic to A. salina, whereas the chloroform and hexane fractions of P. gymnospora (788.277 μg·mL−1 and 706.990 μg·mL−1) showed moderate toxicity, indicating that the toxic compounds present in these algae are nonpolar. PMID:24688787

  14. Larvicidal Activity against Aedes aegypti and Molluscicidal Activity against Biomphalaria glabrata of Brazilian Marine Algae.


    Guedes, Elíca Amara Cecília; de Carvalho, Cenira M; Ribeiro Junior, Karlos Antonio Lisboa; Lisboa Ribeiro, Thyago Fernando; de Barros, Lurdiana Dayse; de Lima, Maria Raquel Ferreira; Prado Moura, Flávia de Barros; Goulart Sant'ana, Antônio Euzebio


    This study investigated the biological activities of five benthic marine algae collected from Northeastern Region of Brazil. The tested activities included larvicidal activity against Aedes aegypti, molluscicidal activity against Biomphalaria glabrata, and toxicity against Artemia salina. Extracts of Ulva lactuca (Chlorophyta), Padina gymnospora, Sargassum vulgare (Phaeophyta), Hypnea musciformis, and Digenea simplex (Rhodophyta) were prepared using different solvents of increasing polarity, including dichloromethane, methanol, ethanol, and water. Of the extracts screened, the dichloromethane extracts of H. musciformis and P. gymnospora exhibited the highest activities and were subjected to bioassay-guided fractionation in hexane and chloroform. The chloroform fractions of the P. gymnospora and H. musciformis extracts showed molluscicidal activity at values below 40  μ g·mL(-1) (11.1460  μ g·mL(-1) and 25.8689  μ g·mL(-1), resp.), and the chloroform and hexane fractions of P. gymnospora showed larvicidal activity at values below 40  μ g·mL(-1) (29.018  μ g·mL(-1) and 17.230  μ g·mL(-1), resp.). The crude extracts were not toxic to A. salina, whereas the chloroform and hexane fractions of P. gymnospora (788.277  μ g·mL(-1) and 706.990  μ g·mL(-1)) showed moderate toxicity, indicating that the toxic compounds present in these algae are nonpolar. PMID:24688787

  15. Production of new cellulose nanomaterial from red algae marine biomass Gelidium elegans.


    Chen, You Wei; Lee, Hwei Voon; Juan, Joon Ching; Phang, Siew-Moi


    Nanocellulose was successfully isolated from Gelidium elegans red algae marine biomass. The red algae fiber was treated in three stages namely alkalization, bleaching treatment and acid hydrolysis treatment. Morphological analysis was performed by field emission scanning electron microscopy (FESEM) and transmission electron microscopy (TEM). TEM results revealed that the isolated nanocellulose had the average diameter and length of 21.8±11.1nm and of 547.3±23.7nm, respectively. Fourier transform infrared (FTIR) spectroscopy proved that the non-cellulosic polysaccharides components were progressively removed during the chemically treatment, and the final derived materials composed of cellulose parent molecular structure. X-ray diffraction (XRD) study showed that the crystallinity of yielded product had been improved after each successive treatments subjected to the treated fiber. The prepared nano-dimensional cellulose demonstrated a network-like structure with higher crystallinity (73%) than that of untreated fiber (33%), and possessed of good thermal stability which is suitable for nanocomposite material. PMID:27474672

  16. Biosorption of copper by marine algae Gelidium and algal composite material in a packed bed column.


    Vilar, Vítor J P; Botelho, Cidália M S; Loureiro, José M; Boaventura, Rui A R


    Marine algae Gelidium and algal composite material were investigated for the continuous removal of Cu(II) from aqueous solution in a packed bed column. The biosorption behaviour was studied during one sorption-desorption cycle of Cu(II) in the flow through column fed with 50 and 25 mg l(-1) of Cu(II) in aqueous solution, at pH 5.3, leading to a maximum uptake capacity of approximately 13 and 3 mg g(-1), respectively, for algae Gelidium and composite material. The breakthrough time decreases as the inlet copper concentration increases, for the same flow rate. The pH of the effluent decreases over the breakthrough time of copper ions, which indicates that ion exchange is one of the mechanisms involved in the biosorption process. Temperature has little influence on the metal uptake capacity and the increase of the ionic strength reduces the sorption capacity, decreasing the breakthrough time. Desorption using 0.1M HNO(3) solution was 100% effective. After two consecutive sorption-desorption cycles no changes in the uptake capacity of the composite material were observed. A mass transfer model including film and intraparticle resistances, and the equilibrium relationship, for adsorption and desorption, was successfully applied for the simulation of the biosorption column performance.

  17. Sulfated polysaccharide from the marine algae Hypnea musciformis inhibits TNBS-induced intestinal damage in rats.


    V Brito, Tarcisio; Barros, Francisco C N; Silva, Renan O; Dias Júnior, Genilson J; C Júnior, José Simião; Franco, Álvaro X; Soares, Pedro M G; Chaves, Luciano S; Abreu, Clara M W S; de Paula, Regina C M; Souza, Marcellus H L P; Freitas, Ana Lúcia P; R Barbosa, André Luiz


    Sulfated polysaccharides extracted from seaweed have important pharmacological properties. Thus, the aim of this study was to characterize the sulfated polysaccharide (PLS) from the algae Hypnea musciformis and evaluate its protective effect in colitis induced by trinitrobenzene sulfonic acid in rats. The sulfated polysaccharide possess a high molecular mass (1.24×10(5)gmol(-1)) and is composed of a κ-carrageenan, as depicted by FT-IR and NMR spectroscopic data. PLS was administered orally (10, 30, and 60mg/kg, p.o.) for three days, starting before TNBS (trinitrobenzene sulfonic acid) instillation (day 1). The rats were killed on day three, the portion of distal colon (5cm) was excised and evaluated macroscopic scores and wet weight. Then, samples of the intestinal were used for histological evaluation and quantification of glutathione, malonyldialdehyde acid, myeloperoxidase, nitrate/nitrite and cytokines. Our results demonstrate that PLS reduced the colitis and all analyzed biochemical parameters. Thus, we concluded that the PLS extracted from the marine algae H. musciformis reduced the colitis in animal model and may have an important promising application in the inflammatory bowel diseases.

  18. Sulfated polysaccharide from the marine algae Hypnea musciformis inhibits TNBS-induced intestinal damage in rats.


    V Brito, Tarcisio; Barros, Francisco C N; Silva, Renan O; Dias Júnior, Genilson J; C Júnior, José Simião; Franco, Álvaro X; Soares, Pedro M G; Chaves, Luciano S; Abreu, Clara M W S; de Paula, Regina C M; Souza, Marcellus H L P; Freitas, Ana Lúcia P; R Barbosa, André Luiz


    Sulfated polysaccharides extracted from seaweed have important pharmacological properties. Thus, the aim of this study was to characterize the sulfated polysaccharide (PLS) from the algae Hypnea musciformis and evaluate its protective effect in colitis induced by trinitrobenzene sulfonic acid in rats. The sulfated polysaccharide possess a high molecular mass (1.24×10(5)gmol(-1)) and is composed of a κ-carrageenan, as depicted by FT-IR and NMR spectroscopic data. PLS was administered orally (10, 30, and 60mg/kg, p.o.) for three days, starting before TNBS (trinitrobenzene sulfonic acid) instillation (day 1). The rats were killed on day three, the portion of distal colon (5cm) was excised and evaluated macroscopic scores and wet weight. Then, samples of the intestinal were used for histological evaluation and quantification of glutathione, malonyldialdehyde acid, myeloperoxidase, nitrate/nitrite and cytokines. Our results demonstrate that PLS reduced the colitis and all analyzed biochemical parameters. Thus, we concluded that the PLS extracted from the marine algae H. musciformis reduced the colitis in animal model and may have an important promising application in the inflammatory bowel diseases. PMID:27474644

  19. Biosorption of copper by marine algae Gelidium and algal composite material in a packed bed column.


    Vilar, Vítor J P; Botelho, Cidália M S; Loureiro, José M; Boaventura, Rui A R


    Marine algae Gelidium and algal composite material were investigated for the continuous removal of Cu(II) from aqueous solution in a packed bed column. The biosorption behaviour was studied during one sorption-desorption cycle of Cu(II) in the flow through column fed with 50 and 25 mg l(-1) of Cu(II) in aqueous solution, at pH 5.3, leading to a maximum uptake capacity of approximately 13 and 3 mg g(-1), respectively, for algae Gelidium and composite material. The breakthrough time decreases as the inlet copper concentration increases, for the same flow rate. The pH of the effluent decreases over the breakthrough time of copper ions, which indicates that ion exchange is one of the mechanisms involved in the biosorption process. Temperature has little influence on the metal uptake capacity and the increase of the ionic strength reduces the sorption capacity, decreasing the breakthrough time. Desorption using 0.1M HNO(3) solution was 100% effective. After two consecutive sorption-desorption cycles no changes in the uptake capacity of the composite material were observed. A mass transfer model including film and intraparticle resistances, and the equilibrium relationship, for adsorption and desorption, was successfully applied for the simulation of the biosorption column performance. PMID:18053711

  20. Characterization of the polyubiquitin gene in the marine red alga Gracilaria verrucosa.


    Zhou, Y H; Ragan, M A


    We have cloned a nuclear gene (UBI6R) and corresponding cDNAs that encode polyubiquitin in the florideophycidean red alga Gracilaria verrucosa. The gene encodes a polyubiquitin composed of six tandem ubiquitin units, followed by a single glutamine residue. The deduced amino acid sequences are identical among all six units, and identical to the ubiquitin of the florideophyte Aglaothamnion neglectum. There is high sequence similarity among the red algal ubiquitins and those of animals, green plants, fungi and several protists. Only one polyubiquitin gene was found by Southern hybridization analysis of G. verrucosa nuclear DNA. The upstream region of the gene is rich in putative cis-acting transcription-regulatory elements, including a putative heat-responsive element. Poly(A) addition to UBI6R mRNA was observed in cDNAs at four different sites, implicating the sequences AATAAA and (or) AGTAAA as poly(A) addition signals. The polyubiquitin genes of red algae show features of concerted evolution, but appear to be subject to less sequence homogenization than those of animals.

  1. Sodium and potassium uptake of Ulva - application of marine macro-algae for space agriculture

    NASA Astrophysics Data System (ADS)

    Yamashita, Masamichi; Tomita-Yokotani, Kaori; Sawaki, Nanase; Notoya, Masahiro; Hashimoto, Hirofumi

    The treatment of sodium, Na, and potassium, K, presents a challenge in space agriculture material recycling, as humans require Na and plants cannot grow at high Na concentrations. Hence, we are proposing the use of marine macro-algae to harvest K and other minerals from composted human waste. Ulva was selected for this feasibility study, since it tolerates a wide range of salinity levels. Growth capability of Ulva was examined under various total salinity levels and proportions of Na and K in the incubation medium. A homeostatic feature of Ulva was found in its intra-cellular concentration of Na and K, and in the intra-cellular ratio between Na and K (at 0.58 ± 0.30, lower than that of human metabolic waste). Intracellular concentration of K in Ulva is 20 times higher than seawater. Because of these characteristics, Ulva is a good candidate species for space agriculture.

  2. Sodium and potassium uptake of Ulva - Application of marine macro-algae for space agriculture

    NASA Astrophysics Data System (ADS)

    Yamashita, M.; Tomita-Yokotani, K.; Hashimoto, H.; Sawaki, N.; Notoya, M.


    The treatment of sodium, Na, and potassium, K, presents a challenge in space agriculture material recycling, as humans require Na and plants cannot grow at high Na concentrations. Hence, we are proposing the use of marine macro-algae to harvest K and other minerals from composted human waste. Ulva was selected for this feasibility study, since it tolerates a wide range of salinity levels. Growth capability of Ulva was examined under various total salinity levels and proportions of Na and K in the incubation medium. A homeostatic feature of Ulva was found in its intra-cellular concentration of Na and K, and in the intra-cellular ratio between Na and K (at 0.58 ± 0.30, lower than that of human metabolic waste). Intracellular concentration of K in Ulva is 20 times higher than seawater. Because of these characteristics, Ulva is a good candidate species for space agriculture.

  3. Marine algae-mediated synthesis of gold nanoparticles using a novel Ecklonia cava.


    Venkatesan, Jayachandran; Manivasagan, Panchanathan; Kim, Se-Kwon; Kirthi, Arivarasan Vishnu; Marimuthu, Sampath; Rahuman, Abdul Abdul


    In the present study, we report rapid biological synthesis of gold nanoparticles (Au NPs) using a novel marine brown alga Ecklonia cava (Family: Lessoniaceae) by the reduction of chloroauric acid. The formation of Au NPs reaction was complete within 1 min at 80 °C and physiochemically characterized with different analytical techniques. FTIR spectroscopy revealed that Au NPs were functionalized with biomolecules that have primary amine group, hydroxyl group and other stabilizing functional groups. X-ray diffraction pattern showed high purity and face-centered cubic structure of Au NPs. Microscopy results showed that these Au NPs are formed with shapes like spherical and triangular with an average size of 30 ± 0.25 nm. Synthesized Au NPs showed good antimicrobial and biocompatibility with human keratinocyte cell line. Thus, physiochemical characteristic results suggest that Au NPs will have promising biomedical applications in different area such as drug delivery, tissue engineering, biosensor, etc.

  4. Cytotoxicity of fucosterol containing fraction of marine algae against breast and colon carcinoma cell line

    PubMed Central

    Khanavi, Mahnaz; Gheidarloo, Razieh; Sadati, Nargess; Ardekani, Mohammad Reza Shams; Nabavi, Seyed Mohammad Bagher; Tavajohi, Shohreh; Ostad, Seyed Nasser


    Context: Marine algae produce different secondary metabolites with a wide range of biological activities. Many studies have been achieved on the screening of biological effects of marine organisms and a lot of active compounds were isolated and characterized. Aims: In an attempt to find cytotoxic compound of hexane fraction, isolation, identification, and cytotoxicity of active compound of this fraction were performed. Materials and Methods: In this study, total methanolic (70%) extract and partition fractions of hexane, chloroform (CHCl3), ethyl acetate (EtOAc), and MeOH–H2O of Sargassum angustifolium, Chondria dasyphylla, and Ulva flexuosa, collected from coastlines of the Persian Gulf in south of Iran, were studied against colon carcinoma (HT-29), colorectal adenocarcinoma (Caco-2), breast ductal carcinoma (T47D), and Swiss mouse embryo fibroblast (NIH 3T3) cell lines by MTT assay. Statistical Analysis Used: IC50 (median growth inhibitory concentration) values were calculated by Sigmaplot (10) software. Results: Hexane fraction of Chondria dasyphylla (IC50 82.26 ± 4.09 μg/ml) and MeOH-H2O fraction of Ulva flexuosa (IC50 116.92 ± 8.58 μg/ml) showed cytotoxic activity against proliferation of T47D cells. Hexane fraction of Sargassum angustifolium was also observed for cytotoxicity against T47D and HT-29 cell lines (IC50 166.42 ± 26.7 and 190.24 ± 52.8 μg/ml), respectively. An investigation of a component from the hexane fraction of Sargassum angustifolium yielded a steroidal metabolite, fucosterol, with cytotoxicity in T47D and HT29 (IC50 27.94 ± 9.3 and 70.41 ± 7.5 μg/ml). Conclusions: These results indicated that fucosterol, the most abundant phytosterol in brown algae, is responsible for cytotoxic effect of this extract against breast and colon carcinoma cell lines. PMID:22438665

  5. Anaerobic and Aerobic Hydrogen Gas Formation by the Blue-Green Alga Anabaena cylindrica

    PubMed Central

    Daday, Arlene; Platz, Rosalea A.; Smith, Geoffrey D.


    An investigation was made of certain factors involved in the formation of hydrogen gas, both in an anaerobic environment (argon) and in air, by the blue-green alga Anabaena cylindrica. The alga had not been previously adapted under hydrogen gas and hence the hydrogen evolution occurred entirely within the nitrogen-fixing heterocyst cells; organisms grown in a fixed nitrogen source, and which were therefore devoid of heterocysts, did not produce hydrogen under these conditions. Use of the inhibitor dichlorophenyl-dimethyl urea showed that hydrogen formation was directly dependent on photosystem I and only indirectly dependent on photosystem II, consistent with heterocysts being the site of hydrogen formation. The uncouplers carbonyl cyanide chlorophenyl hydrazone and dinitrophenol almost completely inhibited hydrogen formation, indicating that the process occurs almost entirely via the adenosine 5′-triphosphate-dependent nitrogenase. Salicylaldoxime also inhibited hydrogen formation, again illustrating the necessity of photophosphorylation. Whereas hydrogen formation could usually only be observed in anaerobic, dinitrogen-free environments, incubation in the presence of the dinitrogen-fixing inhibitor carbon monoxide plus the hydrogenase inhibitor acetylene resulted in significant formation of hydrogen even in air. Hydrogen formation was studied in batch cultures as a function of age of the cultures and also as a function of culture concentration, in both cases the cultures being harvested in logarithmic growth. Hydrogen evolution (and acetylene-reducing activity) exhibited a distinct maximum with respect to the age of the cultures. Finally, the levels of the protective enzyme, superoxide dismutase, were measured in heterocyst and vegetative cell fractions of the organism; the level was twice as high in heterocyst cells (2.3 units/mg of protein) as in vegetative cells (1.1 units/mg of protein). A simple procedure for isolating heterocyst cells is described. PMID

  6. Small G proteins of two green algae are localized to exocytic compartments and to flagella.


    Huber, H; Beyser, K; Fabry, S


    The Ypt/Rab proteins are small GTPases, which belong to the Ras superfamily and have been shown to be involved in endo- and exocytosis in mammalian cells and yeast. Using affinity-purified antibodies specific for four Ypt proteins, namely Ypt1p, Ypt4p, Ypt5p and Ypt6p, of the multicellular green alga Volvox carteri (YptVp) and its close unicellular relative Chlamydomonas reinhardtii (YptCp), we examined the abundance of the corresponding antigens during the asexual life cycle of Volvox, and their intracellular localization. The YptV proteins were found in all stages throughout the asexual life cycle and are tightly associated with intracellular membranes. Indirect immunofluorescence revealed that YptV4p, YptV5p and YptV6p are present in perinuclear regions of the cell, indicating an association with the Golgi region. Golgi localization of YptV4p and YptV6p in Volvox was confirmed by immunogold electron microscopy. In contrast, we found Ypt1p associated with the contractile vacuole in both V. carteri and C. reinhardtii. Furthermore, the YptV proteins were also detected along the entire length of the flagella of somatic Volvox cells. This flagellar location was substantiated by western blot analysis of extracts prepared from isolated flagella of both algae. While localization to exocytic compartments is in agreement with the established Ypt/Rab function in intracellular vesicle transport of eukaryotic cells, presence in the algal flagellum is the first hint of a possible role for small G proteins also in motility organelles.

  7. Uranium accumulation and toxicity in the green alga Chlamydomonas reinhardtii is modulated by pH.


    Lavoie, Michel; Sabatier, Sébastien; Garnier-Laplace, Jacqueline; Fortin, Claude


    The effects of pH on metal uptake and toxicity in aquatic organisms are currently poorly understood and remain an evolving topic in studies about the biotic ligand model (BLM). In the present study, the authors investigated how pH may influence long-term (4 d) uranium (U) accumulation and chronic toxicity in batch cultures of the freshwater green alga Chlamydomonas reinhardtii. The toxicity expressed as a function of the free uranyl ion was much greater at pH 7 (effective concentration, 50% [EC50] = 1.8 × 10(-9)  M UO2 (2+) ) than at pH 5 (EC50 = 1.2 × 10(-7)  M UO2 (2+) ). The net accumulation rate of U in algal cells was much higher at pH 7 than at pH 5 for the same free [UO2 (2+) ], but the cells exposed at pH 5 were also more sensitive to intracellular U than the cells at pH 7 with EC50s of 4.0 × 10(-15) and 7.1 × 10(-13)  mol of internalized U cell(-1) , respectively. The higher cellular sensitivity to U at pH 5 than at pH 7 could be explained partly by the increase in cytosolic U binding to algal soluble proteins or enzymes at pH 5 as observed by subcellular fractionation. To predict U accumulation and toxicity in algae accurately, the important modulating effects of pH on U accumulation and U cellular sensitivity should be considered in the BLM. PMID:24596137

  8. Effects of different strategies of mineral supplementation (marine algae alone or combined with rumen boluses) in organic dairy systems.


    López-Alonso, M; Rey-Crespo, F; Orjales, I; Rodríguez-Bermúdez, R; Miranda, M


    This study was designed to evaluate the effect of marine algae supplementation alone or in combination with a regular mineral supplement (rumen boluses) to improve the mineral status in organic dairy cattle and their effect on the milk mineral composition, milk production, composition (% of fat and protein) and quality (SCC). Thirty-two Holstein Friesian lactating cows were randomly selected and assigned to the algae (A), boluses (B), algae+boluses (AB) and control group (C). For the algae groups (A, AB), a supplement composed of Sea Lettuce (80%), Japanese Wireweed (17.5%) and Furbelows (2.5%) was formulated to be given to the cows at the rate of 100 g/animal per day (A1) for the length of 4 weeks. In the second half of the experiment (weeks 5-8), the algae mixture was reformulated and the proportion of Furbelows was increased from 2.5% to 5.0% with a subsequent decrease of Lettuce to 77.5% (A2). In the boluses group (B), each cow received 2 boluses after calving. Blood (serum) and milk samples were collected at 2 and 4 week intervals, respectively, and analysed for trace element concentrations by ICP-MS. Information related to the milk composition and SCC during a 305-day lactation for each animal were obtained from the Dairy Records Management System. The supplementation with algae, boluses or the combination of both treatments showed a statistically significant effect on the iodine (algae), selenium (boluses) and cobalt (algae+boluses) status of the animals. In milk, treatments had a statistical significant increase on iodine, and a tendency to increase selenium concentrations. The assayed algae mixture combined with another source of selenium could be an effective tool to improve the mineral status in serum and milk.

  9. Effect of scenedesmus acuminatus green algae extracts on the development of Candida lipolytic yeast in gas condensate-containing media

    NASA Technical Reports Server (NTRS)

    Bilmes, B. I.; Kasymova, G. A.; Runov, V. I.; Karavayeva, N. N.


    Data are given of a comparative study of the growth and development as well as the characteristics of the biomass of the C. Lipolytica yeast according to the content of raw protein, protein, lipids, vitamins in the B group, and residual hydrocarbons during growth in media with de-aromatized gas-condensate FNZ as the carbon source with aqueous and alcohol extracts of S. acuminatus as the biostimulants. It is shown that the decoction and aqueous extract of green algae has the most intensive stimulating effect on the yeast growth. When a decoction of algae is added to the medium, the content of residual hydrocarbons in the biomass of C. lipolytica yeast is reduced by 4%; the quantity of protein, lipids, thamine and inositol with replacement of the yeast autolysate by the decoction of algae is altered little.

  10. Acute toxicities of pharmaceuticals toward green algae. mode of action, biopharmaceutical drug disposition classification system and quantile regression models.


    Villain, Jonathan; Minguez, Laetitia; Halm-Lemeille, Marie-Pierre; Durrieu, Gilles; Bureau, Ronan


    The acute toxicities of 36 pharmaceuticals towards green algae were estimated from a set of quantile regression models representing the first global quantitative structure-activity relationships. The selection of these pharmaceuticals was based on their predicted environmental concentrations. An agreement between the estimated values and the observed acute toxicity values was found for several families of pharmaceuticals, in particular, for antidepressants. A recent classification (BDDCS) of drugs based on ADME properties (Absorption, Distribution, Metabolism and Excretion) was clearly correlated with the acute ecotoxicities towards algae. Over-estimation of toxicity from our QSAR models was observed for classes 2, 3 and 4 whereas our model results were in agreement for the class 1 pharmaceuticals. Clarithromycin, a class 3 antibiotic characterized by weak metabolism and high solubility, was the most toxic to algae (molecular stability and presence in surface water).

  11. Acute toxicities of pharmaceuticals toward green algae. mode of action, biopharmaceutical drug disposition classification system and quantile regression models.


    Villain, Jonathan; Minguez, Laetitia; Halm-Lemeille, Marie-Pierre; Durrieu, Gilles; Bureau, Ronan


    The acute toxicities of 36 pharmaceuticals towards green algae were estimated from a set of quantile regression models representing the first global quantitative structure-activity relationships. The selection of these pharmaceuticals was based on their predicted environmental concentrations. An agreement between the estimated values and the observed acute toxicity values was found for several families of pharmaceuticals, in particular, for antidepressants. A recent classification (BDDCS) of drugs based on ADME properties (Absorption, Distribution, Metabolism and Excretion) was clearly correlated with the acute ecotoxicities towards algae. Over-estimation of toxicity from our QSAR models was observed for classes 2, 3 and 4 whereas our model results were in agreement for the class 1 pharmaceuticals. Clarithromycin, a class 3 antibiotic characterized by weak metabolism and high solubility, was the most toxic to algae (molecular stability and presence in surface water). PMID:26590695

  12. Evidence for land plant cell wall biosynthetic mechanisms in charophyte green algae

    PubMed Central

    Mikkelsen, Maria D.; Harholt, Jesper; Ulvskov, Peter; Johansen, Ida E.; Fangel, Jonatan U.; Doblin, Monika S.; Bacic, Antony; Willats, William G. T.


    Background and Aims The charophyte green algae (CGA) are thought to be the closest living relatives to the land plants, and ancestral CGA were unique in giving rise to the land plant lineage. The cell wall has been suggested to be a defining structure that enabled the green algal ancestor to colonize land. These cell walls provide support and protection, are a source of signalling molecules, and provide developmental cues for cell differentiation and elongation. The cell wall of land plants is a highly complex fibre composite, characterized by cellulose cross-linked by non-cellulosic polysaccharides, such as xyloglucan, embedded in a matrix of pectic polysaccharides. How the land plant cell wall evolved is currently unknown: early-divergent chlorophyte and prasinophyte algae genomes contain a low number of glycosyl transferases (GTs), while land plants contain hundreds. The number of GTs in CGA is currently unknown, as no genomes are available, so this study sought to give insight into the evolution of the biosynthetic machinery of CGA through an analysis of available transcriptomes. Methods Available CGA transcriptomes were mined for cell wall biosynthesis GTs and compared with GTs characterized in land plants. In addition, gene cloning was employed in two cases to answer important evolutionary questions. Key Results Genetic evidence was obtained indicating that many of the most important core cell wall polysaccharides have their evolutionary origins in the CGA, including cellulose, mannan, xyloglucan, xylan and pectin, as well as arabino-galactan protein. Moreover, two putative cellulose synthase-like D family genes (CSLDs) from the CGA species Coleochaete orbicularis and a fragment of a putative CSLA/K-like sequence from a CGA Spirogyra species were cloned, providing the first evidence that all the cellulose synthase/-like genes present in early-divergent land plants were already present in CGA. Conclusions The results provide new insights into the evolution of

  13. Complex phylogenetic distribution of a non-canonical genetic code in green algae

    PubMed Central


    Background A non-canonical nuclear genetic code, in which TAG and TAA have been reassigned from stop codons to glutamine, has evolved independently in several eukaryotic lineages, including the ulvophycean green algal orders Dasycladales and Cladophorales. To study the phylogenetic distribution of the standard and non-canonical genetic codes, we generated sequence data of a representative set of ulvophycean green algae and used a robust green algal phylogeny to evaluate different evolutionary scenarios that may account for the origin of the non-canonical code. Results This study demonstrates that the Dasycladales and Cladophorales share this alternative genetic code with the related order Trentepohliales and the genus Blastophysa, but not with the Bryopsidales, which is sister to the Dasycladales. This complex phylogenetic distribution whereby all but one representative of a single natural lineage possesses an identical deviant genetic code is unique. Conclusions We compare different evolutionary scenarios for the complex phylogenetic distribution of this non-canonical genetic code. A single transition to the non-canonical code followed by a reversal to the canonical code in the Bryopsidales is highly improbable due to the profound genetic changes that coincide with codon reassignment. Multiple independent gains of the non-canonical code, as hypothesized for ciliates, are also unlikely because the same deviant code has evolved in all lineages. Instead we favor a stepwise acquisition model, congruent with the ambiguous intermediate model, whereby the non-canonical code observed in these green algal orders has a single origin. We suggest that the final steps from an ambiguous intermediate situation to a non-canonical code have been completed in the Trentepohliales, Dasycladales, Cladophorales and Blastophysa but not in the Bryopsidales. We hypothesize that in the latter lineage an initial stage characterized by translational ambiguity was not followed by final

  14. Effects of marine actinomycete on the removal of a toxicity alga Phaeocystis globose in eutrophication waters

    PubMed Central

    Zhang, Huajun; Zhang, Su; Peng, Yun; Li, Yi; Chen, Zhangran; Xu, Hong; Yu, Zhiming; Zheng, Wei; Zheng, Tianling


    Phaeocystis globosa blooms in eutrophication waters can cause severely damage in marine ecosystem and consequently influence human activities. This study investigated the effect and role of an algicidal actinomycete (Streptomyces sp. JS01) on the elimination process of P. globosa. JS01 supernatant could alter algal cell membrane permeability in 4 h when analyzed with flow cytometry. Reactive oxygen species (ROS) levels were 7.2 times higher than that at 0 h following exposure to JS01 supernatant for 8 h, which indicated that algal cells suffered from oxidative damage. The Fv/Fm value which could reflect photosystem II (PS II) electron flow status also decreased. Real-time PCR showed that the expression of the photosynthesis related genes psbA and rbcS were suppressed by JS01 supernatant, which might induce damage to PS II. Our results demonstrated that JS01 supernatant can change algal membrane permeability in a short time and then affect photosynthesis process, which might block the PS II electron transport chain to produce excessive ROS. This experiment demonstrated that Streptomyces sp. JS01 could eliminate harmful algae in marine waters efficiently and may be function as a harmful algal bloom controller material. PMID:26042109

  15. Influence of extracellular polysaccharides (EPS) produced by two different green unicellular algae on membrane filtration in an algae-based biofuel production process.


    Matsumoto, Takaki; Yamamura, Hiroshi; Hayakawa, Jyunpei; Watanabe, Yoshimasa; Harayama, Shigeaki


    In the present study, two strains of green algae named S1 and S2, categorized as the same species of Pseudo-coccomyxa ellipsoidea but showing 99% homology, were cultivated under the same conditions and filtrated with a microfiltration membrane. On the basis of the results of the extracellular polysaccharides (EPS) characteristics of these two green algae and the degree of fouling, the influence of these characteristics on the performance of membrane filtration was investigated. There was no difference in the specific growth rate between the S1 and S2 strains; however, large differences were seen in the amount and quality of EPS between S1 and S2. When the S1 and S2 strains were filtered with a membrane, the trend in the increase in transmembrane pressure (TMP) was quite different. The filtration of the S1 strain showed a rapid increase in TMP, whereas the TMP of the filtration of the S2 strain did not increase at all during the operation. This clearly demonstrated that the characteristics of each strain affect the development of membrane fouling. On the basis of the detailed characterization of solved-EPS (s-EPS) and bound-EPS (b-EPS), it was clarified that s-EPS mainly contributed to irreversible fouling for both operations and the biopolymer-like organic matter contained in b-EPS mainly contributed to reversible fouling. PMID:24804668

  16. Influence of extracellular polysaccharides (EPS) produced by two different green unicellular algae on membrane filtration in an algae-based biofuel production process.


    Matsumoto, Takaki; Yamamura, Hiroshi; Hayakawa, Jyunpei; Watanabe, Yoshimasa; Harayama, Shigeaki


    In the present study, two strains of green algae named S1 and S2, categorized as the same species of Pseudo-coccomyxa ellipsoidea but showing 99% homology, were cultivated under the same conditions and filtrated with a microfiltration membrane. On the basis of the results of the extracellular polysaccharides (EPS) characteristics of these two green algae and the degree of fouling, the influence of these characteristics on the performance of membrane filtration was investigated. There was no difference in the specific growth rate between the S1 and S2 strains; however, large differences were seen in the amount and quality of EPS between S1 and S2. When the S1 and S2 strains were filtered with a membrane, the trend in the increase in transmembrane pressure (TMP) was quite different. The filtration of the S1 strain showed a rapid increase in TMP, whereas the TMP of the filtration of the S2 strain did not increase at all during the operation. This clearly demonstrated that the characteristics of each strain affect the development of membrane fouling. On the basis of the detailed characterization of solved-EPS (s-EPS) and bound-EPS (b-EPS), it was clarified that s-EPS mainly contributed to irreversible fouling for both operations and the biopolymer-like organic matter contained in b-EPS mainly contributed to reversible fouling.

  17. Metabolic regulation of triacylglycerol accumulation in the green algae: identification of potential targets for engineering to improve oil yield.


    Goncalves, Elton C; Wilkie, Ann C; Kirst, Matias; Rathinasabapathi, Bala


    The great need for more sustainable alternatives to fossil fuels has increased our research interests in algal biofuels. Microalgal cells, characterized by high photosynthetic efficiency and rapid cell division, are an excellent source of neutral lipids as potential fuel stocks. Various stress factors, especially nutrient-starvation conditions, induce an increased formation of lipid bodies filled with triacylglycerol in these cells. Here we review our knowledge base on glycerolipid synthesis in the green algae with an emphasis on recent studies on carbon flux, redistribution of lipids under nutrient-limiting conditions and its regulation. We discuss the contributions and limitations of classical and novel approaches used to elucidate the algal triacylglycerol biosynthetic pathway and its regulatory network in green algae. Also discussed are gaps in knowledge and suggestions for much needed research both on the biology of triacylglycerol accumulation and possible avenues to engineer improved algal strains. PMID:26801206

  18. Experimental evidence that evolutionary relatedness does not affect the ecological mechanisms of coexistence in freshwater green algae.


    Narwani, Anita; Alexandrou, Markos A; Oakley, Todd H; Carroll, Ian T; Cardinale, Bradley J


    The coexistence of competing species depends on the balance between their fitness differences, which determine their competitive inequalities, and their niche differences, which stabilise their competitive interactions. Darwin proposed that evolution causes species' niches to diverge, but the influence of evolution on relative fitness differences, and the importance of both niche and fitness differences in determining coexistence have not yet been studied together. We tested whether the phylogenetic distances between species of green freshwater algae determined their abilities to coexist in a microcosm experiment. We found that niche differences were more important in explaining coexistence than relative fitness differences, and that phylogenetic distance had no effect on either coexistence or on the sizes of niche and fitness differences. These results were corroborated by an analysis of the frequency of the co-occurrence of 325 pairwise combinations of algal taxa in > 1100 lakes across North America. Phylogenetic distance may not explain the coexistence of freshwater green algae.

  19. Metabolic regulation of triacylglycerol accumulation in the green algae: identification of potential targets for engineering to improve oil yield.


    Goncalves, Elton C; Wilkie, Ann C; Kirst, Matias; Rathinasabapathi, Bala


    The great need for more sustainable alternatives to fossil fuels has increased our research interests in algal biofuels. Microalgal cells, characterized by high photosynthetic efficiency and rapid cell division, are an excellent source of neutral lipids as potential fuel stocks. Various stress factors, especially nutrient-starvation conditions, induce an increased formation of lipid bodies filled with triacylglycerol in these cells. Here we review our knowledge base on glycerolipid synthesis in the green algae with an emphasis on recent studies on carbon flux, redistribution of lipids under nutrient-limiting conditions and its regulation. We discuss the contributions and limitations of classical and novel approaches used to elucidate the algal triacylglycerol biosynthetic pathway and its regulatory network in green algae. Also discussed are gaps in knowledge and suggestions for much needed research both on the biology of triacylglycerol accumulation and possible avenues to engineer improved algal strains.

  20. Nucleotide diversity of the colorless green alga Polytomella parva (Chlorophyceae, Chlorophyta): high for the mitochondrial telomeres, surprisingly low everywhere else.


    Smith, David Roy; Lee, Robert W


    Silent-site nucleotide diversity data (π(silent)) can provide insights into the forces driving genome evolution. Here we present π(silent) statistics for the mitochondrial and nuclear DNAs of Polytomella parva, a nonphotosynthetic green alga with a highly reduced, linear fragmented mitochondrial genome. We show that this species harbors very little genetic diversity, with the exception of the mitochondrial telomeres, which have an excess of polymorphic sites. These data are compared with previously published π(silent) values from the mitochondrial and nuclear genomes of the model species Chlamydomonas reinhardtii and Volvox carteri, which are close relatives of P. parva, and are used to understand the modes and tempos of genome evolution within green algae. PMID:21762422

  1. Response of the green alga Oophila sp., a salamander endosymbiont, to a PSII-inhibitor under laboratory conditions.


    Baxter, Leilan; Brain, Richard; Rodriguez-Gil, Jose Luis; Hosmer, Alan; Solomon, Keith; Hanson, Mark


    In a rare example of autotroph-vertebrate endosymbiosis, eggs of the yellow-spotted salamander (Ambystoma maculatum) are colonized by a green alga (Oophila sp.) that significantly enhances salamander development. Previous studies have demonstrated the potential for impacts to the salamander embryo when growth of the algae is impaired by exposure to herbicides. To further investigate this relationship, the authors characterized the response of the symbiotic algae (Oophila sp.) alone to the photosystem II (PSII) inhibitor atrazine under controlled laboratory conditions. After extraction of the alga from A. maculatum eggs and optimization of culturing conditions, 4 toxicity assays (96 h each) were conducted. Recovery of the algal population was also assessed after a further 96 h in untreated media. Average median effective concentration (EC50) values of 123 µg L(-1) (PSII yield), 169 µg L(-1) (optical density), and 299 µg L(-1) (growth rate) were obtained after the 96-h exposure. Full recovery of exposed algal populations after 96 h in untreated media was observed for all endpoints, except for optical density at the greatest concentration tested (300 µg L(-1) ). Our results show that, under laboratory conditions, Oophila sp. is generally less sensitive to atrazine than standard test species. Although conditions of growth in standard toxicity tests are not identical to those in the natural environment, these results provide an understanding of the tolerance of this alga to PSII inhibitors as compared with other species.

  2. Response of the green alga Oophila sp., a salamander endosymbiont, to a PSII-inhibitor under laboratory conditions.


    Baxter, Leilan; Brain, Richard; Rodriguez-Gil, Jose Luis; Hosmer, Alan; Solomon, Keith; Hanson, Mark


    In a rare example of autotroph-vertebrate endosymbiosis, eggs of the yellow-spotted salamander (Ambystoma maculatum) are colonized by a green alga (Oophila sp.) that significantly enhances salamander development. Previous studies have demonstrated the potential for impacts to the salamander embryo when growth of the algae is impaired by exposure to herbicides. To further investigate this relationship, the authors characterized the response of the symbiotic algae (Oophila sp.) alone to the photosystem II (PSII) inhibitor atrazine under controlled laboratory conditions. After extraction of the alga from A. maculatum eggs and optimization of culturing conditions, 4 toxicity assays (96 h each) were conducted. Recovery of the algal population was also assessed after a further 96 h in untreated media. Average median effective concentration (EC50) values of 123 µg L(-1) (PSII yield), 169 µg L(-1) (optical density), and 299 µg L(-1) (growth rate) were obtained after the 96-h exposure. Full recovery of exposed algal populations after 96 h in untreated media was observed for all endpoints, except for optical density at the greatest concentration tested (300 µg L(-1) ). Our results show that, under laboratory conditions, Oophila sp. is generally less sensitive to atrazine than standard test species. Although conditions of growth in standard toxicity tests are not identical to those in the natural environment, these results provide an understanding of the tolerance of this alga to PSII inhibitors as compared with other species. PMID:24782078

  3. Phytochrome levels in the green alga Mesotaenium caldariorum are light regulated.


    Morand, L Z; Kidd, D G; Lagarias, J C


    Experiments undertaken in this investigation examine the influence of light on the levels of phytochrome in the green alga Mesotaenium caldariorum and also provide partial protein sequence of the algal phytochrome. Immunochemical and spectrophotometric measurements reveal that phytochrome levels increase nearly 4-fold upon transfer of light-grown algal cells to total darkness during a 6- to 8-d adaptation period. Within 24 h after return to continuous illumination, the level of phytochrome in dark-adapted cells has decreased to that found in light-grown cells. Red or far-red light experiments show that both effects of light, phytochrome accumulation during dark adaptation and light-dependent decrease of phytochrome, do not depend on the form of the phytochrome photoreceptor (i.e. far-red absorbing or red absorbing) present in the algal cell. The light-dependent reduction of phytochrome in dark-adapted cells is inhibited by the photosynthetic electron transport inhibitor 3-(3,4-dichlorophenyl)-1,1-dimethyl urea, suggesting that this light effect is mediated by photosynthesis. Microsequence analyses of internal peptides indicate that algal phytochrome purified from dark-adapted cells shares the greatest sequence identity with phytochrome from the fern Selaginella (74%). Compared with higher plant photoreceptors, Mesotaenium phytochrome appears to be more closely related to phyB gene products (i.e. 62 and 63% average sequence identity) than to phyA gene products (i.e. 50 and 53% average sequence identity). Because light regulation and the structure of Mesotaenium phytochrome do not conform with either type I (light-labile) or type II (light-stable) phytochromes from higher plants, these results support the hypothesis that the lower green plant photoreceptors represent a distinct class of phytochrome. PMID:8278502

  4. Isolation of a novel oil globule protein from the green alga Haematococcus pluvialis (Chlorophyceae).


    Peled, Ehud; Leu, Stefan; Zarka, Aliza; Weiss, Meira; Pick, Uri; Khozin-Goldberg, Inna; Boussiba, Sammy


    Cytoplasmic oil globules of Haematococcus pluvialis (Chlorophyceae) were isolated and analyzed for pigments, lipids and proteins. Astaxanthin appeared to be the only pigment deposited in the globules. Triacyglycerols were the main lipids (more than 90% of total fatty acids) in both the cell-free extract and in the oil globules. Lipid profile analysis of the oil globules showed that relative to the cell-free extract, they were enriched with extraplastidial lipids. A fatty acids profile revealed that the major fatty acids in the isolated globules were oleic acid (18:1) and linoleic acid (18:2). Protein extracts from the globules revealed seven enriched protein bands, all of which were possible globule-associated proteins. A major 33-kDa globule protein was partially sequenced by MS/MS analysis, and degenerate DNA primers were prepared and utilized to clone its encoding gene from cDNA extracted from cells grown in a nitrogen depleted medium under high light. The sequence of this 275-amino acid protein, termed the Haematococcus Oil Globule Protein (HOGP), revealed partial homology with a Chlamydomonas reinhardtii oil globule protein and with undefined proteins from other green algae. The HOGP transcript was barely detectable in vegetative cells, but its level increased by more than 100 fold within 12 h of exposure to nitrogen depletion/high light conditions, which induced oil accumulation. HOGP is the first oil-globule-associated protein to be identified in H. pluvialis, and it is a member of a novel gene family that may be unique to green microalgae. PMID:21732215

  5. Molecular Identification of Rickettsial Endosymbionts in the Non-Phagotrophic Volvocalean Green Algae

    PubMed Central

    Kawafune, Kaoru; Hongoh, Yuichi; Hamaji, Takashi; Nozaki, Hisayoshi


    Background The order Rickettsiales comprises Gram-negative obligate intracellular bacteria (also called rickettsias) that are mainly associated with arthropod hosts. This group is medically important because it contains human-pathogenic species that cause dangerous diseases. Until now, there has been no report of non-phagotrophic photosynthetic eukaryotes, such as green plants, harboring rickettsias. Methodology/Principal Findings We examined the bacterial endosymbionts of two freshwater volvocalean green algae: unicellular Carteria cerasiformis and colonial Pleodorina japonica. Epifluorescence microscopy using 4′-6-deamidino-2-phenylindole staining revealed the presence of endosymbionts in all C. cerasiformis NIES-425 cells, and demonstrated a positive correlation between host cell size and the number of endosymbionts. Strains both containing and lacking endosymbionts of C. cerasiformis (NIES-425 and NIES-424) showed a >10-fold increase in cell number and typical sigmoid growth curves over 192 h. A phylogenetic analysis of 16 S ribosomal (r)RNA gene sequences from the endosymbionts of C. cerasiformis and P. japonica demonstrated that they formed a robust clade (hydra group) with endosymbionts of various non-arthropod hosts within the family Rickettsiaceae. There were significantly fewer differences in the 16 S rRNA sequences of the rickettsiacean endosymbionts between C. cerasiformis and P. japonica than in the chloroplast 16 S rRNA or 18 S rRNA of the host volvocalean cells. Fluorescence in situ hybridization demonstrated the existence of the rickettsiacean endosymbionts in the cytoplasm of two volvocalean species. Conclusions/Significance The rickettsiacean endosymbionts are likely not harmful to their volvocalean hosts and may have been recently transmitted from other non-arthropod organisms. Because rickettsias are the closest relatives of mitochondria, incipient stages of mitochondrial endosymbiosis may be deduced using both strains with and without C

  6. Extraction of nutraceuticals from Spirulina (blue-green alga): A bioorganic chemistry practice using thin-layer chromatography.


    Herrera Bravo de Laguna, Irma; Toledo Marante, Francisco J; Luna-Freire, Kristerson R; Mioso, Roberto


    Spirulina is a blue-green alga (cyanobacteria) with high nutritive value. This work provides an innovative and original approach to the consideration of a bioorganic chemistry practice, using Spirulina for the separation of phytochemicals with nutraceutical characteristics via thin-layer chromatography (TLC) plates. The aim is to bring together current research, theory, and practice, and always in accordance with pedagogical ideas. PMID:26331489

  7. Palindromic Genes in the Linear Mitochondrial Genome of the Nonphotosynthetic Green Alga Polytomella magna

    PubMed Central

    Smith, David Roy; Hua, Jimeng; Archibald, John M.; Lee, Robert W.


    Organelle DNA is no stranger to palindromic repeats. But never has a mitochondrial or plastid genome been described in which every coding region is part of a distinct palindromic unit. While sequencing the mitochondrial DNA of the nonphotosynthetic green alga Polytomella magna, we uncovered precisely this type of genic arrangement. The P. magna mitochondrial genome is linear and made up entirely of palindromes, each containing 1–7 unique coding regions. Consequently, every gene in the genome is duplicated and in an inverted orientation relative to its partner. And when these palindromic genes are folded into putative stem-loops, their predicted translational start sites are often positioned in the apex of the loop. Gel electrophoresis results support the linear, 28-kb monomeric conformation of the P. magna mitochondrial genome. Analyses of other Polytomella taxa suggest that palindromic mitochondrial genes were present in the ancestor of the Polytomella lineage and lost or retained to various degrees in extant species. The possible origins and consequences of this bizarre genomic architecture are discussed. PMID:23940100

  8. Simultaneous cryo X-ray ptychographic and fluorescence microscopy of green algae

    PubMed Central

    Deng, Junjing; Vine, David J.; Chen, Si; Nashed, Youssef S. G.; Jin, Qiaoling; Phillips, Nicholas W.; Peterka, Tom; Ross, Rob; Vogt, Stefan; Jacobsen, Chris J.


    Trace metals play important roles in normal and in disease-causing biological functions. X-ray fluorescence microscopy reveals trace elements with no dependence on binding affinities (unlike with visible light fluorophores) and with improved sensitivity relative to electron probes. However, X-ray fluorescence is not very sensitive for showing the light elements that comprise the majority of cellular material. Here we show that X-ray ptychography can be combined with fluorescence to image both cellular structure and trace element distribution in frozen-hydrated cells at cryogenic temperatures, with high structural and chemical fidelity. Ptychographic reconstruction algorithms deliver phase and absorption contrast images at a resolution beyond that of the illuminating lens or beam size. Using 5.2-keV X-rays, we have obtained sub–30-nm resolution structural images and ∼90-nm–resolution fluorescence images of several elements in frozen-hydrated green algae. This combined approach offers a way to study the role of trace elements in their structural context. PMID:25675478

  9. Comparison of the Photosynthetic Yield of Cyanobacteria and Green Algae: Different Methods Give Different Answers

    PubMed Central

    Schuurmans, R. Milou; van Alphen, Pascal; Schuurmans, J. Merijn; Matthijs, Hans C. P.; Hellingwerf, Klaas J.


    The societal importance of renewable carbon-based commodities and energy carriers has elicited a particular interest for high performance phototrophic microorganisms. Selection of optimal strains is often based on direct comparison under laboratory conditions of maximal growth rate or additional valued features such as lipid content. Instead of reporting growth rate in culture, estimation of photosynthetic efficiency (quantum yield of PSII) by pulse-amplitude modulated (PAM) fluorimetry is an often applied alternative method. Here we compared the quantum yield of PSII and the photonic yield on biomass for the green alga Chlorella sorokiniana 211-8K and the cyanobacterium Synechocystis sp. PCC 6803. Our data demonstrate that the PAM technique inherently underestimates the photosynthetic efficiency of cyanobacteria by rendering a high F0 and a low FM, specifically after the commonly practiced dark pre-incubation before a yield measurement. Yet when comparing the calculated biomass yield on light in continuous culture experiments, we obtained nearly equal values for both species. Using mutants of Synechocystis sp. PCC 6803, we analyzed the factors that compromise its PAM-based quantum yield measurements. We will discuss the role of dark respiratory activity, fluorescence emission from the phycobilisomes, and the Mehler-like reaction. Based on the above observations we recommend that PAM measurements in cyanobacteria are interpreted only qualitatively. PMID:26394153

  10. Respiratory-deficient mutants of the unicellular green alga Chlamydomonas: a review.


    Salinas, Thalia; Larosa, Véronique; Cardol, Pierre; Maréchal-Drouard, Laurence; Remacle, Claire


    Genetic manipulation of the unicellular green alga Chlamydomonas reinhardtii is straightforward. Nuclear genes can be interrupted by insertional mutagenesis or targeted by RNA interference whereas random or site-directed mutagenesis allows the introduction of mutations in the mitochondrial genome. This, combined with a screen that easily allows discriminating respiratory-deficient mutants, makes Chlamydomonas a model system of choice to study mitochondria biology in photosynthetic organisms. Since the first description of Chlamydomonas respiratory-deficient mutants in 1977 by random mutagenesis, many other mutants affected in mitochondrial components have been characterized. These respiratory-deficient mutants increased our knowledge on function and assembly of the respiratory enzyme complexes. More recently some of these mutants allowed the study of mitochondrial gene expression processes poorly understood in Chlamydomonas. In this review, we update the data concerning the respiratory components with a special focus on the assembly factors identified on other organisms. In addition, we make an inventory of different mitochondrial respiratory mutants that are inactivated either on mitochondrial or nuclear genes.

  11. 5'-monohydroxyphylloquinone is the dominant naphthoquinone of PSI in the green alga Chlamydomonas reinhardtii.


    Ozawa, Shin-ichiro; Kosugi, Makiko; Kashino, Yasuhiro; Sugimura, Takashi; Takahashi, Yuichiro


    Thylakoid membranes contain two types of quinones, benzoquinone (plastoquinone) and naphthoquinone, which are involved in photosynthetic electron transfer. Unlike the benzoquinone, the chemical species of naphthoquinone present (phylloquinone, menaquinone-4 and 5'-monohydroxyphylloquinone) varies depending on the oxygenic photosynthetic organisms. The green alga Chlamydomonas reinhardtii has been used as a model organism to study the function of the naphthoquinone bound to PSI. However, the level of phylloquinone and the presence of other naphthoquinones in this organism remain unknown. In the present study, we found that 5'-monohydroxyphylloquinone is the predominant naphthoquinone in cell and thylakoid extracts based on the retention time during reverse phase HPLC, absorption and mass spectrometry measurements. It was shown that 5'-monohydroxyphylloquinone is enriched 2.5-fold in the PSI complex as compared with thylakoid membranes but that it is absent from PSI-deficient mutant cells. We also found a small amount of phylloquinone in the cells and in the PSI complex and estimated that accumulated 5'-monohydroxyphylloquinone and phylloquinone account for approximately 90 and 10%, respectively, of the total naphthoquinone content. The ratio of these two naphthoquinones remained nearly constant in the cells and in the PSI complexes from logarithmic and stationary cell growth stages. We conclude that both 5'-monohydroxyphylloquinone and phylloquinone stably co-exist as major and minor naphthoquinones in Chlamydomonas PSI.

  12. Genome-wide characterization of genetic variation in the unicellular, green alga Chlamydomonas reinhardtii.


    Jang, Hyosik; Ehrenreich, Ian M


    Chlamydomonas reinhardtii is a model system for studying cilia, photosynthesis, and other core features of eukaryotes, and is also an emerging source of biofuels. Despite its importance to basic and applied biological research, the level and pattern of genetic variation in this haploid green alga has yet to be characterized on a genome-wide scale. To improve understanding of C. reinhardtii's genetic variability, we generated low coverage whole genome resequencing data for nearly all of the available isolates of this species, which were sampled from a number of sites in North America over the past ∼70 years. Based on the analysis of more than 62,000 single nucleotide polymorphisms, we identified two groups of isolates that represent geographical subpopulations of the species. We also found that measurements of genetic diversity were highly variable throughout the genome, in part due to technical factors. We studied the level and pattern of linkage disequilibrium (LD), and observed one chromosome that exhibits elevated LD. Furthermore, we detected widespread evidence of recombination across the genome, which implies that outcrossing occurs in natural populations of this species. In summary, our study provides multiple insights into the sequence diversity of C. reinhardtii that will be useful to future studies of natural genetic variation in this organism.

  13. Relief of arsenate toxicity by Cd-stimulated phytochelatin synthesis in the green alga Chlamydomonas reinhardtii.


    Kobayashi, Isao; Fujiwara, Shoko; Saegusa, Hirotaka; Inouhe, Masahiro; Matsumoto, Hiroko; Tsuzuki, Mikio


    In most photosynthetic organisms, inorganic arsenic taken up into the cells inhibits photosynthesis and cellular growth. In a green alga, Chlamydomonas reinhardtii, 0.5 mM arsenate inhibited photosynthesis almost completely within 30 min. However, in cells acclimated with a sublethal concentration (0.05 to 0.1 mM) of Cd, the inhibition of photosynthesis at 30 min after the addition of arsenate was relieved by more than 50%. The concentrations of arsenic incorporated into the cells were not significantly different between the Cd-acclimated and the non-acclimated cells. The Cd-acclimated cells accumulated Cd and synthesized phytochelatin (PC) peptides, which are known to play an important role in detoxification of heavy metals in plants. By the addition of an inhibitor of glutathione (an intermediate in the PC biosynthetic pathway) biosynthesis, buthionine sulfoximine, cells lost not only Cd tolerance but also arsenate tolerance. These results suggest that glutathione and/or PCs synthesized in Cd-acclimated cells are involved in mechanisms of arsenate tolerance.

  14. Simultaneous cryo X-ray ptychographic and fluorescence microscopy of green algae

    SciTech Connect

    Deng, Junjing; Vine, David J.; Chen, Si; Nashed, Youssef S. G.; Jin, Qiaoling; Phillips, Nicholas W.; Peterka, Tom; Ross, Rob; Vogt, Stefan; Jacobsen, Chris J.


    Trace metals play important roles in normal and in disease-causing biological functions. X-ray fluorescence microscopy reveals trace elements with no dependence on binding affinities (unlike with visible light fluorophores) and with improved sensitivity relative to electron probes. However, X-ray fluorescence is not very sensitive for showing the light elements that comprise the majority of cellular material. Here we show that X-ray ptychography can be combined with fluorescence to image both cellular structure and trace element distribution in frozen-hydrated cells at cryogenic temperatures, with high structural and chemical fidelity. Ptychographic reconstruction algorithms deliver phase and absorption contrast images at a resolution beyond that of the illuminating lens or beam size. Using 5.2-keV X-rays, we have obtained sub–30-nm resolution structural images and ~90-nm–resolution fluorescence images of several elements in frozen-hydrated green algae. This combined approach offers a way to study the role of trace elements in their structural context.

  15. Simultaneous cryo X-ray ptychographic and fluorescence microscopy of green algae


    Deng, Junjing; Vine, David J.; Chen, Si; Nashed, Youssef S. G.; Jin, Qiaoling; Phillips, Nicholas W.; Peterka, Tom; Ross, Rob; Vogt, Stefan; Jacobsen, Chris J.


    Trace metals play important roles in normal and in disease-causing biological functions. X-ray fluorescence microscopy reveals trace elements with no dependence on binding affinities (unlike with visible light fluorophores) and with improved sensitivity relative to electron probes. However, X-ray fluorescence is not very sensitive for showing the light elements that comprise the majority of cellular material. Here we show that X-ray ptychography can be combined with fluorescence to image both cellular structure and trace element distribution in frozen-hydrated cells at cryogenic temperatures, with high structural and chemical fidelity. Ptychographic reconstruction algorithms deliver phase and absorption contrast images at a resolutionmore » beyond that of the illuminating lens or beam size. Using 5.2-keV X-rays, we have obtained sub–30-nm resolution structural images and ~90-nm–resolution fluorescence images of several elements in frozen-hydrated green algae. This combined approach offers a way to study the role of trace elements in their structural context.« less

  16. Characterization of Hydrogen Metabolism in the Multicellular Green Alga Volvox carteri


    Cornish, Adam J.; Green, Robin; Gärtner, Katrin; Mason, Saundra; Hegg, Eric L.


    Hydrogen gas functions as a key component in the metabolism of a wide variety of microorganisms, often acting as either a fermentative end-product or an energy source. The number of organisms reported to utilize hydrogen continues to grow, contributing to and expanding our knowledge of biological hydrogen processes. Here we demonstrate that Volvox carteri f. nagariensis, a multicellular green alga with differentiated cells, evolves H2 both when supplied with an abiotic electron donor and under physiological conditions. The genome of Volvox carteri contains two genes encoding putative [FeFe]-hydrogenases (HYDA1 and HYDA2), and the transcripts for these genes accumulate under anaerobicmore » conditions. The HYDA1 and HYDA2 gene products were cloned, expressed, and purified, and both are functional [FeFe]-hydrogenases. Additionally, within the genome the HYDA1 and HYDA2 genes cluster with two putative genes which encode hydrogenase maturation proteins. This gene cluster resembles operon-like structures found within bacterial genomes and may provide further insight into evolutionary relationships between bacterial and algal [FeFe]-hydrogenase genes.« less

  17. Bioenergetic Strategy for the Biodegradation of p-Cresol by the Unicellular Green Alga Scenedesmus obliquus

    PubMed Central

    Papazi, Aikaterini; Assimakopoulos, Konstantinos; Kotzabasis, Kiriakos


    Cultures from the unicellular green alga Scenedesmus obliquus biodegrade the toxic p-cresol (4-methylphenol) and use it as alternative carbon/energy source. The biodegradation procedure of p-cresol seems to be a two-step process. HPLC analyses indicate that the split of the methyl group (first step) that is possibly converted to methanol (increased methanol concentration in the growth medium), leading, according to our previous work, to changes in the molecular structure and function of the photosynthetic apparatus and therefore to microalgal biomass increase. The second step is the fission of the intermediately produced phenol. A higher p-cresol concentration results in a higher p-cresol biodegradation rate and a lower total p-cresol biodegradability. The first biodegradation step seems to be the most decisive for the effectiveness of the process, because methanol offers energy for the further biodegradation reactions. The absence of LHCII from the Scenedesmus mutant wt-lhc stopped the methanol effect and significantly reduced the p-cresol biodegradation (only 9%). The present contribution deals with an energy distribution between microalgal growth and p-cresol biodegradation, activated by p-cresol concentration. The simultaneous biomass increase with the detoxification of a toxic phenolic compound (p-cresol) could be a significant biotechnological aspect for further applications. PMID:23251641

  18. Active hydrocarbon biosynthesis and accumulation in a green alga, Botryococcus braunii (race A).


    Hirose, Mana; Mukaida, Fukiko; Okada, Sigeru; Noguchi, Tetsuko


    Among oleaginous microalgae, the colonial green alga Botryococcus braunii accumulates especially large quantities of hydrocarbons. This accumulation may be achieved more by storage of lipids in the extracellular space rather than in the cytoplasm, as is the case for all other examined oleaginous microalgae. The stage of hydrocarbon synthesis during the cell cycle was determined by autoradiography. The cell cycle of B. braunii race A was synchronized by aminouracil treatment, and cells were taken at various stages in the cell cycle and cultured in a medium containing [(14)C]acetate. Incorporation of (14)C into hydrocarbons was detected. The highest labeling occurred just after septum formation, when it was about 2.6 times the rate during interphase. Fluorescent and electron microscopy revealed that new lipid accumulation on the cell surface occurred during at least two different growth stages and sites of cells. Lipid bodies in the cytoplasm were not prominent in interphase cells. These lipid bodies then increased in number, size, and inclusions, reaching maximum values just before the first lipid accumulation on the cell surface at the cell apex. Most of them disappeared from the cytoplasm concomitant with the second new accumulation at the basolateral region, where extracellular lipids continuously accumulated. The rough endoplasmic reticulum near the plasma membrane is prominent in B. braunii, and the endoplasmic reticulum was often in contact with both a chloroplast and lipid bodies in cells with increasing numbers of lipid bodies. We discuss the transport pathway of precursors of extracellular hydrocarbons in race A.

  19. Convoluted Plasma Membrane Domains in the Green Alga Chara are Depleted of Microtubules and Actin Filaments.


    Sommer, Aniela; Hoeftberger, Margit; Hoepflinger, Marion C; Schmalbrock, Sarah; Bulychev, Alexander; Foissner, Ilse


    Charasomes are convoluted plasma membrane domains in the green alga Chara australis. They harbor H(+)-ATPases involved in acidification of the medium, which facilitates carbon uptake required for photosynthesis. In this study we investigated the distribution of cortical microtubules and cortical actin filaments in relation to the distribution of charasomes. We found that microtubules and actin filaments were largely lacking beneath the charasomes, suggesting the absence of nucleating and/or anchoring complexes or an inhibitory effect on polymerization. We also investigated the influence of cytoskeleton inhibitors on the light-dependent growth and the darkness-induced degradation of charasomes. Inhibition of cytoplasmic streaming by cytochalasin D significantly inhibited charasome growth and delayed charasome degradation, whereas depolymerization of microtubules by oryzalin or stabilization of microtubules by paclitaxel had no effect. Our data indicate that the membrane at the cytoplasmic surface of charasomes has different properties in comparison with the smooth plasma membrane. We show further that the actin cytoskeleton is necessary for charasome growth and facilitates charasome degradation presumably via trafficking of secretory and endocytic vesicles, respectively. However, microtubules are required neither for charasome growth nor for charasome degradation. PMID:26272553

  20. Integration of carbon assimilation modes with photosynthetic light capture in the green alga Chlamydomonas reinhardtii.


    Berger, Hanna; Blifernez-Klassen, Olga; Ballottari, Matteo; Bassi, Roberto; Wobbe, Lutz; Kruse, Olaf


    The unicellular green alga Chlamydomonas reinhardtii is capable of using organic and inorganic carbon sources simultaneously, which requires the adjustment of photosynthetic activity to the prevailing mode of carbon assimilation. We obtained novel insights into the regulation of light-harvesting at photosystem II (PSII) following altered carbon source availability. In C. reinhardtii, synthesis of PSII-associated light-harvesting proteins (LHCBMs) is controlled by the cytosolic RNA-binding protein NAB1, which represses translation of particular LHCBM isoform transcripts. This mechanism is fine-tuned via regulation of the nuclear NAB1 promoter, which is activated when linear photosynthetic electron flow is restricted by CO(2)-limitation in a photoheterotrophic context. In the wild-type, accumulation of NAB1 reduces the functional PSII antenna size, thus preventing a harmful overexcited state of PSII, as observed in a NAB1-less mutant. We further demonstrate that translation control as a newly identified long-term response to prolonged CO(2)-limitation replaces LHCII state transitions as a fast response to PSII over-excitation. Intriguingly, activation of the long-term response is perturbed in state transition mutant stt7, suggesting a regulatory link between the long- and short-term response. We depict a regulatory circuit operating on distinct timescales and in different cellular compartments to fine-tune light-harvesting in photoheterotrophic eukaryotes.

  1. Oxygen-dependent proton efflux in cyanobacteria (blue-green algae). [Anabaena variabilis

    SciTech Connect

    Scherer, S.; Stuerzl, E.; Boeger, P.


    The oxygen-dependent proton efflux (in the dark) of intact cells of Anabaena variabilis and four other cyanobacteria (blue-green algae) was investigated. In contrast to bacteria and isolated mitochondria, an H/sup +//e ratio (= protons translocated per electron transported) of only 0.23 to 0.35 and a P/e ratio of 0.8 to 1.5 were observed, indicative of respiratory electron transport being localized essentially on the thylakoids, not on the cytoplasmic membrane. Oxygen-induced acidification of the medium was sensitive to cyanide and the uncoupler carbonyl cyanide m-chlorophenylhydrazone. Inhibitors such as 2,6-dinitrophenol and vanadate exhibited a significant decrease in the H/sup +//e ratio. After the oxygen pulse, electron transport started immediately, but proton efflux lagged 40 to 60 s behind, a period also needed before maximum ATP pool levels were attained. The authors suggest that proton efflux in A. variabilis is due to a proton-translocating ATP hydrolase (ATP-consuming ATPase) rather than to respiratory electron transport located on the cytoplasmic membrane.

  2. Characterization of Hydrogen Metabolism in the Multicellular Green Alga Volvox carteri.


    Cornish, Adam J; Green, Robin; Gärtner, Katrin; Mason, Saundra; Hegg, Eric L


    Hydrogen gas functions as a key component in the metabolism of a wide variety of microorganisms, often acting as either a fermentative end-product or an energy source. The number of organisms reported to utilize hydrogen continues to grow, contributing to and expanding our knowledge of biological hydrogen processes. Here we demonstrate that Volvox carteri f. nagariensis, a multicellular green alga with differentiated cells, evolves H2 both when supplied with an abiotic electron donor and under physiological conditions. The genome of Volvox carteri contains two genes encoding putative [FeFe]-hydrogenases (HYDA1 and HYDA2), and the transcripts for these genes accumulate under anaerobic conditions. The HYDA1 and HYDA2 gene products were cloned, expressed, and purified, and both are functional [FeFe]-hydrogenases. Additionally, within the genome the HYDA1 and HYDA2 genes cluster with two putative genes which encode hydrogenase maturation proteins. This gene cluster resembles operon-like structures found within bacterial genomes and may provide further insight into evolutionary relationships between bacterial and algal [FeFe]-hydrogenase genes. PMID:25927230

  3. Characterization of Hydrogen Metabolism in the Multicellular Green Alga Volvox carteri.


    Cornish, Adam J; Green, Robin; Gärtner, Katrin; Mason, Saundra; Hegg, Eric L


    Hydrogen gas functions as a key component in the metabolism of a wide variety of microorganisms, often acting as either a fermentative end-product or an energy source. The number of organisms reported to utilize hydrogen continues to grow, contributing to and expanding our knowledge of biological hydrogen processes. Here we demonstrate that Volvox carteri f. nagariensis, a multicellular green alga with differentiated cells, evolves H2 both when supplied with an abiotic electron donor and under physiological conditions. The genome of Volvox carteri contains two genes encoding putative [FeFe]-hydrogenases (HYDA1 and HYDA2), and the transcripts for these genes accumulate under anaerobic conditions. The HYDA1 and HYDA2 gene products were cloned, expressed, and purified, and both are functional [FeFe]-hydrogenases. Additionally, within the genome the HYDA1 and HYDA2 genes cluster with two putative genes which encode hydrogenase maturation proteins. This gene cluster resembles operon-like structures found within bacterial genomes and may provide further insight into evolutionary relationships between bacterial and algal [FeFe]-hydrogenase genes.

  4. Monophyly of primary photosynthetic eukaryotes: green plants, red algae, and glaucophytes.


    Rodríguez-Ezpeleta, Naiara; Brinkmann, Henner; Burey, Suzanne C; Roure, Béatrice; Burger, Gertraud; Löffelhardt, Wolfgang; Bohnert, Hans J; Philippe, Hervé; Lang, B Franz


    Between 1 and 1.5 billion years ago, eukaryotic organisms acquired the ability to convert light into chemical energy through endosymbiosis with a Cyanobacterium (e.g.,). This event gave rise to "primary" plastids, which are present in green plants, red algae, and glaucophytes ("Plantae" sensu Cavalier-Smith). The widely accepted view that primary plastids arose only once implies two predictions: (1) all plastids form a monophyletic group, as do (2) primary photosynthetic eukaryotes. Nonetheless, unequivocal support for both predictions is lacking (e.g.,). In this report, we present two phylogenomic analyses, with 50 genes from 16 plastid and 15 cyanobacterial genomes and with 143 nuclear genes from 34 eukaryotic species, respectively. The nuclear dataset includes new sequences from glaucophytes, the less-studied group of primary photosynthetic eukaryotes. We find significant support for both predictions. Taken together, our analyses provide the first strong support for a single endosymbiotic event that gave rise to primary photosynthetic eukaryotes, the Plantae. Because our dataset does not cover the entire eukaryotic diversity (but only four of six major groups in), further testing of the monophyly of Plantae should include representatives from eukaryotic lineages for which currently insufficient sequence information is available.

  5. Occurrence of Only One Form of Glutamine Synthetase in the Green Alga Monoraphidium braunii.

    PubMed Central

    Garcia-Fernandez, J. M.; Lopez-Ruiz, A.; Toribio, F.; Roldan, J. M.; Diez, J.


    Anion-exchange chromatography of crude extracts from the green alga Monoraphidium braunii yielded two glutamine synthetase (GS) activities. The ratio of activities was markedly different when crude extracts were subjected to various processing conditions but was not influenced by environmental factors of cell cultures. However, high performance liquid chromatography anion-exchange chromatograms showed only one GS if the crude extracts were processed immediately after cell disruption. Moreover, standard chromatography of crude extracts obtained in the absence of dithioerythritol, a reductant generally used in disruption buffers, yielded a single activity peak. Enzyme samples from the two activities obtained in the presence of dithioerythritol were purified for physicochemical characterization and antibody production. Both enzyme samples exhibited similar reactions to different inactivating agents and were undistinguishable by size-exclusion chromatography and native polyacrylamide gel electrophoresis. Additionally, the two GS preparations showed absolute antigenic identity as demonstrated by immunodiffusion and immunoblotting experiments. Immunocytochemistry of M. braunii cryosections evidenced a chloroplast-specific distribution of the enzyme, which rules out the existence of a cytoplasmic counterpart. All these results support the proposal that M. braunii possesses only one form of GS. PMID:12232093

  6. Characterization of Hydrogen Metabolism in the Multicellular Green Alga Volvox carteri

    PubMed Central

    Cornish, Adam J.; Green, Robin; Gärtner, Katrin; Mason, Saundra; Hegg, Eric L.


    Hydrogen gas functions as a key component in the metabolism of a wide variety of microorganisms, often acting as either a fermentative end-product or an energy source. The number of organisms reported to utilize hydrogen continues to grow, contributing to and expanding our knowledge of biological hydrogen processes. Here we demonstrate that Volvox carteri f. nagariensis, a multicellular green alga with differentiated cells, evolves H2 both when supplied with an abiotic electron donor and under physiological conditions. The genome of Volvox carteri contains two genes encoding putative [FeFe]-hydrogenases (HYDA1 and HYDA2), and the transcripts for these genes accumulate under anaerobic conditions. The HYDA1 and HYDA2 gene products were cloned, expressed, and purified, and both are functional [FeFe]-hydrogenases. Additionally, within the genome the HYDA1 and HYDA2 genes cluster with two putative genes which encode hydrogenase maturation proteins. This gene cluster resembles operon-like structures found within bacterial genomes and may provide further insight into evolutionary relationships between bacterial and algal [FeFe]-hydrogenase genes. PMID:25927230

  7. Characterization of Hydrogen Metabolism in the Multicellular Green Alga Volvox carteri

    SciTech Connect

    Cornish, Adam J.; Green, Robin; Gärtner, Katrin; Mason, Saundra; Hegg, Eric L.


    Hydrogen gas functions as a key component in the metabolism of a wide variety of microorganisms, often acting as either a fermentative end-product or an energy source. The number of organisms reported to utilize hydrogen continues to grow, contributing to and expanding our knowledge of biological hydrogen processes. Here we demonstrate that Volvox carteri f. nagariensis, a multicellular green alga with differentiated cells, evolves H2 both when supplied with an abiotic electron donor and under physiological conditions. The genome of Volvox carteri contains two genes encoding putative [FeFe]-hydrogenases (HYDA1 and HYDA2), and the transcripts for these genes accumulate under anaerobic conditions. The HYDA1 and HYDA2 gene products were cloned, expressed, and purified, and both are functional [FeFe]-hydrogenases. Additionally, within the genome the HYDA1 and HYDA2 genes cluster with two putative genes which encode hydrogenase maturation proteins. This gene cluster resembles operon-like structures found within bacterial genomes and may provide further insight into evolutionary relationships between bacterial and algal [FeFe]-hydrogenase genes.

  8. A novel alphaproteobacterial ectosymbiont promotes the growth of the hydrocarbon-rich green alga Botryococcus braunii

    PubMed Central

    Tanabe, Yuuhiko; Okazaki, Yusuke; Yoshida, Masaki; Matsuura, Hiroshi; Kai, Atsushi; Shiratori, Takashi; Ishida, Ken-ichiro; Nakano, Shin-ichi; Watanabe, Makoto M.


    Botryococcus braunii is a colony-forming green alga that accumulates large amounts of liquid hydrocarbons within the colony. The utilization of B. braunii for biofuel production is however hindered by its low biomass productivity. Here we describe a novel bacterial ectosymbiont (BOTRYCO-2) that confers higher biomass productivity to B. braunii. 16S rDNA analysis indicated that the sequence of BOTRYCO-2 shows low similarity (<90%) to cultured bacterial species and located BOTRYCO-2 within a phylogenetic lineage consisting of uncultured alphaproteobacterial clones. Fluorescence in situ hybridization (FISH) studies and transmission electric microscopy indicated that BOTRYCO-2 is closely associated with B. braunii colonies. Interestingly, FISH analysis of a water bloom sample also found BOTRYCO-2 bacteria in close association with cyanobacterium Microcystis aeruginosa colonies, suggesting that BOTRYCO-2 relatives have high affinity to phytoplankton colonies. A PCR survey of algal bloom samples revealed that the BOTRYCO-2 lineage is commonly found in Microcystis associated blooms. Growth experiments indicated that B. braunii Ba10 can grow faster and has a higher biomass (1.8-fold) and hydrocarbon (1.5-fold) yield in the presence of BOTRYCO-2. Additionally, BOTRYCO-2 conferred a higher biomass yield to BOT-22, one of the fastest growing strains of B. braunii. We propose the species name ‘Candidatus Phycosocius bacilliformis’ for BOTRYCO-2. PMID:26130609

  9. Ammonia removal from anaerobic digestion effluent of livestock waste using green alga Scenedesmus sp.


    Park, Jongmin; Jin, Hai-Feng; Lim, Byung-Ran; Park, Ki-Young; Lee, Kisay


    The green alga Scenedesmus was investigated for its ability to remove nitrogen from anaerobic digestion effluent possessing high ammonium content and alkalinity in addition to its growth characteristics. Nitrate and ammonium were indistinguishable as a nitrogen source when the ammonium concentration was at normal cultivation levels. Ammonium up to 100ppm NH(4)-N did not inhibit cell growth, but did decrease final cell density by up to 70% at a concentration of 200-500ppm NH(4)-N. Inorganic carbon of alkalinity in the form of bicarbonate was consumed rapidly, in turn causing the attenuation of cell growth. Therefore, maintaining a certain level of inorganic carbon is necessary in order to prolong ammonia removal. A moderate degree of aeration was beneficial to ammonia removal, not only due to the stripping of ammonium to ammonia gas but also due to the stripping of oxygen, which is an inhibitor of regular photosynthesis. Magnesium is easily consumed compared to other metallic components and therefore requires periodic supplementation. Maintaining appropriate levels of alkalinity, Mg, aeration along with optimal an initial NH(4)(+)/cell ratio were all necessary for long-term semi-continuous ammonium removal and cell growth. PMID:20663665

  10. Lipopolysaccharide containing L-acofriose in the filamentous blue-green alga Anabaena variabilis.


    Weckesser, J; Katz, A; Drews, G; Mayer, H; Fromme, I


    For the first time, an O-antigenic lipopolysaccharide (LPS) has been isolated from a filamentous blue-green alga (Anabaena variabilis). It was extractable with phenol-water, resulting in extraction of the bulk of the LPS into the phenol phase. The polysaccharide moiety of this LPS consists of l-rhamnose, its 3-O-methyl ether l-acofriose, d-mannose, d-glucose, and d-galactose. l-Glycero-d-mannoheptose and 2-keto-3-deoxyoctonate, the two characteristic sugar components of enteric LPS, and phosphate groups are absent from the A. variabilis O antigen. The only amino sugar present is d-glucosamine. Three hydroxy fatty acids were identified, namely, beta-hydroxymyristic, beta-hydroxypalmitic and beta-hydroxystearic acids, in addition to palmitic and unidentified fatty acid. The LPS of A. variabilis is localized in the outermost cell wall layer and behaves like a bacterial O antigen in serological tests. The passive hemagglutination yielded high titers with isolated LPS (pretreated by heat or by alkali) and rabbit antisera prepared against living or heat-killed cells. The position of the precipitation arcs after immunoelectrophoresis of the O antigen indicates the lack of charged groups. The water phase of the phenol-water extract contains, in high yield, a glucose polymer. It is serologically inactive as shown by the passive hemagglutination test and by agar-gel precipitation.

  11. Convoluted Plasma Membrane Domains in the Green Alga Chara are Depleted of Microtubules and Actin Filaments.


    Sommer, Aniela; Hoeftberger, Margit; Hoepflinger, Marion C; Schmalbrock, Sarah; Bulychev, Alexander; Foissner, Ilse


    Charasomes are convoluted plasma membrane domains in the green alga Chara australis. They harbor H(+)-ATPases involved in acidification of the medium, which facilitates carbon uptake required for photosynthesis. In this study we investigated the distribution of cortical microtubules and cortical actin filaments in relation to the distribution of charasomes. We found that microtubules and actin filaments were largely lacking beneath the charasomes, suggesting the absence of nucleating and/or anchoring complexes or an inhibitory effect on polymerization. We also investigated the influence of cytoskeleton inhibitors on the light-dependent growth and the darkness-induced degradation of charasomes. Inhibition of cytoplasmic streaming by cytochalasin D significantly inhibited charasome growth and delayed charasome degradation, whereas depolymerization of microtubules by oryzalin or stabilization of microtubules by paclitaxel had no effect. Our data indicate that the membrane at the cytoplasmic surface of charasomes has different properties in comparison with the smooth plasma membrane. We show further that the actin cytoskeleton is necessary for charasome growth and facilitates charasome degradation presumably via trafficking of secretory and endocytic vesicles, respectively. However, microtubules are required neither for charasome growth nor for charasome degradation.

  12. Convoluted Plasma Membrane Domains in the Green Alga Chara are Depleted of Microtubules and Actin Filaments

    PubMed Central

    Sommer, Aniela; Hoeftberger, Margit; Hoepflinger, Marion C.; Schmalbrock, Sarah; Bulychev, Alexander; Foissner, Ilse


    Charasomes are convoluted plasma membrane domains in the green alga Chara australis. They harbor H+-ATPases involved in acidification of the medium, which facilitates carbon uptake required for photosynthesis. In this study we investigated the distribution of cortical microtubules and cortical actin filaments in relation to the distribution of charasomes. We found that microtubules and actin filaments were largely lacking beneath the charasomes, suggesting the absence of nucleating and/or anchoring complexes or an inhibitory effect on polymerization. We also investigated the influence of cytoskeleton inhibitors on the light-dependent growth and the darkness-induced degradation of charasomes. Inhibition of cytoplasmic streaming by cytochalasin D significantly inhibited charasome growth and delayed charasome degradation, whereas depolymerization of microtubules by oryzalin or stabilization of microtubules by paclitaxel had no effect. Our data indicate that the membrane at the cytoplasmic surface of charasomes has different properties in comparison with the smooth plasma membrane. We show further that the actin cytoskeleton is necessary for charasome growth and facilitates charasome degradation presumably via trafficking of secretory and endocytic vesicles, respectively. However, microtubules are required neither for charasome growth nor for charasome degradation. PMID:26272553

  13. Class XIII myosins from the green alga Acetabularia: driving force in organelle transport and tip growth?


    Vugrek, Oliver; Sawitzky, Heiko; Menzel, Diedrik


    The green alga Acetabularia cliftonii (Dasycladales) contains at least two myosin genes, which already have been assigned class XIII of the myosin superfamily (Cope et al., 1996, Structure 4: 969-987). Here we report a complete analysis of their gene structure and their corresponding transcripts Aclmyo1 and Aclmyo2. Despite promising Northern blot data no evidence for alternative splicing could be found. Dissecting the primary structure at complementary deoxyribonucleic acid (cDNA) level we found a myosin typical organization in head, neck and variable tail region. Most striking is the extremely short tail region of Aclmyo1 with only 18 residues and the maximum number of 7 IQ motifs in Aclmyo2. Probing Acetabularia protein extracts with an antibody raised to a synthetic peptide derived from the amino terminal region in Alcmyo1 showed cross-reactivity to a polypeptide with a molecular mass of approximately 100 kD. This corresponds to the predicted molecular weight of Aclmyo1, which is 106 kD as deduced from the amino acid sequence. Additionally, the same cross-reactive protein is capable of binding F-actin as indicated by a co-sedimentation assay. Confocal laser scanning microscopy with raised antibody revealed co-localization with organelles, the budding region of lateral whorls and the cell apex suggesting involvement of putative Acetabularia myosin in organelle transport and tip growth.

  14. Dynamics and pharmacological perturbations of the endoplasmic reticulum in the unicellular green alga Acetabularia.


    Menzel, D


    The giant unicellular green alga Acetabularia was labeled with the lipophilic fluorochrome DiOC6 (3,3'-dihexyloxacarbocyanine) and examined by confocal laser scanning microscopy to study the distribution of the endoplasmic reticulum (ER) and its dynamic changes after the application of inhibitors. In control cells, a two-dimensional polygonal network of ER sheets and tubulus is suspended between parallel, longitudinally oriented bands. These bands coincide with the main physical tracks of organelle transport. All treatments that inhibited organelle motility caused a transformation of the polygonal network into confluent large patches of lamellar ER sheets. The shape of the lamellar sheets and residual activities of the ER were dependent on the inhibitors used. The largest ER lamellae were obtained after cytochalasin D (CD) treatment which effectively stopped cytoplasmic streaming. CD also caused the formation of a network of fine tubules overlapping with the lamellar sheets. Okadaic acid, a specific inhibitor of serine/threonine-protein phosphatases, also caused inhibition of organelle movement and enlargement of lamellar areas. Tension in the cytoplasm appeared to be reduced, as judged from the convexly curved lamellar rims and wavy connecting ER tubules. In contrast, N-ethylmaleimide, a sulfhydryl group blocking reagent, rapidly stopped streaming and halted all activities of the ER in a rigor-like state. These effects are interpreted in the context of actin-based motility phenomena prevalent in Acetabularia, and regulatory principles are discussed that might underlie ER dynamics.

  15. Genome of the halotolerant green alga Picochlorum sp. reveals strategies for thriving under fluctuating environmental conditions.


    Foflonker, Fatima; Price, Dana C; Qiu, Huan; Palenik, Brian; Wang, Shuyi; Bhattacharya, Debashish


    An expected outcome of climate change is intensification of the global water cycle, which magnifies surface water fluxes, and consequently alters salinity patterns. It is therefore important to understand the adaptations and limits of microalgae to survive changing salinities. To this end, we sequenced the 13.5 Mbp genome of the halotolerant green alga Picochlorum SENEW3 (SE3) that was isolated from a brackish water pond subject to large seasonal salinity fluctuations. Picochlorum SE3 encodes 7367 genes, making it one of the smallest and most gene dense eukaryotic genomes known. Comparison with the pico-prasinophyte Ostreococcus tauri, a species with a limited range of salt tolerance, reveals the enrichment of transporters putatively involved in the salt stress response in Picochlorum SE3. Analysis of cultures and the protein complement highlight the metabolic flexibility of Picochlorum SE3 that encodes genes involved in urea metabolism, acetate assimilation and fermentation, acetoin production and glucose uptake, many of which form functional gene clusters. Twenty-four cases of horizontal gene transfer from bacterial sources were found in Picochlorum SE3 with these genes involved in stress adaptation including osmolyte production and growth promotion. Our results identify Picochlorum SE3 as a model for understanding microalgal adaptation to stressful, fluctuating environments.

  16. Phototoxicity of benzo(a)pyrene in the green alga Selenastrum capricornutum

    SciTech Connect

    Cody, T.E.; Radike, M.J.; Warshawsky, D.


    The effects of selected polycyclic aromatic hydrocarbons (PAHs) on the growth of the green alga Selenastrum capricornutum in three light regimens were examined. In gold fluorescent light, benzo(a)pyrene (BaP) at 12 mg/liter (48, benz(a)anthracene (BaA) at 40 mg/liter (175, anthracene (A) at 40 mg/liter (224, and 13 metabolites of BaP each at 40 had no effect on algal growth. In cool-white fluorescent light, 30% inhibition of algal growth occurred with 0.1 BaP, 8.0 BaA, and 40 A. BaP at 0.16 mg/liter (0.64 totally inhibited growth. BaP concentrations an order of magnitude lower inhibited algal growth in fluorescent blacklight. In cool-white light, 5 of 13 metabolites of BaP (each 40 inhibited algal growth; 3,6-quinone; 6-hydroxy; 9-hydroxy; 3-hydroxy; and 1,6-quinone. Based on these results, PAHs and metabolites of BaP are selectively phototoxic to S. capricornutum due to the incident light intensity below 550 nm.

  17. Photosynthetic regeneration of ATP using a strain of thermophilic blue-green algae

    SciTech Connect

    Sawa, Y.; Kanayama, K.; Ochiai, H.


    Photosynthetic ATP accumulation was shown in the presence of exogenous ADP plus ortho-phosphate on illumination to the intact cells of a strain of thermophilic blue-green algae isolated from Matsue hot springs, Mastigocladus sp. Kinetic studies of various effectors on the ATP accumulation proved that the ATP synthesis depends mainly on the cyclic photophosphorylation system around photosystem I (PS-I) in the algal cells. The temperature and pH optima for the accumulation were found at 45 degrees C and pH 7.5. Maximum yield was obtained with light intensity higher than 15 mW/squared cm. Borate ion exerted pronounced enhancement on the ATP synthesis. With a continuous reactor at a flow rate of 1 ml/hour at 45 degrees C and pH 7.5, efficient photoconversion of ADP (2mM, at substrate reservoir) to ATP (1mM, at product outlet) has been maintained for a period of 2.5 days, though the efficiency has decreased in a further 2-day period to the level of 0.5 mM ATP/9.5 h of residence time. (Refs. 24).

  18. Toxic cell concentrations of three polychlorinated biphenyl congeners in the green alga, Selenastrum capricornutum

    SciTech Connect

    Mayer, P. |; Halling-Soerensen, B.; Nyholm, N.; Sijm, D.T.H.M.


    Algal growth inhibition tests were performed with the unicellular green alga Selenastrum capricornutum and three {sup 14}C-labeled polychlorinated biphenyl (PCB) congeners. Toxicity was related to external aqueous concentrations and additionally to internal algal bound PCB concentrations. Estimates of the concentrations at 50% effectiveness (EC50s) for the three PCB congeners ranged within a factor of 17 when based on measured aqueous concentrations. When based on internal toxicant concentrations the corresponding range was 6.7 to 14.3 mmol/kg wet weight. Thus, changing the basis from external to internal concentrations reduced the range by almost one order of magnitude. Additional toxic cell concentrations of five monoaromatic compounds and S. capricornutum were calculated from literature data to be in the same order of magnitude as the experimental toxic cell concentrations for the PCBs, whereas EC50 values for all substances ranged by more than four orders of magnitude. The experimental and calculated data indicate that observed differences in the estimated EC50 values were mainly due to differences in bioconcentration behavior rather than to different intrinsic toxicities. These findings are in agreement with the concept of baseline toxicity, meaning that a number of hydrophobic organics exerts their acute toxicity by one relatively nonspecific mode of action.

  19. Comparison of the Photosynthetic Yield of Cyanobacteria and Green Algae: Different Methods Give Different Answers.


    Schuurmans, R Milou; van Alphen, Pascal; Schuurmans, J Merijn; Matthijs, Hans C P; Hellingwerf, Klaas J


    The societal importance of renewable carbon-based commodities and energy carriers has elicited a particular interest for high performance phototrophic microorganisms. Selection of optimal strains is often based on direct comparison under laboratory conditions of maximal growth rate or additional valued features such as lipid content. Instead of reporting growth rate in culture, estimation of photosynthetic efficiency (quantum yield of PSII) by pulse-amplitude modulated (PAM) fluorimetry is an often applied alternative method. Here we compared the quantum yield of PSII and the photonic yield on biomass for the green alga Chlorella sorokiniana 211-8K and the cyanobacterium Synechocystis sp. PCC 6803. Our data demonstrate that the PAM technique inherently underestimates the photosynthetic efficiency of cyanobacteria by rendering a high F0 and a low FM, specifically after the commonly practiced dark pre-incubation before a yield measurement. Yet when comparing the calculated biomass yield on light in continuous culture experiments, we obtained nearly equal values for both species. Using mutants of Synechocystis sp. PCC 6803, we analyzed the factors that compromise its PAM-based quantum yield measurements. We will discuss the role of dark respiratory activity, fluorescence emission from the phycobilisomes, and the Mehler-like reaction. Based on the above observations we recommend that PAM measurements in cyanobacteria are interpreted only qualitatively. PMID:26394153

  20. Heterotrimeric G-proteins in green algae. An early innovation in the evolution of the plant lineage.


    Hackenberg, Dieter; Pandey, Sona


    Heterotrimeric G-proteins (G-proteins, hereafter) are important signaling components in all eukaryotes. The absence of these proteins in the sequenced genomes of Chlorophycean green algae has raised questions about their evolutionary origin and prevalence in the plant lineage. The existence of G-proteins has often been correlated with the acquisition of embryophytic life-cycle and/or terrestrial habitats of plants which occurred around 450 million years ago. Our discovery of functional G-proteins in Chara braunii, a representative of the Charophycean green algae, establishes the existence of this conserved signaling pathway in the most basal plants and dates it even further back to 1-1.5 billion years ago. We have now identified the sequence homologs of G-proteins in additional algal families and propose that green algae represent a model system for one of the most basal forms of G-protein signaling known to exist to date. Given the possible differences that exist between plant and metazoan G-protein signaling mechanisms, such basal organisms will serve as important resources to trace the evolutionary origin of proposed mechanistic differences between the systems as well as their plant-specific functions.

  1. Heterotrimeric G-proteins in green algae. An early innovation in the evolution of the plant lineage.


    Hackenberg, Dieter; Pandey, Sona


    Heterotrimeric G-proteins (G-proteins, hereafter) are important signaling components in all eukaryotes. The absence of these proteins in the sequenced genomes of Chlorophycean green algae has raised questions about their evolutionary origin and prevalence in the plant lineage. The existence of G-proteins has often been correlated with the acquisition of embryophytic life-cycle and/or terrestrial habitats of plants which occurred around 450 million years ago. Our discovery of functional G-proteins in Chara braunii, a representative of the Charophycean green algae, establishes the existence of this conserved signaling pathway in the most basal plants and dates it even further back to 1-1.5 billion years ago. We have now identified the sequence homologs of G-proteins in additional algal families and propose that green algae represent a model system for one of the most basal forms of G-protein signaling known to exist to date. Given the possible differences that exist between plant and metazoan G-protein signaling mechanisms, such basal organisms will serve as important resources to trace the evolutionary origin of proposed mechanistic differences between the systems as well as their plant-specific functions. PMID:25764428

  2. Arabitol provided by lichenous fungi enhances ability to dissipate excess light energy in a symbiotic green alga under desiccation.


    Kosugi, Makiko; Miyake, Hirohisa; Yamakawa, Hisanori; Shibata, Yutaka; Miyazawa, Atsuo; Sugimura, Takashi; Satoh, Kazuhiko; Itoh, Shigeru; Kashino, Yasuhiro


    Lichens are drought-resistant symbiotic organisms of mycobiont fungi and photobiont green algae or cyanobacteria, and have an efficient mechanism to dissipate excess captured light energy into heat in a picosecond time range to avoid photoinhibition. This mechanism can be assessed as drought-induced non-photochemical quenching (d-NPQ) using time-resolved fluorescence spectroscopy. A green alga Trebouxia sp., which lives within a lichen Ramalina yasudae, is one of the most common green algal photobionts. This alga showed very efficient d-NPQ under desiccation within the lichen thallus, whereas it lost d-NPQ ability when isolated from R. yasudae, indicating the importance of the interaction with the mycobiont for d-NPQ ability. We analyzed the water extracts from lichen thalli that enhanced d-NPQ in Trebouxia. Of several sugar compounds identified in the water extracts by nuclear magnetic resonance (NMR), mass spectrometry (MS) and gas chromatography (GC) analyses, only d-arabitol recovered d-NPQ in isolated Trebouxia to a level similar to that detected for R. yasudae thallus. Other sugar compounds did not help the expression of d-NPQ at the same concentrations. Thus, arabitol is essential for the expression of d-NPQ to dissipate excess captured light energy into heat, protecting the photobiont from photoinhibition. The relationship between mycobionts and photobionts is, therefore, not commensalism, but mutualism with each other, as shown by d-NPQ expression.

  3. The effect of bloom of filamentous green algae on the reproduction of yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottoidae) during ecological crisis in Lake Baikal.


    Khanaev, I V; Dzyuba, E V; Kravtsova, L S; Grachev, M A


    In shallow water areas of open Lake Baikal, filamentous green alga of the genus Spirogyra grows abundantly. Together with alga of the genus Ulothrix, it forms algal mats. According to our observations from 2010 to 2013, the spawning habitat conditions for the yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottidae) proved to be significantly disturbed in the littoral zone of Listvennichnyi Bay (southern Baikal), which, in turn, reduced the number of egg layings. With a 100% projective cover of the floor and a high density of green filamentous algae, the shallow-water stony substrate becomes completely inaccessible for spawning of the August population. PMID:27193877

  4. The effect of bloom of filamentous green algae on the reproduction of yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottoidae) during ecological crisis in Lake Baikal.


    Khanaev, I V; Dzyuba, E V; Kravtsova, L S; Grachev, M A


    In shallow water areas of open Lake Baikal, filamentous green alga of the genus Spirogyra grows abundantly. Together with alga of the genus Ulothrix, it forms algal mats. According to our observations from 2010 to 2013, the spawning habitat conditions for the yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottidae) proved to be significantly disturbed in the littoral zone of Listvennichnyi Bay (southern Baikal), which, in turn, reduced the number of egg layings. With a 100% projective cover of the floor and a high density of green filamentous algae, the shallow-water stony substrate becomes completely inaccessible for spawning of the August population.

  5. Application of solid-acid catalyst and marine macro-algae Gracilaria verrucosa to production of fermentable sugars.


    Jeong, Gwi-Taek; Kim, Sung-Koo; Park, Don-Hee


    In this study, the hydrolysis of marine macro-algae Gracilaria verrucosa with a solid-acid catalyst was investigated. To optimize the hydrolysis, four reaction factors, including liquid-to-solid ratio, catalyst loading, reaction temperature, and reaction time, were investigated. In the results, the highest total reducing sugar (TRS) yield, 61 g/L (51.9%), was obtained under the following conditions: 1:7.5 solid-to-liquid ratio, 15% (w/v) catalyst loading, 140 °C reaction temperature, and 150 min reaction time. Under these conditions, 10.7 g/L of 5-HMF and 2.5 g/L of levulinic acid (LA) were generated. The application of solid-acid catalyst and marine macro-algae resources shows a very high potential for production of fermentable sugars.

  6. Screening for antibacterial and antifungal activities in some marine algae from the Fujian coast of China with three different solvents

    NASA Astrophysics Data System (ADS)

    Zheng, Yi; Chen, Yin-Shan; Lu, Hai-Sheng


    Three different solvents viz ethanol, acetone and methanol-toluene (3:1) were used to extract antibiotics from 23 species of marine algae belonging to the Chlorophyta, Phaeophyta and Rhodophyta. Their crude extracts were tested for antibacterial and antifungal activities. Among them, the ethanol extract showed the strongest activity against the bacteria and fungi tested. Four species of the Rhodophyta ( Laurencia okamurai, Dasya scoparia, Grateloupia filicina and plocamium telfairiae) showed a wide spectrum of antibacterial activity. Every solvent extract from the four species was active against all the bacteria tested. The test bacterium Pseudomonas solancearum and the fungus Penicilium citrinum were most sensitive to the extracts of marine algae. In general, the extracts of seaweeds inhibited bacteria more strongly than fungi and species of the Rhodophyta showed the greatest activity against the bacteria and fungi tested.

  7. A rapid, modular and marker-free chloroplast expression system for the green alga Chlamydomonas reinhardtii.


    Bertalan, Ivo; Munder, Matthias C; Weiß, Caroline; Kopf, Judith; Fischer, Dirk; Johanningmeier, Udo


    In search of alternative expression platforms heterologous protein production in microalgae has gained increasing importance in the last years. Particularly, the chloroplast of the green alga Chlamydomonas reinhardtii has been adopted to successfully express foreign proteins like vaccines and antibodies. However, when compared with other expression systems, the development of the algal chloroplast to a powerful production platform for recombinant proteins is still in its early stages. In an effort to further improve methods for a reliable and rapid generation of transplastomic Chlamydomonas strains we constructed the key plasmid pMM2 containing the psbA gene and a multiple cloning site for foreign gene insertion. The psbA gene allows a marker-free selection procedure using as a recipient the Fud7 strain of Chlamydomonas, which grows on media containing acetate as a carbon source, but is unable to grow photoautotrophically due to the lack of an intact psbA gene. Biolistic transformation of Fud7 with vectors containing this gene restores photoautotrophic growth and thus permits selection in the light on media without carbon sources and antibiotics. The multiple cloning site with a BsaI recognition sequence allows type IIs restriction enzyme-based modular cloning which rapidly generates new gene constructs without sequences, which could influence the expression and characteristics of the foreign protein. In order to demonstrate the feasibility of this approach, a codon optimized version of the gene for the bacterial protein MPT64 has been integrated into the plastome. Several strains with different promoter/UTR combinations show a stable expression of the HA tagged MPT64 protein in Chlamydomonas chloroplasts.

  8. Toxicity assessment of manufactured nanomaterials using the unicellular green alga Chlamydomonas reinhardtii.


    Wang, Jiangxin; Zhang, Xuezhi; Chen, Yongsheng; Sommerfeld, Milton; Hu, Qiang


    With the rapid development of nanotechnology, there is an increasing risk of human and environmental exposure to nanotechnology-based materials and products. As water resources are particularly vulnerable to direct and indirect contamination of nonomaterials (NMs), the potential toxicity and environmental implication of NMs to aquatic organisms must be evaluated. In this study, we assessed potential toxicity of two commercially used NMs, titanium dioxide (TiO(2)) and quantum dots (QDs), using the unicellular green alga Chlamydomonas reinhartii as a model system. The response of the organism to NMs was assessed at physiological, biochemical, and molecular genetic levels. Growth kinetics showed that growth inhibition occurred during the first two to three days of cultivation in the presence of TiO(2) or QDs. Measurements of lipid peroxidation measurement indicated that oxidative stress of the cells occurred as early as 6 h after exposure to TiO(2) or QDs. The transcriptional expression profiling of four stress response genes (sod1, gpx, cat, and ptox2) revealed that transient up-regulation of these genes occurred in cultures containing as low as 1.0 mg L(-1) of TiO(2) or 0.1 mg L(-1) of QDs, and the maximum transcripts of cat, sod1, gpx, and ptox2 occurred at 1.5, 3, 3, and 6 h, respectively, and were proportional to the initial concentration of the NMs. As the cultures continued, recovery in growth was observed and the extent of recovery, as indicated by the final cell concentration, was dosage-dependent. QDs were found to be more toxic to Chlamydomonas cells than TiO(2) under our experimental conditions.

  9. Functional Rearrangement of the Light-Harvesting Antenna upon State Transitions in a Green Alga

    PubMed Central

    Wlodarczyk, Lucyna M.; Snellenburg, Joris J.; Ihalainen, Janne A.; van Grondelle, Rienk; van Stokkum, Ivo H.M.; Dekker, Jan P.


    State transitions in the green alga Chlamydomonas reinhardtii serve to balance excitation energy transfer to photosystem I (PSI) and to photosystem II (PSII) and possibly play a role as a photoprotective mechanism. Thus, light-harvesting complex II (LHCII) can switch between the photosystems consequently transferring more excitation energy to PSII (state 1) or to PSI (state 2) or can end up in LHCII-only domains. In this study, low-temperature (77 K) steady-state and time-resolved fluorescence measured on intact cells of Chlamydomonas reinhardtii shows that independently of the state excitation energy transfer from LHCII to PSI or to PSII occurs on two main timescales of <15 ps and ∼100 ps. Moreover, in state 1 almost all LHCIIs are functionally connected to PSII, whereas the transition from state 1 to a state 2 chemically locked by 0.1 M sodium fluoride leads to an almost complete functional release of LHCIIs from PSII. About 2/3 of the released LHCIIs transfer energy to PSI and ∼1/3 of the released LHCIIs form a component designated X-685 peaking at 685 nm that decays with time constants of 0.28 and 5.8 ns and does not transfer energy to PSI or to PSII. A less complete state 2 was obtained in cells incubated under anaerobic conditions without chemical locking. In this state about half of all LHCIIs remained functionally connected to PSII, whereas the remaining half became functionally connected to PSI or formed X-685 in similar amounts as with chemical locking. We demonstrate that X-685 originates from LHCII domains not connected to a photosystem and that its presence introduces a change in the interpretation of 77 K steady-state fluorescence emission measured upon state transitions in Chalamydomonas reinhardtii. PMID:25606675

  10. Colony organization in the green alga Botryococcus braunii is specified by a complex extracellular matrix


    Weiss, Taylor L.; Roth, Robyn; Goodson, Carrie; Vithda, Stanislav; Black, Ian; Azadi, Parastoo; Rusch, Jannette; Holzenburg, Andreas; Devarenne, Timothy P.; Goodenough, Ursula


    Botryococcus braunii is a colonial green alga whose cells associate via a complex extracellular matrix (ECM) and produce prodigious amounts of liquid hydrocarbons that can be readily converted into conventional combustion engine fuels. We used quickfreeze deep-etch electron microscopy and biochemical/histochemical analysis to elucidate many new features of B. braunii cell/colony organization and composition. Intracellular lipid bodies associate with the chloroplast and endoplasmic reticulum (ER) but show no evidence of being secreted. The ER displays striking fenestrations and forms a continuous subcortical system in direct contact with the cell membrane. The ECM has three distinct components. (i) Each cell ismore » surrounded by a fibrous β-1, 4- and/or β-1, 3-glucan-containing cell wall. (ii) The intracolonial ECM space is filled with a cross-linked hydrocarbon network permeated with liquid hydrocarbons. (iii) Colonies are enclosed in a retaining wall festooned with a fibrillar sheath dominated by arabinose-galactose polysaccharides, which sequesters ECM liquid hydrocarbons. Each cell apex associates with the retaining wall and contributes to its synthesis. Retaining-wall domains also form "drapes" between cells, with some folding in on themselves and penetrating the hydrocarbon interior of a mother colony, partitioning it into daughter colonies. In addition, we propose that retaining-wall components are synthesized in the apical Golgi apparatus, delivered to apical ER fenestrations, and assembled on the surfaces of apical cell walls, where a proteinaceous granular layer apparently participates in fibril morphogenesis. We further propose that hydrocarbons are produced by the nonapical ER, directly delivered to the contiguous cell membrane, and pass across the nonapical cell wall into the hydrocarbon-based ECM.« less

  11. Toxicity assessment of manufactured nanomaterials using the unicellular green alga Chlamydomonas reinhardtii.


    Wang, Jiangxin; Zhang, Xuezhi; Chen, Yongsheng; Sommerfeld, Milton; Hu, Qiang


    With the rapid development of nanotechnology, there is an increasing risk of human and environmental exposure to nanotechnology-based materials and products. As water resources are particularly vulnerable to direct and indirect contamination of nonomaterials (NMs), the potential toxicity and environmental implication of NMs to aquatic organisms must be evaluated. In this study, we assessed potential toxicity of two commercially used NMs, titanium dioxide (TiO(2)) and quantum dots (QDs), using the unicellular green alga Chlamydomonas reinhartii as a model system. The response of the organism to NMs was assessed at physiological, biochemical, and molecular genetic levels. Growth kinetics showed that growth inhibition occurred during the first two to three days of cultivation in the presence of TiO(2) or QDs. Measurements of lipid peroxidation measurement indicated that oxidative stress of the cells occurred as early as 6 h after exposure to TiO(2) or QDs. The transcriptional expression profiling of four stress response genes (sod1, gpx, cat, and ptox2) revealed that transient up-regulation of these genes occurred in cultures containing as low as 1.0 mg L(-1) of TiO(2) or 0.1 mg L(-1) of QDs, and the maximum transcripts of cat, sod1, gpx, and ptox2 occurred at 1.5, 3, 3, and 6 h, respectively, and were proportional to the initial concentration of the NMs. As the cultures continued, recovery in growth was observed and the extent of recovery, as indicated by the final cell concentration, was dosage-dependent. QDs were found to be more toxic to Chlamydomonas cells than TiO(2) under our experimental conditions. PMID:18768203

  12. A new paradigm for producing astaxanthin from the unicellular green alga Haematococcus pluvialis.


    Zhang, Zhen; Wang, Baobei; Hu, Qiang; Sommerfeld, Milton; Li, Yuanguang; Han, Danxiang


    The unicellular green alga Haematococcus pluvialis has been exploited as a cell factory to produce the high-value antioxidant astaxanthin for over two decades, due to its superior ability to synthesize astaxanthin under adverse culture conditions. However, slow vegetative growth under favorable culture conditions and cell deterioration or death under stress conditions (e.g., high light, nitrogen starvation) has limited the astaxanthin production. In this study, a new paradigm that integrated heterotrophic cultivation, acclimation of heterotrophically grown cells to specific light/nutrient regimes, followed by induction of astaxanthin accumulation under photoautotrophic conditions was developed. First, the environmental conditions such as pH, carbon source, nitrogen regime, and light intensity, were optimized to induce astaxanthin accumulation in the dark-grown cells. Although moderate astaxanthin content (e.g., 1% of dry weight) and astaxanthin productivity (2.5 mg L(-1)  day(-1) ) were obtained under the optimized conditions, a considerable number of cells died off when subjected to stress for astaxanthin induction. To minimize the susceptibility of dark-grown cells to light stress, the algal cells were acclimated, prior to light induction of astaxanthin biosynthesis, under moderate illumination in the presence of nitrogen. Introduction of this strategy significantly reduced the cell mortality rate under high-light and resulted in increased cellular astaxanthin content and astaxanthin productivity. The productivity of astaxanthin was further improved to 10.5 mg L(-1)  day(-1) by implementation of such a strategy in a bubbling column photobioreactor. Biochemical and physiological analyses suggested that rebuilding of photosynthetic apparatus including D1 protein and PsbO, and recovery of PSII activities, are essential for acclimation of dark-grown cells under photo-induction conditions. Biotechnol. Bioeng. 2016;113: 2088-2099. © 2016 The Authors

  13. Phragmoplast of the green alga Spirogyra is functionally distinct from the higher plant phragmoplast.


    Sawitzky, H; Grolig, F


    Cytokinesis in the green alga Spirogyra (Zygnemataceae) is characterized by centripetal growth of a septum, which impinges on a persistent, centrifugally expanding telophase spindle, leading to a phragmoplast-like structure of potential phylogenetic significance (Fowke, L. C., and J. D. Pickett-Heaps. 1969. J. Phycol. 5:273-281). Combining fluorescent tagging of the cytoskeleton in situ and video-enhanced differential interference contrast microscopy of live cells, the process of cytokinesis was investigated with emphasis on cytoskeletal reorganization and concomitant redistribution of organelles. Based on a sequence of cytoskeletal arrangements and the effects of cytoskeletal inhibitors thereon, cytokinetic progression could be divided into three functional stages with respect to the contribution of microfilaments (MFs) and microtubules (MTs): (1) Initiation: in early prophase, a cross wall initial was formed independently of MFs and MTs at the presumptive site of wall growth. (2) Septum ingrowth: numerous organelles accumulated at the cross wall initial concomitant with reorganization of the extensive peripheral interphase MF array into a distinct circumferential MF array. This array guided the ingrowing septum until it contacted the expanding interzonal MT array. (3) Cross wall closure: MFs at the growing edge of the septum coaligned with and extended along the interzonal MTs toward the daughter nuclei. Thus, actin-based transportation of small organelles during this third stage occurred, in part, along a scaffold previously deployed in space by MTs. Displacement of the nuclei-associated interzonal MT array by centrifugation and depolymerization of the phragmoplast-like structure showed that the success of cytokinesis at the third stage depends on the interaction of both MF and MT cytoskeletons. Important features of the phragmoplast-like structure in Spirogyra were different from the higher plant phragmoplast: in particular, MFs were responsible for the

  14. Blue-Green Algae Inhibit the Development of Atherosclerotic Lesions in Apolipoprotein E Knockout Mice.


    Ku, Chai Siah; Kim, Bohkyung; Pham, Tho X; Yang, Yue; Wegner, Casey J; Park, Young-Ki; Balunas, Marcy; Lee, Ji-Young


    Hyperlipidemia and inflammation contribute to the development of atherosclerotic lesions. Our objective was to determine antiatherogenic effect of edible blue-green algae (BGA) species, that is, Nostoc commune var. sphaeroides Kützing (NO) and Spirulina platensis (SP), in apolipoprotein E knockout (ApoE(-/-)) mice, a well-established mouse model of atherosclerosis. Male ApoE(-/-) mice were fed a high-fat/high-cholesterol (HF/HC, 15% fat and 0.2% cholesterol by wt) control diet or a HF/HC diet supplemented with 5% (w/w) of NO or SP powder for 12 weeks. Plasma total cholesterol (TC) and triglycerides (TG) were measured, and livers were analyzed for histology and gene expression. Morphometric analysis for lesions and immunohistochemical analysis for CD68 were conducted in the aorta and the aortic root. NO supplementation significantly decreased plasma TC and TG, and liver TC, compared to control and SP groups. In the livers of NO-fed mice, less lipid droplets were present with a concomitant decrease in fatty acid synthase protein levels than the other groups. There was a significant increase in hepatic low-density lipoprotein receptor protein levels in SP-supplemented mice than in control and NO groups. Quantification of aortic lesions by en face analysis demonstrated that both NO and SP decreased aortic lesion development to a similar degree compared with control. While lesions in the aortic root were not significantly different between groups, the CD68-stained area in the aortic root was significantly lowered in BGA-fed mice than controls. In conclusion, both NO and SP supplementation decreased the development of atherosclerotic lesions, suggesting that they may be used as a natural product for atheroprotection. PMID:26566121

  15. Ecotoxicity of silica nanoparticles to the green alga Pseudokirchneriella subcapitata: importance of surface area.


    Van Hoecke, Karen; De Schamphelaere, Karel A C; Van der Meeren, Paul; Lucas, Stéphane; Janssen, Colin R


    To date, (eco)toxicological information on industrial nanoparticles is very limited. In the present study, the hypothesis that the ecotoxicity of nanoparticles (NPs) is related to their surface area and not to their mass was tested using a freshwater green algal species. Particle diameter and morphology were assessed using light scattering and electron microscopy techniques. To assess the toxicity of silica (SiO2) nanoparticles, the growth inhibition of the alga Pseudokirchneriella subcapitata when exposed to stable silica suspensions was monitored. Commercial LUDOX suspensions of nanoparticles with 12.5 and 27.0 nm diameter were found to be toxic, with 72-h 20% effect concentrations for growth rate (E(r)C20) values +/- standard deviation (n = 5) of 20.0 +/- 5.0 and 28.8 +/- 3.2 mg/L, respectively. The toxicity was attributable to the solid nanospheres, because no aggregation was observed and dissolution of the nanoparticles was negligible. When expressing the concentration as a surface area, the difference in toxicity was not significant. In the latter case, 72-h E(r)C20 values +/- standard deviation (n = 5) were 4.7 +/- 1.2 and 3.9 +/- 0.4 m2/L. Silica bulk material was found to be nontoxic up to 1 g/L. In an additional experiment with 100 mg/L of 12.5 and 27.0 nm SiO2 NPs, the interaction between the nanoparticles and algal cells was studied using transmission electron microscopy. Although the particles clearly adhered to the outer cell surface, no evidence was found for particle uptake. PMID:19086319

  16. Construction of a growth model in the green alga Tetraselmis subcordiformis using a response surface approach

    NASA Astrophysics Data System (ADS)

    Wang, Hui; Niu, Jingyan; Liu, Jiahui; Yang, Hongshuai; Liu, Zhigang


    The green alga Tetraselmis subcordiformis has been widely used as a quality live food for aquaculture species, and also has been studied as a model organism for the photo-biological production of hydrogen. We attempted to quantify the relationship between T. subcordiformis specific growth rate (SGR) and three important environmental factors (temperature, salinity, and pH) using the central composite design and response surface method under laboratory conditions. The results showed that the linear effects of temperature and salinity were significant (P< 0.05), and they were equally important in impacting T. subcordiformis specific growth; the linear effect of pH was not significant (P>0.05); the interactive effect of temperature and pH was significant (P<0.05), whereas the temperature × salinity and salinity × pH interactions were not significant (P>0.05); all of the quadratic effects of the three factors were significant (P<0.05). A model equation for specific growth rate with the three factors was established, with the unadjusted and predictive R 2 as high as 0.990 and 0.921, respectively, suggesting that the model was a very good fit and that it could be used to predict SGR. Through optimizing the reliable model, an optimal 3-factor combination of 25 °C/35 of salinity/pH 7.9 was obtained, at which the maximum specific growth rate (0.65) was recorded, with a desirability value of 93.8%. These experimental results could serve as guidelines for increasing T. subcordiformis production efficiency.

  17. A rapid, modular and marker-free chloroplast expression system for the green alga Chlamydomonas reinhardtii.


    Bertalan, Ivo; Munder, Matthias C; Weiß, Caroline; Kopf, Judith; Fischer, Dirk; Johanningmeier, Udo


    In search of alternative expression platforms heterologous protein production in microalgae has gained increasing importance in the last years. Particularly, the chloroplast of the green alga Chlamydomonas reinhardtii has been adopted to successfully express foreign proteins like vaccines and antibodies. However, when compared with other expression systems, the development of the algal chloroplast to a powerful production platform for recombinant proteins is still in its early stages. In an effort to further improve methods for a reliable and rapid generation of transplastomic Chlamydomonas strains we constructed the key plasmid pMM2 containing the psbA gene and a multiple cloning site for foreign gene insertion. The psbA gene allows a marker-free selection procedure using as a recipient the Fud7 strain of Chlamydomonas, which grows on media containing acetate as a carbon source, but is unable to grow photoautotrophically due to the lack of an intact psbA gene. Biolistic transformation of Fud7 with vectors containing this gene restores photoautotrophic growth and thus permits selection in the light on media without carbon sources and antibiotics. The multiple cloning site with a BsaI recognition sequence allows type IIs restriction enzyme-based modular cloning which rapidly generates new gene constructs without sequences, which could influence the expression and characteristics of the foreign protein. In order to demonstrate the feasibility of this approach, a codon optimized version of the gene for the bacterial protein MPT64 has been integrated into the plastome. Several strains with different promoter/UTR combinations show a stable expression of the HA tagged MPT64 protein in Chlamydomonas chloroplasts. PMID:25554634

  18. In Vitro Reconstitution of Light-harvesting Complexes of Plants and Green Algae

    PubMed Central

    Natali, Alberto; Roy, Laura M.; Croce, Roberta


    In plants and green algae, light is captured by the light-harvesting complexes (LHCs), a family of integral membrane proteins that coordinate chlorophylls and carotenoids. In vivo, these proteins are folded with pigments to form complexes which are inserted in the thylakoid membrane of the chloroplast. The high similarity in the chemical and physical properties of the members of the family, together with the fact that they can easily lose pigments during isolation, makes their purification in a native state challenging. An alternative approach to obtain homogeneous preparations of LHCs was developed by Plumley and Schmidt in 19871, who showed that it was possible to reconstitute these complexes in vitro starting from purified pigments and unfolded apoproteins, resulting in complexes with properties very similar to that of native complexes. This opened the way to the use of bacterial expressed recombinant proteins for in vitro reconstitution. The reconstitution method is powerful for various reasons: (1) pure preparations of individual complexes can be obtained, (2) pigment composition can be controlled to assess their contribution to structure and function, (3) recombinant proteins can be mutated to study the functional role of the individual residues (e.g., pigment binding sites) or protein domain (e.g., protein-protein interaction, folding). This method has been optimized in several laboratories and applied to most of the light-harvesting complexes. The protocol described here details the method of reconstituting light-harvesting complexes in vitro currently used in our laboratory,and examples describing applications of the method are provided. PMID:25350712

  19. A new paradigm for producing astaxanthin from the unicellular green alga Haematococcus pluvialis

    PubMed Central

    Zhang, Zhen; Wang, Baobei; Hu, Qiang; Sommerfeld, Milton


    ABSTRACT The unicellular green alga Haematococcus pluvialis has been exploited as a cell factory to produce the high‐value antioxidant astaxanthin for over two decades, due to its superior ability to synthesize astaxanthin under adverse culture conditions. However, slow vegetative growth under favorable culture conditions and cell deterioration or death under stress conditions (e.g., high light, nitrogen starvation) has limited the astaxanthin production. In this study, a new paradigm that integrated heterotrophic cultivation, acclimation of heterotrophically grown cells to specific light/nutrient regimes, followed by induction of astaxanthin accumulation under photoautotrophic conditions was developed. First, the environmental conditions such as pH, carbon source, nitrogen regime, and light intensity, were optimized to induce astaxanthin accumulation in the dark‐grown cells. Although moderate astaxanthin content (e.g., 1% of dry weight) and astaxanthin productivity (2.5 mg L−1 day−1) were obtained under the optimized conditions, a considerable number of cells died off when subjected to stress for astaxanthin induction. To minimize the susceptibility of dark‐grown cells to light stress, the algal cells were acclimated, prior to light induction of astaxanthin biosynthesis, under moderate illumination in the presence of nitrogen. Introduction of this strategy significantly reduced the cell mortality rate under high‐light and resulted in increased cellular astaxanthin content and astaxanthin productivity. The productivity of astaxanthin was further improved to 10.5 mg L−1 day−1 by implementation of such a strategy in a bubbling column photobioreactor. Biochemical and physiological analyses suggested that rebuilding of photosynthetic apparatus including D1 protein and PsbO, and recovery of PSII activities, are essential for acclimation of dark‐grown cells under photo‐induction conditions. Biotechnol. Bioeng. 2016;113: 2088–2099.

  20. Assessing the combined effects from two kinds of cephalosporins on green alga (Chlorella pyrenoidosa) based on response surface methodology.


    Guo, Ruixin; Xie, Weishu; Chen, Jianqiu


    The present work evaluated the combined effects of cefradine and ceftazidime on the green alga Chlorella pyrenoidosa using response surface methodologies (RSM). After a 48 h-exposure, the population growth rate (PGR), the chlorophyll-a content and the SOD content of the alga increased with increased concentrations of two antibiotics. However, the three responses did not continue to demonstrate significant increases once antibiotic concentrations exceed a moderate level. Three two order polynomial regression equations were obtained to describe well the relationship between the responses of the alga and the two antibiotics' concentration (R(2) = 0.9997, 0.9292 and 0.9039, respectively). Three 3 D-surface graphs and their contour plots showed directly the changing trends of the alga under the combined effects of two antibiotics. This study for the first time employed the RSM in ecotoxicology, which indicated that the RSM should be placed under a feasible and a potential application prospect in toxicity assessment.

  1. Effects of lead on growth, photosynthetic characteristics and production of reactive oxygen species of two freshwater green algae.


    Dao, Ly H T; Beardall, John


    In the natural environment, heavy metal contamination can occur as long-term pollution of sites or as pulses of pollutants from wastewater disposal. In this study two freshwater green algae, Chlorella sp. FleB1 and Scenedesmus YaA6, were isolated from lead-polluted water samples and the effects of 24 h vs 4 and 8 d exposure of cultures to lead on growth, photosynthetic physiology and production of reactive oxygen species (ROS) of these algae were investigated. In Chlorella sp. FleB1, there was agreement between lead impacts on chlorophyll content, photosynthesis and growth in most case. However, in Scenedesmus acutus YaA6 growth was inhibited at lower lead concentrations (0.03-0.87 × 10(-9) M), under which ROS, measured by 2',7' dichlorodihydrofluorescein diacetate fluorescence, were 4.5 fold higher than in controls but photosynthesis was not affected, implying that ROS had played a role in the growth inhibition that did not involve direct effects on photosynthesis. Effects of short-term (5 h, 24 h) vs long-term (4 d and 8 d) exposure to lead were also compared between the two algae. The results contribute to our understanding of the mechanisms of lead toxicity to algae.

  2. Assessing the combined effects from two kinds of cephalosporins on green alga (Chlorella pyrenoidosa) based on response surface methodology.


    Guo, Ruixin; Xie, Weishu; Chen, Jianqiu


    The present work evaluated the combined effects of cefradine and ceftazidime on the green alga Chlorella pyrenoidosa using response surface methodologies (RSM). After a 48 h-exposure, the population growth rate (PGR), the chlorophyll-a content and the SOD content of the alga increased with increased concentrations of two antibiotics. However, the three responses did not continue to demonstrate significant increases once antibiotic concentrations exceed a moderate level. Three two order polynomial regression equations were obtained to describe well the relationship between the responses of the alga and the two antibiotics' concentration (R(2) = 0.9997, 0.9292 and 0.9039, respectively). Three 3 D-surface graphs and their contour plots showed directly the changing trends of the alga under the combined effects of two antibiotics. This study for the first time employed the RSM in ecotoxicology, which indicated that the RSM should be placed under a feasible and a potential application prospect in toxicity assessment. PMID:25684417

  3. Management of Local Stressors Can Improve the Resilience of Marine Canopy Algae to Global Stressors

    PubMed Central

    Strain, Elisabeth M. A.; van Belzen, Jim; van Dalen, Jeroen; Bouma, Tjeerd J.; Airoldi, Laura


    Coastal systems are increasingly threatened by multiple local anthropogenic and global climatic stressors. With the difficulties in remediating global stressors, management requires alternative approaches that focus on local scales. We used manipulative experiments to test whether reducing local stressors (sediment load and nutrient concentrations) can improve the resilience of foundation species (canopy algae along temperate rocky coastlines) to future projected global climate stressors (high wave exposure, increasing sea surface temperature), which are less amenable to management actions. We focused on Fucoids (Cystoseira barbata) along the north-western Adriatic coast in the Mediterranean Sea because of their ecological relevance, sensitivity to a variety of human impacts, and declared conservation priority. At current levels of sediment and nutrients, C. barbata showed negative responses to the simulated future scenarios of high wave exposure and increased sea surface temperature. However, reducing the sediment load increased the survival of C. barbata recruits by 90.24% at high wave exposure while reducing nutrient concentrations resulted in a 20.14% increase in the survival and enhanced the growth of recruited juveniles at high temperature. We conclude that improving water quality by reducing nutrient concentrations, and particularly the sediment load, would significantly increase the resilience of C. barbata populations to projected increases in climate stressors. Developing and applying appropriate targets for specific local anthropogenic stressors could be an effective management action to halt the severe and ongoing loss of key marine habitats. PMID:25807516

  4. A new member of the leucyl aminopeptidase family purified and identified from a marine unicellular algae.


    Sankievicz, D; Colepicolo, P


    Leucyl aminopeptidase (LAP; EC activity was purified from crude extracts of the marine unicellular algae Gonyaulax polyedra by a combination of hydrophobic interaction with phenyl sepharose, DEAE-cellulose, and mono-Q HR5/5 ion-exchange chromatography. The undenaturated protein has a molecular mass of about 110 kD and based on sodium dodecyl sulfate-polyacrylamide gel electrophoresis, the enzyme appears to be composed of two possibly identical subunits of 55 kD. The identity of the protein was confirmed by a cross-reaction of the purified protein with an antibody raised against a commercial LAP. Biochemical characterization showed that the Gonyaulax enzyme was similar to most of the previously described LAPs. Gonyaulax LAP is a metallo-enzyme since EDTA and 1,10-phenathroline significantly inhibited activity. Addition of the metal ions Zn(2+), Cu(2+) inhibited 80% of LAP activity, suggesting they are not the natural cofactors of the enzyme. Other metals, such as Ca(2+), Co(2+), Mn(2+), or Mg(2+) (concentrations up to 4 mM), caused no alteration in the total activity of Gonyaulax LAP.

  5. Sulfated polysaccharide fraction from marine algae Solieria filiformis: Structural characterization, gastroprotective and antioxidant effects.


    Sousa, Willer M; Silva, Renan O; Bezerra, Francisco F; Bingana, Rudy D; Barros, Francisco Clark N; Costa, Luís E C; Sombra, Venicios G; Soares, Pedro M G; Feitosa, Judith P A; de Paula, Regina C M; Souza, Marcellus H L P; Barbosa, André Luiz R; Freitas, Ana Lúcia P


    A sulfated polysaccharide (SFP) fraction from the marine alga Solieria filiformis was extracted and submitted to microanalysis, molar mass estimation and spectroscopic analysis. We evaluated its gastroprotective potential in vivo in an ethanol-induced gastric damage model and its in vitro antioxidant properties (DPPH, chelating ferrous ability and total antioxidant capacity). Its chemical composition revealed to be essentially an iota-carrageenan with a molar mass of 210.9kDa and high degree of substitution for sulfate groups (1.08). In vivo, SFP significantly (P<0.05) reduced, in a dose dependent manner, the ethanol-induced gastric damage. SFP prevents glutathione consume and increase of malondialdehyde and hemoglobin levels. SFP presented an IC50 of 1.77mg/mL in scavenging DPPH. The chelating ferrous ability was 38.98%, and the total antioxidant capacity was 2.01mg/mL. Thus, SFP prevents the development of ethanol-induced gastric damage by reducing oxidative stress in vivo and possesses relevant antioxidant activity in vitro.

  6. Inhibitory effect of Salicornia europaea on the marine alga Skeletonema costatum.


    Jiang, Dan; Huang, Lingfeng; Lin, Yongqing; Nie, Lingling; Lv, Sulian; Kuang, Tingyun; Li, Yinxin


    Exploiting the negative biochemical interference between plants and algal species has been suggested as a method to control harmful algal blooms. In this work, we investigated the inhibitory effect of the salt marsh halophyte Salicornia europaea against the marine alga Skeletonema costatum. S. europaea suppressed the growth of S. costatum in a nutrient-sufficient co-culture system, indicating that the inhibition of algal growth was because of the phytotoxic effect of S. europaea, rather than nutrient competition. We tested aqueous and organic extracts from S. europaea roots against S. costatum. The organic extracts inhibited growth and affected the cell size and chlorophyll a content of S. costatum in a dose-dependent manner. Among the three tested organic extracts, the methanol extract had the greatest effects on S. costatum, followed by butanol extract, and then the chloroform extract. Two flavonoids, rutin and quercetin-3-β-D-glucoside, were identified in the methanol extract by high performance liquid chromatography. The concentration of rutin was much higher than that of quercetin-3-β-D-glucoside. In an algal bioassay, rutin inhibited the growth of S. costatum and the inhibitory effect increased with increasing rutin concentration and with decreasing initial algal density. Therefore, we concluded that S. europaea negatively affects the growth of S. costatum, and that rutin, a metabolite of S. europaea, may play a role in this inhibitory effect. PMID:22744186

  7. Proteomic analysis of lipid body from the alkenone‐producing marine haptophyte alga Tisochrysis lutea

    PubMed Central

    Shi, Qing; Araie, Hiroya; Bakku, Ranjith Kumar; Fukao, Yoichiro; Rakwal, Randeep; Suzuki, Iwane


    Lipid body (LB) is recognized as the cellular carbon and energy storage organelle in many organisms. LBs have been observed in the marine haptophyte alga Tisochrysis lutea that produces special lipids such as long‐chain (C37‐C40) ketones (alkenones) with 2–4 trans‐type double bonds. In this study, we succeeded in developing a modified method to isolate LB from T. lutea. Purity of isolated LBs was confirmed by the absence of chlorophyll auto‐fluorescence and no contamination of the most abundant cellular protein ribulose‐1,5‐bisphosphate carboxylase/oxygenase. As alkenones predominated in the LB by GC‐MS analysis, the LB can be more appropriately named as “alkenone body (AB).” Extracted AB‐containing proteins were analyzed by the combination of 1DE (SDS‐PAGE) and MS/MS for confident protein identification and annotated using BLAST tools at National Center for Biotechnology Information. Totally 514 proteins were identified at the maximum. The homology search identified three major proteins, V‐ATPase, a hypothetical protein EMIHUDRAFT_465517 found in other alkenone‐producing haptophytes, and a lipid raft‐associated SPFH domain‐containing protein. Our data suggest that AB of T. lutera is surrounded by a lipid membrane originating from either the ER or the ER‐derived four layer‐envelopes chloroplast and function as the storage site of alkenones and alkenes. PMID:25914246

  8. Unsupervised hierarchical partitioning of hyperspectral images: application to marine algae identification

    NASA Astrophysics Data System (ADS)

    Chen, B.; Chehdi, K.; De Oliveria, E.; Cariou, C.; Charbonnier, B.


    In this paper a new unsupervised top-down hierarchical classification method to partition airborne hyperspectral images is proposed. The unsupervised approach is preferred because the difficulty of area access and the human and financial resources required to obtain ground truth data, constitute serious handicaps especially over large areas which can be covered by airborne or satellite images. The developed classification approach allows i) a successive partitioning of data into several levels or partitions in which the main classes are first identified, ii) an estimation of the number of classes automatically at each level without any end user help, iii) a nonsystematic subdivision of all classes of a partition Pj to form a partition Pj+1, iv) a stable partitioning result of the same data set from one run of the method to another. The proposed approach was validated on synthetic and real hyperspectral images related to the identification of several marine algae species. In addition to highly accurate and consistent results (correct classification rate over 99%), this approach is completely unsupervised. It estimates at each level, the optimal number of classes and the final partition without any end user intervention.

  9. The isolation of prophyra-334 from marine algae and its UV-absorption behavior

    NASA Astrophysics Data System (ADS)

    Zhaohui, Zhang; Xin, Gao; Tashiro, Yuri; Matsukawa, Shingo; Ogawa, Hiroo


    Prophyra-334 was prepared by methanol extraction and HPLC methods from marine algae (dried laver). It is a sunscreen compound that has good absorption of ultraviolet radiations in the wavelength ranges of 200-400 nm. The absorption maximum wavelength of prophyra-334 is at 334 nm, so defined the name. The molar extinction coefficient (ɛ) of prophyra-334 in aqueous solution at 334 nm wavelength is 4.23×104. The absorption of prophyra-334 in organic solvents differs in aqueous solutions. In polar organic solvents, the absorption maximum wavelength of prophyra-334 has a slight shift toward longer wavelength compared with that in pure water. On the contrary, in inert non-polar organic solvents, the absorption maximum wavelength and the shape of absorption spectra of prophyra-334 are changed. The effects of organic solvents on prophyra-334 stability suggested that: (1) the absorbance of prophyra-334 in water is generally constant at temperature of 60°C in 24 h, meaning that prophyra-334 is quite stable in water; (2) the absorbance of prophyra-334 in ethanol and hexane decreases at the same condition. The stability of prophyra-334 in organic solvents is less than that in aqueous solution. In benzene, the prophyra-334 is very instable.

  10. Proteomic analysis of lipid body from the alkenone-producing marine haptophyte alga Tisochrysis lutea.


    Shi, Qing; Araie, Hiroya; Bakku, Ranjith Kumar; Fukao, Yoichiro; Rakwal, Randeep; Suzuki, Iwane; Shiraiwa, Yoshihiro


    Lipid body (LB) is recognized as the cellular carbon and energy storage organelle in many organisms. LBs have been observed in the marine haptophyte alga Tisochrysis lutea that produces special lipids such as long-chain (C37 -C40) ketones (alkenones) with 2-4 trans-type double bonds. In this study, we succeeded in developing a modified method to isolate LB from T. lutea. Purity of isolated LBs was confirmed by the absence of chlorophyll auto-fluorescence and no contamination of the most abundant cellular protein ribulose-1,5-bisphosphate carboxylase/oxygenase. As alkenones predominated in the LB by GC-MS analysis, the LB can be more appropriately named as "alkenone body (AB)." Extracted AB-containing proteins were analyzed by the combination of 1DE (SDS-PAGE) and MS/MS for confident protein identification and annotated using BLAST tools at National Center for Biotechnology Information. Totally 514 proteins were identified at the maximum. The homology search identified three major proteins, V-ATPase, a hypothetical protein EMIHUDRAFT_465517 found in other alkenone-producing haptophytes, and a lipid raft-associated SPFH domain-containing protein. Our data suggest that AB of T. lutera is surrounded by a lipid membrane originating from either the ER or the ER-derived four layer-envelopes chloroplast and function as the storage site of alkenones and alkenes.

  11. Sulfated polysaccharide fraction from marine algae Solieria filiformis: Structural characterization, gastroprotective and antioxidant effects.


    Sousa, Willer M; Silva, Renan O; Bezerra, Francisco F; Bingana, Rudy D; Barros, Francisco Clark N; Costa, Luís E C; Sombra, Venicios G; Soares, Pedro M G; Feitosa, Judith P A; de Paula, Regina C M; Souza, Marcellus H L P; Barbosa, André Luiz R; Freitas, Ana Lúcia P


    A sulfated polysaccharide (SFP) fraction from the marine alga Solieria filiformis was extracted and submitted to microanalysis, molar mass estimation and spectroscopic analysis. We evaluated its gastroprotective potential in vivo in an ethanol-induced gastric damage model and its in vitro antioxidant properties (DPPH, chelating ferrous ability and total antioxidant capacity). Its chemical composition revealed to be essentially an iota-carrageenan with a molar mass of 210.9kDa and high degree of substitution for sulfate groups (1.08). In vivo, SFP significantly (P<0.05) reduced, in a dose dependent manner, the ethanol-induced gastric damage. SFP prevents glutathione consume and increase of malondialdehyde and hemoglobin levels. SFP presented an IC50 of 1.77mg/mL in scavenging DPPH. The chelating ferrous ability was 38.98%, and the total antioxidant capacity was 2.01mg/mL. Thus, SFP prevents the development of ethanol-induced gastric damage by reducing oxidative stress in vivo and possesses relevant antioxidant activity in vitro. PMID:27516258

  12. Management of local stressors can improve the resilience of marine canopy algae to global stressors.


    Strain, Elisabeth M A; van Belzen, Jim; van Dalen, Jeroen; Bouma, Tjeerd J; Airoldi, Laura


    Coastal systems are increasingly threatened by multiple local anthropogenic and global climatic stressors. With the difficulties in remediating global stressors, management requires alternative approaches that focus on local scales. We used manipulative experiments to test whether reducing local stressors (sediment load and nutrient concentrations) can improve the resilience of foundation species (canopy algae along temperate rocky coastlines) to future projected global climate stressors (high wave exposure, increasing sea surface temperature), which are less amenable to management actions. We focused on Fucoids (Cystoseira barbata) along the north-western Adriatic coast in the Mediterranean Sea because of their ecological relevance, sensitivity to a variety of human impacts, and declared conservation priority. At current levels of sediment and nutrients, C. barbata showed negative responses to the simulated future scenarios of high wave exposure and increased sea surface temperature. However, reducing the sediment load increased the survival of C. barbata recruits by 90.24% at high wave exposure while reducing nutrient concentrations resulted in a 20.14% increase in the survival and enhanced the growth of recruited juveniles at high temperature. We conclude that improving water quality by reducing nutrient concentrations, and particularly the sediment load, would significantly increase the resilience of C. barbata populations to projected increases in climate stressors. Developing and applying appropriate targets for specific local anthropogenic stressors could be an effective management action to halt the severe and ongoing loss of key marine habitats. PMID:25807516

  13. The Structure-Activity Relationship between Marine Algae Polysaccharides and Anti-Complement Activity

    PubMed Central

    Jin, Weihua; Zhang, Wenjing; Liang, Hongze; Zhang, Quanbin


    In this study, 33 different polysaccharides were prepared to investigate the structure-activity relationships between the polysaccharides, mainly from marine algae, and anti-complement activity in the classical pathway. Factors considered included extraction methods, fractionations, molecular weight, molar ratio of galactose to fucose, sulfate, uronic acid (UA) content, linkage, branching, and the type of monosaccharide. It was shown that the larger the molecular weights, the better the activities. The molar ratio of galactose (Gal) to fucose (Fuc) was a positive factor at a concentration lower than 10 µg/mL, while it had no effect at a concentration more than 10 µg/mL. In addition, sulfate was necessary; however, the sulfate content, the sulfate pattern, linkage and branching had no effect at a concentration of more than 10 µg/mL. Moreover, the type of monosaccharide had no effect. Laminaran and UA fractions had no activity; however, they could reduce the activity by decreasing the effective concentration of the active composition when they were mixed with the active compositions. The effect of the extraction methods could not be determined. Finally, it was observed that sulfated galactofucan showed good anti-complement activity after separation. PMID:26712768

  14. Complete sequence of the mitochondrial DNA of the red alga Porphyra purpurea. Cyanobacterial introns and shared ancestry of red and green algae.

    PubMed Central

    Burger, G; Saint-Louis, D; Gray, M W; Lang, B F


    The mitochondrial DNA (mtDNA) of Porphyra purpurea, a circular-mapping genome of 36,753 bp, has been completely sequenced. A total of 57 densely packed genes has been identified, including the basic set typically found in animals and fungi, as well as seven genes characteristic of protist and plant mtDNAs and specifying ribosomal proteins and subunits of succinate:ubiquinone oxidoreductase. The mitochondrial large subunit rRNA gene contains two group II introns that are extraordinarily similar to those found in the cyanobacterium Calothrix sp, suggesting a recent lateral intron transfer between a bacterial and a mitochondrial genome. Notable features of P. purpurea mtDNA include the presence of two 291-bp inverted repeats that likely mediate homologous recombination, resulting in genome rearrangement, and of numerous sequence polymorphisms in the coding and intergenic regions. Comparative analysis of red algal mitochondrial genomes from five different, evolutionarily distant orders reveals that rhodophyte mtDNAs are unusually uniform in size and gene order. Finally, phylogenetic analyses provide strong evidence that red algae share a common ancestry with green algae and plants. PMID:10488235

  15. Enhanced acetyl-CoA production is associated with increased triglyceride accumulation in the green alga Chlorella desiccata.


    Avidan, Omri; Brandis, Alexander; Rogachev, Ilana; Pick, Uri


    Triglycerides (TAGs) from microalgae can be utilized as food supplements and for biodiesel production, but little is known about the regulation of their biosynthesis. This work aimed to test the relationship between acetyl-CoA (Ac-CoA) levels and TAG biosynthesis in green algae under nitrogen deprivation. A novel, highly sensitive liquid chromatography mass spectrometry (LC-MS/MS) technique enabled us to determine the levels of Ac-CoA, malonyl-CoA, and unacetylated (free) CoA in green microalgae. A comparative study of three algal species that differ in TAG accumulation levels shows that during N starvation, Ac-CoA levels rapidly rise, preceding TAG accumulation in all tested species. The levels of Ac-CoA in the high TAG accumulator Chlorella desiccata exceed the levels in the moderate TAG accumulators Dunaliella tertiolecta and Chlamydomonas reinhardtii. Similarly, malonyl-CoA and free CoA levels also increase, but to lower extents. Calculated cellular concentrations of Ac-CoA are far lower than reported K mAc-CoA values of plastidic Ac-CoA carboxylase (ptACCase) in plants. Transcript level analysis of plastidic pyruvate dehydrogenase (ptPDH), the major chloroplastic Ac-CoA producer, revealed rapid induction in parallel with Ac-CoA accumulation in C. desiccata, but not in D. tertiolecta or C. reinhardtii. It is proposed that the capacity to accumulate high TAG levels in green algae critically depends on their ability to divert carbon flow towards Ac-CoA. This requires elevation of the chloroplastic CoA pool level and enhancement of Ac-CoA biosynthesis. These conclusions may have important implications for future genetic manipulation to enhance TAG biosynthesis in green algae.

  16. The blue-green blood plasma of marine fish.


    Fang, L S; Bada, J L


    1. The blue-green coloration of the blood plasma in some marine fishes, which is attributed to a protein bound tetrapyrrol (biliverdin), is an anomaly in vertebrates. 2. Recent studies have shown that biliverdin not only occurs in many fish, but is also present in the blood of tobacco hornworm, the wings of moth and butterfly, the shell of bird eggs, the serum and egg of frog, the placenta of dog and in the blood of humans suffering from hepatic diseases. 3. In this review, we begin with a historical account of the description of the presence of blue-green blood plasma in fish, and then consider the biochemistry, metabolism, physiology, and the ecological implications of biliverdin in fish. 4. A comparative description of the occurrence of biliverdin in fish and other animals is presented. 5. The mechanism of accumulation of biliverdin in fish blood and its evolutionary significance are also considered. It is suggested that this process may serve as a useful model for further research on bile pigment metabolism in other animals.

  17. The influence of extracellular compounds produced by selected Baltic cyanobacteria, diatoms and dinoflagellates on growth of green algae Chlorella vulgaris

    NASA Astrophysics Data System (ADS)

    Żak, Adam; Kosakowska, Alicja


    Secondary metabolites produced by bacteria, fungi, algae and plants could affect the growth and development of biological and agricultural systems. This natural process that occurs worldwide is known as allelopathy. The main goal of this work was to investigate the influence of metabolites obtained from phytoplankton monocultures on the growth of green algae Chlorella vulgaris. We selected 6 species occurring in the Baltic Sea from 3 different taxonomic groups: cyanobacteria (Aphanizomenon flos-aquae; Planktothrix agardhii), diatoms (Thalassiosira pseudonana; Chaetoceros wighamii) and dinoflagellates (Alexandrium ostenfeldii; Prorocentrum minimum). In this study we have demonstrated that some of selected organisms caused allelopathic effects against microalgae. Both the negative and positive effects of collected cell-free filtrates on C. vulgaris growth, chlorophyll a concentration and fluorescence parameters (OJIP, QY, NPQ) have been observed. No evidence has been found for the impact on morphology and viability of C. vulgaris cells.

  18. Comparative Chloroplast Genome Analyses of Streptophyte Green Algae Uncover Major Structural Alterations in the Klebsormidiophyceae, Coleochaetophyceae and Zygnematophyceae

    PubMed Central

    Lemieux, Claude; Otis, Christian; Turmel, Monique


    The Streptophyta comprises all land plants and six main lineages of freshwater green algae: Mesostigmatophyceae, Chlorokybophyceae, Klebsormidiophyceae, Charophyceae, Coleochaetophyceae and Zygnematophyceae. Previous comparisons of the chloroplast genome from nine streptophyte algae (including four zygnematophyceans) revealed that, although land plant chloroplast DNAs (cpDNAs) inherited most of their highly conserved structural features from green algal ancestors, considerable cpDNA changes took place during the evolution of the Zygnematophyceae, the sister group of land plants. To gain deeper insights into the evolutionary dynamics of the chloroplast genome in streptophyte algae, we sequenced the cpDNAs of nine additional taxa: two klebsormidiophyceans (Entransia fimbriata and Klebsormidium sp. SAG 51.86), one coleocheatophycean (Coleochaete scutata) and six zygnematophyceans (Cylindrocystis brebissonii, Netrium digitus, Roya obtusa, Spirogyra maxima, Cosmarium botrytis and Closterium baillyanum). Our comparative analyses of these genomes with their streptophyte algal counterparts indicate that the large inverted repeat (IR) encoding the rDNA operon experienced loss or expansion/contraction in all three sampled classes and that genes were extensively shuffled in both the Klebsormidiophyceae and Zygnematophyceae. The klebsormidiophycean genomes boast greatly expanded IRs, with the Entransia 60,590-bp IR being the largest known among green algae. The 206,025-bp Entransia cpDNA, which is one of the largest genome among streptophytes, encodes 118 standard genes, i.e., four additional genes compared to its Klebsormidium flaccidum homolog. We inferred that seven of the 21 group II introns usually found in land plants were already present in the common ancestor of the Klebsormidiophyceae and its sister lineages. At 107,236 bp and with 117 standard genes, the Coleochaete IR-less genome is both the smallest and most compact among the streptophyte algal cpDNAs analyzed thus

  19. Comparative Chloroplast Genome Analyses of Streptophyte Green Algae Uncover Major Structural Alterations in the Klebsormidiophyceae, Coleochaetophyceae and Zygnematophyceae.


    Lemieux, Claude; Otis, Christian; Turmel, Monique


    The Streptophyta comprises all land plants and six main lineages of freshwater green algae: Mesostigmatophyceae, Chlorokybophyceae, Klebsormidiophyceae, Charophyceae, Coleochaetophyceae and Zygnematophyceae. Previous comparisons of the chloroplast genome from nine streptophyte algae (including four zygnematophyceans) revealed that, although land plant chloroplast DNAs (cpDNAs) inherited most of their highly conserved structural features from green algal ancestors, considerable cpDNA changes took place during the evolution of the Zygnematophyceae, the sister group of land plants. To gain deeper insights into the evolutionary dynamics of the chloroplast genome in streptophyte algae, we sequenced the cpDNAs of nine additional taxa: two klebsormidiophyceans (Entransia fimbriata and Klebsormidium sp. SAG 51.86), one coleocheatophycean (Coleochaete scutata) and six zygnematophyceans (Cylindrocystis brebissonii, Netrium digitus, Roya obtusa, Spirogyra maxima, Cosmarium botrytis and Closterium baillyanum). Our comparative analyses of these genomes with their streptophyte algal counterparts indicate that the large inverted repeat (IR) encoding the rDNA operon experienced loss or expansion/contraction in all three sampled classes and that genes were extensively shuffled in both the Klebsormidiophyceae and Zygnematophyceae. The klebsormidiophycean genomes boast greatly expanded IRs, with the Entransia 60,590-bp IR being the largest known among green algae. The 206,025-bp Entransia cpDNA, which is one of the largest genome among streptophytes, encodes 118 standard genes, i.e., four additional genes compared to its Klebsormidium flaccidum homolog. We inferred that seven of the 21 group II introns usually found in land plants were already present in the common ancestor of the Klebsormidiophyceae and its sister lineages. At 107,236 bp and with 117 standard genes, the Coleochaete IR-less genome is both the smallest and most compact among the streptophyte algal cpDNAs analyzed thus

  20. Comparative Chloroplast Genome Analyses of Streptophyte Green Algae Uncover Major Structural Alterations in the Klebsormidiophyceae, Coleochaetophyceae and Zygnematophyceae.


    Lemieux, Claude; Otis, Christian; Turmel, Monique


    The Streptophyta comprises all land plants and six main lineages of freshwater green algae: Mesostigmatophyceae, Chlorokybophyceae, Klebsormidiophyceae, Charophyceae, Coleochaetophyceae and Zygnematophyceae. Previous comparisons of the chloroplast genome from nine streptophyte algae (including four zygnematophyceans) revealed that, although land plant chloroplast DNAs (cpDNAs) inherited most of their highly conserved structural features from green algal ancestors, considerable cpDNA changes took place during the evolution of the Zygnematophyceae, the sister group of land plants. To gain deeper insights into the evolutionary dynamics of the chloroplast genome in streptophyte algae, we sequenced the cpDNAs of nine additional taxa: two klebsormidiophyceans (Entransia fimbriata and Klebsormidium sp. SAG 51.86), one coleocheatophycean (Coleochaete scutata) and six zygnematophyceans (Cylindrocystis brebissonii, Netrium digitus, Roya obtusa, Spirogyra maxima, Cosmarium botrytis and Closterium baillyanum). Our comparative analyses of these genomes with their streptophyte algal counterparts indicate that the large inverted repeat (IR) encoding the rDNA operon experienced loss or expansion/contraction in all three sampled classes and that genes were extensively shuffled in both the Klebsormidiophyceae and Zygnematophyceae. The klebsormidiophycean genomes boast greatly expanded IRs, with the Entransia 60,590-bp IR being the largest known among green algae. The 206,025-bp Entransia cpDNA, which is one of the largest genome among streptophytes, encodes 118 standard genes, i.e., four additional genes compared to its Klebsormidium flaccidum homolog. We inferred that seven of the 21 group II introns usually found in land plants were already present in the common ancestor of the Klebsormidiophyceae and its sister lineages. At 107,236 bp and with 117 standard genes, the Coleochaete IR-less genome is both the smallest and most compact among the streptophyte algal cpDNAs analyzed thus

  1. TiO2 nanoparticles in the marine environment: Physical effects responsible for the toxicity on algae Phaeodactylum tricornutum.


    Wang, Yixiang; Zhu, Xiaoshan; Lao, Yongmin; Lv, Xiaohui; Tao, Yi; Huang, Boming; Wang, Jiangxin; Zhou, Jin; Cai, Zhonghua


    Nanoscale titanium dioxide (nTiO2) has been widely used in cosmetics, catalysts, varnishes, etc., which is raising concerns about its potential hazards to the ecosystem, including the marine environment. In this study, the toxicological effect of nTiO2 on the marine phytoplankton Phaeodactylum tricornutum was carefully investigated. The results showed that nTiO2 at concentrations ≥20mg/L could significantly inhibit P. tricornutum growth. The 5-day EC50 of nTiO2 to P. tricornutum growth is 167.71mg/L. Interestingly, nTiO2 was found to exert its most severe inhibition effects on the first day of exposure, at a lower EC50 of 12.65mg/L. During the experiment, nTiO2 aggregates were found to entrap algae cells, which is likely responsible for the observed toxic effects. Direct physical effects such as cell wall damage from the algae entrapment were confirmed by flow cytometry and TEM imaging. Moreover, low indirect effects such as shading and oxidative stress were observed, which supported the idea that direct physical effects could be the dominant factor that causes nTiO2 toxicity in P. tricornutum. Our research provides direct evidence for the toxicological impact of nTiO2 on marine microalgae, which will help us to build a good understanding of the ecological risks of nanoparticles in the marine environment. PMID:27060054

  2. TiO2 nanoparticles in the marine environment: Physical effects responsible for the toxicity on algae Phaeodactylum tricornutum.


    Wang, Yixiang; Zhu, Xiaoshan; Lao, Yongmin; Lv, Xiaohui; Tao, Yi; Huang, Boming; Wang, Jiangxin; Zhou, Jin; Cai, Zhonghua


    Nanoscale titanium dioxide (nTiO2) has been widely used in cosmetics, catalysts, varnishes, etc., which is raising concerns about its potential hazards to the ecosystem, including the marine environment. In this study, the toxicological effect of nTiO2 on the marine phytoplankton Phaeodactylum tricornutum was carefully investigated. The results showed that nTiO2 at concentrations ≥20mg/L could significantly inhibit P. tricornutum growth. The 5-day EC50 of nTiO2 to P. tricornutum growth is 167.71mg/L. Interestingly, nTiO2 was found to exert its most severe inhibition effects on the first day of exposure, at a lower EC50 of 12.65mg/L. During the experiment, nTiO2 aggregates were found to entrap algae cells, which is likely responsible for the observed toxic effects. Direct physical effects such as cell wall damage from the algae entrapment were confirmed by flow cytometry and TEM imaging. Moreover, low indirect effects such as shading and oxidative stress were observed, which supported the idea that direct physical effects could be the dominant factor that causes nTiO2 toxicity in P. tricornutum. Our research provides direct evidence for the toxicological impact of nTiO2 on marine microalgae, which will help us to build a good understanding of the ecological risks of nanoparticles in the marine environment.

  3. Evolutionary relatedness does not predict competition and co-occurrence in natural or experimental communities of green algae.


    Alexandrou, Markos A; Cardinale, Bradley J; Hall, John D; Delwiche, Charles F; Fritschie, Keith; Narwani, Anita; Venail, Patrick A; Bentlage, Bastian; Pankey, M Sabrina; Oakley, Todd H


    The competition-relatedness hypothesis (CRH) predicts that the strength of competition is the strongest among closely related species and decreases as species become less related. This hypothesis is based on the assumption that common ancestry causes close relatives to share biological traits that lead to greater ecological similarity. Although intuitively appealing, the extent to which phylogeny can predict competition and co-occurrence among species has only recently been rigorously tested, with mixed results. When studies have failed to support the CRH, critics have pointed out at least three limitations: (i) the use of data poor phylogenies that provide inaccurate estimates of species relatedness, (ii) the use of inappropriate statistical models that fail to detect relationships between relatedness and species interactions amidst nonlinearities and heteroskedastic variances, and (iii) overly simplified laboratory conditions that fail to allow eco-evolutionary relationships to emerge. Here, we address these limitations and find they do not explain why evolutionary relatedness fails to predict the strength of species interactions or probabilities of coexistence among freshwater green algae. First, we construct a new data-rich, transcriptome-based phylogeny of common freshwater green algae that are commonly cultured and used for laboratory experiments. Using this new phylogeny, we re-analyse ecological data from three previously published laboratory experiments. After accounting for the possibility of nonlinearities and heterogeneity of variances across levels of relatedness, we find no relationship between phylogenetic distance and ecological traits. In addition, we show that communities of North American green algae are randomly composed with respect to their evolutionary relationships in 99% of 1077 lakes spanning the continental United States. Together, these analyses result in one of the most comprehensive case studies of how evolutionary history influences

  4. Evolutionary relatedness does not predict competition and co-occurrence in natural or experimental communities of green algae

    PubMed Central

    Alexandrou, Markos A.; Cardinale, Bradley J.; Hall, John D.; Delwiche, Charles F.; Fritschie, Keith; Narwani, Anita; Venail, Patrick A.; Bentlage, Bastian; Pankey, M. Sabrina; Oakley, Todd H.


    The competition-relatedness hypothesis (CRH) predicts that the strength of competition is the strongest among closely related species and decreases as species become less related. This hypothesis is based on the assumption that common ancestry causes close relatives to share biological traits that lead to greater ecological similarity. Although intuitively appealing, the extent to which phylogeny can predict competition and co-occurrence among species has only recently been rigorously tested, with mixed results. When studies have failed to support the CRH, critics have pointed out at least three limitations: (i) the use of data poor phylogenies that provide inaccurate estimates of species relatedness, (ii) the use of inappropriate statistical models that fail to detect relationships between relatedness and species interactions amidst nonlinearities and heteroskedastic variances, and (iii) overly simplified laboratory conditions that fail to allow eco-evolutionary relationships to emerge. Here, we address these limitations and find they do not explain why evolutionary relatedness fails to predict the strength of species interactions or probabilities of coexistence among freshwater green algae. First, we construct a new data-rich, transcriptome-based phylogeny of common freshwater green algae that are commonly cultured and used for laboratory experiments. Using this new phylogeny, we re-analyse ecological data from three previously published laboratory experiments. After accounting for the possibility of nonlinearities and heterogeneity of variances across levels of relatedness, we find no relationship between phylogenetic distance and ecological traits. In addition, we show that communities of North American green algae are randomly composed with respect to their evolutionary relationships in 99% of 1077 lakes spanning the continental United States. Together, these analyses result in one of the most comprehensive case studies of how evolutionary history influences

  5. Comparative analysis of the chemical composition of mixed and pure cultures of green algae and their decomposed residues by C nuclear magnetic resonance spectroscopy.


    Zelibor, J L; Romankiw, L; Hatcher, P G; Colwell, R R


    It is known that macromolecular organic matter in aquatic environments, i.e., humic substances, is highly aliphatic. These aliphatic macromolecules, predominantly paraffinic in structure, are prevalent in marine and lacustrine sediments and are believed to originate from algae or bacteria. A comparative study of mixed and pure cultures of green algae and their decomposed residues was performed by using solid-state C nuclear magnetic resonance spectroscopy as the primary analytical method. Results obtained in this study confirm the presence of components that are chemically refractory and that are defined as alghumin and hydrolyzed alghumin. These were detected in heterogeneous, homogeneous, and axenic biomasses composed of several genera of Chlorophyta. Although the chemical composition of algal biomass varied with culture conditions, the chemical structure of the alghumin and hydrolyzed alghumin, demonstrated by C nuclear magnetic resonance spectroscopy appeared to be constant for members of the Chlorophyta examined in this study. The alghumin was dominated by carbohydrate-carbon, with minor amounts of amide or carboxyl carbon and paraffinic carbon, the latter surviving strong hydrolysis by 6 N HCI (hydrolyzed alghumin). Bacterial decomposition of heterogeneous algal biomass labeled with C was conducted under both aerobic and anaerobic conditions to determine chemical structure and stability of the refractory material. The refractory fraction ranged from 33% in aerobic to 44% in anaerobic cultures. The refractory fraction recovered from either aerobic or anaerobic degradation comprised 40% alghumin, which represented an enrichment by 10% relative to the proportion of alghumin derived from whole cells of algae. The paraffinic component in the hydrolyzed alghumin of whole algal cells was found to be 1.8% and increased to 5.1 and 6.9% after aerobic and anaerobic bacterial degradation, respectively. It is concluded that members of the Chlorophyta contain a common

  6. Combined effect of oil, oil products and dispersants on the blue-green algae Synechocystis aquatilis and Anabaena variabilis

    SciTech Connect

    Gapochka, L.D.; Brodskii, L.I.; Kravchenko, M.E.; Fedorov, V.D.


    The study of the combined effect of oil, oil products and dispersants on the growth of the blue-green algae Synechocystis aquatilis and Anabaena variabilis has shown that out of 12 studied oil-dispersant pairs 6 revealed a positive relationship, which provides evidence for a decrease in oil and oil products toxic effect in the presence of a dispersant. The positive interaction between oil and oil products was found. The negative oil and oil products effect on all studied indices of A. variabilis culture increases with time.

  7. Blue-green algae (Arthrospira platensis) as an ingredient in pasta: free radical scavenging activity, sensory and cooking characteristics evaluation.


    Zouari, Nacim; Abid, Mouna; Fakhfakh, Nahed; Ayadi, M A; Zorgui, Lazhar; Ayadi, Moez; Attia, Hamadi


    The effects of semolina enrichment with blue-green algae (Arthrospira platensis) at three different levels (1, 2 and 3 g/100 g of semolina) on the colour, cooking properties, firmness, free radical scavenging activity and sensory characteristics of pasta are reported. Microalgae addition resulted in higher swelling index and lower cooking loss than the control sample. A significant increase in pasta firmness was evidenced with an increase of added microalgae due to structural reinforcement. In addition to colouring, the use of A. platensis (2 g/100 g of semolina) can enhance the sensory quality and nutraceutical potential as evaluated by free radical scavenging activity of pasta. PMID:21568819

  8. Interactive effects of copper oxide nanoparticles and light to green alga Chlamydomonas reinhardtii.


    Cheloni, Giulia; Marti, Elodie; Slaveykova, Vera I


    The present study explores the effect of light with different spectral composition on the stability of CuO-nanoparticle (CuO-NP) dispersions and their effects to green alga Chlamydomonas reinhardtii. The results showed that simulated natural light (SNL) and light with enhanced UVB radiation (UVR*) do not affect the dissolution of CuO-NPs as compared to light irradiation conditions typically used in laboratory incubator (INC). Comparable values of ζ-potential and hydrodynamic size during 24h were found under all studied conditions. Concentrations of CuO-NPs below 1mgL(-1) do not attenuate the light penetration in the algal suspensions in comparison with NP-free system. Exposure to a combination of 8μgL(-1) or 0.8mgL(-1) CuO-NPs and INC or SNL has no significant effect on the algal growth inhibition, algal fluorescence and membrane integrity under short-term exposure. However, an enhancement of the percentage of cells experiencing oxidative stress was observed upon exposure to 0.8mgL(-1) CuO-NPs and SNL for 4 and 8h. Combination of UVR* and 0.8mgL(-1) CuO-NPs resulted in synergistic effects for all biological endpoints. Despite the photocatalytic properties of CuO-NPs no significant increase in abiotic reactive oxygen species (ROS) production under simulated solar radiation was observed suggesting that the synergistic effect observed might be correlated to other factors than CuO-NP-mediated ROS photoproduction. Tests performed with CuSO4 confirmed the important role of dissolution as toxicity driving force for lower CuO-NP concentration. However, they failed to clarify the contribution of dissolved Cu on the combined effects at 0.8mgL(-1) CuO-NPs. The results point out the necessity of taking into account the possible interactions between ENPs and changing light conditions when evaluating the potential effects of ENPs to phytoplankton in natural waters.

  9. Interactive effects of copper oxide nanoparticles and light to green alga Chlamydomonas reinhardtii.


    Cheloni, Giulia; Marti, Elodie; Slaveykova, Vera I


    The present study explores the effect of light with different spectral composition on the stability of CuO-nanoparticle (CuO-NP) dispersions and their effects to green alga Chlamydomonas reinhardtii. The results showed that simulated natural light (SNL) and light with enhanced UVB radiation (UVR*) do not affect the dissolution of CuO-NPs as compared to light irradiation conditions typically used in laboratory incubator (INC). Comparable values of ζ-potential and hydrodynamic size during 24h were found under all studied conditions. Concentrations of CuO-NPs below 1mgL(-1) do not attenuate the light penetration in the algal suspensions in comparison with NP-free system. Exposure to a combination of 8μgL(-1) or 0.8mgL(-1) CuO-NPs and INC or SNL has no significant effect on the algal growth inhibition, algal fluorescence and membrane integrity under short-term exposure. However, an enhancement of the percentage of cells experiencing oxidative stress was observed upon exposure to 0.8mgL(-1) CuO-NPs and SNL for 4 and 8h. Combination of UVR* and 0.8mgL(-1) CuO-NPs resulted in synergistic effects for all biological endpoints. Despite the photocatalytic properties of CuO-NPs no significant increase in abiotic reactive oxygen species (ROS) production under simulated solar radiation was observed suggesting that the synergistic effect observed might be correlated to other factors than CuO-NP-mediated ROS photoproduction. Tests performed with CuSO4 confirmed the important role of dissolution as toxicity driving force for lower CuO-NP concentration. However, they failed to clarify the contribution of dissolved Cu on the combined effects at 0.8mgL(-1) CuO-NPs. The results point out the necessity of taking into account the possible interactions between ENPs and changing light conditions when evaluating the potential effects of ENPs to phytoplankton in natural waters. PMID:26655656

  10. Extraction and PTP1B inhibitory activity of bromophenols from the marine red alga Symphyocladia latiuscula

    NASA Astrophysics Data System (ADS)

    Liu, Xu; Li, Xiaoming; Gao, Lixin; Cui, Chuanming; Li, Chunshun; Li, Jia; Wang, Bingui


    Previously, we had characterized several structurally interesting brominated phenols from the marine red alga Symphyocladia latiuscula collected from various sites. However, Phytochemical investigations on this species collected from the Weihai coastline of Shandong Province remains blank. Therefore, we characterized the chemical constituents of individuals of this species collected from the region. Eight bromophenols were isolated and identified. Using detailed spectroscopic techniques and comparisons with published data, these compounds were identified as 2,3-dibromo-4,5-dihydroxybenzyl methyl ether ( 1), 3,5-dibromo-4-hydroxybenzoic acid ( 2), 2,3,6-tribromo-4,5-dihydroxymethylbenzene ( 3), 2,3,6-tribromo-4,5-dihydroxybenzaldehyde ( 4), 2,3,6-tribromo-4,5-dihydroxybenzyl methyl ether ( 5), bis(2,3,6-tribromo-4,5-dihydroxyphenyl)methane ( 6), 1,2-bis(2,3,6-tribromo-4,5-dihydroxyphenyl)-ethane ( 7), and 1-(2,3,6-tribromo-4,5-dihydroxybenzyl)-pyrrolidin-2-one ( 8). Among these compounds, 1 and 2 were isolated for the first time from S. latiuscula. Each compound was evaluated on the ability to inhibit protein tyrosine phosphatase 1B (PTP1B), which is a potential therapeutic target in the treatment of type 2 diabetes. Bromophenols 5, 6, and 7 showed strong activities with IC50 values of 3.9, 4.3, and 3.5 μmol/L, respectively. This study provides further evidence that bromophenols are predominant among the chemical constituents of Symphyocladia, and that some of these compounds may be candidates for the development of anti-diabetes drugs.

  11. Copper-induced synthesis of ascorbate, glutathione and phytochelatins in the marine alga Ulva compressa (Chlorophyta).


    Mellado, Macarena; Contreras, Rodrigo A; González, Alberto; Dennett, Geraldine; Moenne, Alejandra


    In order to analyze the synthesis of antioxidant and heavy metal-chelating compounds in response to copper stress, the marine alga Ulva compressa (Chlorophyta) was exposed to 10 μM copper for 7 days and treated with inhibitors of ASC synthesis, lycorine, and GSH synthesis, buthionine sulfoximine (BSO). The levels of ascorbate, in its reduced (ASC) and oxidized (DHA) forms, glutathione, in its reduced (GSH) and oxidized (GSSG) forms, and phytochelatins (PCs) were determined as well as activities of enzymes involved in ASC synthesis, L-galactose dehydrogenase (GDH) and L-galactono 1,4 lactone dehydrogenase (GLDH), and in GSH synthesis, γ-glutamylcysteine synthase (γ-GCS) and glutathione synthase (GS). The level of ASC rapidly decreased to reach a minimum at day 1 that remained low until day 7, DHA decreased until day 1 but slowly increased up to day 7 and its accumulation was inhibited by lycorine. In addition, GSH level increased to reach a maximal level at day 5 and GSSG increased up to day 7 and their accumulation was inhibited by BSO. Activities of GDH and GLDH increased until day 7 and GLDH was inhibited by lycorine. Moreover, activities of γ-GCS and GS increased until day 7 and γ-GCS was inhibited by BSO. Furthermore, PC2, PC3 and PC4, increased until day 7 and their accumulation was inhibited by BSO. Thus, copper induced the synthesis of ascorbate, glutathione and PCs in U. compressa suggesting that these compounds are involved in copper tolerance. Interestingly, U. compressa is, until now, the only ulvophyte showing ASC, GSH and PCs synthesis in response to copper excess.

  12. Proliferation of group II introns in the chloroplast genome of the green alga Oedocladium carolinianum (Chlorophyceae)

    PubMed Central

    Otis, Christian


    Background The chloroplast genome sustained extensive changes in architecture during the evolution of the Chlorophyceae, a morphologically and ecologically diverse class of green algae belonging to the Chlorophyta; however, the forces driving these changes are poorly understood. The five orders recognized in the Chlorophyceae form two major clades: the CS clade consisting of the Chlamydomonadales and Sphaeropleales, and the OCC clade consisting of the Oedogoniales, Chaetophorales, and Chaetopeltidales. In the OCC clade, considerable variations in chloroplast DNA (cpDNA) structure, size, gene order, and intron content have been observed. The large inverted repeat (IR), an ancestral feature characteristic of most green plants, is present in Oedogonium cardiacum (Oedogoniales) but is lacking in the examined members of the Chaetophorales and Chaetopeltidales. Remarkably, the Oedogonium 35.5-kb IR houses genes that were putatively acquired through horizontal DNA transfer. To better understand the dynamics of chloroplast genome evolution in the Oedogoniales, we analyzed the cpDNA of a second representative of this order, Oedocladium carolinianum. Methods The Oedocladium cpDNA was sequenced and annotated. The evolutionary distances separating Oedocladium and Oedogonium cpDNAs and two other pairs of chlorophycean cpDNAs were estimated using a 61-gene data set. Phylogenetic analysis of an alignment of group IIA introns from members of the OCC clade was performed. Secondary structures and insertion sites of oedogonialean group IIA introns were analyzed. Results The 204,438-bp Oedocladium genome is 7.9 kb larger than the Oedogonium genome, but its repertoire of conserved genes is remarkably similar and gene order differs by only one reversal. Although the 23.7-kb IR is missing the putative foreign genes found in Oedogonium, it contains sequences coding for a putative phage or bacterial DNA primase and a hypothetical protein. Intergenic sequences are 1.5-fold longer and

  13. Red coralline algae assessed as marine pH proxies using 11B MAS NMR

    NASA Astrophysics Data System (ADS)

    Cusack, M.; Kamenos, N. A.; Rollion-Bard, C.; Tricot, G.


    Reconstructing pH from biogenic carbonates using boron isotopic compositions relies on the assumption that only borate, and no boric acid, is present. Red coralline algae are frequently used in palaeoenvironmental reconstruction due to their widespread distribution and regular banding frequency. Prior to undertaking pH reconstructions using red coralline algae we tested the boron composition of the red coralline alga Lithothamnion glaciale using high field NMR. In bulk analysed samples, thirty percent of boron was present as boric acid. We suggest that prior to reconstructing pH using coralline algae 1) species-specific boron compositions and 2) within-skeleton special distributions of boron are determined for multiple species. This will enable site selective boron analyses to be conducted validating coralline algae as palaeo-pH proxies based on boron isotopic compositions.

  14. Red coralline algae assessed as marine pH proxies using 11B MAS NMR

    PubMed Central

    Cusack, M.; Kamenos, N. A.; Rollion-Bard, C.; Tricot, G.


    Reconstructing pH from biogenic carbonates using boron isotopic compositions relies on the assumption that only borate, and no boric acid, is present. Red coralline algae are frequently used in palaeoenvironmental reconstruction due to their widespread distribution and regular banding frequency. Prior to undertaking pH reconstructions using red coralline algae we tested the boron composition of the red coralline alga Lithothamnion glaciale using high field NMR. In bulk analysed samples, thirty percent of boron was present as boric acid. We suggest that prior to reconstructing pH using coralline algae 1) species-specific boron compositions and 2) within-skeleton special distributions of boron are determined for multiple species. This will enable site selective boron analyses to be conducted validating coralline algae as palaeo-pH proxies based on boron isotopic compositions. PMID:25640229

  15. Light-harvesting complex Lhcb9 confers a green alga-type photosystem I supercomplex to the moss Physcomitrella patens.


    Iwai, Masakazu; Yokono, Makio; Kono, Masaru; Noguchi, Ko; Akimoto, Seiji; Nakano, Akihiko


    Light-harvesting complex (LHC) proteins in chloroplast thylakoid membranes not only transfer absorbed light energy to the two photosystems but also regulate the rate of energy transfer to avoid photodamage. Here we demonstrate that Lhcb9, a recently discovered LHC protein in the moss Physcomitrella patens, functions to connect LHC proteins with photosystem I (PSI), resulting in the formation of two different types of PSI supercomplexes in thylakoid membranes. We observed that the Lhcb9-containing PSI supercomplex is disassembled in response to excess light conditions. On the basis of our phylogenetic analysis, it appears that P. patens acquired Lhcb9 by horizontal gene transfer from the earlier green algal lineage, leading to the presence of both green alga-type and vascular plant-type PSI supercomplexes, which would have been crucial for conquering the dynamic environmental interface between aquatic and terrestrial conditions it faced during evolution.

  16. Sequestration of Dimethylsulfoniopropionate (DMSP) and Acrylate from the Green Alga Ulva Spp. by the Sea Hare Aplysia juliana.


    Kamio, Michiya; Koyama, Mao; Hayashihara, Nobuko; Hiei, Kaori; Uchida, Hajime; Watanabe, Ryuichi; Suzuki, Toshiyuki; Nagai, Hiroshi


    Many animals sequester secondary metabolites from their food. In this study, we hypothesized that the sea hare Aplysia juliana sequesters secondary metabolites from green algae. To test this, we performed NMR-based metabolomic analysis on methanol extracts of Ulva spp. and A. juliana. Another sea hare, Bursatella leachii, which mainly feeds on another type of alga, was added to this analysis as an outgroup. Two body parts of the sea hares, skin and digestive glands, were used in the analysis. Principal component analysis (PCA) on the NMR data of these samples detected biomarkers common to Ulva spp. and A. juliana. This result indicates sequestration of secondary metabolites by the herbivore from the plants. The biomarker metabolites were identified as dimethylsulfoniopropionate (DMSP) and acrylate, which were concentrated in skin of A. juliana and were released from the skin of live animals when physically stressed. Thus, our NMR-based metabolomic study revealed sequestration of algae-derived secondary metabolites in skin of A. Juliana, and in the discharge of the metabolites under conditions that mimic attack by predators. PMID:27179528

  17. Refactoring the Six-Gene Photosystem II Core in the Chloroplast of the Green Algae Chlamydomonas reinhardtii.


    Gimpel, Javier A; Nour-Eldin, Hussam H; Scranton, Melissa A; Li, Daphne; Mayfield, Stephen P


    Oxygenic photosynthesis provides the energy to produce all food and most of the fuel on this planet. Photosystem II (PSII) is an essential and rate-limiting component of this process. Understanding and modifying PSII function could provide an opportunity for optimizing photosynthetic biomass production, particularly under specific environmental conditions. PSII is a complex multisubunit enzyme with strong interdependence among its components. In this work, we have deleted the six core genes of PSII in the eukaryotic alga Chlamydomonas reinhardtii and refactored them in a single DNA construct. Complementation of the knockout strain with the core PSII synthetic module from three different green algae resulted in reconstitution of photosynthetic activity to 85, 55, and 53% of that of the wild-type, demonstrating that the PSII core can be exchanged between algae species and retain function. The strains, synthetic cassettes, and refactoring strategy developed for this study demonstrate the potential of synthetic biology approaches for tailoring oxygenic photosynthesis and provide a powerful tool for unraveling PSII structure-function relationships.

  18. Klebsormidium flaccidum, a charophycean green alga, exhibits cold acclimation that is closely associated with compatible solute accumulation and ultrastructural changes.


    Nagao, Manabu; Matsui, Kenji; Uemura, Matsuo


    To elucidate the fundamental mechanisms and subsequent evolutionary aspects of plant cold acclimation, we examined the effect of cold acclimation on freezing tolerance in Klebsormidium flaccidum, a green alga belonging to Charophyceae, a sister group of land plants. Freezing tolerance of K. flaccidum was significantly enhanced by cold treatment: survival increased from 15% at -10 degrees C when grown at 18 degrees C to 55 and 85% after exposure at 2 degrees C for 2 and 7 d, respectively. Accompanying the development of freezing tolerance, soluble sugars (glucose and sucrose), a putative glycoside and amino acids, including gamma-aminobutyric acid (GABA), accumulated to high levels in the alga, suggesting that these solutes play a crucial role in the cold acclimation of K. flaccidum. Interestingly, the application of abscisic acid (ABA) did not change the freezing tolerance of the alga. We also observed changes in cell structure, including increased numbers and sizes of starch grains in chloroplasts, chloroplast enlargement, vacuole size reduction and cytoplasmic volume increase. These results suggest that K. flaccidum responds well to cold treatment and develops freezing tolerance in a process comparable to that of land plants.

  19. The complete chloroplast DNA sequence of the green alga Nephroselmis olivacea: insights into the architecture of ancestral chloroplast genomes.


    Turmel, M; Otis, C; Lemieux, C


    Green plants seem to form two sister lineages: Chlorophyta, comprising the green algal classes Prasinophyceae, Ulvophyceae, Trebouxiophyceae, and Chlorophyceae, and Streptophyta, comprising the Charophyceae and land plants. We have determined the complete chloroplast DNA (cpDNA) sequence (200,799 bp) of Nephroselmis olivacea, a member of the class (Prasinophyceae) thought to include descendants of the earliest-diverging green algae. The 127 genes identified in this genome represent the largest gene repertoire among the green algal and land plant cpDNAs completely sequenced to date. Of the Nephroselmis genes, 2 (ycf81 and ftsI, a gene involved in peptidoglycan synthesis) have not been identified in any previously investigated cpDNA; 5 genes [ftsW, rnE, ycf62, rnpB, and trnS(cga)] have been found only in cpDNAs of nongreen algae; and 10 others (ndh genes) have been described only in land plant cpDNAs. Nephroselmis and land plant cpDNAs share the same quadripartite structure-which is characterized by the presence of a large rRNA-encoding inverted repeat and two unequal single-copy regions-and very similar sets of genes in corresponding genomic regions. Given that our phylogenetic analyses place Nephroselmis within the Chlorophyta, these structural characteristics were most likely present in the cpDNA of the common ancestor of chlorophytes and streptophytes. Comparative analyses of chloroplast genomes indicate that the typical quadripartite architecture and gene-partitioning pattern of land plant cpDNAs are ancient features that may have been derived from the genome of the cyanobacterial progenitor of chloroplasts. Our phylogenetic data also offer insight into the chlorophyte ancestor of euglenophyte chloroplasts.

  20. The GC-Rich Mitochondrial and Plastid Genomes of the Green Alga Coccomyxa Give Insight into the Evolution of Organelle DNA Nucleotide Landscape

    SciTech Connect

    Smith, David Roy; Burki, Fabien; Yamada, Takashi; Grimwood, Jane; Grigoriev, Igor V.; Van Etten, James L.; Keeling, Patrick J.


    Most of the available mitochondrial and plastid genome sequences are biased towards adenine and thymine (AT) over guanine and cytosine (GC). Examples of GC-rich organelle DNAs are limited to a small but eclectic list of species, including certain green algae. Here, to gain insight in the evolution of organelle nucleotide landscape, we present the GC-rich mitochondrial and plastid DNAs from the trebouxiophyte green alga Coccomyxa sp. C-169. We compare these sequences with other GC-rich organelle DNAs and argue that the forces biasing them towards G and C are nonadaptive and linked to the metabolic and/or life history features of this species. The Coccomyxa organelle genomes are also used for phylogenetic analyses, which highlight the complexities in trying to resolve the interrelationships among the core chlorophyte green algae, but ultimately favour a sister relationship between the Ulvophyceae and Chlorophyceae, with the Trebouxiophyceae branching at the base of the chlorophyte crown.

  1. The physiological response of two green calcifying algae from the Great Barrier Reef towards high dissolved inorganic and organic carbon (DIC and DOC) availability.


    Meyer, Friedrich Wilhelm; Vogel, Nikolas; Teichberg, Mirta; Uthicke, Sven; Wild, Christian


    Increasing dissolved inorganic carbon (DIC) concentrations associated with ocean acidification can affect marine calcifiers, but local factors, such as high dissolved organic carbon (DOC) concentrations through sewage and algal blooms, may interact with this global factor. For calcifying green algae of the genus Halimeda, a key tropical carbonate producer that often occurs in coral reefs, no studies on these interactions have been reported. These data are however urgently needed to understand future carbonate production. Thus, we investigated the independent and combined effects of DIC (pCO2 402 μatm/ pHtot 8.0 and 996 μatm/ pHtot 7.7) and DOC (added as glucose in 0 and 294 μmol L-1) on growth, calcification and photosynthesis of H. macroloba and H. opuntia from the Great Barrier Reef in an incubation experiment over 16 days. High DIC concentrations significantly reduced dark calcification of H. opuntia by 130 % and led to net dissolution, but did not affect H. macroloba. High DOC concentrations significantly reduced daily oxygen production of H. opuntia and H. macroloba by 78 % and 43 %, respectively, and significantly reduced dark calcification of H. opuntia by 70%. Combined high DIC and DOC did not show any interactive effects for both algae, but revealed additive effects for H. opuntia where the combination of both factors reduced dark calcification by 162 % compared to controls. Such species-specific differences in treatment responses indicate H. opuntia is more susceptible to a combination of high DIC and DOC than H. macroloba. From an ecological perspective, results further suggest a reduction of primary production for Halimeda-dominated benthic reef communities under high DOC concentrations and additional decreases of carbonate accretion under elevated DIC concentrations, where H. opuntia dominates the benthic community. This may reduce biogenic carbonate sedimentation rates and hence the buffering capacity against further ocean acidification.

  2. The Physiological Response of Two Green Calcifying Algae from the Great Barrier Reef towards High Dissolved Inorganic and Organic Carbon (DIC and DOC) Availability

    PubMed Central

    Meyer, Friedrich Wilhelm; Vogel, Nikolas; Teichberg, Mirta; Uthicke, Sven; Wild, Christian


    Increasing dissolved inorganic carbon (DIC) concentrations associated with ocean acidification can affect marine calcifiers, but local factors, such as high dissolved organic carbon (DOC) concentrations through sewage and algal blooms, may interact with this global factor. For calcifying green algae of the genus Halimeda, a key tropical carbonate producer that often occurs in coral reefs, no studies on these interactions have been reported. These data are however urgently needed to understand future carbonate production. Thus, we investigated the independent and combined effects of DIC (pCO2 402 μatm/ pHtot 8.0 and 996 μatm/ pHtot 7.7) and DOC (added as glucose in 0 and 294 μmol L-1) on growth, calcification and photosynthesis of H. macroloba and H. opuntia from the Great Barrier Reef in an incubation experiment over 16 days. High DIC concentrations significantly reduced dark calcification of H. opuntia by 130 % and led to net dissolution, but did not affect H. macroloba. High DOC concentrations significantly reduced daily oxygen production of H. opuntia and H. macroloba by 78 % and 43 %, respectively, and significantly reduced dark calcification of H. opuntia by 70%. Combined high DIC and DOC did not show any interactive effects for both algae, but revealed additive effects for H. opuntia where the combination of both factors reduced dark calcification by 162 % compared to controls. Such species-specific differences in treatment responses indicate H. opuntia is more susceptible to a combination of high DIC and DOC than H. macroloba. From an ecological perspective, results further suggest a reduction of primary production for Halimeda-dominated benthic reef communities under high DOC concentrations and additional decreases of carbonate accretion under elevated DIC concentrations, where H. opuntia dominates the benthic community. This may reduce biogenic carbonate sedimentation rates and hence the buffering capacity against further ocean acidification. PMID

  3. The physiological response of two green calcifying algae from the Great Barrier Reef towards high dissolved inorganic and organic carbon (DIC and DOC) availability.


    Meyer, Friedrich Wilhelm; Vogel, Nikolas; Teichberg, Mirta; Uthicke, Sven; Wild, Christian


    Increasing dissolved inorganic carbon (DIC) concentrations associated with ocean acidification can affect marine calcifiers, but local factors, such as high dissolved organic carbon (DOC) concentrations through sewage and algal blooms, may interact with this global factor. For calcifying green algae of the genus Halimeda, a key tropical carbonate producer that often occurs in coral reefs, no studies on these interactions have been reported. These data are however urgently needed to understand future carbonate production. Thus, we investigated the independent and combined effects of DIC (pCO2 402 μatm/ pHtot 8.0 and 996 μatm/ pHtot 7.7) and DOC (added as glucose in 0 and 294 μmol L-1) on growth, calcification and photosynthesis of H. macroloba and H. opuntia from the Great Barrier Reef in an incubation experiment over 16 days. High DIC concentrations significantly reduced dark calcification of H. opuntia by 130 % and led to net dissolution, but did not affect H. macroloba. High DOC concentrations significantly reduced daily oxygen production of H. opuntia and H. macroloba by 78 % and 43 %, respectively, and significantly reduced dark calcification of H. opuntia by 70%. Combined high DIC and DOC did not show any interactive effects for both algae, but revealed additive effects for H. opuntia where the combination of both factors reduced dark calcification by 162 % compared to controls. Such species-specific differences in treatment responses indicate H. opuntia is more susceptible to a combination of high DIC and DOC than H. macroloba. From an ecological perspective, results further suggest a reduction of primary production for Halimeda-dominated benthic reef communities under high DOC concentrations and additional decreases of carbonate accretion under elevated DIC concentrations, where H. opuntia dominates the benthic community. This may reduce biogenic carbonate sedimentation rates and hence the buffering capacity against further ocean acidification. PMID

  4. A Simple Green Synthesis of Palladium Nanoparticles with Sargassum Alga and Their Electrocatalytic Activities Towards Hydrogen Peroxide.


    Momeni, S; Nabipour, I


    This study presents the synthesis of palladium nanoparticles (PdNPs) using the extract derived from the marine alga, Sargassum bovinum, collected from Persian Gulf area. Water-soluble compounds that exist in the marine alga extract were the main cause of the reduction of palladium ions to Pd nanoparticles. The basic properties of PdNPs produced in this method were confirmed by UV-visible spectroscopy, transmission electron microscopy (TEM), X-ray diffraction (XRD), energy-dispersive X-ray (EDX) analysis, and Fourier transform infrared spectroscopy (FTIR). TEM confirmed the monodispersed and octahedral shape of PdNPs within the size ranges from 5 to 10 nm. Catalytic performance of the biosynthetic PdNPs was investigated by electrochemical reduction of hydrogen peroxide (H2O2). PdNP-modified carbon ionic liquid electrode (PdNPs/CILE) was developed as a nonenzymatic sensor for the determination of hydrogen peroxide. Amperometric measurements showed that PdNPs/CILE is a reliable sensor for the detection of hydrogen peroxide in the range of 5.0 μM-15.0 mM with a sensitivity of 284.35 mAmM(-1) cm(-2) and a detection limit of 1.0 μM. Moreover, PdNPs/CILE exhibits a wide linear range, high sensitivity and selectivity, and excellent stability for the detection of H2O2 in aqueous solutions.

  5. A Simple Green Synthesis of Palladium Nanoparticles with Sargassum Alga and Their Electrocatalytic Activities Towards Hydrogen Peroxide.


    Momeni, S; Nabipour, I


    This study presents the synthesis of palladium nanoparticles (PdNPs) using the extract derived from the marine alga, Sargassum bovinum, collected from Persian Gulf area. Water-soluble compounds that exist in the marine alga extract were the main cause of the reduction of palladium ions to Pd nanoparticles. The basic properties of PdNPs produced in this method were confirmed by UV-visible spectroscopy, transmission electron microscopy (TEM), X-ray diffraction (XRD), energy-dispersive X-ray (EDX) analysis, and Fourier transform infrared spectroscopy (FTIR). TEM confirmed the monodispersed and octahedral shape of PdNPs within the size ranges from 5 to 10 nm. Catalytic performance of the biosynthetic PdNPs was investigated by electrochemical reduction of hydrogen peroxide (H2O2). PdNP-modified carbon ionic liquid electrode (PdNPs/CILE) was developed as a nonenzymatic sensor for the determination of hydrogen peroxide. Amperometric measurements showed that PdNPs/CILE is a reliable sensor for the detection of hydrogen peroxide in the range of 5.0 μM-15.0 mM with a sensitivity of 284.35 mAmM(-1) cm(-2) and a detection limit of 1.0 μM. Moreover, PdNPs/CILE exhibits a wide linear range, high sensitivity and selectivity, and excellent stability for the detection of H2O2 in aqueous solutions. PMID:26041058

  6. Ribosomal protein L10 is encoded in the mitochondrial genome of many land plants and green algae

    PubMed Central


    Background The mitochondrial genomes of plants generally encode 30-40 identified protein-coding genes and a large number of lineage-specific ORFs. The lack of wide conservation for most ORFs suggests they are unlikely to be functional. However, an ORF, termed orf-bryo1, was recently found to be conserved among bryophytes suggesting that it might indeed encode a functional mitochondrial protein. Results From a broad survey of land plants, we have found that the orf-bryo1 gene is also conserved in the mitochondria of vascular plants and charophycean green algae. This gene is actively transcribed and RNA edited in many flowering plants. Comparative sequence analysis and distribution of editing suggests that it encodes ribosomal protein L10 of the large subunit of the ribosome. In several lineages, such as crucifers and grasses, where the rpl10 gene has been lost from the mitochondrion, we suggest that a copy of the nucleus-encoded chloroplast-derived rpl10 gene may serve as a functional replacement. Conclusion Despite the fact that there are now over 20 mitochondrial genome sequences for land plants and green algae, this gene has remained unidentified and largely undetected until now because of the unlikely coincidence that most of the earlier sequences were from the few lineages that lack the intact gene. These results illustrate the power of comparative sequencing to identify novel genomic features. PMID:19917118

  7. Ca(2+)-regulated cyclic electron flow supplies ATP for nitrogen starvation-induced lipid biosynthesis in green alga.


    Chen, Hui; Hu, Jinlu; Qiao, Yaqin; Chen, Weixian; Rong, Junfeng; Zhang, Yunming; He, Chenliu; Wang, Qiang


    We previously showed that both the linear photosynthetic electron transportation rate and the respiration rate dropped significantly during N starvation-induced neutral lipid accumulation in an oil-producing microalga, Chlorella sorokiniana, and proposed a possible role for cyclic electron flow (CEF) in ATP supply. In this study, we further exploited this hypothesis in both Chlorella sorokiniana C3 and the model green alga Chlamydomonas. We found that both the rate of CEF around photosystem I and the activity of thylakoid membrane-located ATP synthetase increased significantly during N starvation to drive ATP production. Furthermore, we demonstrated that the Chlamydomonas mutant pgrl1, which is deficient in PGRL1-mediated CEF, accumulated less neutral lipids and had reduced rates of CEF under N starvation. Further analysis revealed that Ca(2+) signaling regulates N starvation-induced neutral lipid biosynthesis in Chlamydomonas by increasing calmodulin activity and boosting the expression of the calcium sensor protein that regulates Pgrl1-mediated CEF. Thus, Ca(2+)-regulated CEF supplies ATP for N starvation-induced lipid biosynthesis in green alga. The increased CEF may re-equilibrate the ATP/NADPH balance and recycle excess light energy in photosystems to prevent photooxidative damage, suggesting Ca(2+)-regulated CEF also played a key role in protecting and sustaining photosystems. PMID:26450399

  8. Metabolite profiling and integrative modeling reveal metabolic constraints for carbon partitioning under nitrogen starvation in the green algae Haematococcus pluvialis.


    Recht, Lee; Töpfer, Nadine; Batushansky, Albert; Sikron, Noga; Gibon, Yves; Fait, Aaron; Nikoloski, Zoran; Boussiba, Sammy; Zarka, Aliza


    The green alga Hematococcus pluvialis accumulates large amounts of the antioxidant astaxanthin under inductive stress conditions, such as nitrogen starvation. The response to nitrogen starvation and high light leads to the accumulation of carbohydrates and fatty acids as well as increased activity of the tricarboxylic acid cycle. Although the behavior of individual pathways has been well investigated, little is known about the systemic effects of the stress response mechanism. Here we present time-resolved metabolite, enzyme activity, and physiological data that capture the metabolic response of H. pluvialis under nitrogen starvation and high light. The data were integrated into a putative genome-scale model of the green alga to in silico test hypotheses of underlying carbon partitioning. The model-based hypothesis testing reinforces the involvement of starch degradation to support fatty acid synthesis in the later stages of the stress response. In addition, our findings support a possible mechanism for the involvement of the increased activity of the tricarboxylic acid cycle in carbon repartitioning. Finally, the in vitro experiments and the in silico modeling presented here emphasize the predictive power of large scale integrative approaches to pinpoint metabolic adjustment to changing environments.

  9. Effects of alginate oligosaccharide mixtures on the growth and fatty acid composition of the green alga Chlamydomonas reinhardtii.


    Yamasaki, Yasuhiro; Yokose, Takeshi; Nishikawa, Toru; Kim, Daekyung; Jiang, Zedong; Yamaguchi, Kenichi; Oda, Tatsuya


    Alginate is a natural acidic linear polysaccharide that is produced by brown seaweeds. It is currently used in a broad range of commercial enterprises, such as the food and medical products industries. Recent evidence has demonstrated that alginate oligosaccharides may function as growth promoting agents for certain plant cells, including those of some green algae. Chlamydomonas reinhardtii is a green alga that is used as a model organism in fundamental molecular biology studies; it is also a producer of biohydrogen. In the present study, we examined effects of two types of alginate oligosaccharide mixtures (AOMs), which were prepared by either enzymatic degradation (ED) or acid hydrolysis (AH), on the growth of C. reinhardtii. Growth was significantly promoted by AOM (ED) in a concentration-dependent manner. The maximum effect was observed on day 4 of treatment. The fatty acid composition of C. reinhardtii was also influenced by AOM (ED); the levels of C16:0, C18:2 cis and C18:3 n-3 increased in treated cells. AOM (AH) and the other saccharides that we tested did not affect the growth of C. reinhardtii. The effects that we identified could promote efficient biomass production by reducing culture times and by changing cellular fatty acid levels.

  10. Effects of Cylindrospermopsin Producing Cyanobacterium and Its Crude Extracts on a Benthic Green Alga-Competition or Allelopathy?


    B-Béres, Viktória; Vasas, Gábor; Dobronoki, Dalma; Gonda, Sándor; Nagy, Sándor Alex; Bácsi, István


    Cylindrospermopsin (CYN) is a toxic secondary metabolite produced by filamentous cyanobacteria which could work as an allelopathic substance, although its ecological role in cyanobacterial-algal assemblages is mostly unclear. The competition between the CYN-producing cyanobacterium Chrysosporum (Aphanizomenon) ovalisporum, and the benthic green alga Chlorococcum sp. was investigated in mixed cultures, and the effects of CYN-containing cyanobacterial crude extract on Chlorococcum sp. were tested by treatments with crude extracts containing total cell debris, and with cell debris free crude extracts, modelling the collapse of a cyanobacterial water bloom. The growth inhibition of Chlorococcum sp. increased with the increasing ratio of the cyanobacterium in mixed cultures (inhibition ranged from 26% to 87% compared to control). Interestingly, inhibition of the cyanobacterium growth also occurred in mixed cultures, and it was more pronounced than it was expected. The inhibitory effects of cyanobacterial crude extracts on Chlorococcum cultures were concentration-dependent. The presence of C. ovalisporum in mixed cultures did not cause significant differences in nutrient content compared to Chlorococcum control culture, so the growth inhibition of the green alga could be linked to the presence of CYN and/or other bioactive compounds. PMID:26528991

  11. Different fates of the chloroplast tufA gene following its transfer to the nucleus in green algae.


    Baldauf, S L; Manhart, J R; Palmer, J D


    Previous work suggested that the tufA gene, encoding protein synthesis elongation factor Tu, was transferred from the chloroplast to the nucleus within the green algal lineage giving rise to land plants. In this report we investigate the timing and mode of transfer by examining chloroplast and nuclear DNA from the three major classes of green algae, with emphasis on the class Charophyceae, the proposed sister group to land plants. Filter hybridizations reveal a chloroplast tufA gene in all Ulvophyceae and Chlorophyceae and in some but not all Charophyceae. One charophycean alga, Coleochaete orbicularis, is shown to contain an intact but highly divergent chloroplast tufA gene, whose product is predicted to be non-functional in protein synthesis. We propose that a copy of the tufA gene was functionally transferred from the chloroplast to the nucleus early in the evolution of the Charophyceae, with chloroplast copies of varying function being retained in some but not all of the subsequently diverging lineages. This proposal is supported by the demonstration of multiple tufA-like sequences in Coleochaete nuclear DNA and in nuclear DNA from all other Charophyceae examined.

  12. Ca2+-regulated cyclic electron flow supplies ATP for nitrogen starvation-induced lipid biosynthesis in green alga

    PubMed Central

    Chen, Hui; Hu, Jinlu; Qiao, Yaqin; Chen, Weixian; Rong, Junfeng; Zhang, Yunming; He, Chenliu; Wang, Qiang


    We previously showed that both the linear photosynthetic electron transportation rate and the respiration rate dropped significantly during N starvation-induced neutral lipid accumulation in an oil-producing microalga, Chlorella sorokiniana, and proposed a possible role for cyclic electron flow (CEF) in ATP supply. In this study, we further exploited this hypothesis in both Chlorella sorokiniana C3 and the model green alga Chlamydomonas. We found that both the rate of CEF around photosystem I and the activity of thylakoid membrane-located ATP synthetase increased significantly during N starvation to drive ATP production. Furthermore, we demonstrated that the Chlamydomonas mutant pgrl1, which is deficient in PGRL1-mediated CEF, accumulated less neutral lipids and had reduced rates of CEF under N starvation. Further analysis revealed that Ca2+ signaling regulates N starvation-induced neutral lipid biosynthesis in Chlamydomonas by increasing calmodulin activity and boosting the expression of the calcium sensor protein that regulates Pgrl1-mediated CEF. Thus, Ca2+-regulated CEF supplies ATP for N starvation-induced lipid biosynthesis in green alga. The increased CEF may re-equilibrate the ATP/NADPH balance and recycle excess light energy in photosystems to prevent photooxidative damage, suggesting Ca2+-regulated CEF also played a key role in protecting and sustaining photosystems. PMID:26450399

  13. Metabolite Profiling and Integrative Modeling Reveal Metabolic Constraints for Carbon Partitioning under Nitrogen Starvation in the Green Algae Haematococcus pluvialis*

    PubMed Central

    Recht, Lee; Töpfer, Nadine; Batushansky, Albert; Sikron, Noga; Gibon, Yves; Fait, Aaron; Nikoloski, Zoran; Boussiba, Sammy; Zarka, Aliza


    The green alga Hematococcus pluvialis accumulates large amounts of the antioxidant astaxanthin under inductive stress conditions, such as nitrogen starvation. The response to nitrogen starvation and high light leads to the accumulation of carbohydrates and fatty acids as well as increased activity of the tricarboxylic acid cycle. Although the behavior of individual pathways has been well investigated, little is known about the systemic effects of the stress response mechanism. Here we present time-resolved metabolite, enzyme activity, and physiological data that capture the metabolic response of H. pluvialis under nitrogen starvation and high light. The data were integrated into a putative genome-scale model of the green alga to in silico test hypotheses of underlying carbon partitioning. The model-based hypothesis testing reinforces the involvement of starch degradation to support fatty acid synthesis in the later stages of the stress response. In addition, our findings support a possible mechanism for the involvement of the increased activity of the tricarboxylic acid cycle in carbon repartitioning. Finally, the in vitro experiments and the in silico modeling presented here emphasize the predictive power of large scale integrative approaches to pinpoint metabolic adjustment to changing environments. PMID:25183014

  14. Metabolite profiling and integrative modeling reveal metabolic constraints for carbon partitioning under nitrogen starvation in the green algae Haematococcus pluvialis.


    Recht, Lee; Töpfer, Nadine; Batushansky, Albert; Sikron, Noga; Gibon, Yves; Fait, Aaron; Nikoloski, Zoran; Boussiba, Sammy; Zarka, Aliza


    The green alga Hematococcus pluvialis accumulates large amounts of the antioxidant astaxanthin under inductive stress conditions, such as nitrogen starvation. The response to nitrogen starvation and high light leads to the accumulation of carbohydrates and fatty acids as well as increased activity of the tricarboxylic acid cycle. Although the behavior of individual pathways has been well investigated, little is known about the systemic effects of the stress response mechanism. Here we present time-resolved metabolite, enzyme activity, and physiological data that capture the metabolic response of H. pluvialis under nitrogen starvation and high light. The data were integrated into a putative genome-scale model of the green alga to in silico test hypotheses of underlying carbon partitioning. The model-based hypothesis testing reinforces the involvement of starch degradation to support fatty acid synthesis in the later stages of the stress response. In addition, our findings support a possible mechanism for the involvement of the increased activity of the tricarboxylic acid cycle in carbon repartitioning. Finally, the in vitro experiments and the in silico modeling presented here emphasize the predictive power of large scale integrative approaches to pinpoint metabolic adjustment to changing environments. PMID:25183014

  15. Localization and Quantification of Callose in the Streptophyte Green Algae Zygnema and Klebsormidium: Correlation with Desiccation Tolerance

    PubMed Central

    Herburger, Klaus; Holzinger, Andreas


    Freshwater green algae started to colonize terrestrial habitats about 460 million years ago, giving rise to the evolution of land plants. Today, several streptophyte green algae occur in aero-terrestrial habitats with unpredictable fluctuations in water availability, serving as ideal models for investigating desiccation tolerance. We tested the hypothesis that callose, a β-d-1,3-glucan, is incorporated specifically in strained areas of the cell wall due to cellular water loss, implicating a contribution to desiccation tolerance. In the early diverging genus Klebsormidium, callose was drastically increased already after 30 min of desiccation stress. Localization studies demonstrated an increase in callose in the undulating cross cell walls during cellular water loss, allowing a regulated shrinkage and expansion after rehydration. This correlates with a high desiccation tolerance demonstrated by a full recovery of the photosynthetic yield visualized at the subcellular level by Imaging-PAM. Furthermore, abundant callose in terminal cell walls might facilitate cell detachment to release dispersal units. In contrast, in the late diverging Zygnema, the callose content did not change upon desiccation for up to 3.5 h and was primarily localized in the corners between individual cells and at terminal cells. While these callose deposits still imply reduction of mechanical damage, the photosynthetic yield did not recover fully in the investigated young cultures of Zygnema upon rehydration. The abundance and specific localization of callose correlates with the higher desiccation tolerance in Klebsormidium when compared with Zygnema. PMID:26412780

  16. Treatment with NaHSO3 greatly enhances photobiological H2 production in the green alga Chlamydomonas reinhardtii.


    Ma, Weimin; Chen, Ming; Wang, Lianjun; Wei, Lanzhen; Wang, Quanxi


    Treatment with NaHSO3 induces a 10-fold increase in H2 photoproduction in the filamentous N2-fixing cyanobacterium Anabaena sp. strain PCC 7120. However, it is unclear whether this treatment also increases H2 photoproduction in green alga. In this study, treatment with 13 mM NaHSO3 resulted in about a 200-fold increase in H2 production in Chlamydomonas reinhardtii, and this increase was most probably the result of red