Detecting errors and anomalies in computerized materials control and accountability databases

DOE Office of Scientific and Technical Information (OSTI.GOV)

Whiteson, R.; Hench, K.; Yarbro, T.

The Automated MC and A Database Assessment project is aimed at improving anomaly and error detection in materials control and accountability (MC and A) databases and increasing confidence in the data that they contain. Anomalous data resulting in poor categorization of nuclear material inventories greatly reduces the value of the database information to users. Therefore it is essential that MC and A data be assessed periodically for anomalies or errors. Anomaly detection can identify errors in databases and thus provide assurance of the integrity of data. An expert system has been developed at Los Alamos National Laboratory that examines thesemore » large databases for anomalous or erroneous data. For several years, MC and A subject matter experts at Los Alamos have been using this automated system to examine the large amounts of accountability data that the Los Alamos Plutonium Facility generates. These data are collected and managed by the Material Accountability and Safeguards System, a near-real-time computerized nuclear material accountability and safeguards system. This year they have expanded the user base, customizing the anomaly detector for the varying requirements of different groups of users. This paper describes the progress in customizing the expert systems to the needs of the users of the data and reports on their results.« less

Quark masses and strong coupling constant in 2+1 flavor QCD

DOE PAGES

Maezawa, Y.; Petreczky, P.

2016-08-30

We present a determination of the strange, charm and bottom quark masses as well as the strong coupling constant in 2+1 flavor lattice QCD simulations using highly improved staggered quark action. The ratios of the charm quark mass to the strange quark mass and the bottom quark mass to the charm quark mass are obtained from the meson masses calculated on the lattice and found to be mc/ms = 11.877(91) and mb/mc = 4.528(57) in the continuum limit. We also determine the strong coupling constant and the charm quark mass using the moments of pseudoscalar charmonium correlators: α s(μ =more » m c) = 0.3697(85) and mc(μ = mc) = 1.267(12) GeV. Our result for αs corresponds to the determination of the strong coupling constant at the lowest energy scale so far and is translated to the value α s(μ = M Z, n f = 5) = 0.11622(84).« less

I want products my own way, but which way? The effects of different product categories and cues on customer responses to Web-based customizations.

PubMed

Chang, Chia-Chi; Chen, Hui-Yun

2009-02-01

Mass customization is a strategy that has been adopted by companies to tailor their products in order to match customer needs more precisely. Therefore, to fully capture the value of mass customization, it is crucial to explore how customers react to mass customization. In previous studies, an implied premise has been that consumers are keen to embrace customized products, and this assumption has also been treated by firms as a prerequisite for successful mass customization strategies. However, an undesirable complexity may result from difficult configuration processes that may intimidate and confuse some customers. Hence, this study explores strategies that marketers can employ to facilitate the customization process. Specifically, this study investigates how to enhance customer satisfaction and purchase decision toward customized products by providing cues compatible with the product category. It is hypothesized that for search products, customers rely more on intrinsic cues when making configuration decisions. On the other hand, for experience products, customers perceive extrinsic cues to be more valuable in assisting them to make configuration decisions. The results suggest that consumers tend to respond more favorably toward customized search products when intrinsic cues are provided than when extrinsic or irrelevant ones are provided. In contrast, when customizing experience products, customers tend to depend more on extrinsic cues than on intrinsic or irrelevant ones.

Top Quark Mass Calibration for Monte Carlo Event Generators

NASA Astrophysics Data System (ADS)

Butenschoen, Mathias; Dehnadi, Bahman; Hoang, André H.; Mateu, Vicent; Preisser, Moritz; Stewart, Iain W.

2016-12-01

The most precise top quark mass measurements use kinematic reconstruction methods, determining the top mass parameter of a Monte Carlo event generator mtMC. Because of hadronization and parton-shower dynamics, relating mtMC to a field theory mass is difficult. We present a calibration procedure to determine this relation using hadron level QCD predictions for observables with kinematic mass sensitivity. Fitting e+e- 2-jettiness calculations at next-to-leading-logarithmic and next-to-next-to-leading-logarithmic order to pythia 8.205, mtMC differs from the pole mass by 900 and 600 MeV, respectively, and agrees with the MSR mass within uncertainties, mtMC≃mt,1 GeV MSR .

Genetics Home Reference: McLeod neuroacanthocytosis syndrome

MedlinePlus

... W, Watt JM, Corbett AJ, Hamdalla HH, Marshall AG, Sutton I, Dotti MT, Malandrini A, Walker RH, ... qualified healthcare professional . About Selection Criteria for Links Data Files & API Site Map Subscribe Customer Support USA. ...

Genetics Home Reference: essential pentosuria

MedlinePlus

... MacCoss MJ, Levy-Lahad E, King MC, Motulsky AG. Garrod's fourth inborn error of metabolism solved by ... qualified healthcare professional . About Selection Criteria for Links Data Files & API Site Map Subscribe Customer Support USA. ...

Genetics Home Reference: cone-rod dystrophy

MedlinePlus

... Citation on PubMed Sergouniotis PI, McKibbin M, Robson AG, Bolz HJ, De Baere E, Müller PL, Heller ... qualified healthcare professional . About Selection Criteria for Links Data Files & API Site Map Subscribe Customer Support USA. ...

Genetics Home Reference: scalp-ear-nipple syndrome

MedlinePlus

... ear nipple syndrome Sources for This Page Marneros AG, Beck AE, Turner EH, McMillin MJ, Edwards MJ, ... qualified healthcare professional . About Selection Criteria for Links Data Files & API Site Map Subscribe Customer Support USA. ...

Genetics Home Reference: leptin receptor deficiency

MedlinePlus

... Ferraz-Amaro I, Dattani MT, Ercan O, Myhre AG, Retterstol L, Stanhope R, Edge JA, McKenzie S, Lessan ... qualified healthcare professional . About Selection Criteria for Links Data Files & API Site Map Subscribe Customer Support USA. ...

Calibration of the Top-Quark Monte Carlo Mass.

PubMed

Kieseler, Jan; Lipka, Katerina; Moch, Sven-Olaf

2016-04-22

We present a method to establish, experimentally, the relation between the top-quark mass m_{t}^{MC} as implemented in Monte Carlo generators and the Lagrangian mass parameter m_{t} in a theoretically well-defined renormalization scheme. We propose a simultaneous fit of m_{t}^{MC} and an observable sensitive to m_{t}, which does not rely on any prior assumptions about the relation between m_{t} and m_{t}^{MC}. The measured observable is independent of m_{t}^{MC} and can be used subsequently for a determination of m_{t}. The analysis strategy is illustrated with examples for the extraction of m_{t} from inclusive and differential cross sections for hadroproduction of top quarks.

A Correlational Study of How Airline Customer Service and Consumer Perception of Airline Customer Service Affect the Air Rage Phenomenon

NASA Technical Reports Server (NTRS)

Hunter, Joyce A.

2007-01-01

Between 1995 and 2000, customer service declined throughout the airline industry, as reported in February 2001 by the U.S. Department of Transportation (2001). One of the biggest problems today within the airline industry is the constant complaining from customers regarding the deterioraton of service (McCollough, Berry, & Yadav, 2000). Since 1995, unfortunately no airline has been immune from service deterioration, as reported by the Airline Quality Rating, an annual report by two airline industry experts who analyzed Department of Transportation statistics (Harrison & Kleinsasser, 1999). The airline' refusal to recognize the issue of customer service has perpetuated an environment that has become dangerous and detrimental to the traveling public as well as to airline employees, which in turn has fueled a new phenomenon, now referred to as "air rage".

E = Mc(super 2) for the Chemist: When is Mass Conserved?

ERIC Educational Resources Information Center

Treptow. Richard S.

2005-01-01

An equation derived by Albert Einstein in 1905 that expresses a relationship between mass and energy, formulated as E = mc(super 2) is discussed with reference to the extent mass is conserved. This query can be used to challenge students and develop their language and critical thinking skills.

Enhancing Critical Thinking Through Creation of Learning Organizations Within the Confines of an Overarching Mechanistic Organization

DTIC Science & Technology

2015-04-30

procedures to retain control over strategic decisions (Hatch & Cunliffe, 2013). Large U.S. corporations such as McDonalds, with its 33,000 restaurants and...1.7 million workers across 119 nations, understand that their 68 million customers per day are demanding changes that their famously consistent and...providing business units greater flexibility and autonomy to meet local customer demands (Hatch & Cunliffe, 2013). So why not build a layered system of

Applying Mass Customization Concepts to Core Courses: Increasing Student-Centered Customization and Enabling Cross-Functional Integration

ERIC Educational Resources Information Center

Wilson, Darryl D.

2011-01-01

This conceptual paper suggests a methodology for increasing student satisfaction in core courses by applying the principle of mass customization to increase student satisfaction. It proposes that customization can be increased by increasing course flexibility along three dimensions: content flexibility, schedule flexibility, and course length…

Segment-based Mass Customization: An Exploration of a New Conceptual Marketing Framework.

ERIC Educational Resources Information Center

Jiang, Pingjun

2000-01-01

Suggests that the concept of mass customization should be seen as an integral part of market segmentation theory which offers the best way to satisfy consumers' unique needs and wants while yielding profits to companies. Proposes a new concept of "segment-based based mass customization," and offers a series of propositions which are…

The service-driven service company.

PubMed

Schlesinger, L A; Heskett, J L

1991-01-01

For more than 40 years, service companies like McDonald's prospered with organizations designed according to the principles of traditional mass-production manufacturing. Today that model is obsolete. It inevitably degrades the quality of service a company can provide by setting in motion a cycle of failure that produces dissatisfied customers, unhappy employees, high turnover among both--and so lower profits and lower productivity overall. The cycle starts with human resource policies that minimize the contributions frontline workers can make: jobs are designed to be idiot-proof. Technology is used largely for monitoring and control. Pay is poor. Training is minimal. Performance expectations are abysmally low. Today companies like Taco Bell, Dayton Hudson, and ServiceMaster are reversing the cycle of failure by putting workers with customer contact first and designing the business system around them. As a result, they are developing a model that replaces the logic of industrialization with a new service-driven logic. This logic: Values investments in people as much as investments in technology--and sometimes more. Uses technology to support the efforts of workers on the front lines, not just to monitor or replace them. Makes recruitment and training crucial for everyone. Links compensation to performance for employees at every level. To justify these investments, the new logic draws on innovative data such as the incremental profits of loyal customers and the total costs of lost employees. Its benefits are becoming clear in higher profits and higher pay--results that competitors bound to the old industrial model will not be able to match.

Benefits of mass customized products: moderating role of product involvement and fashion innovativeness.

PubMed

Park, Minjung; Yoo, Jungmin

2018-02-01

The objective of this study was to explore impacts and benefits of mass customized products on emotional product attachment, favorable attitudes toward a mass customization program, and the ongoing effect on loyalty intentions. This study further investigated how benefits, attachment, attitudes, and loyalty intentions differed as a function of involvement and fashion innovativeness. 290 female online shoppers in South Korea participated in an online survey. Results of this study revealed that perceived benefits positively influenced emotional product attachment and attitudes toward a mass customization program. In addition, attachment positively influenced attitudes, which in turn affected loyalty intentions. This study also found that benefits, attachment, attitudes, and loyalty intentions were all higher in highly involved consumers (high fashion innovators) than those in less involved consumers (low fashion innovators). This study concludes with theoretical and practical implications for mass customization programs.

Genetics Home Reference: alveolar capillary dysplasia with misalignment of pulmonary veins

MedlinePlus

... K, Schultz R, Hallam L, McRae D, Nicholson AG, Newbury R, Durham-O'Donnell J, Knight G, ... qualified healthcare professional . About Selection Criteria for Links Data Files & API Site Map Subscribe Customer Support USA. ...

Bioacumulation of cyanotoxins in Hypophthalmichthys molitrix (silver carp) in Paranoá Lake, Brasilia-DF, Brazil.

PubMed

Oliveira, N B; Schwartz, C A; Bloch, C; Paulino, L; Pires, O R

2013-03-01

Three individuals of silver carp (Hypophthalmichthys molitrix) were collected biweekly from Paranoá Lake (DF, Brazil) for analysis of microcystin (MC) concentrations in their muscle and liver tissue. Analysis by high performance liquid chromatography and mass spectrometry revealed MC masses and fragmentation patterns that were identified as MC-LR (995.04 m/z), MC-LA (909.01 m/z) and an unknown MC (987.07 m/z). Concentrations were calculated as MC-LR equivalents using a calibration curve prepared with a standard of MC-LR. May/06 was the month with the highest MC-LR equivalent concentrations in muscle and liver (3.83 ± 2.78, and 12.94 ± 10.51 μg g(-1), respectively). Our results show that during the drought months (April-September), consumption of fish with these MC concentrations would result in exposure to MCs that greatly exceed the World Health Organization's recommended tolerable daily intake limit of 0.04 μg MC kg(-1) body weight.

An in-depth evaluation of accuracy and precision in Hg isotopic analysis via pneumatic nebulization and cold vapor generation multi-collector ICP-mass spectrometry.

PubMed

Rua-Ibarz, Ana; Bolea-Fernandez, Eduardo; Vanhaecke, Frank

2016-01-01

Mercury (Hg) isotopic analysis via multi-collector inductively coupled plasma (ICP)-mass spectrometry (MC-ICP-MS) can provide relevant biogeochemical information by revealing sources, pathways, and sinks of this highly toxic metal. In this work, the capabilities and limitations of two different sample introduction systems, based on pneumatic nebulization (PN) and cold vapor generation (CVG), respectively, were evaluated in the context of Hg isotopic analysis via MC-ICP-MS. The effect of (i) instrument settings and acquisition parameters, (ii) concentration of analyte element (Hg), and internal standard (Tl)-used for mass discrimination correction purposes-and (iii) different mass bias correction approaches on the accuracy and precision of Hg isotope ratio results was evaluated. The extent and stability of mass bias were assessed in a long-term study (18 months, n = 250), demonstrating a precision ≤0.006% relative standard deviation (RSD). CVG-MC-ICP-MS showed an approximately 20-fold enhancement in Hg signal intensity compared with PN-MC-ICP-MS. For CVG-MC-ICP-MS, the mass bias induced by instrumental mass discrimination was accurately corrected for by using either external correction in a sample-standard bracketing approach (SSB) or double correction, consisting of the use of Tl as internal standard in a revised version of the Russell law (Baxter approach), followed by SSB. Concomitant matrix elements did not affect CVG-ICP-MS results. Neither with PN, nor with CVG, any evidence for mass-independent discrimination effects in the instrument was observed within the experimental precision obtained. CVG-MC-ICP-MS was finally used for Hg isotopic analysis of reference materials (RMs) of relevant environmental origin. The isotopic composition of Hg in RMs of marine biological origin testified of mass-independent fractionation that affected the odd-numbered Hg isotopes. While older RMs were used for validation purposes, novel Hg isotopic data are provided for the latest generations of some biological RMs.

Accurate and precise determination of isotopic ratios by MC-ICP-MS: a review.

PubMed

Yang, Lu

2009-01-01

For many decades the accurate and precise determination of isotope ratios has remained a very strong interest to many researchers due to its important applications in earth, environmental, biological, archeological, and medical sciences. Traditionally, thermal ionization mass spectrometry (TIMS) has been the technique of choice for achieving the highest accuracy and precision. However, recent developments in multi-collector inductively coupled plasma mass spectrometry (MC-ICP-MS) have brought a new dimension to this field. In addition to its simple and robust sample introduction, high sample throughput, and high mass resolution, the flat-topped peaks generated by this technique provide for accurate and precise determination of isotope ratios with precision reaching 0.001%, comparable to that achieved with TIMS. These features, in combination with the ability of the ICP source to ionize nearly all elements in the periodic table, have resulted in an increased use of MC-ICP-MS for such measurements in various sample matrices. To determine accurate and precise isotope ratios with MC-ICP-MS, utmost care must be exercised during sample preparation, optimization of the instrument, and mass bias corrections. Unfortunately, there are inconsistencies and errors evident in many MC-ICP-MS publications, including errors in mass bias correction models. This review examines "state-of-the-art" methodologies presented in the literature for achievement of precise and accurate determinations of isotope ratios by MC-ICP-MS. Some general rules for such accurate and precise measurements are suggested, and calculations of combined uncertainty of the data using a few common mass bias correction models are outlined.

Southwestern Power Administration Update, October- December 2004

DOE Office of Scientific and Technical Information (OSTI.GOV)

None

2004-12-01

On October 29, 2004, Southwestern and Southwest Power Pool, Inc. (SPP) reached agreement on interim arrangements to be implemented after the October 31, 2004, expiration of the membership agreement between the two parties. According to Jim McDonald, Director of Southwestern’s Division of Customer Service, the interim agreement forged between Southwestern and SPP seeks to minimize impacts to SPP as well as to Southwestern and its customers while Southwestern and SPP work on a seams/coordination agreement to succeed the expired membership agreement.

Structural Characterization and Absolute Quantification of Microcystin Peptides Using Collision-Induced and Ultraviolet Photo-Dissociation Tandem Mass Spectrometry

NASA Astrophysics Data System (ADS)

Attard, Troy J.; Carter, Melissa D.; Fang, Mengxuan; Johnson, Rudolph C.; Reid, Gavin E.

2018-05-01

Microcystin (MC) peptides produced by cyanobacteria pose a hepatotoxic threat to human health upon ingestion from contaminated drinking water. While rapid MC identification and quantification in contaminated body fluids or tissue samples is important for patient treatment and outcomes, conventional immunoassay-based measurement strategies typically lack the specificity required for unambiguous determination of specific MC variants, whose toxicity can significantly vary depending on their structures. Furthermore, the unambiguous identification and accurate quantitation of MC variants using tandem mass spectrometry (MS/MS)-based methods can be limited due to a current lack of appropriate stable isotope-labeled internal standards. To address these limitations, we have systematically examined here the sequence and charge state dependence to the formation and absolute abundance of both "global" and "variant-specific" product ions from representative MC-LR, MC-YR, MC-RR, and MC-LA peptides, using higher-energy collisional dissociation (HCD)-MS/MS, ion-trap collision-induced dissociation (CID)-MS/MS and CID-MS3, and 193 nm ultraviolet photodissociation (UPVD)-MS/MS. HCD-MS/MS was found to provide the greatest detection sensitivity for both global and variant-specific product ions in each of the MC variants, except for MC-YR where a variant-specific product uniquely formed via UPVD-MS/MS was observed with the greatest absolute abundance. A simple methodology for the preparation and characterization of 18O-stable isotope-labeled MC reference materials for use as internal standards was also developed. Finally, we have demonstrated the applicability of the methods developed herein for absolute quantification of MC-LR present in human urine samples, using capillary scale liquid chromatography coupled with ultra-high resolution / accurate mass spectrometry and HCD-MS/MS.

The Sixth Great Mass Extinction

ERIC Educational Resources Information Center

Wagler, Ron

2012-01-01

Five past great mass extinctions have occurred during Earth's history. Humanity is currently in the midst of a sixth, human-induced great mass extinction of plant and animal life (e.g., Alroy 2008; Jackson 2008; Lewis 2006; McDaniel and Borton 2002; Rockstrom et al. 2009; Rohr et al. 2008; Steffen, Crutzen, and McNeill 2007; Thomas et al. 2004;…

Quantum algorithm for association rules mining

NASA Astrophysics Data System (ADS)

Yu, Chao-Hua; Gao, Fei; Wang, Qing-Le; Wen, Qiao-Yan

2016-10-01

Association rules mining (ARM) is one of the most important problems in knowledge discovery and data mining. Given a transaction database that has a large number of transactions and items, the task of ARM is to acquire consumption habits of customers by discovering the relationships between itemsets (sets of items). In this paper, we address ARM in the quantum settings and propose a quantum algorithm for the key part of ARM, finding frequent itemsets from the candidate itemsets and acquiring their supports. Specifically, for the case in which there are Mf(k ) frequent k -itemsets in the Mc(k ) candidate k -itemsets (Mf(k )≤Mc(k ) ), our algorithm can efficiently mine these frequent k -itemsets and estimate their supports by using parallel amplitude estimation and amplitude amplification with complexity O (k/√{Mc(k )Mf(k ) } ɛ ) , where ɛ is the error for estimating the supports. Compared with the classical counterpart, i.e., the classical sampling-based algorithm, whose complexity is O (k/Mc(k ) ɛ2) , our quantum algorithm quadratically improves the dependence on both ɛ and Mc(k ) in the best case when Mf(k )≪Mc(k ) and on ɛ alone in the worst case when Mf(k )≈Mc(k ) .

Three-dimensional body scanning system for apparel mass-customization

NASA Astrophysics Data System (ADS)

Xu, Bugao; Huang, Yaxiong; Yu, Weiping; Chen, Tong

2002-07-01

Mass customization is a new manufacturing trend in which mass-market products (e.g., apparel) are quickly modified one at a time based on customers' needs. It is an effective competing strategy for maximizing customers' satisfaction and minimizing inventory costs. An automatic body measurement system is essential for apparel mass customization. This paper introduces the development of a body scanning system, body size extraction methods, and body modeling algorithms. The scanning system utilizes the multiline triangulation technique to rapidly acquire surface data on a body, and provides accurate body measurements, many of which are not available with conventional methods. Cubic B-spline curves are used to connect and smooth body curves. From the scanned data, a body form can be constructed using linear Coons surfaces. The body form can be used as a digital model of the body for 3-D garment design and for virtual try-on of a designed garment. This scanning system and its application software enable apparel manufacturers to provide custom design services to consumers seeking personal-fit garments.

Purification and characterization of enterocin MC13 produced by a potential aquaculture probiont Enterococcus faecium MC13 isolated from the gut of Mugil cephalus.

PubMed

Satish Kumar, R; Kanmani, P; Yuvaraj, N; Paari, K A; Pattukumar, V; Arul, V

2011-12-01

A bacteriocin producer strain MC13 was isolated from the gut of Mugil cephalus (grey mullet) and identified as Enterococcus faecium. The bacteriocin of E. faecium MC13 was purified to homogeneity, as confirmed by Tricine sodium dodecyl sulphate - polyacrylamide gel electrophoresis (SDS-PAGE). Reverse-phase high-performance liquid chromatography (HPLC) analysis showed a single active fraction eluted at 26 min, and matrix-assisted laser desorption ionization time of flight (MALDI-TOF) mass spectrometry analysis showed the molecular mass to be 2.148 kDa. The clear zone in native PAGE corresponding to enterocin MC13 band further substantiated its molecular mass. A dialyzed sample (semicrude preparation) of enterocin MC13 was broad spectrum in its action and inhibited important seafood-borne pathogens: Listeria monocytogenes , Vibrio parahaemolyticus, and Vibrio vulnificus. This antibacterial substance was sensitive to proteolytic enzymes: trypsin, protease, and chymotrypsin but insensitive to catalase and lipase, confirming that inhibition was due to the proteinaceous molecule, i.e., bacteriocin, and not due to hydrogen peroxide. Enterocin MC13 tolerated heat treatment (up to 90 °C for 20 min). Enterococcus faecium MC13 was effective in bile salt tolerance, acid tolerance, and adhesion to the HT-29 cell line. These properties reveal the potential of E. faecium MC13 to be a probiotic bacterium. Enterococcus faecium MC13 could be used as potential fish probiotic against pathogens such as V. parahaemolyticus, Vibrio harveyi, and Aeromonas hydrophila in fisheries. Also, this could be a valuable seafood biopreservative against L. monocytogenes.

The four faces of mass customization.

PubMed

Gilmore, J H; Pine, B J

1997-01-01

Virtually all executives today recognize the need to provide outstanding service to customers. Focusing on the customer, however, is both an imperative and a potential curse. In their desire to become customer driven, many companies have resorted to inventing new programs and procedures to meet every customer's request. But as customers and their needs grow increasingly diverse, such an approach has become a surefire way to add unnecessary cost and complexity to operations. Companies around the world have embraced mass customization in an attempt to avoid those pitfalls. Readily available information technology and flexible work processes permit them to customize goods or services for individual customers in high volumes at low cost. But many managers have discovered that mass customization itself can produce unnecessary cost and complexity. They are realizing that they did not examine thoroughly enough what kind of customization their customers would value before they plunged ahead. That is understandable. Until now, no framework has existed to help managers determine the type of customization they should pursue. James Gilmore and Joseph Pine provide managers with just such a framework. They have identified four distinct approaches to customization. When designing or redesigning a product, process, or business unit, managers should examine each approach for possible insights into how to serve their customers best. In some cases, a single approach will dominate the design. More often, however, managers will need a mix of some or all of the four approaches to serve their own particular set of customers.

Comparison of Microcystis aeruginosa (PCC7820 and PCC7806) growth and intracellular microcystins content determined by liquid chromatography-mass spectrometry, enzyme-linked immunosorbent assay anti-Adda and phosphatase bioassay.

PubMed

Ríos, V; Moreno, I; Prieto, A I; Soria-Díaz, M E; Frías, J E; Cameán, A M

2014-03-01

Cyanobacteria are able to produce several metabolites that have toxic effects on humans and animals. Among these cyanotoxins, the hepatotoxic microcystins (MC) occur frequently. The intracellular MC content produced by two strains of Microcystis aeruginosa, PCC7806 and PCC7820, and its production kinetics during the culture time were studied in order to elucidate the conditions that favour the growth and proliferation of these toxic strains. Intracellular MC concentrations measured by liquid chromatography (LC) coupled to electrospray ionization mass spectrometer (MS) were compared with those obtained by enzyme-linked immunosorbent assay (ELISA) anti-Adda and protein phosphatase 2A (PP2A) inhibition assays. It has been demonstrated there are discrepancies in the quantification of MC content when comparing ELISA and LC-MS results. However, a good correlation has been obtained between PP2A inhibition assay and LC-MS. Three MC were identified using LC-MS in the PCC7806 strain: MC-LR, demethylated MC-LR and a new variant detected for the first time in this strain, [L-MeSer(7)] MC-LR. In PCC7820, MC-LR, D-Asp(3)-MCLR, Dglu(OCH3)-MCLR, MC-LY, MC-LW and MC-LF were identificated. The major one was MC-LR in both strains, representing 81 and 79% of total MC, respectively. The total MC content in M. aeruginosa PCC7820 was almost three-fold higher than in PCC7806 extracts.

Influence of Geometry on a High Surface Area-Solid Phase Microextraction Sampler for Chemical Vapor Collection

DTIC Science & Technology

2007-06-04

LCDR Greg Cook , PhD Date...Science Research Unit • Dr. Robert Mustacich of RVM Scientific • My thesis advisory committee: LtCol Peter LaPuma, LCDR Greg Cook , and Dr. Brian...which constitutes a mass spectrum. A computer compares the mass spectrum to a mass spectral library like a fingerprint. (McMaster and McMaster, 1997

Strategic Supply

DTIC Science & Technology

2003-01-01

online, www.customs.ustreas.gov/xp/cgov/import/commercial_enforcement/ ctpat /fact_sheet.xm, March 24, 2003. [42] John M. Patterson, “Supply Chain... ctpat /fast/fast_info, March 24, 2003. [45] Our concept of the maturity scale is borrowed from Kevin P. McCormack and Wiliam C. Johnson, “Supply

Body mass index, perceived and actual physical competence: the relationship among young children.

PubMed

Spessato, B C; Gabbard, C; Robinson, L; Valentini, N C

2013-11-01

The purpose of this study was to examine the relationship between perceived physical competence (PPC), actual motor competence (MC) and body mass index (BMI) in young children. We assessed MC (Test of Gross Motor Development - 2nd Edition), PPC (Pictorial Scale of Perceived Competence and Social Acceptance) and BMI (CDC calculator) of 178 young children ages 4-7 years. The linear regression model for the overall sample showed that BMI was a better predictor of PPC than MC. Also, obese children had lower PPC, but showed no differences in MC compared with leaner peers. PPC of young obese children was lower than their leaner counterparts, yet their MC was similar. That outcome draws attention to the importance of promoting positive PPC in young children. © 2012 John Wiley & Sons Ltd.

B2C Mass Customization in the Classroom

ERIC Educational Resources Information Center

Visich, John K.; Gu, Qiannong; Khumawala, Basheer M.

2012-01-01

The purpose of this article is to describe an internet-based mass customization assignment in Operations Management/Supply Chain Management classes where students utilize the Web site of a company that offers a customized product. Students evaluate the user interface, judge the value proposition of the product they demonstrate, and discuss issues…

McIDAS-V: Data Analysis and Visualization for NPOESS and GOES-R

NASA Astrophysics Data System (ADS)

Rink, T.; Achtor, T. H.

2009-12-01

McIDAS-V, the next-generation McIDAS, is being built on top a modern, cross-platform software framework which supports development of 4-D, interactive displays and integration of wide-array of geophysical data. As the replacement of McIDAS, the development emphasis is on future satellite observation platforms such as NPOESS and GOES-R. Data interrogation, analysis and visualization capabilities have been developed for multi- and hyper-spectral instruments like MODIS, AIRS and IASI, and are being extended for application to VIIRS and CrIS. Compatibility with GOES-R ABI level1 and level2 product storage formats has been demonstrated. The abstract data model, which can internalize most any geophysical data, opens up new possibilities for data fusion techniques, for example, polar and geostationary, (LEO/GEO), synergy for research and validation. McIDAS-V follows an object-oriented design model, using the Java programming language, allowing specialized extensions for for new sources of data, and novel displays and interactive behavior. The reference application, what the user sees on startup, can be customized, and the system has a persistence mechanism allowing sharing of the application state across the internet. McIDAS-V is open-source, and free to the public.

Quantification of Global DNA Methylation Levels by Mass Spectrometry.

PubMed

Fernandez, Agustin F; Valledor, Luis; Vallejo, Fernando; Cañal, Maria Jesús; Fraga, Mario F

2018-01-01

Global DNA methylation was classically considered the relative percentage of 5-methylcysine (5mC) with respect to total cytosine (C). Early approaches were based on the use of high-performance separation technologies and UV detection. However, the recent development of protocols using mass spectrometry for the detection has increased sensibility and permitted the precise identification of peak compounds based on their molecular masses. This allows work to be conducted with much less genomic DNA starting material and also to quantify 5-hydroxymethyl-cytosine (5hmC), a recently identified form of methylated cytosine that could play an important role in active DNA demethylation. Here, we describe the protocol that we currently use in our laboratory to analyze 5mC and 5hmC by mass spectrometry. The protocol, which is based on the method originally developed by Le and colleagues using Ultra Performance Liquid Chromatography (UPLC) and mass spectrometry (triple Quadrupole (QqQ)) detection, allows for the rapid and accurate quantification of relative global 5mC and 5hmC levels starting from just 1 μg of genomic DNA, which allows for the rapid and accurate quantification of relative global 5mC and 5hmC levels.

77 FR 64567 - Product List Change

Federal Register 2010, 2011, 2012, 2013, 2014

2012-10-22

... Delivery service from the competitive product list due to low customer demand.\\2\\ It states that there are... POSTAL REGULATORY COMMISSION [Docket No. MC2013-3; Order No. 1503] Product List Change AGENCY... product list. This notice provides public notice of the Postal Service's filing, invites public comment...

Skeletal Maturation, Body Size, and Motor Coordination in Youth 11-14 Years.

PubMed

Freitas, Duarte Luís; Lausen, Berthold; Maia, José Antonio Ribeiro; Gouveia, Élvio Rúbio; Thomis, Martine; Lefevre, Johan; Silva, Ricardo Dinis; Malina, Robert M

2016-06-01

The objective of this study is to estimate the relative contribution of biological maturation to variance in the motor coordination (MC) among youth and to explore gender differences in the associations. Skeletal maturation (Tanner-Whitehouse 3), stature, body mass, and MC (Körperkoordinationstest für Kinder) were assessed in 613 youths, 284 boys and 329 girls 11-14 yr of age. Standardized residuals of skeletal age on chronological age were used as the estimate of skeletal maturity status independent of chronological age. Hierarchical multiple regression analyses were used to analyse associations between skeletal maturity status and MC. Skeletal maturity status by itself, i.e., standardized residuals of skeletal age on chronological age (step 3) explained a maximum of 8.1% of the variance in MC in boys (ΔR3 in the range of 0.0%-8.1%) and 2.8% of the variance in girls (ΔR3 in the range of 0.0%-2.8%), after controlling for stature, body mass and interactions of the standardized residuals of skeletal age on chronological age with stature and body mass. Corresponding percentages for the interactions of the standardized residuals of skeletal age and stature and body mass, after adjusting for stature and body mass (step 2) were 8.7% in boys (ΔR2 in the range of 0.3%-8.7%) and 7.1% in girls (ΔR2 in the range of 0.1%-7.1%). Chow tests suggested structural changes in β-coefficients in the four MC tests among boys and girls, 12-13 yr. The percentage of variance in the four MC tests explained by skeletal maturation was relatively small, but the relationships differed between boys and girls. By inference, other factors, e.g., neuromuscular maturation, specific instruction and practice, sport participation, and others may influence MC at these ages.

Mass Customization in Schools: Strategies Dutch Secondary Schools Pursue to Cope with the Diversity-Efficiency Dilemma

ERIC Educational Resources Information Center

Waslander, Sietske

2007-01-01

Faced with the diversity-efficiency dilemma, private companies apply "mass customization" strategies to add diversity without adding costs. As schools are urged to become more "customer oriented" they also face a diversity-efficiency dilemma. This article asks how Dutch secondary schools cope with this dilemma and to what…

Emissions from Forest Fires near Mexico City

NASA Technical Reports Server (NTRS)

Yokelson, R.; Urbanski, S.; Atlas, E.; Toohey, D.; Alvarado, E.; Crounse, J.; Wennberg, P.; Fisher, M.; Wold, C.; Campos, T.;

Planetary data analysis and display system: A version of PC-McIDAS

NASA Technical Reports Server (NTRS)

Limaye, Sanjay S.; Sromovsky, L. A.; Saunders, R. S.; Martin, Michael

1993-01-01

We propose to develop a system for access and analysis of planetary data from past and future space missions based on an existing system, the PC-McIDAS workstation. This system is now in use in the atmospheric science community for access to meteorological satellite and conventional weather data. The proposed system would be usable not only by planetary atmospheric researchers but also by the planetary geologic community. By providing the critical tools of an efficient system architecture, newer applications and customized user interfaces can be added by the end user within such a system.

Validation of the determination of the B isotopic composition in Roman glasses with laser ablation multi-collector inductively coupled plasma-mass spectrometry

NASA Astrophysics Data System (ADS)

Devulder, Veerle; Gerdes, Axel; Vanhaecke, Frank; Degryse, Patrick

2015-03-01

The applicability of laser ablation multi-collector inductively coupled plasma-mass spectrometry (LA-MC-ICP-MS) for the determination of the B isotopic composition in Roman glasses was investigated. The δ11B values thus obtained provide information on the natron flux used during the glass-making process. The glass samples used for this purpose were previously characterized using pneumatic nebulization (PN) MC-ICP-MS. Unfortunately, this method is time-consuming and labor-intensive and consumes some 100 mg of sample, which is a rather high amount for ancient materials. Therefore, the use of the less invasive and faster LA-MC-ICP-MS approach was explored. In this work, the results for 29 Roman glasses and 4 home-made glasses obtained using both techniques were compared to assess the suitability of LA-MC-ICP-MS in this context. The results are in excellent agreement within experimental uncertainty. No difference in overall mass discrimination was observed between the Roman glasses, NIST SRM 610 reference glass and B6 obsidian. The expanded uncertainty of the LA-MC-ICP-MS approach was estimated to be < 2‰, which is similar to that obtained upon sample digestion and PN-MC-ICP-MS measurement.

Exercise training improves heart rate variability after methamphetamine dependency.

PubMed

Dolezal, Brett Andrew; Chudzynski, Joy; Dickerson, Daniel; Mooney, Larissa; Rawson, Richard A; Garfinkel, Alan; Cooper, Christopher B

2014-06-01

Heart rate variability (HRV) reflects a healthy autonomic nervous system and is increased with physical training. Methamphetamine dependence (MD) causes autonomic dysfunction and diminished HRV. We compared recently abstinent methamphetamine-dependent participants with age-matched, drug-free controls (DF) and also investigated whether HRV can be improved with exercise training in the methamphetamine-dependent participants. In 50 participants (MD = 28; DF = 22), resting heart rate (HR; R-R intervals) was recorded over 5 min while seated using a monitor affixed to a chest strap. Previously reported time domain (SDNN, RMSSD, pNN50) and frequency domain (LFnu, HFnu, LF/HF) parameters of HRV were calculated with customized software. MD were randomized to thrice-weekly exercise training (ME = 14) or equal attention without training (MC = 14) over 8 wk. Groups were compared using paired and unpaired t-tests. Statistical significance was set at P ≤ 0.05. Participant characteristics were matched between groups (mean ± SD): age = 33 ± 6 yr; body mass = 82.7 ± 12 kg, body mass index = 26.8 ± 4.1 kg·min. Compared with DF, the MD group had significantly higher resting HR (P < 0.05), LFnu, and LF/HF (P < 0.001) as well as lower SDNN, RMSSD, pNN50, and HFnu (all P < 0.001). At randomization, HRV indices were similar between ME and MC groups. However, after training, the ME group significantly (all P < 0.001) increased SDNN (+14.7 ± 2.0 ms, +34%), RMSSD (+19.6 ± 4.2 ms, +63%), pNN50 (+22.6% ± 2.7%, +173%), HFnu (+14.2 ± 1.9, +60%), and decreased HR (-5.2 ± 1.1 bpm, -7%), LFnu (-9.6 ± 1.5, -16%), and LF/HF (-0.7 ± 0.3, -19%). These measures did not change from baseline in the MC group. HRV, based on several conventional indices, was diminished in recently abstinent, methamphetamine-dependent individuals. Moreover, physical training yielded a marked increase in HRV, representing increased vagal modulation or improved autonomic balance.

Give Everyone a Vested Interest in Food Service.

ERIC Educational Resources Information Center

Watkins, Shirley Maree

1987-01-01

Describes the school food service industry, providing 27 million meals daily in 89,000 schools, as second only to McDonald's in size. Offers advice for developing a superior, cooperative business venture. Focus must be on visible managers, high quality staff, clearly communicated objectives, and customer satisfaction. (MLH)

Methods for Tier 2 Modeling Within the Training Range Environmental Evaluation and Characterization System

DTIC Science & Technology

2011-03-01

acre-yr, compared with 54 tons/acre-yr as computed with the Universal Soil Loss Equation ( USLE ). Thus, it appears that the Einstein and Brown equations... USLE that is already needed for soil erosion that exports aqueous phase (adsorbed and dissolved) MC. This will mean that solid phase MC will not affect...phase MC mass to soil mass b = soil dry bulk density, g/m3 A = AOI site area, m2 E = soil erosion rate as determined from the USLE , m/yr It is

The statistical challenge of constraining the low-mass IMF in Local Group dwarf galaxies

NASA Astrophysics Data System (ADS)

El-Badry, Kareem; Weisz, Daniel R.; Quataert, Eliot

2017-06-01

We use Monte Carlo simulations to explore the statistical challenges of constraining the characteristic mass (mc) and width (σ) of a lognormal sub-solar initial mass function (IMF) in Local Group dwarf galaxies using direct star counts. For a typical Milky Way (MW) satellite (MV = -8), jointly constraining mc and σ to a precision of ≲ 20 per cent requires that observations be complete to ≲ 0.2 M⊙, if the IMF is similar to the MW IMF. A similar statistical precision can be obtained if observations are only complete down to 0.4 M⊙, but this requires measurement of nearly 100× more stars, and thus, a significantly more massive satellite (MV ˜ -12). In the absence of sufficiently deep data to constrain the low-mass turnover, it is common practice to fit a single-sloped power law to the low-mass IMF, or to fit mc for a lognormal while holding σ fixed. We show that the former approximation leads to best-fitting power-law slopes that vary with the mass range observed and can largely explain existing claims of low-mass IMF variations in MW satellites, even if satellite galaxies have the same IMF as the MW. In addition, fixing σ during fitting leads to substantially underestimated uncertainties in the recovered value of mc (by a factor of ˜4 for typical observations). If the IMFs of nearby dwarf galaxies are lognormal and do vary, observations must reach down to ˜mc in order to robustly detect these variations. The high-sensitivity, near-infrared capabilities of the James Webb Space Telescope and Wide-Field Infrared Survey Telescope have the potential to dramatically improve constraints on the low-mass IMF. We present an efficient observational strategy for using these facilities to measure the IMFs of Local Group dwarf galaxies.

Teaching E=mc2: An Exploration of Some Issues.

ERIC Educational Resources Information Center

Baierlein, Ralph

1991-01-01

A discussion of what E=mc2 means and other issues associated with the equation are presented. The differences between matter, mass, and energy, a derivation of the equation, the history of the word mass and examples of how it is used, misconceptions surrounding the equation, and a discussion of uranium fission are included. (KR)

Superpartner mass measurement technique using 1D orthogonal decompositions of the Cambridge transverse mass variable M(T2).

PubMed

Konar, Partha; Kong, Kyoungchul; Matchev, Konstantin T; Park, Myeonghun

2010-07-30

We propose a new model-independent technique for mass measurements in missing energy events at hadron colliders. We illustrate our method with the most challenging case of a single-step decay chain. We consider inclusive same-sign chargino pair production in supersymmetry, followed by leptonic decays to sneutrinos χ+ χ+ → ℓ+ ℓ'+ ν(ℓ)ν(ℓ') and invisible decays ν(ℓ) → ν(ℓ) χ(1)(0). We introduce two one-dimensional decompositions of the Cambridge MT2 variable: M(T2∥) and M(T2⊥), on the direction of the upstream transverse momentum P→T and the direction orthogonal to it, respectively. We show that the sneutrino mass Mc can be measured directly by minimizing the number of events N(Mc) in which MT2 exceeds a certain threshold, conveniently measured from the end point M(T2⊥)(max) (Mc).

EPIEgram: The Educational Consumers' Newsletter. Volume 17, Numbers 1-9, 1990-1991.

ERIC Educational Resources Information Center

EPIEgram: The Educational Consumers' Newsletter, 1991

1991-01-01

The nine issues of EPIEgram in this collection provide information about educational materials, educational technology, and elementary and secondary educational concerns. The following articles are included: (1) Designer Texts--Macmillan-McGraw To Offer Custom School Books; (2) Children's Lit is Alive and Well; (3) Swear Words, Satanism, and Sex;…

Maternal Predictors of Preschool Child-Eating Behaviours, Food Intake and Body Mass Index: A Prospective Study

ERIC Educational Resources Information Center

McPhie, Skye; Skouteris, Helen; Fuller-Tyszkiewicz, Matthew; McCabe, Marita; Ricciardelli, Lina A.; Milgrom, Jeannette; Baur, Louise A.; Dell'Aquila, Daniela

2012-01-01

This study extends McPhie et al. (2011)'s [Maternal correlates of preschool child eating behaviours and body mass index: A cross-sectional study. "International Journal of Pediatric Obesity", Early Online, 1-5.] McPhie et al. (2011)'s cross-sectional research, by prospectively evaluating maternal child-feeding practices, parenting style and…

Simultaneous effect of initial moisture content and airflow rate on biodrying of sewage sludge.

PubMed

Huiliñir, Cesar; Villegas, Manuel

2015-10-01

The simultaneous effect of initial moisture content (initial Mc) and air-flow rate (AFR) on biodrying performance was evaluated. For the study, a 3(2) factorial design, whose factors were AFR (1, 2 and 3 L/min kg(TS)) and initial Mc (59, 68 and 78% w.b.), was used. Using energy and water mass balance the main routes of water removal, energy use and efficiencies were determined. The results show that initial Mc has a stronger effect on the biodrying than the AFR, affecting the air outlet temperature and improving the water removal, with higher maximum temperatures obtained around 68% and the lowest maximum matrix temperature obtained at initial Mc = 78%.Through the water mass balance it was found that the main mechanism for water removal was the aeration, with higher water removal at intermediate initial Mc (68%) and high AFR (3 L/min kg(TS)). The energy balance indicated that bioreaction is the main energy source for water evaporation, with higher energy produced at intermediate initial Mc (68%). Finally, it was found that low values of initial Mc (59%) improve biodrying efficiency. Copyright © 2015 Elsevier Ltd. All rights reserved.

[Research on structure of MC-nylon 6/aramid composites by spectroanalysis method].

PubMed

Wang, Can-Yao; Zheng, Yu-Ying

2008-01-01

The Kevlar fiber, treated with toluene-2,4-diisocyanate and caprolactam, was used to reinforce MC nylon 6. XPS showed the change in chemical components and spectra after fiber was treated. IR showed that the spectra of Kevlar fiber and MC-nylon 6 were incorporated purely when they were mixed, while the treated Kevlar fiber provided the activation in the ring-opening polymerization of caprolactam, and the amide groups of graft chains could form strong hydrogen bonds with matrix. These graft chains and hydrogen bonds would contribute to improving interfacial bonding between MC-nylon 6 and Kevlar fiber. XRD indicated that the induction of Kevlar fiber had no effect on the cryastalline style of MC-nylon 6 obviously, however, the crystals had better seasonal structure. The crystals of MC-nylon 6/Kevlar fiber composites were more perfect than that of MC-nylon 6/Kevlar untreated fiber composites with the same amount of Kevlar fiber. The increase of Kevlar fiber contributed to forming perfect a spherulite when the mass concentration of Kevlar fiber was less than 2%, however, the more the Kevlar fiber, the less the content of a spherulite when the mass concentration of Kevlar fiber was more than 2%.

Fermi gases with imaginary mass imbalance and the sign problem in Monte-Carlo calculations

NASA Astrophysics Data System (ADS)

Roscher, Dietrich; Braun, Jens; Chen, Jiunn-Wei; Drut, Joaquín E.

2014-05-01

Fermi gases in strongly coupled regimes are inherently challenging for many-body methods. Although progress has been made analytically, quantitative results require ab initio numerical approaches, such as Monte-Carlo (MC) calculations. However, mass-imbalanced and spin-imbalanced gases are not accessible to MC calculations due to the infamous sign problem. For finite spin imbalance, the problem can be circumvented using imaginary polarizations and analytic continuation, and large parts of the phase diagram then become accessible. We propose to apply this strategy to the mass-imbalanced case, which opens up the possibility to study the associated phase diagram with MC calculations. We perform a first mean-field analysis which suggests that zero-temperature studies, as well as detecting a potential (tri)critical point, are feasible.

Toward Mass Customization of Health Information

PubMed Central

de la Cruz, Norberto B.; Kahn, Charles E.

1999-01-01

As a part of its community outreach efforts, the Medical College of Wisconsin developed the “MCW HealthLink” health information resource. The philosophy, design and implementation of the site lend well to steering future developments towards mass customization of health information.

Mapping DNA adducts of mitomycin C and decarbamoyl mitomycin C in cell lines using liquid chromatography/electrospray tandem mass spectrometry

PubMed Central

Paz, Manuel M.; Ladwa, Sweta; Champeil, Elise; Liu, Yanfeng; Rockwell, Sara; Boamah, Ernest K.; Bargonetti, Jill; Callahan, John; Roach, John; Tomasz, Maria

2009-01-01

The antitumor antibiotic and cancer chemotherapeutic agent mitomycin C (MC) alkylates and cross-links DNA, forming six major MC-deoxyguanosine adducts of known structures in vitro and in vivo. Two of these adducts are derived from 2,7-diaminomitosene (2,7-DAM), a non-toxic reductive metabolite of MC formed in cells in situ. Several methods have been used for analysis of MC-DNA adducts in the past; however, a need exists for a safer, more comprehensive and direct assay of the six-adduct complex. Development of an assay, based on mass spectrometry is described. DNA from EMT6 mouse mammary tumor cells, Fanconi Anemia –A fibroblasts, normal human fibroblasts, and MCF-7 human breast cancer cells was isolated after MC or DMC treatment of the cells, digested to nucleosides and submitted to liquid chromatography electrospray-tandem mass spectrometry. Two fragments of each parent ion were monitored (“multiple reaction monitoring”; MRM). Identification and quantitative analysis was based on a standard mixture of six adducts, the preparation of which is described here in detail. The lower limit of detection of adducts is estimated as 0.25 picomol. Three initial applications of this method are reported: (i) differential kinetics of adduct repair in EMT6 cells; (ii) analysis of adducts in MC- or DMC-treated Fanconi Anemia cells; and (iii) comparison of the adducts generated by treatment of MCF-7 breast cancer cells with MC and DMC. Notable results are the following: repair removal of the DNA interstrand cross-link and of the two adducts of 2,7-DAM is relatively slow; both MC and DMC generate DNA interstrand cross-links in human fibroblasts, Fanconi Anemia-A fibroblasts and MCF-7 cells as well as EMT6 cells; DMC shows a stereochemical preference of linkage to the guanine-2-amino group opposite from that of MC. PMID:19053323

Mapping DNA adducts of mitomycin C and decarbamoyl mitomycin C in cell lines using liquid chromatography/ electrospray tandem mass spectrometry.

PubMed

Paz, Manuel M; Ladwa, Sweta; Champeil, Elise; Liu, Yanfeng; Rockwell, Sara; Boamah, Ernest K; Bargonetti, Jill; Callahan, John; Roach, John; Tomasz, Maria

2008-12-01

The antitumor antibiotic and cancer chemotherapeutic agent mitomycin C (MC) alkylates and crosslinks DNA, forming six major MC-deoxyguanosine adducts of known structures in vitro and in vivo. Two of these adducts are derived from 2,7-diaminomitosene (2,7-DAM), a nontoxic reductive metabolite of MC formed in cells in situ. Several methods have been used for the analysis of MC-DNA adducts in the past; however, a need exists for a safer, more comprehensive and direct assay of the six-adduct complex. Development of an assay, based on mass spectrometry, is described. DNA from EMT6 mouse mammary tumor cells, Fanconi Anemia-A fibroblasts, normal human fibroblasts, and MCF-7 human breast cancer cells was isolated after MC or 10-decarbamoyl mitomycin C (DMC) treatment of the cells, digested to nucleosides, and submitted to liquid chromatography electrospray-tandem mass spectrometry. Two fragments of each parent ion were monitored ("multiple reaction monitoring"). Identification and quantitative analysis were based on a standard mixture of six adducts, the preparation of which is described here in detail. The lower limit of detection of adducts is estimated as 0.25 pmol. Three initial applications of this method are reported as follows: (i) differential kinetics of adduct repair in EMT6 cells, (ii) analysis of adducts in MC- or DMC-treated Fanconi Anemia cells, and (iii) comparison of the adducts generated by treatment of MCF-7 breast cancer cells with MC and DMC. Notable results are the following: Repair removal of the DNA interstrand cross-link and of the two adducts of 2,7-DAM is relatively slow; both MC and DMC generate DNA interstrand cross-links in human fibroblasts, Fanconi Anemia-A fibroblasts, and MCF-7 cells as well as EMT6 cells; and DMC shows a stereochemical preference of linkage to the guanine-2-amino group opposite from that of MC.

The Mug:. on E = mc2 and Relativity Theory in the Mass Culture

NASA Astrophysics Data System (ADS)

Okun, L. B.

2013-11-01

This note is an attempt to explain in simple words why the famous relation E = mc2 misrepresents the essence of Einstein's relativity theory. The first part of the note is addressed to high-school teachers, the rest - to those university professors of Physics who allow themselves to say that the mass of a body increases with its velocity.

The Role of Motor Competence and Body Mass Index in Children's Activity Levels in Physical Education Classes

ERIC Educational Resources Information Center

Spessato, Barbara Coiro; Gabbard, Carl; Valentini, Nadia C.

2013-01-01

Our goal was to investigate the role of body mass index (BMI) and motor competence (MC) in children's physical activity (PA) levels during physical education (PE) classes. We assessed PA levels of 5-to-10-year old children ("n" = 264) with pedometers in four PE classes. MC was assessed using the TGMD-2 and BMI values were classified…

High-precision Ru isotopic measurements by multi-collector ICP-MS.

PubMed

Becker, Harry; Dalpe, Claude; Walker, Richard J

2002-06-01

Ruthenium isotopic data for a pure Aldrich ruthenium nitrate solution obtained using a Nu Plasma multi collector inductively coupled plasma-mass spectrometer (MC-ICP-MS) shows excellent agreement (better than 1 epsilon unit = 1 part in 10(4)) with data obtained by other techniques for the mass range between 96 and 101 amu. External precisions are at the 0.5-1.7 epsilon level (2sigma). Higher sensitivity for MC ICP-MS compared to negative thermal ionization mass spectrometry (N-TIMS) is offset by the uncertainties introduced by relatively large mass discrimination and instabilities in the plasma source-ion extraction region that affect the long-term reproducibility. Large mass bias correction in ICP mass spectrometry demands particular attention to be paid to the choice of normalizing isotopes. Because of its position in the mass spectrum and the large mass bias correction, obtaining precise and accurate abundance data for 104Ru by MC-ICP-MS remains difficult. Internal and external mass bias correction schemes in this mass range may show similar shortcomings if the isotope of interest does not lie within the mass range covered by the masses used for normalization. Analyses of meteorite samples show that if isobaric interferences from Mo are sufficiently large (Ru/Mo < 10(4)), uncertainties on the Mo interference correction propagate through the mass bias correction and yield inaccurate results for Ru isotopic compositions. Second-order linear corrections may be used to correct for these inaccuracies, but such results are generally less precise than N-TIMS data.

Optimization of GATE and PHITS Monte Carlo code parameters for uniform scanning proton beam based on simulation with FLUKA general-purpose code

NASA Astrophysics Data System (ADS)

Kurosu, Keita; Takashina, Masaaki; Koizumi, Masahiko; Das, Indra J.; Moskvin, Vadim P.

2014-10-01

Although three general-purpose Monte Carlo (MC) simulation tools: Geant4, FLUKA and PHITS have been used extensively, differences in calculation results have been reported. The major causes are the implementation of the physical model, preset value of the ionization potential or definition of the maximum step size. In order to achieve artifact free MC simulation, an optimized parameters list for each simulation system is required. Several authors have already proposed the optimized lists, but those studies were performed with a simple system such as only a water phantom. Since particle beams have a transport, interaction and electromagnetic processes during beam delivery, establishment of an optimized parameters-list for whole beam delivery system is therefore of major importance. The purpose of this study was to determine the optimized parameters list for GATE and PHITS using proton treatment nozzle computational model. The simulation was performed with the broad scanning proton beam. The influences of the customizing parameters on the percentage depth dose (PDD) profile and the proton range were investigated by comparison with the result of FLUKA, and then the optimal parameters were determined. The PDD profile and the proton range obtained from our optimized parameters list showed different characteristics from the results obtained with simple system. This led to the conclusion that the physical model, particle transport mechanics and different geometry-based descriptions need accurate customization in planning computational experiments for artifact-free MC simulation.

A Case Report of Partial Nephrectomy of Mucinous Cystadenocarcinoma in Kidney and Its Literature Review

PubMed Central

Kim, Sung Han; Yuk, Heong Dong; Park, Weon Seo; Kim, Sun Ho; Joung, Jae Young; Seo, Ho Kyung; Lee, Kang Hyun; Chung, Jinsoo

2016-01-01

Mucinous cystadenocarcinoma (MC) of the kidney is a rare epithelial tumor originating from the renal pelvic urothelium and few study cases have been reported. Because of the rarity of these tumors and their unknown histogenesis, its diagnosis is difficult until surgical exploration. We report here on a 55-year-old man referred to the urology department from the hepatology department because of a cystic renal mass measuring approximately 5 cm in size, which was detected incidentally under ultrasonography during the routine examination of liver. The renal mass was finally diagnosed as MC originating from kidney after partial nephrectomy and the patient still showed no evidence of recurrence until 12 months postoperatively. This is the first report on a case of renal MC in a patient who underwent partial nephrectomy. The aim of this report is to present our unusual case of MC and also review the previous literature on the pathological and radiological aspects of MC of kidney. PMID:25687861

Investigation of mass dependence effects for the accurate determination of molybdenum isotope amount ratios by MC-ICP-MS using synthetic isotope mixtures.

PubMed

Malinovsky, Dmitry; Dunn, Philip J H; Petrov, Panayot; Goenaga-Infante, Heidi

2015-01-01

Methodology for absolute Mo isotope amount ratio measurements by multicollector inductively coupled plasma-mass spectrometry (MC-ICP-MS) using calibration with synthetic isotope mixtures (SIMs) is presented. For the first time, synthetic isotope mixtures prepared from seven commercially available isotopically enriched molybdenum metal powders ((92)Mo, (94)Mo, (95)Mo, (96)Mo, (97)Mo, (98)Mo, and (100)Mo) are used to investigate whether instrumental mass discrimination of Mo isotopes in MC-ICP-MS is consistent with mass-dependent isotope distribution. The parent materials were dissolved and mixed as solutions to obtain mixtures with accurately known isotope amount ratios. The level of elemental impurities in the isotopically enriched molybdenum metal powders was quantified by ICP-MS by using both high-resolution and reaction cell instruments to completely resolve spectral interferences. The Mo isotope amount ratio values with expanded uncertainty (k = 2), determined by MC-ICP-MS for a high-purity Mo rod from Johnson Matthey, were as follows: (92)Mo/(95)Mo = 0.9235(9), (94)Mo/(95)Mo = 0.5785(8), (96)Mo/(95)Mo = 1.0503(9), (97)Mo/(95)Mo = 0.6033(6), (98)Mo/(95)Mo = 1.5291(20), and (100)Mo/(95)Mo = 0.6130(7). A full uncertainty budget for the measurements is presented which shows that the largest contribution to the uncertainty budget comes from correction for elemental impurities (∼51%), followed by the contribution from weighing operations (∼26 %). The atomic weight of molybdenum was calculated to be 95.947(2); the uncertainty in parentheses is expanded uncertainty with the coverage factor of 2. A particular advantage of the developed method is that calibration factors for all six Mo isotope amount ratios, involving the (95)Mo isotope, were experimentally determined. This allows avoiding any assumption on mass-dependent isotope fractions in MC-ICP-MS, inherent to the method of double spike previously used for Mo isotope amount ratio measurements. However, data obtained in this study show that instrumental mass discrimination in MC-ICP-MS is consistent with mass-dependent Mo isotope fractionation. This was demonstrated by a good agreement between experimentally obtained and theoretically expected values of the exponent of isotope fractionation, β, for each triad of Mo isotopes.

[Microcirculatory investigations in hemophilia patients].

PubMed

Davydkin, I L; Kosiakova, Iu A

2012-01-01

to evaluate microcirculation (MC) and its influencing factors in hemophilia patients. In 44 hemophilia patients with recurrent hemarthrosis, laser Doppler flowmetry was used to evaluate resting MC above the index fingers, knee and ankle joints during an occlusion test, with allowance made for muscle and adipose tissue mass. The increased perfusion value above the afflicted joints was found to correspond to the phase of an exacerbation of posthemorrhagic inflammation and to be a risk factor of recurrent hemarrthrosis. Analysis of the occlusion test above the knee joints and index fingers revealed a diminished MC reserve and a tendency to precapillary spasm. MC changes were more pronounced in a shortage of muscle and adipose tissue mass. Hemophilia patients must regularly do physical exercises to make skeletal muscles develop well in order to prevent an exacerbation of the joint inflammatory process.

Preferences for body type and body characteristics associated with attractive and unattractive bodies: Jackson and McGill revisited.

PubMed

Rosenfeld, L B; Stewart, S C; Stinnett, H J; Jackson, L A

1999-10-01

The present investigation replicates Jackson and McGill's study (1996) and extends it by considering the effects of respondents' own height, weight, and body mass on perceptions of attractiveness. Results, although generally supportive of those found by Jackson and McGill, point to the influence of respondents' own physical characteristics in the process of perceptions of attractiveness: only 1 of Jackson and McGill's 3 (of a possible 19) differences between responses of African- and Euro-American women was corroborated (the importance of silky hair for Euro-American women), whereas a second difference (the importance of round buttocks for African-American women) disappeared when controlling for respondents' weight, height, and body mass. Although differences between the two investigations may be attributed to regional differences in the surveyed students (Michigan and North Carolina), the small effect of one's own weight, height, and body mass in assessing an other-sex person's attractiveness may reflect adherence to norms learned very early in life that are subject to regional variations.

Tide Gauge Records Reveal Improved Processing of Gravity Recovery and Climate Experiment Time-Variable Mass Solutions over the Coastal Ocean

NASA Astrophysics Data System (ADS)

Piecuch, Christopher G.; Landerer, Felix W.; Ponte, Rui M.

2018-05-01

Monthly ocean bottom pressure solutions from the Gravity Recovery and Climate Experiment (GRACE), derived using surface spherical cap mass concentration (MC) blocks and spherical harmonics (SH) basis functions, are compared to tide gauge (TG) monthly averaged sea level data over 2003-2015 to evaluate improved gravimetric data processing methods near the coast. MC solutions can explain ≳ 42% of the monthly variance in TG time series over broad shelf regions and in semi-enclosed marginal seas. MC solutions also generally explain ˜5-32 % more TG data variance than SH estimates. Applying a coastline resolution improvement algorithm in the GRACE data processing leads to ˜ 31% more variance in TG records explained by the MC solution on average compared to not using this algorithm. Synthetic observations sampled from an ocean general circulation model exhibit similar patterns of correspondence between modeled TG and MC time series and differences between MC and SH time series in terms of their relationship with TG time series, suggesting that observational results here are generally consistent with expectations from ocean dynamics. This work demonstrates the improved quality of recent MC solutions compared to earlier SH estimates over the coastal ocean, and suggests that the MC solutions could be a useful tool for understanding contemporary coastal sea level variability and change.

FROM THE HISTORY OF PHYSICS: The Einstein formula: E0=mc2. "Isn't the Lord laughing?"

NASA Astrophysics Data System (ADS)

Okun, L. B.

2008-05-01

The article traces the way Einstein formulated the relation between energy and mass in his work from 1905 to 1955. Einstein emphasized quite often that the mass m of a body is equivalent to its rest energy E0. At the same time, he frequently resorted to the less clear-cut statement of the equivalence of energy and mass. As a result, Einstein's formula E0=mc2 still remains much less known than its popular form, E=mc2, in which E is the total energy equal to the sum of the rest energy and the kinetic energy of a freely moving body. One of the consequences of this is the widespread fallacy that the mass of a body increases when its velocity increases and even that this is an experimental fact. As wrote the playwright A N Ostrovsky "Something must exist for people, something so austere, so lofty, so sacrosanct that it would make profaning it unthinkable."

Mass Customized Technical Textiles in the B2B Sector

NASA Astrophysics Data System (ADS)

Gebhardt, R.; Barteld, M.; Grafmüller, L.; Mosig, T.; Weiß, M.

2017-10-01

Mass Customization is a great opportunity for textile companies for both staying competitive in high-wage countries and offering inexpensive, customized products. Within the area of Technical Textiles, this study focuses on the B2B sector and shows the status quo, potentials and strengths. Both management and technological issues are addressed. For the former, business models and the value co-creation process are dealt with, for the latter, the focus is on modelling.

Toward Mass Customization in the Age of Information: The Case for Open Engineering Systems

NASA Technical Reports Server (NTRS)

Simpson, Timothy W.; Lautenschlager, Uwe; Mistree, Farrokh

1997-01-01

In the Industrial Era, manufacturers used "dedicated" engineering systems to mass produce their products. In today's increasingly competitive markets, the trend is toward mass customization, something that becomes increasingly feasible when modern information technologies are used to create open engineering systems. Our focus is on how designers can provide enhanced product flexibility and variety (if not fully customized products) through the development of open engineering systems. After presenting several industrial examples, we anchor our new systems philosophy with two real engineering applications. We believe that manufacturers who adopt open systems will achieve competitive advantage in the Information Age.

How Fidelity invests in service professionals.

PubMed

McColgan, E A

1997-01-01

If you're in the business of service delivery, investment in the training and development of your staff is one of the keys to your company's success. But what's the best way to design and implement your investment? In 1994, Fidelity Institutional Retirement Services Company (FIRSCo) needed to ensure that its rapidly expanding staff maintained the company's high levels of customer satisfaction. The solution, according to Ellyn McColgan, formerly an executive vice president of FIRSCo and now the president of Fidelity Investments Tax-Exempt Services Company, was to reach out to its service associates with a powerful new model for training and development called Service Delivery University. SDU is a virtual university with a content-based core curriculum and five colleges that focus on business concepts and skills. It is driven by three principles. First, all training must be directly aligned with the company's strategic and financial objectives and focused on customer needs. Second, service delivery is a profession and should be taught as such. And finally, professional development should be the primary responsibility of line managers rather than the human resources department. McColgan explains how FIRSCo overcame resistance to this sweeping change in employee education. (Time was one obstacle: each associate receives 80 hours of training per year.) In addition, the author discusses the fine art of measuring the success of a program like SDU. She finds that the company's investment has paid dividends to the staff, to the organization as a whole, and to FIRSCo's customers.

Analytical, experimental, and Monte Carlo system response matrix for pinhole SPECT reconstruction

DOE Office of Scientific and Technical Information (OSTI.GOV)

Aguiar, Pablo, E-mail: pablo.aguiar.fernandez@sergas.es; Pino, Francisco; Silva-Rodríguez, Jesús

2014-03-15

Purpose: To assess the performance of two approaches to the system response matrix (SRM) calculation in pinhole single photon emission computed tomography (SPECT) reconstruction. Methods: Evaluation was performed using experimental data from a low magnification pinhole SPECT system that consisted of a rotating flat detector with a monolithic scintillator crystal. The SRM was computed following two approaches, which were based on Monte Carlo simulations (MC-SRM) and analytical techniques in combination with an experimental characterization (AE-SRM). The spatial response of the system, obtained by using the two approaches, was compared with experimental data. The effect of the MC-SRM and AE-SRM approachesmore » on the reconstructed image was assessed in terms of image contrast, signal-to-noise ratio, image quality, and spatial resolution. To this end, acquisitions were carried out using a hot cylinder phantom (consisting of five fillable rods with diameters of 5, 4, 3, 2, and 1 mm and a uniform cylindrical chamber) and a custom-made Derenzo phantom, with center-to-center distances between adjacent rods of 1.5, 2.0, and 3.0 mm. Results: Good agreement was found for the spatial response of the system between measured data and results derived from MC-SRM and AE-SRM. Only minor differences for point sources at distances smaller than the radius of rotation and large incidence angles were found. Assessment of the effect on the reconstructed image showed a similar contrast for both approaches, with values higher than 0.9 for rod diameters greater than 1 mm and higher than 0.8 for rod diameter of 1 mm. The comparison in terms of image quality showed that all rods in the different sections of a custom-made Derenzo phantom could be distinguished. The spatial resolution (FWHM) was 0.7 mm at iteration 100 using both approaches. The SNR was lower for reconstructed images using MC-SRM than for those reconstructed using AE-SRM, indicating that AE-SRM deals better with the projection noise than MC-SRM. Conclusions: The authors' findings show that both approaches provide good solutions to the problem of calculating the SRM in pinhole SPECT reconstruction. The AE-SRM was faster to create and handle the projection noise better than MC-SRM. Nevertheless, the AE-SRM required a tedious experimental characterization of the intrinsic detector response. Creation of the MC-SRM required longer computation time and handled the projection noise worse than the AE-SRM. Nevertheless, the MC-SRM inherently incorporates extensive modeling of the system and therefore experimental characterization was not required.« less

Mass, Energy, Space And Time Systemic Theory---MEST

NASA Astrophysics Data System (ADS)

Cao, Dayong

2010-03-01

Things have their physical system of the mass, energy, space and time of themselves-MEST. The matter have the physical systemic moel like that the mass-energy is center and the space-time is around. The time is from the frequency of wave, the space is from the amplitude of wave. What is the physical effection of the wave. The gravity and inertial force is from the wave. Not only the planets have the mass and the kinetic energy, but also it have the wave and the wave energy. According to the equivalence principle of the general relativity, there is the equation: ma=mg and mv^2 /2= δmc^2. The energy equation of the planets: E=mv^2=mgr (v is velocity) be bring put forward. In quantum mechanics, according to the quantum light theory and the de Broglie's theory , there are the equation of the wave: E=hν, p=h/λ (h is Planck constant, p is momentum, λ is the wavelengh), and there is the equation of the wave: E=mc^2. So the energy equation of the planets: E=mv^2 = mv^2 /2 + δmc^2 (mv^2 /2= δmc^2 ) be bring put forward. The equation: δmc^2 show that the planets have the wave of itself, and the wave give the planets the energy. So it do not fall from the heaven. When the matter go into the heaven, it need get the wave energy (like the potential energy). So we can make a new light-flight with the light-driving force.

Knowing what to sell, when, and to whom.

PubMed

Kumar, V; Venkatesan, Rajkumar; Reinartz, Werner

2006-03-01

Despite an abundance of data, most companies do a poor job of predicting the behavior of their customers. In fact, the authors' research suggests that even companies that take the greatest trouble over their predictions about whether a particular customer will buy a particular product are correct only around 55% of the time--a result that hardly justifies the costs of having a CRM system in the first place. Businesses usually conclude from studies like this that it's impossible to use the past to predict the future, so they revert to the timeworn marketing practice of inundating their customers with offers. But as the authors explain, the reason for the poor predictions is not any basic limitation of CRM systems or the predictive power of past behavior, but rather of the mathematical methods that companies use to interpret the data. The authors have developed a new way of predicting customer behavior, based on the work of the Nobel Prize-winning economist Daniel McFadden, that delivers vastly improved results. Indeed, the methodology increases the odds of successfully predicting a specific purchase by a specific customer at a specific time to about 85%, a number that will have a major impact on any company's marketing ROI. What's more, using this methodology, companies can increase revenues while reducing their frequency of customer contact-evidence that overcommunication with customers may actually damage a company's sales.

Transport and Thermohaline Structure in the Western Tropical North Pacific

NASA Astrophysics Data System (ADS)

Schonau, Martha Coakley

Transport and thermohaline structure of water masses and their respective variability are observed and modeled in the western tropical North Pacific using autonomous underwater gliders, Argo climatology and a numerical ocean state estimate. The North Equatorial Current (NEC) advects subtropical and subpolar water masses into the region that are transported equatorward by the Mindanao Current (MC). Continuous glider observations of these two currents from June 2009 to December 2013 provide absolute geostrophic velocity, water mass structure, and transport. The observations are compared to Argo climatology (Roemmich and Gilson, 2009), wind and precipitation to assess forcing, and annual and interannual variability. Observations are assimilated into a regional ocean state estimate (1/6°) to examine regional transport variability and its relationship to the El Nino-Southern Oscillation phenomena (ENSO). The NEC, described in Chapter 1, is observed along 134.3°E, from 8.5°N to 16.5°N. NEC thermocline transport is relatively constant, with a variable subthermocline transport that is distinguished by countercurrents centered at 9.6°N and 13.1°N. Correlation between thermocline and subthermocline transport is strong. Isopycnals with subducted water masses, the North Pacific Tropical Water and North Pacific Intermediate Water, have the greatest fine-scale thermohaline variance. The NEC advects water masses into the MC, described in Chapter 2, that flows equatorward along the coast of Mindanao. Gliders observed the MC at a mean latitude of 8.5°N. The Mindanao Undercurrent (MUC) persists in the subthermocline offshore of the MC, with a net poleward transport of intermediate water typical of South Pacific origin. The variable subthermocline transport in the MC/MUC has an inverse linear relationship with the Nino 3.4 index and strongly impacts total transport variability. For each the MC and NEC, surface salinity and thermocline depth have a strong relationship with ENSO, and there is relationship between the fine-scale and large-scale isopycnal thermohaline structure. In Chapter 3, a numerical ocean state estimates shows strong interannual variability of regional transport with ENSO. Prior to mature ENSO events, transport in each the NEC, MC and North Equatorial Counter Current (NECC) increase. The increase is from meridional gradients in isopycnal depth related to interannual wind anomalies.

On mass and momentum conservation in the variable-parameter Muskingum method

NASA Astrophysics Data System (ADS)

Reggiani, Paolo; Todini, Ezio; Meißner, Dennis

2016-12-01

In this paper we investigate mass and momentum conservation in one-dimensional routing models. To this end we formulate the conservation equations for a finite-dimensional reach and compute individual terms using three standard Saint-Venant (SV) solvers: SOBEK, HEC-RAS and MIKE11. We also employ two different variable-parameter Muskingum (VPM) formulations: the classical Muskingum-Cunge (MC) and the revised, mass-conservative Muskingum-Cunge-Todini (MCT) approach, whereby geometrical cross sections are treated analytically in both cases. We initially compare the three SV solvers for a straight mild-sloping prismatic channel with geometric cross sections and a synthetic hydrograph as boundary conditions against the analytical MC and MCT solutions. The comparison is substantiated by the fact that in this flow regime the conditions for the parabolic equation model solved by MC and MCT are met. Through this intercomparison we show that all approaches have comparable mass and momentum conservation properties, except the MC. Then we extend the MCT to use natural cross sections for a real irregular river channel forced by an observed triple-peak event and compare the results with SOBEK. The model intercomparison demonstrates that the VPM in the form of MCT can be a computationally efficient, fully mass and momentum conservative approach and therefore constitutes a valid alternative to Saint-Venant based flood wave routing for a wide variety of rivers and channels in the world when downstream boundary conditions or hydraulic structures are non-influential.

26 CFR 1.924(e)-1 - Activities relating to the disposition of export property.

Code of Federal Regulations, 2010 CFR

2010-04-01

..., television, newspaper, trade journals, mass mailings, or billboards), in order to induce multiple customers or potential customers to buy or rent the property or services from the FSC or related supplier... export customers or potential export customers. Advertising except for the advertising described in § 1...

Bioreactor mechanically guided 3D mesenchymal stem cell chondrogenesis using a biocompatible novel thermo-reversible methylcellulose-based hydrogel.

PubMed

Cochis, A; Grad, S; Stoddart, M J; Farè, S; Altomare, L; Azzimonti, B; Alini, M; Rimondini, L

2017-03-23

Autologous chondrocyte implantation for cartilage repair represents a challenge because strongly limited by chondrocytes' poor expansion capacity in vitro. Mesenchymal stem cells (MSCs) can differentiate into chondrocytes, while mechanical loading has been proposed as alternative strategy to induce chondrogenesis excluding the use of exogenous factors. Moreover, MSC supporting material selection is fundamental to allow for an active interaction with cells. Here, we tested a novel thermo-reversible hydrogel composed of 8% w/v methylcellulose (MC) in a 0.05 M Na 2 SO 4 solution. MC hydrogel was obtained by dispersion technique and its thermo-reversibility, mechanical properties, degradation and swelling were investigated, demonstrating a solution-gelation transition between 34 and 37 °C and a low bulk degradation (<20%) after 1 month. The lack of any hydrogel-derived immunoreaction was demonstrated in vivo by mice subcutaneous implantation. To induce in vitro chondrogenesis, MSCs were seeded into MC solution retained within a porous polyurethane (PU) matrix. PU-MC composites were subjected to a combination of compression and shear forces for 21 days in a custom made bioreactor. Mechanical stimulation led to a significant increase in chondrogenic gene expression, while histological analysis detected sulphated glycosaminoglycans and collagen II only in loaded specimens, confirming MC hydrogel suitability to support load induced MSCs chondrogenesis.

Sm-Nd isotopic compositions of LREE minerals for use as reference materials for in situ analysis by LA-MC-ICPMS

NASA Astrophysics Data System (ADS)

Fisher, C. M.; McFarlane, C. R.; Sylvester, P.; Hanchar, J. M.; Lam, R.; Schmitz, M. D.

2009-12-01

Recent work has demonstrated the possibility of obtaining both accurate and precise in situ Sm-Nd isotopic data in light rare earth enriched (LREE) accessory minerals including apatite, titanite, and monazite, using laser ablation-multicollector-inductively coupled plasma mass spectrometry (LA-MC-ICPMS). A distinct advantage of using LA-MC-ICPMS is that Sm-Nd isotopic data from these minerals can be determined in sub-grain domains potentially avoiding problems of isotopic mixing from inherited or xenocrystic components and allowing both valuable tracer isotope and geochronologic data to be obtained. However, a number of analytical obstacles complicate accurate Sm-Nd determination by LA-MC-ICPMS including mass bias corrections, the 144Sm isobaric interference on 144Nd, and potential offset (ca. 20-40 ppm) from thermal ionization mass spectrometry (TIMS) determination of similar materials. Thus, in order to verify Sm-Nd isotopic determination from unknowns, matrix-matched quality control standards (i.e., reference materials) must be developed to test the data handling protocol. This talk will present new Sm-Nd isotopic data determined by both TIMS as well as LA-MC-ICPMS of a number of natural potential reference minerals including Durango apatite, Fish Canyon titanite, Daibosatsu allanite, Trebilcock monazite, as well as a monazite from the Doi Inthanon core complex in northern Thailand. Our preliminary LA-MC-ICPMS results demonstrate that Durango apatite, Fish Canyon titanite, and Thailand monazite show both inter- and intra-grain homogeneity at current levels of precision (ca. 0.3-0.5 ɛNd) and close agreement with our TIMS data.

Statistical and biological gene-lifestyle interactions of MC4R and FTO with diet and physical activity on obesity: new effects on alcohol consumption

USDA-ARS?s Scientific Manuscript database

Fat mass and obesity (FTO) and melanocortin-4 receptor (MC4R) and are relevant genes associated with obesity. This could be through food intake, but results are contradictory. Modulation by diet or other lifestyle factors is also not well understood. To investigate whether MC4R and FTO associations ...

[Determination of five microcystins in drinking water by HPLC/MS/MS].

PubMed

Liu, Honghe; Mao, Lisha; Zhu, Zhou; Liu, Guihua; Chen, Yuhua

2012-09-01

A high performance liquid chromatography-tandem mass spectrometric method was established for determination of five microcystins( MC-LR,MC-LW,MC-RR, MC-LF, MC-YR)in drinking water and source water. The five microcystins in water was cleaned by 0.22 microm millipore filter, then detected by high performance liquid chromatography-tandem mass spectrometry. Identification was achieved by electrospray ionization (ESI) in positive mode using multiple reaction monitoring. The calibration curves of five microcystins showed good linearity in the range of 0.5-50 microg/L with correlation coefficient in the range of 0.9994 -1.0000. The detection limit of the method was from 0.06 microg/L to 0.08 microg/L, the recoveries of two spiking levels ranged from 91.2% to 102%, and RSDs of range from 2.11% to 3.26% were obtained. The method for determination of five microcystins in drinking water and source water by HPLC-MS/MS was of operation convenience, less interference from impurities and good accuracy, which could meet the requirements of national health standard method for the determination of microcystins in drinking water.

Online Student Induction: A Case Study of the Use of Mass Customization Techniques

ERIC Educational Resources Information Center

Phillips, Marion; Hawkins, Rachel; Lunsford, Jane; Sinclair-Pearson, Andrew

2004-01-01

New technology within Open and Distance learning (ODL) provides new opportunities for the delivery of learner support resources. Mass customization techniques offer the advantages of efficient production combined with the development of a learning experience precisely tailored for the individual's study requirements. In this article, we discuss…

First isolation and antinociceptive activity of a lipid transfer protein from noni (Morinda citrifolia) seeds.

PubMed

Campos, Dyély C O; Costa, Andrea S; Lima, Amanda D R; Silva, Fredy D A; Lobo, Marina D P; Monteiro-Moreira, Ana Cristina O; Moreira, Renato A; Leal, Luzia K A M; Miron, Diogo; Vasconcelos, Ilka M; Oliveira, Hermógenes D

2016-05-01

In this study a novel heat-stable lipid transfer protein, designated McLTP1, was purified from noni (Morinda citrifolia L.) seeds, using four purification steps which resulted in a high-purified protein yield (72 mg McLTP1 from 100g of noni seeds). McLTP1 exhibited molecular masses of 9.450 and 9.466 kDa, determined by electrospray ionisation mass spectrometry. The N-terminal sequence of McLTP1 (AVPCGQVSSALSPCMSYLTGGGDDPEARCCAGV), as analysed by NCBI-BLAST database, revealed a high degree of identity with other reported plant lipid transfer proteins. In addition, this protein proved to be resistant to pepsin, trypsin and chymotrypsin digestion. McLTP1 given intraperitoneally (1, 2, 4 and 8 mg/kg) and orally (8 mg/kg) caused an inhibition of the writhing response induced by acetic acid in mice. This protein displayed thermostability, retaining 100% of its antinociceptive activity after 30 min incubation at 80 °C. Pretreatment of mice with McLTP1 (8 mg/kg, i.p. and p.o.) also decreased neurogenic and inflammatory phases of nociception in the formalin test. Naloxone (2 mg/kg, i.p.) antagonised the antinociceptive effect of McLTP1 suggesting that the opioid mechanisms mediate the analgesic properties of this protein. Copyright © 2016 Elsevier B.V. All rights reserved.

Precise determination of cosmogenic Ne in CREU-1 quartz standard, using the Helix-MC Plus mass spectrometer

NASA Astrophysics Data System (ADS)

Hamilton, D.; Honda, M.; Zhang, X.; Phillips, D.; Matchan, E.

2017-12-01

The Helix-MC Plus multi-collector noble gas mass spectrometer at the Australian National University is uniquely equipped with three high mass resolution collectors on H2, Axial and L2 positions. Their mass resolution and mass resolving power are as high as 1,800 and 8,000, respectively. The Helix-MC Plus can totally separate 20Ne+ from 40Ar++ isobaric interference and also partially separate 21Ne+ from 20NeH+ and 22Ne+ from 12C16O2++. By adjusting collector positions, we are able to measure interference-free Ne isotope intensities and have re-determined the 21Ne abundance in air [1]. Analyses by Honda et al. [1] demonstrated that 20Ne1H contributes approximately 2% to previously determined atmospheric 21Ne values [2], and a new atmospheric 21Ne/20Ne ratio of 0.002906 was calculated. Using the Helix-MC Plus mass spectrometer, we measured Ne abundances in the CREU-1 quartz standard [3] and determined cosmogenic concentrations by subtraction of atmospheric Ne with the new atmospheric 21Ne/20Ne value. The average concentration of cosmogenic 21Ne determined from four repeated analyses is 338 ± 12 × 106 atom/g (2σ). This compares with the average concentration of 348 ± 10 × 106 atom/g (2σ) from 45 analyses determined by several laboratories [3], where Ne isotope analyses were undertaken by conventional low resolution mass spectrometers and atmospheric Ne was subtracted using the conventional atmospheric 21Ne/20Ne [2]. On this basis, for a sample with abundant cosmogenic Ne, like CREU-1 quartz, previously measured by low mass resolution mass spectrometers are likely valid and their geological implications are unaffected. However, for low 21Ne concentration samples, combining new generation of mass spectrometers as well as the new atmospheric ratio may have significance for cosmogenic 21Ne surface exposure dating. References: [1] Honda M., et. al., International Journal of Mass Spectrometry, 387, 1 (2015). [2] Eberhardt P., et. al., Zeitschrift fur Naturforschung, 20a, 623 (1965). [3] Vermeesch P., et. al., Quaternary Geochronology, 26, 20 (2015).

Quantification of 60Fe atoms by MC-ICP-MS for the redetermination of the half-life.

PubMed

Kivel, Niko; Schumann, Dorothea; Günther-Leopold, Ines

2013-03-01

In many scientific fields, the half-life of radionuclides plays an important role. The accurate knowledge of this parameter has direct impact on, e.g., age determination of archeological artifacts and of the elemental synthesis in the universe. In order to derive the half-life of a long-lived radionuclide, the activity and the absolute number of atoms have to be analyzed. Whereas conventional radiation measurement methods are typically applied for activity determinations, the latter can be determined with high accuracy by mass spectrometric techniques. Over the past years, the half-lives of several radionuclides have been specified by means of multiple-collector inductively coupled plasma mass spectrometry (MC-ICP-MS) complementary to the earlier reported values mainly derived by accelerator mass spectrometry. The present paper discusses all critical aspects (amount of material, radiochemical sample preparation, interference correction, isotope dilution mass spectrometry, calculation of measurement uncertainty) for a precise analysis of the number of atoms by MC-ICP-MS exemplified for the recently published half-life determination of 60Fe (Rugel et al, Phys Rev Lett 103:072502, 2009).

An observational study of consumer use of fast-food restaurant drive-through lanes: implications for menu labelling policy.

PubMed

Roberto, Christina A; Hoffnagle, Elena; Bragg, Marie A; Brownell, Kelly D

2010-11-01

Some versions of restaurant menu labelling legislation do not require energy information to be posted on menus for drive-through lanes. The present study was designed to quantify the number of customers who purchase fast food through drive-in windows as a means of informing legislative labelling efforts. This was an observational study. The study took place at two McDonald's and Burger King restaurants, and single Dairy Queen, Kentucky Fried Chicken, Taco Bell and Wendy's restaurants. The number of customers entering the chain restaurants and purchasing food via the drive-through lane were recorded. A total of 3549 patrons were observed. The percentage of customers who made their purchases at drive-throughs was fifty-seven. The overall average (57 %) is likely a conservative estimate because some fast-food restaurants have late-night hours when only the drive-throughs are open. Since nearly six in ten customers purchase food via the drive-through lanes, menu labelling legislation should mandate the inclusion of menu labels on drive-through menu boards to maximise the impact of this public health intervention.

Characterisation of an ion source on the Helix MC Plus noble gas mass spectrometer - pressure dependent mass discrimination

NASA Astrophysics Data System (ADS)

Zhang, X.

2017-12-01

Characterisation of an ion source on the Helix MC Plusnoble gas mass spectrometer - pressure dependent mass discrimination Xiaodong Zhang* dong.zhang@anu.edu.au Masahiko Honda Masahiko.honda@anu.edu.au Research School of Earth Sciences, The Australian National University, Canberra, Australia To obtain reliable measurements of noble gas elemental and isotopic abundances in a geological sample it is essential that the mass discrimination (instrument-induced isotope fractionation) of the mass spectrometer remain constant over the working range of noble gas partial pressures. It is known, however, that there are pressure-dependent variations in sensitivity and mass discrimination in conventional noble gas mass spectrometers [1, 2, 3]. In this study, we discuss a practical approach to ensuring that the pressure effect in the Helix MC Plus high resolution, multi-collector noble gas mass spectrometer is minimised. The isotopic composition of atmospheric Ar was measured under a range of operating conditions to test the effects of different parameters on Ar mass discrimination. It was found that the optimised ion source conditions for pressure independent mass discrimination for Ar were different from those for maximised Ar sensitivity. The optimisation can be achieved by mainly adjusting the repeller voltage. It is likely that different ion source settings will be required to minimise pressure-dependent mass discrimination for different noble gases. A recommended procedure for tuning an ion source to reduce pressure dependent mass discrimination will be presented. References: Honda M., et al., Geochim. Cosmochim. Acta, 57, 859 -874, 1993. Burnard P. G., and Farley K. A., Geochemistry Geophysics Geosystems, Volume 1, 2000GC00038, 2000. Mabry J., et al., Journal of Analytical Atomic Spectrometry, 27, 1012 - 1017, 2012.

Insect Biometrics: Optoacoustic Signal Processing and Its Applications to Remote Monitoring of McPhail Type Traps.

PubMed

Potamitis, Ilyas; Rigakis, Iraklis; Fysarakis, Konstantinos

2015-01-01

Monitoring traps are important components of integrated pest management applied against important fruit fly pests, including Bactrocera oleae (Gmelin) and Ceratitis capitata (Widemann), Diptera of the Tephritidae family, which effect a crop-loss/per year calculated in billions of euros worldwide. Pests can be controlled with ground pesticide sprays, the efficiency of which depends on knowing the time, location and extent of infestations as early as possible. Trap inspection is currently carried out manually, using the McPhail trap, and the mass spraying is decided based on a decision protocol. We introduce the term 'insect biometrics' in the context of entomology as a measure of a characteristic of the insect (in our case, the spectrum of its wingbeat) that allows us to identify its species and make devices to help face old enemies with modern means. We modify a McPhail type trap into becoming electronic by installing an array of photoreceptors coupled to an infrared emitter, guarding the entrance of the trap. The beating wings of insects flying in the trap intercept the light and the light fluctuation is turned to a recording. Custom-made electronics are developed that are placed as an external add-on kit, without altering the internal space of the trap. Counts from the trap are transmitted using a mobile communication network. This trap introduces a new automated remote-monitoring method different to audio and vision-based systems. We evaluate our trap in large number of insects in the laboratory by enclosing the electronic trap in insectary cages. Our experiments assess the potential of delivering reliable data that can be used to initialize reliably the spraying process at large scales but to also monitor the impact of the spraying process as it eliminates the time-lag between acquiring and delivering insect counts to a central agency.

Insect Biometrics: Optoacoustic Signal Processing and Its Applications to Remote Monitoring of McPhail Type Traps

PubMed Central

Potamitis, Ilyas; Rigakis, Iraklis; Fysarakis, Konstantinos

2015-01-01

Monitoring traps are important components of integrated pest management applied against important fruit fly pests, including Bactrocera oleae (Gmelin) and Ceratitis capitata (Widemann), Diptera of the Tephritidae family, which effect a crop-loss/per year calculated in billions of euros worldwide. Pests can be controlled with ground pesticide sprays, the efficiency of which depends on knowing the time, location and extent of infestations as early as possible. Trap inspection is currently carried out manually, using the McPhail trap, and the mass spraying is decided based on a decision protocol. We introduce the term ‘insect biometrics’ in the context of entomology as a measure of a characteristic of the insect (in our case, the spectrum of its wingbeat) that allows us to identify its species and make devices to help face old enemies with modern means. We modify a McPhail type trap into becoming electronic by installing an array of photoreceptors coupled to an infrared emitter, guarding the entrance of the trap. The beating wings of insects flying in the trap intercept the light and the light fluctuation is turned to a recording. Custom-made electronics are developed that are placed as an external add-on kit, without altering the internal space of the trap. Counts from the trap are transmitted using a mobile communication network. This trap introduces a new automated remote-monitoring method different to audio and vision-based systems. We evaluate our trap in large number of insects in the laboratory by enclosing the electronic trap in insectary cages. Our experiments assess the potential of delivering reliable data that can be used to initialize reliably the spraying process at large scales but to also monitor the impact of the spraying process as it eliminates the time-lag between acquiring and delivering insect counts to a central agency. PMID:26544845

Detection of counterfeit antiviral drug Heptodin and classification of counterfeits using isotope amount ratio measurements by multicollector inductively coupled plasma mass spectrometry (MC-ICPMS) and isotope ratio mass spectrometry (IRMS).

PubMed

Santamaria-Fernandez, Rebeca; Hearn, Ruth; Wolff, Jean-Claude

2009-06-01

Isotope ratio mass spectrometry (IRMS) and multicollector inductively coupled plasma mass spectrometry (MC-ICP-MS) are highly important techniques that can provide forensic evidence that otherwise would not be available. MC-ICP-MS has proved to be a very powerful tool for measuring high precision and accuracy isotope amount ratios. In this work, the potential of combining isotope amount ratio measurements performed by MC-ICP-MS and IRMS for the detection of counterfeit pharmaceutical tablets has been investigated. An extensive study for the antiviral drug Heptodin has been performed for several isotopic ratios combining MC-ICP-MS and an elemental analyser EA-IRMS for stable isotope amount ratio measurements. The study has been carried out for 139 batches of the antiviral drug and analyses have been performed for C, S, N and Mg isotope ratios. Authenticity ranges have been obtained for each isotopic system and combined to generate a unique multi-isotopic pattern only present in the genuine tablets. Counterfeit tablets have then been identified as those tablets with an isotopic fingerprint outside the genuine isotopic range. The combination of those two techniques has therefore great potential for pharmaceutical counterfeit detection. A much greater power of discrimination is obtained when at least three isotopic systems are combined. The data from these studies could be presented as evidence in court and therefore methods need to be validated to support their credibility. It is also crucial to be able to produce uncertainty values associated to the isotope amount ratio measurements so that significant differences can be identified and the genuineness of a sample can be assessed.

Evaluation of mercury loads from climate change projections

Treesearch

Paul Conrads; Paul M. Bradley; Stephen T. Benedict; Toby D. Feaster

2016-01-01

McTier Creek is a small coastal plain watershed located in Aiken County, South Carolina. McTier Creek forms part of the headwaters for the Edisto River basin, which is noted for having some of the highest recorded fish-tissue mercury concentrations in the United States. A simple water-quality load model, TOPLOAD, which was developed for McTier Creek, utilizes a mass...

Pharmacokinetic study of tianeptine and its active metabolite MC5 in rats following different routes of administration using a novel liquid chromatography tandem mass spectrometry analytical method.

PubMed

Szafarz, Małgorzata; Wencel, Agnieszka; Pociecha, Krzysztof; Fedak, Filip A; Wlaź, Piotr; Wyska, Elżbieta

2018-02-01

Tianeptine is an atypical antidepressant with a unique mechanism of action and recently it has been also reported that its major metabolite, compound MC5, possesses pharmacological activity similar to that of the parent drug. The current study aims to investigate the pharmacokinetics (PK) of both tianeptine and MC5 after intravenous or intraperitoneal administration of the parent drug as well as the metabolic ratio of MC5 in rats. To achieve these goals an LC-MS/MS method using the small sample volume for the quantitation of tianeptine and its active metabolite MC5 in rat plasma and liver perfusate has been developed and validated. Following an intravenous administration of tianeptine pharmacokinetic parameters were calculated by non-compartmental analysis. The average tianeptine volume of distribution at steady state was 2.03 L/kg and the systemic clearance equaled 1.84 L/h/kg. The mean elimination half-lives of tianeptine and MC5 metabolite were 1.16 and 7.53 h, respectively. The hepatic clearance of tianeptine determined in the isolated rat liver perfusion studies was similar to the perfusate flow rate despite the low metabolic ratio of MC5. Mass spectrometric analysis of rat bile indicated that tianeptine and MC5 metabolite are eliminated with bile as glucuronide and glutamine conjugates. Bioavailability of tianeptine after its intraperitoneal administration was 69%. The PK model with a metabolite compartment developed in this study for both tianeptine and MC5 metabolite after two routes of administration may facilitate tianeptine dosage selection for the prospective pharmacological experiments.

Effect of cryopreservation on delineation of immune cell subpopulations in tumor specimens as determinated by multiparametric single cell mass cytometry analysis.

PubMed

Kadić, Elma; Moniz, Raymond J; Huo, Ying; Chi, An; Kariv, Ilona

2017-02-02

Comprehensive understanding of cellular immune subsets involved in regulation of tumor progression is central to the development of cancer immunotherapies. Single cell immunophenotyping has historically been accomplished by flow cytometry (FC) analysis, enabling the analysis of up to 18 markers. Recent advancements in mass cytometry (MC) have facilitated detection of over 50 markers, utilizing high resolving power of mass spectrometry (MS). This study examined an analytical and operational feasibility of MC for an in-depth immunophenotyping analysis of the tumor microenvironment, using the commercial CyTOF™ instrument, and further interrogated challenges in managing the integrity of tumor specimens. Initial longitudinal studies with frozen peripheral blood mononuclear cells (PBMCs) showed minimal MC inter-assay variability over nine independent runs. In addition, detection of common leukocyte lineage markers using MC and FC detection confirmed that these methodologies are comparable in cell subset identification. An advanced multiparametric MC analysis of 39 total markers enabled a comprehensive evaluation of cell surface marker expression in fresh and cryopreserved tumor samples. This comparative analysis revealed significant reduction of expression levels of multiple markers upon cryopreservation. Most notably myeloid derived suppressor cells (MDSC), defined by co-expression of CD66b + and CD15 + , HLA-DR dim and CD14 - phenotype, were undetectable in frozen samples. These results suggest that optimization and evaluation of cryopreservation protocols is necessary for accurate biomarker discovery in frozen tumor specimens.

Bioreactor mechanically guided 3D mesenchymal stem cell chondrogenesis using a biocompatible novel thermo-reversible methylcellulose-based hydrogel

PubMed Central

Cochis, A.; Grad, S.; Stoddart, M. J.; Farè, S.; Altomare, L.; Azzimonti, B.; Alini, M.; Rimondini, L.

2017-01-01

Autologous chondrocyte implantation for cartilage repair represents a challenge because strongly limited by chondrocytes’ poor expansion capacity in vitro. Mesenchymal stem cells (MSCs) can differentiate into chondrocytes, while mechanical loading has been proposed as alternative strategy to induce chondrogenesis excluding the use of exogenous factors. Moreover, MSC supporting material selection is fundamental to allow for an active interaction with cells. Here, we tested a novel thermo-reversible hydrogel composed of 8% w/v methylcellulose (MC) in a 0.05 M Na2SO4 solution. MC hydrogel was obtained by dispersion technique and its thermo-reversibility, mechanical properties, degradation and swelling were investigated, demonstrating a solution-gelation transition between 34 and 37 °C and a low bulk degradation (<20%) after 1 month. The lack of any hydrogel-derived immunoreaction was demonstrated in vivo by mice subcutaneous implantation. To induce in vitro chondrogenesis, MSCs were seeded into MC solution retained within a porous polyurethane (PU) matrix. PU-MC composites were subjected to a combination of compression and shear forces for 21 days in a custom made bioreactor. Mechanical stimulation led to a significant increase in chondrogenic gene expression, while histological analysis detected sulphated glycosaminoglycans and collagen II only in loaded specimens, confirming MC hydrogel suitability to support load induced MSCs chondrogenesis. PMID:28332587

A rapid and reliable method for Pb isotopic analysis of peat and lichens by laser ablation-quadrupole-inductively coupled plasma-mass spectrometry for biomonitoring and sample screening.

PubMed

Kylander, M E; Weiss, D J; Jeffries, T E; Kober, B; Dolgopolova, A; Garcia-Sanchez, R; Coles, B J

2007-01-16

An analytical protocol for rapid and reliable laser ablation-quadrupole (LA-Q)- and multi-collector (MC-) inductively coupled plasma-mass spectrometry (ICP-MS) analysis of Pb isotope ratios ((207)Pb/(206)Pb and (208)Pb/(206)Pb) in peats and lichens is developed. This technique is applicable to source tracing atmospheric Pb deposition in biomonitoring studies and sample screening. Reference materials and environmental samples were dry ashed and pressed into pellets for introduction by laser ablation. No binder was used to reduce contamination. LA-MC-ICP-MS internal and external precisions were <1.1% and <0.3%, respectively, on both (207)Pb/(206)Pb and (208)Pb/(206)Pb ratios. LA-Q-ICP-MS internal precisions on (207)Pb/(206)Pb and (208)Pb/(206)Pb ratios were lower with values for the different sample sets <14.3% while external precisions were <2.9%. The level of external precision acquired in this study is high enough to distinguish between most modern Pb sources. LA-MC-ICP-MS measurements differed from thermal ionisation mass spectrometry (TIMS) values by 1% or less while the accuracy obtained using LA-Q-ICP-MS compared to solution MC-ICP-MS was 3.1% or better using a run bracketing (RB) mass bias correction method. Sample heterogeneity and detector switching when measuring (208)Pb by Q-ICP-MS are identified as sources of reduced analytical performance.

Advances in laser ablation MC-ICPMS isotopic analysis of rock materials

NASA Astrophysics Data System (ADS)

Young, E. D.

2007-12-01

Laser ablation multiple-collector inductively coupled plasma-source mass spectrometry (LA-MC-ICPMS) is a rapid method for obtaining high-precision isotope ratio measurements in geological samples. The method has been used with success for measuring isotope ratios of numerous elements, including Pb, Hf, Mg, Si, and Fe in terrestrial and extraterrestrial samples. It fills the gap between the highest precision obtainable with acid digestion together with MC-ICPMS and thermal ionization mass spectrometry (TIMS) and the maximum spatial resolution afforded by secondary ion mass spectrometry (SIMS). Matrix effects have been shown to be negligible for Pb isotopic analysis by LA-MC-ICPMS (Simon et al., 2007). Glass standards NBS 610, 612, and 614 have Pb/matrix ratios spanning two orders of magnitude. Our sample-standard bracketing laser ablation technique gives accurate and precise 208Pb/206Pb and 207Pb/206Pb for these glasses. The accuracy is superior to that obtained when using Tl to correct for mass fractionation. Accuracy and precision (± 0.2 ‰) for Pb in feldspars is comparable to that for double-spike TIMS. Data like these have been used to distinguish distinct sources of magmas in the Long Valley silicic magma system. LA-MC-ICPMS analyses of Mg isotope ratios in calcium-aluminum-rich inclusions (CAIs) from carbonaceous chondrite meteorites have revealed a wealth of new information about the history of these objects. A byproduct of this work has been recognition of the importance of different mass fractionation laws among three isotopes of a given element. Kinetic and equilibrium processes define distinct fractionation laws. Reservoir effects can further modify these laws. The result is that the linear coefficient β that relates the logarithms of the ratios n2/n1 and n3/n1 (ni refers to the number of atoms of isotope i) of isotopes with masses m3 > m2 > m1 is not unique. Rather, it is process dependent. In the case of Mg, this coefficient ranges from 0.521 for single-step equilibrium processes to 0.510 or even lower for kinetic processes. Rayleigh fractionation involving a kinetic process with a single-step β of 0.510 produces an effective β of 0.512. Such differences in fractionation laws can be crucial for determining excesses or deficits in isotopes relative to mass fractionation. Contrary to some assertions, Si isotope ratios can be measured with high accuracy and precision using 193 nm excimer lasers with nanosecond pulse widths (Shahar and Young, 2007). Silicon isotope ratios in CAIs measured by 193 nm LA-MC-ICPMS have been combined with Mg isotope ratios to constrain the astrophysical environments in which these oldest solar system materials formed. Accuracy of the measurements was determined using gravimetric standards of various matrix compositions. The results establish that matrix effects for Si are below detection at the ± 0.2 ‰ precision of the laser ablation technique. High mass resolving power (m/Δ m ~ 9000) is necessary to obtain accurate Si isotope ratios by laser ablation. High-precision LA-MC-ICPMS measurements of 176Hf/177Hf in zircons can be obtained by normalizing to 179Hf/177Hf assuming an exponential fractionation law and no mass-dependent Hf, Lu, or Yb stable isotope fractionation. With corrections for interfering 176Lu and 176Yb precision for this method can be on the order of 0.3 epsilon (0.03 ‰). The approach has been used to infer the existence of continental crust on Earth 4.4 billion years before present (Harrison et al., 2005).

Effect of water storage on ultimate tensile strength and mass changes of universal adhesives.

PubMed

Bahrololumi, Nazanin; Beglou, Amirreza; Najafi-Abrandabadi, Ahmad; Sadr, Alireza; Sheikh-Al-Eslamian, Seyedeh-Mahsa; Ghasemi, Amir

2017-01-01

The aim of the present study was to evaluate the influence of water storage on micro tensile strength (µTS) and mass changes (MC) of two universal adhesives. 10 disk-shaped specimens were prepared for each adhesive; Scotchbond Universal (SCU) All-Bond Universal (ABU) and Adper Single Bond 2 (SB2). At the baseline and after 1 day and 28 days of water storage, their mass were measured and compared to estimate water sorption and solubility. For µTS test, 20 dumbbell shaped specimens were also prepared for each adhesive in two subgroups of 1 day and 28 days water storage. MC was significantly lower for SCU and ABU than SB2 ( P < 0.05) at both time intervals. In all three adhesives, the MC was significantly lower at 28 days compared to that at 1 day ( P < 0.05). Similarly, µTS was significantly higher for SCU and ABU than SB2 at both storage intervals ( P < 0.05). After 28 days, µTS increased significantly for universal adhesives ( P < 0.05). MC and µTS of adhesives were both material and time dependent when stored in water; both universal adhesives showed less water sorption and higher values of µTS than the control group. Key words: Absorption, dental adhesives, dentin-bonding agents, solubility, tensile strength.

Absolute measurements and certified reference material for iron isotopes using multiple-collector inductively coupled mass spectrometry.

PubMed

Zhou, Tao; Zhao, Motian; Wang, Jun; Lu, Hai

2008-01-01

Two enriched isotopes, 99.94 at.% 56Fe and 99.90 at.% 54Fe, were blended under gravimetric control to prepare ten synthetic isotope samples whose 56Fe isotope abundances ranged from 95% to 20%. For multiple-collector inductively coupled plasma mass spectrometry (MC-ICP-MS) measurements typical polyatomic interferences were removed by using Ar and H2 as collision gas and operating the MC-ICP-MS system in soft mode. Thus high-precision measurements of the Fe isotope abundance ratios were accomplished. Based on the measurement of the synthetic isotope abundance ratios by MC-ICP-MS, the correction factor for mass discrimination was calculated and the results were in agreement with results from IRMM014. The precision of all ten correction factors was 0.044%, indicating a good linearity of the MC-ICP-MS method for different isotope abundance ratio values. An isotopic reference material was certified under the same conditions as the instrument was calibrated. The uncertainties of ten correction factors K were calculated and the final extended uncertainties of the isotopic certified Fe reference material were 5.8363(37) at.% 54Fe, 91.7621(51) at.% 56Fe, 2.1219(23) at.% 57Fe, and 0.2797(32) at.% 58Fe.

OVERFLOW-Interaction with Industry

NASA Technical Reports Server (NTRS)

Buning, Pieter G.; George, Michael W. (Technical Monitor)

1996-01-01

A Navier-Stokes flow solver, OVERFLOW, has been developed by researchers at NASA Ames Research Center to use overset (Chimera) grids to simulate the flow about complex aerodynamic shapes. Primary customers of the OVERFLOW flow solver and related software include McDonnell Douglas and Boeing, as well as the NASA Focused Programs for Advanced Subsonic Technology (AST) and High Speed Research (HSR). Code development has focused on customer issues, including improving code performance, ability to run on workstation clusters and the NAS SP2, and direct interaction with industry on accuracy assessment and validation. Significant interaction with NAS has produced a capability tailored to the Ames computing environment, and code contributions have come from a wide range of sources, both within and outside Ames.

The Survey of HI in Extremely Low-mass Dwarfs: A Multi-Wavelength Perspective on Low-Mass Galaxy Evolution

NASA Astrophysics Data System (ADS)

Cannon, John M.; McNichols, Andrew; Teich, Yaron; Adams, Elizabeth A.; Giovanelli, Riccardo; Haynes, Martha P.; McQuinn, Kristen B.; Salzer, John Joseph; Skillman, Evan D.; Dolphin, Andrew E.; Elson, Edward C.; Haurberg, Nathalie C.; Huang, Shan; Janowiecki, Steven; Jozsa, Gyula; Leisman, Luke; Ott, Juergen; Papastergis, Emmanouil; Rhode, Katherine L.; Saintonge, Amelie; Van Sistine, Angela; Warren, Steven R.

2017-01-01

The “Survey of HI in Extremely Low-mass Dwarfs” (SHIELD) is a multiwavelength study of local volume low-mass galaxies drawn from the Arecibo Legacy Fast ALFA (ALFALFA) catalog. HST/Spitzer joint program GO-12658 revealed the stellar populations of the first 12 SHIELD galaxies (Cannon et al. 2011), allowing accurate distance measurements (McQuinn et al. 2014) and detailed studies of the patterns of recent star formation in each galaxy (McQuinn et al. 2015). These HST and Spitzer images are a critical interpretive benchmark for ground-based optical imaging and spectroscopy (Haurberg et al. 2015), as well as for sensitive VLA HI spectral line imaging of the SHIELD galaxies (McNichols et al. 2016; Teich et al. 2016). These results have furthered our understanding of the evolution of galaxies in a mass regime that was previously only sparsely populated. With the low-redshift ALFALFA catalog now complete, the scope of the SHIELD program has been expanded to include all 82 galaxies that meet distance, line width, and HI flux criteria for being gas-rich, low-mass galaxies. In HST program 13750, images of 18 more SHIELD galaxies have again set the physical scales for supporting HI spectral line imaging with both the VLA and the WSRT (Gordon et al. 2016). Taken as a whole, the ongoing SHIELD program is one of the most comprehensive multiwavelength studies of the physical properties of low-mass galaxies outside of the Local Group.

A proof-of-concept study for measuring gait speed, steadiness, and dynamic balance under various footwear conditions outside of the gait laboratory.

PubMed

Wrobel, James S; Edgar, Sarah; Cozzetto, Dana; Maskill, James; Peterson, Paul; Najafi, Bijan

2010-01-01

This pilot study examined the effect of custom and prefabricated foot orthoses on self-selected walking speed, walking speed variability, and dynamic balance in the mediolateral direction. The gait of four healthy participants was analyzed with a body-worn sensor system across a distance of at least 30 m outside of the gait laboratory. Participants walked at their habitual speed in four conditions: barefoot, regular shoes, prefabricated foot orthoses, and custom foot orthoses. In the custom foot orthoses condition, gait speed was improved on average 13.5% over the barefoot condition and 9.8% over the regular shoe condition. The mediolateral range of motion of center of mass was reduced 55% and 56% compared with the shoes alone and prefabricated foot orthoses conditions, respectively. This may suggest better gait efficiency and lower energy cost with custom foot orthoses. This tendency remained after normalizing center of mass by gait speed, suggesting that irrespective of gait speed, custom foot orthoses improve center of mass motion in the mediolateral direction compared with other footwear conditions. Gait intercycle variability, measured by intercycle coefficient of variation of gait speed, was decreased on average by 25% and 19% compared with the barefoot and shoes-alone conditions, respectively. The decrease in gait unsteadiness after wearing custom foot orthoses may suggest improved proprioception from the increased contact area of custom foot orthoses versus the barefoot condition. These findings may open new avenues for objective assessment of the impact of prescribed footwear on dynamic balance and spatiotemporal parameters of gait and assess gait adaptation after use of custom foot orthoses.

Forward to the Future: Estimating River Discharge with McFLI

NASA Astrophysics Data System (ADS)

Gleason, C. J.; Durand, M. T.; Garambois, P. A.

2016-12-01

The global surface water budget is still poorly understood, and improving our understanding of freshwater budgets requires coordination between in situ observations, models, and remote sensing. The upcoming launch of the NASA/CNES Surface Water and Ocean Topography (SWOT) satellite has generated considerable excitement as a new tool enabling hydrologists to tackle some of the most pressing questions facing their discipline. One question in particular which SWOT seems well suited to answer is river discharge (flow rate) estimation in ungauged basins: SWOT's anticipated measurements of river surface height and area have ushered in a new technique in hydrology- what we are here calling Mass conserved Flow Law Inversions, or McFLI. McFLI algorithms leverage classic hydraulic flow expressions (e.g. Manning's Equation, hydraulic geometry) within mass conserved river reaches to construct a simplified but still underconstrained system of equations to be solved for an unknown discharge. Most existing McFLI techniques have been designed to take advantage of SWOT's measurements and Manning's Equation: SWOT will observe changes in cross sectional area and river surface slope over time, so the McFLI need only solve for baseflow area and Manning's roughness coefficient. Recently published preliminary results have indicated that McFLI can be a viable tool in a global hydrologist's toolbox (discharge errors less than 30% as compared to gauges are possible in most cases). Therefore, we here outline the progress to date for McFLI techniques, and highlight three key areas for future development: 1) Maximize the accuracy and robustness of McFLI by incorporating ancillary data from satellites, models, and in situ observations. 2) Develop new McFLI techniques using novel or underutilized flow laws. 3) Systematically test McFLI to define different inversion classes of rivers with well-defined error budgets based on geography and available data for use in gauged and ungauged basins alike.

Improving Estimates of Greenland Ice Sheet Surface Mass Balance with Satellite Observations

NASA Astrophysics Data System (ADS)

Briggs, K.

2016-12-01

Mass losses from the Greenland Ice Sheet have been accelerating over recent years (e.g. McMillan et al., 2016; Velicogna et al., 2014). This acceleration has predominantly been linked to increasing rates of negative surface mass balance, and in particular, increasing ice surface melt rates (e.g. McMillan et al., 2016; Velicogna et al., 2014). At the ice sheet scale, SMB is assessed using SMB model outputs, which in addition to enabling understanding of the origin of mass balance signals, are required as ancillary data in mass balance assessments from altimetry and the mass budget method. Due to the importance of SMB for mass balance over Greenland and the sensitivity of mass balance assessments to SMB model outputs, high accuracy of these models is crucial. A critical limiting factor in SMB modeling is however, a lack of in-situ data that is required for model constraint and evaluation. Such data is limited in time and space due to inherent logistical and financial constraints. Remote sensing datasets, being spatially extensive and relatively densely sampled in both space and time, do not suffer such constraints. Here, we show satellite observations of Greenland SMB. McMillan, M., Leeson, A., Shepherd, A., Briggs, K., Armitage, T. W.K., Hogg, A., Kuipers Munneke, P., van den Broeke, M., Noël, B., van de Berg, W., Ligtenberg, S., Horwath, M., Groh, A. , Muir, A. and Gilbert, L. 2016. A high resolution record of Greenland Mass Balance. Geophysical Research Letters. 43, doi:10.1002/2016GL069666 Velicogna, I., Sutterley, T. C. and van den Broeke, M. R. 2014. Regional acceleration in ice mass loss from Greenland and Antarctica using GRACE time-variable gravity data. Geophysical Research Letters. 41, 8130-8137, doi:10.1002/2014GL061052

Root Cause Analyses of Nunn-McCurdy Breaches. Volume 2: Excalibur Artillery Projectile and the Navy Enterprise Resource Planning Program, with an Approach to Analyzing Program Complexity and Risk

DTIC Science & Technology

2012-01-01

The mismatch, it was feared, would wreck the processes that the ERP was trying to improve; customers did not have the choice of putting the ERP...program features ahead of attempting a deep dive into the data looking for problems. An initial conceptual framework would allow a decision- maker to

Challenges of German Land Forces 2030 and Beyond

DTIC Science & Technology

2011-03-24

Defense, Army Staff, February 2009 - May 2010). 52 VUCA - volatility, uncertainty, complexity, and ambiguity. Gerras, Stephen J., ed., Strategic...2007). Gerras, Stephen J., ed., Strategic Leadership Primer, 3rd ed. (Carlisle: U.S. Army War College, 2010). Gray, Colin S., Modern Strategy (Oxford...Profession, 2nd rev. and exp. ed. (Boston: Mc Graw Hill Custom Publishing, 2005). Alan G. Stolberg, “Crafting National Interests in the 21st

Client-oriented Building Mass Customization (CoBMC)

NASA Astrophysics Data System (ADS)

Lee, Xia Sheng; Faris Khamidi, Mohd; Kuppusamy, Sivaraman; Tuck Heng, Chin

2017-12-01

Although much later compared to other industries including aerospace, automobile, oil and gas etc., digital technology development has been cresting towards an exponential curve in the construction industry. Technological diversity and abundance change the game from “what you can” to “what you want”. Society is changing at an unprecedented rate. Consequently adaptability will be crucial. This research paper explores the integration of digital adaptive technologies that transform the construction industry from the mass production to that of a possible client-oriented mass customization. The focus on the design, construction and performance stages of a building project, currently undergoing major overhaul faces a paradigm shift globally that will impact and compel attention for the next three decades with viable solutions such as Building Information Modelling (BIM) to manage massive data cum information. Customization maximizes clients’ participation during the design process thereby achieving greater effective value and higher satisfaction. A study between customized and standardized examples will investigate how adaptive customization will shift the design paradigm from cost to value centric. This action research will explore different aspects of emerging innovative systems already in place pushing the edge of frontiers, and transforming the building industry landscape whether micro or giga, to compliment new technologies to create an unprecedented exhilaration of freshness over the mundane, routine and mediocrity. Three identified fundamental aspects that are instrumental to Client-oriented Building Mass Customization (CoBMC) are design option visualization, parametric product information and n-dimensional modelling. The study concluded that a paradigm shift is therefore inevitable for every stakeholder including clients who will need to re-examine their roles, capabilities, and competencies in preparation towards challenging future.

New bound on neutrino dipole moments from globular-cluster stars

NASA Technical Reports Server (NTRS)

Raffelt, Georg G.

1990-01-01

Neutrino dipole moments mu(nu) would increase the core mass of red giants at the helium flash by delta(Mc) = 0.015 solar mass x mu(nu)/10 to the -12th muB (where muB is the Bohr magneton) because of enhanced neutrino losses. Existing measurements of the bolometric magnitudes of the brightest red giants in 26 globular clusters, number counts of horizontal-branch stars and red giants in 15 globular clusters, and statistical parallax determinations of field RR Lyr luminosities yield delta(Mc) = 0.009 + or - 0.012 solar mass, so that conservatively mu(nu) is less than 3 x 10 to the -12th muB.

Correlation between BMI and motor coordination in children.

PubMed

Lopes, Vítor P; Stodden, David F; Bianchi, Mafalda M; Maia, Jose A R; Rodrigues, Luis P

2012-01-01

To analyze the association between motor coordination (MC) and body mass index (BMI) across childhood and early adolescence. This study is cross-sectional. Data were collected in 7175 children (boys n=3616, girls n=3559), ages 6-14 years. BMI was calculated from measured height and weight [body mass (kg)/height (m(2))]. Motor coordination was evaluated using Kiphard-Schilling's body coordination test (KTK). Spearman's rank correlation was used to study the association between BMI and MC. A Kruskal-Wallis test was used to analyze the differences in MC between children of normal weight, overweight and obese children. Correlations between MC and BMI were negative and varied between 0.05 and 0.49. The highest negative correlations for both boys and girls was at 11 years of age. There was a general pattern of increasing negative correlations in both genders from 6 to 11 years of age and then a decrease in correlation strengths through 14 years of age. In both boys (χ(2)((2))=324.01; p<0.001) and girls (χ(2)((2))=291.20; p<0.001) there were significant differences in MC between the three groups' weight status. Normal weight children of both sexes demonstrated significantly higher MC scores than overweight. Obese children in both sexes had the lowest MC scores among all three groups. Motor coordination demonstrated an inverse relationship with BMI across childhood and into early adolescence. The strength of the inverse relation increased during childhood, but decreased through early adolescence. Overweight and obese children of both sexes demonstrated significantly lower MC than normal weight children. Copyright © 2011 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.

The calculation of mass attenuation coefficients of well-known thermoluminescent dosimetric compounds at wide energy range

NASA Astrophysics Data System (ADS)

Ermis, Elif Ebru

2017-02-01

The photon mass attenuation coefficients of LiF, BaSO4, CaCO3 and CaSO4 thermoluminescent dosimetric compounds at 100; 300; 500; 600; 800; 1,000; 1,500; 2,000; 3,000 and 5,000 keV gamma-ray energies were calculated. For this purpose, FLUKA Monte Carlo (MC) program which is one of the well-known MC codes was used in this study. Furthermore, obtained results were analyzed by means of ROOT program. National Institute of Standards and Technology (NIST) values were also used to compare the obtained theoretical values because the mass attenuation values of the used compounds could not found in the literature. Calculated mass attenuation coefficients were highly in accordance with the NIST values. As a consequence, FLUKA was successful in calculating the mass attenuation coefficients of the most used thermoluminescent compound.

An RFID-Based Manufacturing Control Framework for Loosely Coupled Distributed Manufacturing System Supporting Mass Customization

NASA Astrophysics Data System (ADS)

Chen, Ruey-Shun; Tsai, Yung-Shun; Tu, Arthur

In this study we propose a manufacturing control framework based on radio-frequency identification (RFID) technology and a distributed information system to construct a mass-customization production process in a loosely coupled shop-floor control environment. On the basis of this framework, we developed RFID middleware and an integrated information system for tracking and controlling the manufacturing process flow. A bicycle manufacturer was used to demonstrate the prototype system. The findings of this study were that the proposed framework can improve the visibility and traceability of the manufacturing process as well as enhance process quality control and real-time production pedigree access. Using this framework, an enterprise can easily integrate an RFID-based system into its manufacturing environment to facilitate mass customization and a just-in-time production model.

TU-AB-BRC-09: Fast Dose-Averaged LET and Biological Dose Calculations for Proton Therapy Using Graphics Cards

DOE Office of Scientific and Technical Information (OSTI.GOV)

Wan, H; Tseung, Chan; Beltran, C

Purpose: To demonstrate fast and accurate Monte Carlo (MC) calculations of proton dose-averaged linear energy transfer (LETd) and biological dose (BD) on a Graphics Processing Unit (GPU) card. Methods: A previously validated GPU-based MC simulation of proton transport was used to rapidly generate LETd distributions for proton treatment plans. Since this MC handles proton-nuclei interactions on an event-by-event using a Bertini intranuclear cascade-evaporation model, secondary protons were taken into account. The smaller contributions of secondary neutrons and recoil nuclei were ignored. Recent work has shown that LETd values are sensitive to the scoring method. The GPU-based LETd calculations were verifiedmore » by comparing with a TOPAS custom scorer that uses tabulated stopping powers, following recommendations by other authors. Comparisons were made for prostate and head-and-neck patients. A python script is used to convert the MC-generated LETd distributions to BD using a variety of published linear quadratic models, and to export the BD in DICOM format for subsequent evaluation. Results: Very good agreement is obtained between TOPAS and our GPU MC. Given a complex head-and-neck plan with 1 mm voxel spacing, the physical dose, LETd and BD calculations for 10{sup 8} proton histories can be completed in ∼5 minutes using a NVIDIA Titan X card. The rapid turnover means that MC feedback can be obtained on dosimetric plan accuracy as well as BD hotspot locations, particularly in regards to their proximity to critical structures. In our institution the GPU MC-generated dose, LETd and BD maps are used to assess plan quality for all patients undergoing treatment. Conclusion: Fast and accurate MC-based LETd calculations can be performed on the GPU. The resulting BD maps provide valuable feedback during treatment plan review. Partially funded by Varian Medical Systems.« less

Changes in energy content of lunchtime purchases from fast food restaurants after introduction of calorie labelling: cross sectional customer surveys.

PubMed

Dumanovsky, Tamara; Huang, Christina Y; Nonas, Cathy A; Matte, Thomas D; Bassett, Mary T; Silver, Lynn D

2011-07-26

To assess the impact of fast food restaurants adding calorie labelling to menu items on the energy content of individual purchases. Cross sectional surveys in spring 2007 and spring 2009 (one year before and nine months after full implementation of regulation requiring chain restaurants' menus to contain details of the energy content of all menu items). Setting 168 randomly selected locations of the top 11 fast food chains in New York City during lunchtime hours. 7309 adult customers interviewed in 2007 and 8489 in 2009. Energy content of individual purchases, based on customers' register receipts and on calorie information provided for all items in menus. For the full sample, mean calories purchased did not change from before to after regulation (828 v 846 kcal, P = 0.22), though a modest decrease was shown in a regression model adjusted for restaurant chain, poverty level for the store location, sex of customers, type of purchase, and inflation adjusted cost (847 v 827 kcal, P = 0.01). Three major chains, which accounted for 42% of customers surveyed, showed significant reductions in mean energy per purchase (McDonald's 829 v 785 kcal, P = 0.02; Au Bon Pain 555 v 475 kcal, P<0.001; KFC 927 v 868 kcal, P<0.01), while mean energy content increased for one chain (Subway 749 v 882 kcal, P<0.001). In the 2009 survey, 15% (1288/8489) of customers reported using the calorie information, and these customers purchased 106 fewer kilocalories than customers who did not see or use the calorie information (757 v 863 kcal, P<0.001). Although no overall decline in calories purchased was observed for the full sample, several major chains saw significant reductions. After regulation, one in six lunchtime customers used the calorie information provided, and these customers made lower calorie choices.

LC/MS/MS structure elucidation of reaction intermediates formed during the TiO2 photocatalysis of microcystin-LR

EPA Science Inventory

Microcystin-LR (MC-LR), a cyanotoxin and emerging drinking water contaminant, was treated with TiO(2) photocatalysts immobilized on stainless steel plates as an alternative to nanoparticles in slurry. The reaction intermediates of MC-LR were identified with mass spectrometry (MS)...

Purification and characterisation of a hypoglycemic peptide from Momordica Charantia L. Var. abbreviata Ser.

PubMed

Yuan, Xiaoqing; Gu, Xiaohong; Tang, Jian

2008-11-15

A water-soluble peptide MC2-1-5 from Momordica charantia L. Var. Abbreviata Ser., with hypoglycemic effect, was purified by ultrafiltration, gel filtration chromatography and reverse-phase high performance liquid chromatography (RP-HPLC). The infrared (IR) spectra showed characteristic absorption peaks and the molecular mass of MC2-1-5 was found to be 3405.5174Da by matrix-assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF-MS). The sequence of its first 10 N-terminal amino acids was GHPYYSIKKS as determined by a protein sequencer. MC2-1-5 reduced the blood glucose level in alloxan-induced diabetic mice by 61.70% and 69.18% at 2 and 4h, respectively, after oral administration at a dose of 2mg/kg. The oral glucose tolerance test (OGTT) showed MC2-1-5 produced a reduction of 25.50%, 39.62% and 41.74% in blood glucose level after 1, 2 and 3h, respectively, of oral administration compared with a diabetic control. Copyright © 2008 Elsevier Ltd. All rights reserved.

Influence of methane addition on selenium isotope sensitivity and their spectral interferences.

PubMed

Floor, Geerke H; Millot, Romain; Iglesias, Mónica; Négrel, Philippe

2011-02-01

The measurements of stable selenium (Se) isotopic signatures by multi-collector inductively coupled plasma mass spectrometry (MC-ICP-MS) are very challenging, due to the presence of spectral interferences and the low abundance of Se in environmental samples. We systematically investigated the effect of methane addition on the signal of Se isotopes and their interferences. It is the first time that the effect of methane addition has been assessed for all Se isotopes and its potential interferences using hydride generator multi-collector inductively coupled plasma mass spectrometry (HG-MC-ICP-MS). Our results show that a small methane addition increases the sensitivity. However, the response differs between a hydride generator and a standard introduction system, which might be related to differences in the ionization processes. Both argon and hydrogen-based interferences, the most common spectral interferences on selenium isotopes in HG-MC-ICP-MS, decrease with increasing methane addition. Therefore, analyte-interference ratios and precision are improved. Methane addition has thus a high potential for the application to stable Se isotopes ratios by HG-MC-ICP-MS. Copyright © 2011 John Wiley & Sons, Ltd.

Synthesis of Mesoporous Carbons from Rice Husk for Supercapacitors with High Energy Density in Ionic Liquid Electrolytes.

PubMed

He, Xiaojun; Zhang, Hebao; Xie, Kang; Xia, Youyi; Zhao, Zhigang; Wang, Xiaoting

2016-03-01

High-performance mesoporous carbons (MCs) for supercapacitors were made from rice husk by one-step microwave-assisted ZnCl2 activation. The microstructures of MCs as-made were characterized by field emission scanning electron microscopy and transmission electron microscopy. The pore structure parameters of MCs were obtained by N2 adsorption technique. The electrochemical properties of MC electrodes were studied by constant current charge-discharge, cyclic voltammetry and electrochemical impedance spectroscopy in different electrolytes. The results showed that the specific surface area of MC4 made at the ZnCl2/rice husk mass of 4:1 reached 1737 m2 g(-1). The specific capacitance and energy density of the electrodes fabricated from the mixture of MC4 and microporous carbon increased with the mass percentage of MC4, reaching 157 F g(-1) and 84 Wh kg(-1) at 0.05 A g(-1), and showed good cycle stability in 1-butyl-3-methylimidazolium hexafluorophosphate electrolyte. Compared to the often-used aqueous and organic electrolytes, MC4 capacitor exhibited extremely high energy density in ionic liquid electrolyte, remaining at 28 Wh kg(-1) at 1684 W kg(-1). This work paves a new way to produce cost-effective MCs from biomass for supercapacitors with extremely high energy density in ionic liquid electrolytes.

Biometrically Supported Census Operations as a Population Control Measure in Counterinsurgency

DTIC Science & Technology

2011-05-12

and Schuster, 2006), 392. The standard for 94 Kenneth Watkin , “Controlling the Use of Force: A Role for Human Rights Norms in Contemporary Armed...Lessons of Experience, Fifth Edition. New York: McGraw Hill Custom Publishing, 2006. 63 Jones, Seth , G. In the Graveyard of Empires: America’s...Control: A Strategy for an Urban Counterinsurgency. Of Interest, Strategic Studies Institute, United States Army War College, February 14, 2008. Watkins

Crowdsourced Formal Verification: A Business Case Analysis Toward a Human-Centered Business Model

DTIC Science & Technology

2015-06-01

literacycampaignmc.org/wp-content/uploads/2011/11/ Compressed-State-of-Literacy-MC1.pdf Ryan , R. M., & Deci , E. L. (2000). Self - determination theory and the...crowd- sourced formal verification games provide intrinsic motivation. Ryan and Deci (2000) sum- marized three needs that drive the intrinsic motivation...competence, relatedness, and au- tonomy. Therefore, such games have to embrace the self - determination of the customers. Games, per se, can satisfy

Mission Options Scoping Tool for Mars Orbiters: Mass Cost Calculator (MC2)

NASA Technical Reports Server (NTRS)

Sturm, Eric J., II; Deutsch, Marie-Jose; Harmon, Corey; Nakagawa, Roy; Kinsey, Robert; Lopez, Nino; Kudrle, Paul; Evans, Alex

2007-01-01

Prior to developing the details of an advanced mission study, the mission architecture trade space is typically explored to assess the scope of feasible options. This paper describes the main features of an Excel-based tool, called the Mass-Cost-Calculator (MC2 ), which is used to perform rapid, high-level mass and cost options analyses of Mars orbiter missions. MC2 consists of a combination of databases, analytical solutions, and parametric relationships to enable quick evaluation of new mission concepts and comparison of multiple architecture options. The tool's outputs provide program management and planning teams with answers to "what if" queries, as well as an understanding of the driving mission elements, during the pre-project planning phase. These outputs have been validated against the outputs generated by the Advanced Projects Design Team (Team X) at NASA's Jet Propulsion Laboratory (JPL). The architecture of the tool allows for future expansion to other orbiters beyond Mars, and to non-orbiter missions, such as those involving fly-by spacecraft, probes, landers, rovers, or other mission elements.

Effect of water storage on ultimate tensile strength and mass changes of universal adhesives

PubMed Central

Bahrololumi, Nazanin; Najafi-Abrandabadi, Ahmad; Sadr, Alireza; Sheikh-Al-Eslamian, Seyedeh-Mahsa; Ghasemi, Amir

2017-01-01

Background The aim of the present study was to evaluate the influence of water storage on micro tensile strength (µTS) and mass changes (MC) of two universal adhesives. Material and Methods 10 disk-shaped specimens were prepared for each adhesive; Scotchbond Universal (SCU) All-Bond Universal (ABU) and Adper Single Bond 2 (SB2). At the baseline and after 1 day and 28 days of water storage, their mass were measured and compared to estimate water sorption and solubility. For µTS test, 20 dumbbell shaped specimens were also prepared for each adhesive in two subgroups of 1 day and 28 days water storage. Results MC was significantly lower for SCU and ABU than SB2 (P < 0.05) at both time intervals. In all three adhesives, the MC was significantly lower at 28 days compared to that at 1 day (P < 0.05). Similarly, µTS was significantly higher for SCU and ABU than SB2 at both storage intervals (P < 0.05). After 28 days, µTS increased significantly for universal adhesives (P < 0.05). Conclusions MC and µTS of adhesives were both material and time dependent when stored in water; both universal adhesives showed less water sorption and higher values of µTS than the control group. Key words:Absorption, dental adhesives, dentin-bonding agents, solubility, tensile strength. PMID:28149468

Strontium isotope ratios (87Sr/86Sr) of tooth enamel: a comparison of solution and laser ablation multicollector inductively coupled plasma mass spectrometry methods.

PubMed

Copeland, Sandi R; Sponheimer, Matt; le Roux, Petrus J; Grimes, Vaughan; Lee-Thorp, Julia A; de Ruiter, Darryl J; Richards, Michael P

2008-10-01

Strontium isotope ratios (87Sr/86Sr) in tooth enamel provide a means to investigate migration and landscape use in humans and other animals. Established methods for measuring (87)Sr/(86)Sr in teeth use bulk sampling (5-20 mg) and labor-intensive elemental purification procedures before analysis by either thermal ionization mass spectrometry (TIMS) or multicollector inductively coupled plasma mass spectrometry (MC-ICP-MS). Another method for measuring 87Sr/86Sr is laser ablation MC-ICP-MS, but concerns have been expressed about its accuracy for measuring tooth enamel. In this study we test the precision and accuracy of the technique by analyzing 30 modern rodent teeth from the Sterkfontein Valley, South Africa by laser ablation MC-ICP-MS and solution MC-ICP-MS. The results show a mean difference in 87Sr/86Sr measured by laser ablation and by solution of 0.0003 +/- 0.0002. This degree of precision is well within the margin necessary for investigating the potential geographic origins of humans or animals in many areas of the world. Because laser ablation is faster, less expensive, and less destructive than bulk sampling solution methods, it opens the possibility for conducting 87Sr/86Sr analyses of intra-tooth samples and small and/or rare specimens such as micromammal and fossil teeth.

SU-F-19A-10: Recalculation and Reporting Clinical HDR 192-Ir Head and Neck Dose Distributions Using Model Based Dose Calculation

DOE Office of Scientific and Technical Information (OSTI.GOV)

Carlsson Tedgren, A; Persson, M; Nilsson, J

Purpose: To retrospectively re-calculate dose distributions for selected head and neck cancer patients, earlier treated with HDR 192Ir brachytherapy, using Monte Carlo (MC) simulations and compare results to distributions from the planning system derived using TG43 formalism. To study differences between dose to medium (as obtained with the MC code) and dose to water in medium as obtained through (1) ratios of stopping powers and (2) ratios of mass energy absorption coefficients between water and medium. Methods: The MC code Algebra was used to calculate dose distributions according to earlier actual treatment plans using anonymized plan data and CT imagesmore » in DICOM format. Ratios of stopping power and mass energy absorption coefficients for water with various media obtained from 192-Ir spectra were used in toggling between dose to water and dose to media. Results: Differences between initial planned TG43 dose distributions and the doses to media calculated by MC are insignificant in the target volume. Differences are moderate (within 4–5 % at distances of 3–4 cm) but increase with distance and are most notable in bone and at the patient surface. Differences between dose to water and dose to medium are within 1-2% when using mass energy absorption coefficients to toggle between the two quantities but increase to above 10% for bone using stopping power ratios. Conclusion: MC predicts target doses for head and neck cancer patients in close agreement with TG43. MC yields improved dose estimations outside the target where a larger fraction of dose is from scattered photons. It is important with awareness and a clear reporting of absorbed dose values in using model based algorithms. Differences in bone media can exceed 10% depending on how dose to water in medium is defined.« less

Binge eating as a major phenotype of melanocortin 4 receptor gene mutations.

PubMed

Branson, Ruth; Potoczna, Natascha; Kral, John G; Lentes, Klaus-Ulrich; Hoehe, Margret R; Horber, Fritz F

2003-03-20

Obesity, a multifactorial disease caused by the interaction of genetic factors with the environment, is largely polygenic. A few mutations in these genes, such as in the leptin receptor (LEPR) gene and melanocortin 4 receptor (MC4R) gene, have been identified as causes of monogenic obesity. We sequenced the complete MC4R coding region, the region of the proopiomelanocortin gene (POMC) encoding the alpha melanocyte-stimulating hormone, and the leptin-binding domain of LEPR in 469 severely obese white subjects (370 women and 99 men; mean [+/-SE] age, 41.0+/-0.5 years; body-mass index [the weight in kilograms divided by the square of the height in meters], 44.1+/-2.0). Fifteen women and 10 men without a history of dieting or a family history of obesity served as normal-weight controls (age, 47.7+/-2.0 years; body-mass index, 21.6+/-0.4). Detailed phenotypic data, including information on body fat, resting energy expenditure, diet-induced thermogenesis, serum concentrations of leptin, and eating behavior, were collected. Twenty-four obese subjects (5.1 percent) and one control subject (4 percent) had MC4R mutations, including five novel variants. Twenty of the 24 obese subjects with an MC4R mutation were matched for age, sex, and body-mass index with 120 of the 445 obese subjects without an MC4R mutation. All mutation carriers reported binge eating, as compared with 14.2 percent of obese subjects without mutations (P<0.001) and 0 percent of the normal-weight subjects without mutations. The prevalence of binge eating was similar among carriers of mutations in the leptin-binding domain of LEPR and noncarriers. No mutations were found in the region of POMC encoding alpha melanocyte-stimulating hormone. Binge eating is a major phenotypic characteristic of subjects with a mutation in MC4R, a candidate gene for the control of eating behavior. Copyright 2003 Massachusetts Medical Society

[Detection of methyl carbamate and ethyl carbamate in yellow rice wine by gas chromatography-mass spectrometry].

PubMed

Wu, Ping-gu; Ma, Bing-jie; Wang, Li-yuan; Shen, Xiang-hong; Zhang, Jing; Tan, Ying; Jiang, Wei

2013-11-01

To establish the method of simultaneous determination of methylcarbamate (MC) and ethylcarbamate (EC) in yellow rice wine by gas chromatography-mass spectrometry (GC/MS). MC and EC in yellow rice wine were derived by 9-xanthydrol, and then the derivants were detected by GC/MS; and quantitatively analyzed by D5-EC isotope internal standard method. The linearity of MC and EC ranged from 2.0 µg/L to 400.0 µg/L, with correlation coefficients at 0.998 and 0.999, respectively. The limits of quantitation (LOQ) and detection (LOD) were 0.67 and 2.0 µg/kg. When MC and EC were added in yellow rice wine at the range of 2.0-300.0 µg/kg, the intraday average recovery rate was 78.8%-102.3%, relative standard deviation was 3.2%-11.6%; interday average recovery rate was 75.4%-101.3%, relative standard deviation was 3.8%-13.4%. 20 samples of yellow rice wine from supermarket were detected using this method, the contents of MC were in the range of ND (no detected) to 1.2 µg/kg, the detection rate was 6% (3/20), the contents of EC in the range of 18.6 µg/kg to 432.3 µg/kg, with the average level at 135.2 µg/kg. The method is simple, rapid and useful for simultaneous determination of MC and EC in yellow rice wine.

Engaging Community Businesses in HIV Prevention: A Feasibility Study

PubMed Central

Rovniak, Liza S.; Hovell, Melbourne F.; Hofstetter, C. Richard; Blumberg, Elaine J.; Sipan, Carol L.; Batista, Marcia F.; Martinez-Donate, Ana P.; Mulvihill, Mary M.; Ayala, Guadalupe X.

2009-01-01

Purpose To explore the feasibility of engaging community businesses in HIV prevention. Design Randomly selected business owners/managers were asked to display discreetly wrapped condoms and brochures provided free-of-charge for 3 months. Assessments were conducted at baseline, mid-, and post-program. Customer feedback was obtained through an online survey. Setting San Diego, California neighborhood with a high rate of AIDS. Subjects Fifty-one business owners/managers representing 10 retail categories, and 52 customers. Measures Participation rates, descriptive characteristics, number of condoms and brochures distributed, customer feedback, business owners'/managers' program satisfaction and willingness to provide future support for HIV prevention. Analysis Kruskal-Wallis, Mann-Whitney U, Fisher's exact, and McNemar's tests were used to analyze data. Results The 20 business owners/managers (39%) who agreed to distribute condoms and brochures reported fewer years in business and more employees than those who agreed only to distribute brochures (20%) or refused to participate (41%), p <.05. Bars were the easiest of ten retail categories to recruit. Businesses with more employees and customers distributed more condoms and brochures, p < .05. More than 90% of customers supported distributing condoms and brochures in businesses and 96% of business owners/managers described their program experience as “positive.” Conclusion Businesses are willing to distribute condoms and brochures to prevent HIV. Policies to increase business participation in HIV prevention should be developed and tested. PMID:20465150

Independent and combined influence of the FTO rs9939609 and MC4Rrs17782313 polymorphisms on hypocaloric diet induced changes in body mass and composition and energy metabolism in non-morbid obese premenopausal women.

PubMed

Labayen, Idoia; Margareto, Javier; Maldonado-Martin, Sara; Gorostegi, Ilargi; Illera, Maitane; Medrano, María; Barrenechea, Lurdes; Larrarte, Eider

2015-05-01

To examine the independent and combined influence of the FTOrs9939609 and the MC4Rrs17782313 polymorphisms on changes in fat mass (FM), resting energy expenditure (REE), leptin, and thyrotropin (TSH) levels, after a 12-week energy-restricted diet intervention in non-morbid premenopausal obese women. Fat mass (dual X-ray absorptiometry), REE (indirect calorimetry) and plasma leptin and thyrotropin levels were measured (before and after the intervention) in 77 obese (BMI: 33.9 ± 2.8 kg/m(2)) women (age: 36.8 ± 7.0y). There were no significant differences across FTOrs9939609 genotype groups (TT vs. A allele carriers, Ps>0.1) on changes in body mass (-8.6 ± 3.2% vs. -8.7 ± 3.3 %), FM (12.8 ± 4.7% vs. -12.9 ± 6.3%), REE (-11.3 ± 4.7 vs. -9.4 ± 8.1%), leptin (-34.1 ± 25.1% vs. -43.5 ± 24.1%) or TSH (5.2 ± 34.5% vs. -1.7 ± 27.1%) levels. Moreover, it was not observed any significant difference on changes in body mass (-8.6 ± 3.6% vs. -8.9 ± 2.6%), FM (-12.7 ± 6.1% vs. -13.4 ± 5.3%), REE (-9.8 ± 7.4% -9.4 ± 9.4%), leptin (-39.0 ± 26.9% vs. -44.8 ± 18.4%) or TSH (-1.0 ± 30.0% vs. 1.5 ± 26.5%) levels between non-C allele carriers and C allele carriers of the MC4Rrs17782313 (Ps>0.3). Finally, there were no significant difference on changes in body mass and composition, REE, leptin or TSH levels among non-risk allele carriers, carriers of the C allele risk of the MC4Rrs17782313, carriers of the A allele of the FTOrs9939609 and carriers of both risk alleles after the 12-week energy-restricted diet intervention (Ps>0.1). Carrying the A risk allele of the FTOrs9939609 and/or the C risk allele of the MC4Rrs17782313 did not influence body mass and FM loss, or REE decrease in obese women after a 12-week energy-restricted diet intervention. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

Feasibility studies of oncornavirus production in microcarrier cultures.

PubMed

Manousos, M; Ahmed, M; Torchio, C; Wolff, J; Shibley, G; Stephens, R; Mayyasi, S

1980-06-01

Studies conducted with virus-infected monolayer cell cultures have demonstrated the feasibility of producing several tumor-associated viruses in microcarrier (mc) cultures (Sephadex G50 beads treated with DEAE-chloride). The efficiency of cell adherence to mc varied with the cell type, the pH of the growth medium, and the stirring force applied to keep the mc in suspension. Most cells attached firmly to the mc and could not be removed easily with routine trypsinization procedures. Techniques using Enzar-T and Pronase were effective in detaching cells from mc in 10 to 15 min while retaining 95% cell viability. After detachment, Ficoll gradients were used for rapid and complete separation of viable cell suspensions from the mc. Retrovirus production in large volumes of mc cultures was investigated with periodic harvesting of growth fluids. Physical, biochemical, and biological properties of the Mason-Pfizer monkey virus and the RD114 virus recovered from the mc cultures were identical to those produced in conventional cultures. The utilization of mc has several applications in research and short-term cultures, but the as-yet-unsolved technical problems met were found to be serious limitations when attempting mass cell culturing on a long-term basis.

The evaluation of lyophilized polymer matrices for administering recombinant human bone morphogenetic protein-2.

PubMed

Duggirala, S S; Rodgers, J B; DeLuca, P P

1996-07-01

Novel unitary devices, prepared by lyophilization of viscous solutions of sodium carboxymethylcellulose (CMC) and methylcellulose (MC), were evaluated as sustained-release delivery systems for recombinant human bone morphogenetic protein-2 (rhBMP-2). In vitro characterization of the unitary devices, which contained rhBMP-2-loaded poly (d,l lactide-co-glycolide) (PLGA) bioerodible particles (BEPs), was conducted over a 2-month period. Determinations included buffer uptake, mass and molecular weight loss and rhBMP-2 release from the unitary devices. CMC devices imbibed approximately 16 times their weight of buffer, while with MC, equilibrium uptake was approximately 6 times the dry weight of the devices. Overall mass loss percentages were approximately 55 and 35%, respectively, for CMC and MC devices. rhBMP-2 release from the devices was essentially a triphasic process: an initial phase during which "free" protein (rhBMP-2 present on the surface and within the pores of the PLGA BEPs) was released, a lag period during which no release was discerned, and then release of "bound" rhBMP-2 (protein adsorbed to the BEPs). The release of bound protein correlated with the mass loss of the polymer which began after 3 weeks. Release from the unitary devices was lower than that from the BEPs alone, due to a retardation effect of the gelled CMC/MC polymers. In rabbits in which full-thickness cranial bone defects were created, the implants were well tolerated and induced significant new bone growth during an 8-week evaluation period. The CMC devices appear to have induced bone earlier (at 2 weeks), but this did not affect eventual 8-week results. CMC devices without rhBMP-2 appeared to provide some bone conduction, in contrast to the blank MC devices.

Sulfate and sulfide sulfur isotopes (δ34S and δ33S) measured by solution and laser ablation MC-ICP-MS: An enhanced approach using external correction

USGS Publications Warehouse

Pribil, Michael; Ridley, William I.; Emsbo, Poul

2015-01-01

Isotope ratio measurements using a multi-collector inductively coupled plasma mass spectrometer (MC-ICP-MS) commonly use standard-sample bracketing with a single isotope standard for mass bias correction for elements with narrow-range isotope systems measured by MC-ICP-MS, e.g. Cu, Fe, Zn, and Hg. However, sulfur (S) isotopic composition (δ34S) in nature can range from at least − 40 to + 40‰, potentially exceeding the ability of standard-sample bracketing using a single sulfur isotope standard to accurately correct for mass bias. Isotopic fractionation via solution and laser ablation introduction was determined during sulfate sulfur (Ssulfate) isotope measurements. An external isotope calibration curve was constructed using in-house and National Institute of Standards and Technology (NIST) Ssulfate isotope reference materials (RM) in an attempt to correct for the difference. The ability of external isotope correction for Ssulfate isotope measurements was evaluated by analyzing NIST and United States Geological Survey (USGS) Ssulfate isotope reference materials as unknowns. Differences in δ34Ssulfate between standard-sample bracketing and standard-sample bracketing with external isotope correction for sulfate samples ranged from 0.72‰ to 2.35‰ over a δ34S range of 1.40‰ to 21.17‰. No isotopic differences were observed when analyzing Ssulfide reference materials over a δ34Ssulfide range of − 32.1‰ to 17.3‰ and a δ33S range of − 16.5‰ to 8.9‰ via laser ablation (LA)-MC-ICP-MS. Here, we identify a possible plasma induced fractionation for Ssulfate and describe a new method using external isotope calibration corrections using solution and LA-MC-ICP-MS.

How Einstein Discovered E0=mc2

NASA Astrophysics Data System (ADS)

Hecht, Eugene

2012-02-01

This paper traces Einstein's discovery of "the equivalence of mass [m] and energy [E0]." He came to that splendid insight in 1905 while employed by the Bern Patent Office, at which time he was not an especially ardent reader of physics journals. How then did the young savant, working outside of academia in semi-isolation, realize that these two seemingly disparate concepts were actually "identical"? Until now little attention has been given to exploring the physics that guided his thinking in this remarkable endeavor. That work culminated (1907) in the equation E0=mc2, where E0 is "rest energy" and m is "invariant mass." Despite claims to the contrary, Einstein did not write this equation, or its ambiguous variant, E =mc2, in 1905. Furthermore, we will propose a compelling reason for his otherwise inexplicable caution. This paper is meant to help clarify the contemporary literature in the service of an informed pedagogy.

Short communication: Evaluation of MALDI-TOF mass spectrometry and a custom reference spectra expanded database for the identification of bovine-associated coagulase-negative staphylococci.

PubMed

Cameron, M; Perry, J; Middleton, J R; Chaffer, M; Lewis, J; Keefe, G P

2018-01-01

This study evaluated MALDI-TOF mass spectrometry and a custom reference spectra expanded database for the identification of bovine-associated coagulase-negative staphylococci (CNS). A total of 861 CNS isolates were used in the study, covering 21 different CNS species. The majority of the isolates were previously identified by rpoB gene sequencing (n = 804) and the remainder were identified by sequencing of hsp60 (n = 56) and tuf (n = 1). The genotypic identification was considered the gold standard identification. Using a direct transfer protocol and the existing commercial database, MALDI-TOF mass spectrometry showed a typeability of 96.5% (831/861) and an accuracy of 99.2% (824/831). Using a custom reference spectra expanded database, which included an additional 13 in-house created reference spectra, isolates were identified by MALDI-TOF mass spectrometry with 99.2% (854/861) typeability and 99.4% (849/854) accuracy. Overall, MALDI-TOF mass spectrometry using the direct transfer method was shown to be a highly reliable tool for the identification of bovine-associated CNS. Copyright © 2018 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

Changes in energy content of lunchtime purchases from fast food restaurants after introduction of calorie labelling: cross sectional customer surveys

PubMed Central

Huang, Christina Y; Nonas, Cathy A; Matte, Thomas D; Bassett, Mary T; Silver, Lynn D

2011-01-01

Objective To assess the impact of fast food restaurants adding calorie labelling to menu items on the energy content of individual purchases. Design Cross sectional surveys in spring 2007 and spring 2009 (one year before and nine months after full implementation of regulation requiring chain restaurants’ menus to contain details of the energy content of all menu items). Setting 168 randomly selected locations of the top 11 fast food chains in New York City during lunchtime hours. Participants 7309 adult customers interviewed in 2007 and 8489 in 2009. Main outcome measures Energy content of individual purchases, based on customers’ register receipts and on calorie information provided for all items in menus. Results For the full sample, mean calories purchased did not change from before to after regulation (828 v 846 kcal, P=0.22), though a modest decrease was shown in a regression model adjusted for restaurant chain, poverty level for the store location, sex of customers, type of purchase, and inflation adjusted cost (847 v 827 kcal, P=0.01). Three major chains, which accounted for 42% of customers surveyed, showed significant reductions in mean energy per purchase (McDonald’s 829 v 785 kcal, P=0.02; Au Bon Pain 555 v 475 kcal, P<0.001; KFC 927 v 868 kcal, P<0.01), while mean energy content increased for one chain (Subway 749 v 882 kcal, P<0.001). In the 2009 survey, 15% (1288/8489) of customers reported using the calorie information, and these customers purchased 106 fewer kilocalories than customers who did not see or use the calorie information (757 v 863 kcal, P<0.001). Conclusion Although no overall decline in calories purchased was observed for the full sample, several major chains saw significant reductions. After regulation, one in six lunchtime customers used the calorie information provided, and these customers made lower calorie choices. PMID:21791497

The development of the red giant branch. II - Astrophysical properties

NASA Technical Reports Server (NTRS)

Sweigart, Allen V.; Greggio, Laura; Renzini, Alvio

1990-01-01

Evolutionary sequences developed in another paper are used here to investigate the properties of the red giant branch (RGB) phase transition. Results are found for compositions in the range Y(MS) between 0.20 and 0.30 and Z between 0.004 and 0.04. The transition mass M(HeF) increases as either Y(MS) decreases or Z increases. The stellar population transition age t(HeF) is virtually independent of composition and close to 0.6 Gyr. The RGB phase transition occurs almost abruptly over a mass range of only a few tenths of a solar mass or, equivalently, over a time interval of about 0.2 Gyr in the life of a stellar population. During the RGB phase transition the core mass Mc at helium ignition increases very rapidly by about 0.15 solar mass, while the luminosity at the tip of the RGB increases by about one order of magnitude. Absolute minima are found for the values of Mc and the RGB tip luminosity.

Association of Synergistetes and Cyclodipeptides with Periodontitis.

PubMed

Marchesan, J T; Morelli, T; Moss, K; Barros, S P; Ward, M; Jenkins, W; Aspiras, M B; Offenbacher, S

2015-10-01

The purpose of this study was to evaluate the microbial community (MC) composition as it relates to salivary metabolites and periodontal clinical parameters in a 21-d biofilm-overgrowth model. Subjects (N = 168) were enrolled equally into 5 categories of periodontal status per the biofilm-gingival interface classification. Microbial species within subgingival plaque samples were identified by human microbiome identification microarray. Whole saliva was analyzed by liquid chromatography-mass spectrometry and gas chromatography-mass spectrometry for metabolite identification. Phylum was grouped into MCs according to principal component analysis. Generalized linear and regression models were used to examine the association among MC, species, periodontal clinical parameters, and salivary metabolome. Multiple comparisons were adjusted with the false discovery rate. The study population was distributed into 8 distinct MC profiles, designated MC-1 to MC-8. MC-2 explained 14% of the variance and was dominated by Synergistetes and Spirochaetes. It was the only community structure significantly associated with high probing depth (P = 0.02) and high bleeding on probing (P = 0.008). MC-2 was correlated with traditional periodontal pathogens and several newly identified putative periodontal pathogens: Fretibacterium fastidiosum, Fretibacterium sp. OT360/OT362, Filifactor alocis, Treponema lecithinolyticum, Eubacterium saphenum, Desulfobulbus sp./OT041, and Mogibacterium timidum. Synergistetes phylum was strongly associated with 2 novel metabolites-cyclo (-leu-pro) and cyclo (-phe-pro)-at 21 d of biofilm overgrowth (P = 0.02). In subjects with severe periodontitis (P2 and P3), cyclo (-leu-pro) and cyclo (-phe-pro) were significantly associated with increased changes in probing depth at 21 d of biofilm overgrowth (P ≤ 0.05). The analysis identified a MC dominated by Synergistetes, with classic and putative newly identified pathogens/pathobionts associated with clinical disease. The metabolomic discovery of 2 novel cyclodipeptides that have been reported to serve as quorum-sensing and/or bacteriocidal/bacteriostatic molecules, in association with Synergistetes, suggests a potential role in periodontal biofilm dysbiosis and periodontal disease that warrants further investigation. © International & American Associations for Dental Research 2015.

MC3R gene polymorphisms are associated with early childhood adiposity gain and infant appetite in an Asian population.

PubMed

Aris, I M; Tint, M T; Teh, A L; Holbrook, J D; Quah, P L; Chong, M F-F; Lin, X; Soh, S E; Saw, S-M; Kwek, K; Godfrey, K M; Gluckman, P D; Chong, Y S; Lek, N; Yap, F; Lee, Y S

2016-12-01

Polymorphic variants within human melanocortin-3 receptor gene (MC3R) gene have been associated with obesity. However, its influence on infancy and early childhood adiposity has not been reported before. We assessed associations between genotype at polymorphic sites within MC3R with early childhood adiposity and interaction with early childhood appetitive traits. We studied 1090 singletons in an Asian mother-offspring cohort genotyped for MC3R and in a subgroup (n = 422) who had completed Child Eating Behaviour Questionnaires (CEBQ) at 12 months. Children were followed from birth to 48 months, and up to 10 measurements of body mass index and five measures of triceps and subscapular skin-folds were obtained. Independent of potential confounders, each additional MC3R minor allele copy was associated with greater body mass index standard deviation score [B{95% confidence interval}: 0.004 units/month {0.001,0.007}; p = 0.007], triceps [0.009 mm/month {0.001,0.02}; p = 0.021] and subscapular skin-fold [0.008 mm/month {0.002,0.01}; p = 0.011] gain velocity in the first 48 months. Each additional MC3R minor allele copy was also associated with increased odds of overweight [odds ratio {95% confidence interval}: 1.48{1.17-1.88}] and obesity [1.58{1.10-2.28}] in the first 48 months. Every additional copy of MC3R minor allele was positively associated with 'slowness-in-eating' appetitive trait [0.24{0.06,0.39}, p = 0.006]; however, the relationship between 'slowness-in-eating' with adiposity gain was not statistically significant. Our findings support the role of MC3R genetic variants in adiposity gain during early childhood. © 2015 The Authors. Pediatric Obesity published by John Wiley & Sons Ltd on behalf of World Obesity Federation.

Reasons for the low uptake of adult male circumcision for the prevention of HIV transmission in Swaziland.

PubMed

Maibvise, Charles; Mavundla, Thandisizwe R

2014-09-01

Swaziland is currently experiencing the worst impact of HIV and AIDS of any country in the world. In an effort to curb further spread of the virus, the country adopted mass male circumcision (MC) as recommended by the World Health Organization in 2007. Despite intense campaigns to promote the procedure over the past three years, the uptake of circumcision remains very low for reasons that are not very clear. The purpose of this study was to explore the reasons for the low uptake of MC in Swaziland despite the massive national MC campaigns. A qualitative research design was used, in which all men who were targeted by the mass MC campaign were eligible. Participants were identified as they came for sexual and reproductive health services at the Family Life Association of Swaziland (FLAS) Clinic, Mbabane. In-depth, individual face-to-face unstructured interviews were conducted to elicit the reasons why men were not going for circumcision. A total of 17 men were interviewed. Results showed that these reasons include fear of the procedure and the possible outcome, perception of no significant benefit of the procedure, impatience about waiting for the procedure or the healing process, religious/cultural beliefs, and worries about the fate of the foreskin. These reasons were attributed to misconceptions and lack of accurate and specific information about some aspects of the circumcision strategy of HIV preventions. Physiological changes and economic activities associated with adulthood were also found to be hindrances to MC uptake. The study recommended that a comprehensive description of the procedure and more precise facts and scientific bases of the MC strategy be incorporated and emphasised in the MC campaigns. Involvement of religious leaders will also facilitate clarification of religious or cultural misunderstandings or misconceptions. A focus on neonatal MC would also help.

Weight status is associated with cross-sectional trajectories of motor co-ordination across childhood.

PubMed

Lopes, V P; Stodden, D F; Rodrigues, L P

2014-11-01

Research indicates the development of motor co-ordination (MC) may be an important contributing factor to positive or negative weight trajectories across childhood. To analyse cross-sectional associations between MC and weight status in children (boys n = 3344 - girls n = 3281), aged 6-11 years and assess overweight/obese risk across different ages. Body mass index (BMI) was calculated [body mass (kg)/height (m(2))]. MC was evaluated using the Körperkoordination Test für Kinder (KTK) and a motor quotient (MQ) was calculated. MQ distribution data were split into tertiles. The effect of age, sex and MQ tertiles on BMI and MC was tested with a factorial anova. A logistic regression also was performed to calculate odd ratios (OR) for being overweight/obese at each age. Children with higher MQ demonstrated lower BMI levels (F(2,6224) = 222.09; P < 0.001). Differences in BMI among MQ tertiles became larger across age (F(10,6224) = 4.53; P < 0.001). The OR of being overweight/obese in both sexes within the lowest MQ tertile increased in each age group from 6 to 11 years. Specifically, OR increased from 2.26 to 27.77 and from 1.87 to 6.81 in boys and girls respectively. Children with low levels of MC have a higher risk of being overweight/obese and this risk increases with age. © 2013 John Wiley & Sons Ltd.

Association of melanocortin-4 receptor gene polymorphisms with obesity-related parameters in Malaysian Malays.

PubMed

Apalasamy, Yamunah Devi; Ming, Moy Foong; Rampal, Sanjay; Bulgiba, Awang; Mohamed, Zahurin

2013-01-01

Melanocortin-4 receptor (MC4R) is an important regulator of body weight and energy intake. Genetic polymorphisms of the MC4R gene have been found to be linked to obesity in many recent studies across the globe. This study aimed to examine the effects of MC4R polymorphisms on obesity parameters, Linkage disequilibrium (LD) pattern and haplotypes in Malaysian Malays. The study subjects were 652 Malaysian Malays. Genomic DNA was extracted from buccal swabs. Genotyping was performed using Sequenom MassARRAY® iPLEX platform. Anthropometric and blood lipid profiles were measured. MC4R rs571312 SNP was associated with logBMI (p = 0.008) and systolic blood pressure (p = 0.005), while MC4R rs2229616 SNP was associated with total cholesterol (TC) levels (p = 0.016). The MC4R rs7227255 SNP did not show any association with obesity parameters. The strength of LD of the MC4R gene region is low and the haplotypes were not associated with obesity in Malaysian Malays.

The relationship of gross upper and lower limb motor competence to measures of health and fitness in adolescents aged 13-14 years.

PubMed

Weedon, Benjamin David; Liu, Francesca; Mahmoud, Wala; Metz, Renske; Beunder, Kyle; Delextrat, Anne; Morris, Martyn G; Esser, Patrick; Collett, Johnny; Meaney, Andy; Howells, Ken; Dawes, Helen

2018-01-01

Motor competence (MC) is an important factor in the development of health and fitness in adolescence. This cross-sectional study aims to explore the distribution of MC across school students aged 13-14 years old and the extent of the relationship of MC to measures of health and fitness across genders. A total of 718 participants were tested from three different schools in the UK, 311 girls and 407 boys (aged 13-14 years), pairwise deletion for correlation variables reduced this to 555 (245 girls, 310 boys). Assessments consisted of body mass index, aerobic capacity, anaerobic power, and upper limb and lower limb MC. The distribution of MC and the strength of the relationships between MC and health/fitness measures were explored. Girls performed lower for MC and health/fitness measures compared with boys. Both measures of MC showed a normal distribution and a significant linear relationship of MC to all health and fitness measures for boys, girls and combined genders. A stronger relationship was reported for upper limb MC and aerobic capacity when compared with lower limb MC and aerobic capacity in boys (t=-2.21, degrees of freedom=307, P=0.03, 95% CI -0.253 to -0.011). Normally distributed measures of upper and lower limb MC are linearly related to health and fitness measures in adolescents in a UK sample. NCT02517333.

Economic Analysis of National Nuclear Security Administration (NNSA) Modernization Alternatives

DTIC Science & Technology

2007-11-01

without nuclear testing; works to reduce global danger from weapons of mass destruction; provides the U.S. Navy with safe and effective nuclear...SFE) covers the acquisition of glove boxes, long-lead facility, and actinide chemistry/materials characterization (AC/MC) equipment whose uniqueness...Hazard Category II AC/MC and actinide Research and Development operations, special nuclear 5 Babcock

Non-Gurney Scaling of Explosives Heavily Loaded with Dense Inert Additives

NASA Astrophysics Data System (ADS)

Loiseau, Jason; Higgins, Andrew; Frost, David

2017-06-01

For most high explosives, the ability to accelerate material to some terminal velocity scales with the ratio of material-mass to charge-mass (M/C) according to the Gurney equations. Generally, the Gurney equation for planar geometry accurately predicts the terminal velocity of the driven material until the M/C ratio is reduced to roughly 0.15 or lower; at which point gasdynamic departures from the assumptions in the model result in systematic underpredictions of the material velocity. The authors conducted a series of open-face sandwich flyer plate experiments to measure the scaling of flyer terminal velocity with M/C for a heterogeneous explosive composed of a packed bed of 280 μm steel particles saturated with amine-sensitized nitromethane (90% NM, 10% diethylenetriamine). The propulsive capability of this explosive did not scale according to a modified form of the Gurney equation. Rather, propulsive efficiency increased as the flyer plate became relatively thicker. In the present study the authors have conducted further experiments using this explosive in symmetric sandwiches as well as for normally-incident detonations initiated via a slapping foil to examine how flyer terminal velocity scales with M/C for alternative geometries and loading conditions.

Precise and traceable carbon isotope ratio measurements by multicollector ICP-MS: what next?

PubMed

Santamaria-Fernandez, Rebeca

2010-06-01

This article reviews recent developments in the use of multicollector inductively coupled plasma mass spectrometry (MC-ICP-MS) to provide high-precision carbon isotope ratio measurements. MC-ICP-MS could become an alternative method to isotope ratio mass spectrometry (IRMS) for rapid carbon isotope ratio determinations in organic compounds and characterisation and certification of isotopic reference materials. In this overview, the advantages, drawbacks and potential of the method for future applications are critically discussed. Furthermore, suggestions for future improvements in terms of precision and sensitivity are made. No doubt, this is an exciting analytical challenge and, as such, hurdles will need to be cleared.

Impact of hydrogen SAE J2601 fueling methods on fueling time of light-duty fuel cell electric vehicles

DOE PAGES

Reddi, Krishna; Elgowainy, Amgad; Rustagi, Neha; ...

2017-05-16

Hydrogen fuel cell electric vehicles (HFCEVs) are zero-emission vehicles (ZEVs) that can provide drivers a similar experience to conventional internal combustion engine vehicles (ICEVs), in terms of fueling time and performance (i.e. power and driving range). The Society of Automotive Engineers (SAE) developed fueling protocol J2601 for light-duty HFCEVs to ensure safe vehicle fills while maximizing fueling performance. This study employs a physical model that simulates and compares the fueling performance of two fueling methods, known as the “lookup table” method and the “MC formula” method, within the SAE J2601 protocol. Both the fueling methods provide fast fueling of HFCEVsmore » within minutes, but the MC formula method takes advantage of active measurement of precooling temperature to dynamically control the fueling process, and thereby provides faster vehicle fills. Here, the MC formula method greatly reduces fueling time compared to the lookup table method at higher ambient temperatures, as well as when the precooling temperature falls on the colder side of the expected temperature window for all station types. Although the SAE J2601 lookup table method is the currently implemented standard for refueling hydrogen fuel cell vehicles, the MC formula method provides significant fueling time advantages in certain conditions; these warrant its implementation in future hydrogen refueling stations for better customer satisfaction with fueling experience of HFCEVs.« less

Impact of hydrogen SAE J2601 fueling methods on fueling time of light-duty fuel cell electric vehicles

DOE Office of Scientific and Technical Information (OSTI.GOV)

Reddi, Krishna; Elgowainy, Amgad; Rustagi, Neha

Hydrogen fuel cell electric vehicles (HFCEVs) are zero-emission vehicles (ZEVs) that can provide drivers a similar experience to conventional internal combustion engine vehicles (ICEVs), in terms of fueling time and performance (i.e. power and driving range). The Society of Automotive Engineers (SAE) developed fueling protocol J2601 for light-duty HFCEVs to ensure safe vehicle fills while maximizing fueling performance. This study employs a physical model that simulates and compares the fueling performance of two fueling methods, known as the “lookup table” method and the “MC formula” method, within the SAE J2601 protocol. Both the fueling methods provide fast fueling of HFCEVsmore » within minutes, but the MC formula method takes advantage of active measurement of precooling temperature to dynamically control the fueling process, and thereby provides faster vehicle fills. Here, the MC formula method greatly reduces fueling time compared to the lookup table method at higher ambient temperatures, as well as when the precooling temperature falls on the colder side of the expected temperature window for all station types. Although the SAE J2601 lookup table method is the currently implemented standard for refueling hydrogen fuel cell vehicles, the MC formula method provides significant fueling time advantages in certain conditions; these warrant its implementation in future hydrogen refueling stations for better customer satisfaction with fueling experience of HFCEVs.« less

Are PEEK-on-Ceramic Bearings an Option for Total Disc Arthroplasty? An In Vitro Tribology Study.

PubMed

Siskey, Ryan; Ciccarelli, Lauren; Lui, Melissa K C; Kurtz, Steven M

2016-11-01

Most contemporary total disc replacements (TDRs) use conventional orthopaedic bearing couples such as ultrahigh-molecular-weight polyethylene (polyethylene) and cobalt-chromium (CoCr). Cervical total disc replacements incorporating polyetheretherketone (PEEK) bearings (specifically PEEK-on-PEEK bearings) have been previously investigated, but little is known about PEEK-on-ceramic bearings for TDR. (1) What is the tribologic behavior of a PEEK-on-ceramic bearing for cervical TDR under idealized, clean wear test conditions? (2) How does the PEEK-on-ceramic design perform under impingement conditions? (3) How is the PEEK-on-ceramic bearing affected by abrasive wear? (4) Is the particle morphology from PEEK-on-ceramic bearings for TDRs affected by adverse wear scenarios? PEEK-on-ceramic cervical TDR bearings were subjected to a 10 million cycle ideal wear test based on ASTM F2423 and ISO 181912-1 using a six-station spine wear simulator (MTS, Eden Prairie, MN, USA) with 5 g/L bovine serum concentration at 23° ± 2° C (ambient temperature). Validated 1 million cycle impingement and 5 million cycle abrasive tests were conducted on the PEEK-on-ceramic bearings based, in part, on retrieval analysis of a comparable bearing design as well as finite element analyses. The ceramic-on-PEEK couple was characterized for damage modes, mass and volume loss, and penetration and the lubricant was subjected to particle analysis. The resulting mass wear rate, volumetric wear rate, based on material density, and particle analysis were compared with clinically available cervical disc bearing couples. The three modes of wear (idealized, impingement, and abrasive) resulted in mean mass wear rates of 0.9 ± 0.2 mg/MC, 1.9 ± 0.5 mg/MC, and 2.8 ± 0.6 mg/MC, respectively. The mass wear rates were converted to volumetric wear rates using density and found to be 0.7 ± 0.1 mm 3 /MC, 1.5 ± 0.4 mm 3 /MC, and 2.1 ± 0.5 mm 3 /MC, respectively. During each test, the PEEK endplates were the primary sources of wear and demonstrated an abrasive wear mechanism. Under idealized and impingement conditions, the ceramic core also demonstrated slight polishing of the articulating surface but the change in mass was unmeasurable. During abrasive testing, the titanium transfer on the core was shown to polish over 5 MC of testing. In all cases and consistent with previous studies of other PEEK bearing couples, the particle size was primarily < 2 µm and morphology was smooth and spheroidal. Overall, the idealized PEEK-on-ceramic wear rate (0.7 ± 0.1 mm 3 /MC) appears comparable to the published wear rates for other polymer-on-hard bearing couples (0.3-6.7 mm 3 /MC) and within the range of 0.2 to 1.9 mm 3 /MC reported for PEEK-on-PEEK cervical disc designs. The particles, based on size and morphology, also suggest the wear mechanism is comparable between the PEEK-on-ceramic couple and other polymer-on-ceramic orthopaedic couples. The PEEK-on-ceramic bearing considered in this study is a novel bearing couple for use in total disc arthroplasty devices and will require clinical evaluation to fully assess the bearing couple and total disc design. However, the wear rates under idealized and adverse conditions, and particle size and morphology, suggest that PEEK-on-ceramic bearings may be a reasonable alternative to polyethylene-on-CoCr and metal-on-metal bearings currently used in cervical TDRs.

Mesoporous carbon spheres with controlled porosity for high-performance lithium-sulfur batteries

NASA Astrophysics Data System (ADS)

Wang, Dexian; Fu, Aiping; Li, Hongliang; Wang, Yiqian; Guo, Peizhi; Liu, Jingquan; Zhao, Xiu Song

2015-07-01

Mesoporous carbon (MC) spheres with hierarchical pores, controlled pore volume and high specific surface areas have been prepared by a mass-producible spray drying assisted template method using sodium alginate as carbon precursor and commercial colloidal silica particles as hard template. The resulting MC spheres, possessing hierarchical pores in the range of 3-30 nm, are employed as conductive matrices for the preparation of cathode materials for lithium-sulfur batteries. A high pressure induced one-step impregnation of elemental sulfur into the pore of the MC spheres has been exploited. The electrochemical performances of sulfur-impregnated MC spheres (S-MC) derived from MC spheres with different pore volume and specific surface area but with the same sulfur loading ratio of 60 wt% (S-MC-X-60) have been investigated in details. The S-MC-4-60 composite cathode material displayed a high initial discharge capacity of 1388 mAhg-1 and a good cycling stability of 857 mAhg-1 after 100 cycles at 0.2C, and shows also excellent rate capability of 864 mAhg-1 at 2C. More importantly, the sulfur loading content in MC-4 spheres can reach as high as 80%, and it still can deliver a capacity of 569 mAhg-1 after 100 cycles at 0.2C.

Effect of vertical sleeve gastrectomy in melanocortin receptor 4-deficient rats.

PubMed

Mul, Joram D; Begg, Denovan P; Alsters, Suzanne I M; van Haaften, Gijs; Duran, Karen J; D'Alessio, David A; le Roux, Carel W; Woods, Stephen C; Sandoval, Darleen A; Blakemore, Alexandra I F; Cuppen, Edwin; van Haelst, Mieke M; Seeley, Randy J

2012-07-01

Bariatric surgery is currently the most effective treatment for obesity. Vertical sleeve gastrectomy (VSG), a commonly applied bariatric procedure, involves surgically incising most of the volume of the stomach. In humans, partial loss of melanocortin receptor-4 (MC4R) activity is the most common monogenic correlate of obesity regardless of lifestyle. At present it is unclear whether genetic alteration of MC4R signaling modulates the beneficial effects of VSG. Following VSG, we analyzed body weight, food intake, glucose sensitivity, and macronutrient preference of wild-type and MC4R-deficient (Mc4r(+/-) and Mc4r(-/-)) rats compared with sham-operated controls. VSG reduced body weight and fat mass and improved glucose metabolism and also shifted preference toward carbohydrates and away from fat. All of this occurred independently of MC4R activity. In addition, MC4R was resequenced in 46 human subjects who underwent VSG. We observed common genetic variations in the coding sequence of MC4R in five subjects. However, none of those variations appeared to affect the outcome of VSG. Taken together, these data suggest that the beneficial effect of VSG on body weight and glucose metabolism is not mediated by alterations in MC4R activity.

Effect of vertical sleeve gastrectomy in melanocortin receptor 4-deficient rats

PubMed Central

Mul, Joram D.; Begg, Denovan P.; Alsters, Suzanne I. M.; van Haaften, Gijs; Duran, Karen J.; D'Alessio, David A.; le Roux, Carel W.; Woods, Stephen C.; Sandoval, Darleen A.; Blakemore, Alexandra I. F.; Cuppen, Edwin; van Haelst, Mieke M.

2012-01-01

Bariatric surgery is currently the most effective treatment for obesity. Vertical sleeve gastrectomy (VSG), a commonly applied bariatric procedure, involves surgically incising most of the volume of the stomach. In humans, partial loss of melanocortin receptor-4 (MC4R) activity is the most common monogenic correlate of obesity regardless of lifestyle. At present it is unclear whether genetic alteration of MC4R signaling modulates the beneficial effects of VSG. Following VSG, we analyzed body weight, food intake, glucose sensitivity, and macronutrient preference of wild-type and MC4R-deficient (Mc4r+/− and Mc4r−/−) rats compared with sham-operated controls. VSG reduced body weight and fat mass and improved glucose metabolism and also shifted preference toward carbohydrates and away from fat. All of this occurred independently of MC4R activity. In addition, MC4R was resequenced in 46 human subjects who underwent VSG. We observed common genetic variations in the coding sequence of MC4R in five subjects. However, none of those variations appeared to affect the outcome of VSG. Taken together, these data suggest that the beneficial effect of VSG on body weight and glucose metabolism is not mediated by alterations in MC4R activity. PMID:22535749

Structure formation and microlensing with axion miniclusters

NASA Astrophysics Data System (ADS)

Fairbairn, Malcolm; Marsh, David J. E.; Quevillon, Jérémie; Rozier, Simon

2018-04-01

If the symmetry breaking responsible for axion dark matter production occurs during the radiation-dominated epoch in the early Universe, then this produces large amplitude perturbations that collapse into dense objects known as axion miniclusters. The characteristic minicluster mass, M0, is set by the mass inside the horizon when axion oscillations begin. For the QCD axion M0˜10-10 M⊙, however, for an axionlike particle, M0 can approach M⊙ or higher. Using the Press-Schechter formalism we compute the mass function of halos formed by hierarchical structure formation from these seeds. We compute the concentrations and collapse times of these halos and show that they can grow to be as massive as 1 06M0. Within the halos, miniclusters likely remain tightly bound, and we compute their gravitational microlensing signal taking the fraction of axion dark matter collapsed into miniclusters, fMC, as a free parameter. A large value of fMC severely weakens constraints on axion scenarios from direct detection experiments. We take into account the non-Gaussian distribution of sizes of miniclusters and determine how this affects the number of microlensing events. We develop the tools to consider microlensing by an extended mass function of nonpointlike objects, and we use microlensing data to place the first observational constraints on fMC. This opens a new window for the potential discovery of the axion.

COMPASS: A general purpose computer aided scheduling tool

NASA Technical Reports Server (NTRS)

Mcmahon, Mary Beth; Fox, Barry; Culbert, Chris

1991-01-01

COMPASS is a generic scheduling system developed by McDonnell Douglas under the direction of the Software Technology Branch at JSC. COMPASS is intended to illustrate the latest advances in scheduling technology and provide a basis from which custom scheduling systems can be built. COMPASS was written in Ada to promote readability and to conform to potential NASA Space Station Freedom standards. COMPASS has some unique characteristics that distinguishes it from commercial products. These characteristics are discussed and used to illustrate some differences between scheduling tools.

A Qualitative Analysis of NASA’s Human Computer Interaction Group Examining the Root Causes of Focusing on Derivative System Improvements Versus Core User Needs

DTIC Science & Technology

2017-12-01

emphasis on meeting deliverable dates over a focus on customer service and user experience, a common finding in McGrath and MacMillan’s (2000) research...including suggestions for reducing this burden, to Washington headquarters Services , Directorate for Information Operations and Reports, 1215...structure, process improvements, and training needs as the group prepares to support the retirement of the International Space Station in the 2020s and

COMPASS: An Ada based scheduler

NASA Technical Reports Server (NTRS)

Mcmahon, Mary Beth; Culbert, Chris

1992-01-01

COMPASS is a generic scheduling system developed by McDonnell Douglas and funded by the Software Technology Branch of NASA Johnson Space Center. The motivation behind COMPASS is to illustrate scheduling technology and provide a basis from which custom scheduling systems can be built. COMPASS was written in Ada to promote readability and to conform to DOD standards. COMPASS has some unique characteristics that distinguishes it from commercial products. This paper discusses these characteristics and uses them to illustrate some differences between scheduling tools.

Engaging community businesses in human immunodeficiency virus prevention: a feasibility study.

PubMed

Rovniak, Liza S; Hovell, Melbourne F; Hofstetter, C Richard; Blumberg, Elaine J; Sipan, Carol L; Batista, Marcia F; Martinez-Donate, Ana P; Mulvihill, Mary M; Ayala, Guadalupe X

2010-01-01

To explore the feasibility of engaging community businesses in human immunodeficiency virus (HIV) prevention. Randomly selected business owners/managers were asked to display discreetly wrapped condoms and brochures, both of which were provided free-of-charge for 3 months. Assessments were conducted at baseline, mid-program, and post-program. Customer feedback was obtained through an online survey. Participants were selected from a San Diego, California neighborhood with a high rate of acquired immune deficiency syndrome. Fifty-one business owners/managers who represented 10 retail categories, and 52 customers. Participation rates, descriptive characteristics, number of condoms and brochures distributed, customer feedback, business owners'/managers' program satisfaction, and business owners'/managers' willingness to provide future support for HIV prevention were measured. Kruskal-Wallis, Mann-Whitney U, Fisher's exact, and McNemar's tests were used to analyze data. The 20 business owners/managers (39%) who agreed to distribute condoms and brochures reported fewer years in business and more employees than those who agreed only to distribute brochures (20%) or who refused to participate (41%; p < .05). Bars were the easiest of ten retail categories to recruit. Businesses with more employees and customers distributed more condoms and brochures (p < .05). More than 90% of customers supported distributing condoms and brochures in businesses, and 96% of business owners/managers described their program experience as positive. Businesses are willing to distribute condoms and brochures to prevent HIV. Policies to increase business participation in HIV prevention should be developed and tested.

Energetic Residues and Crater Geometries from the Firing of 120-mm High-Explosive Mortar Projectiles into Eagle River Flats, June 2007

DTIC Science & Technology

2008-07-01

samples. ERDC/CRREL TR-08-10 15 c. US DH-48 isokinetic sampler. Figure 7 (cont’d). The second activity was the collection of soil at the...3 0.28 Mc1/3 0.3 Mc1/3 Ra Apparent radius of the crater in meters Mc Mass of the explosive charge in kilograms Da Apparent depth of the crater in... meters The apparent depth and radius of a crater will increase with the depth of explosive charge below the surface down to a maximum depth called

Cost effectiveness of ergonomic redesign of electronic motherboard.

PubMed

Sen, Rabindra Nath; Yeow, Paul H P

2003-09-01

A case study to illustrate the cost effectiveness of ergonomic redesign of electronic motherboard was presented. The factory was running at a loss due to the high costs of rejects and poor quality and productivity. Subjective assessments and direct observations were made on the factory. Investigation revealed that due to motherboard design errors, the machine had difficulty in placing integrated circuits onto the pads, the operators had much difficulty in manual soldering certain components and much unproductive manual cleaning (MC) was required. Consequently, there were high rejects and occupational health and safety (OHS) problems, such as, boredom and work discomfort. Also, much labour and machine costs were spent on repairs. The motherboard was redesigned to correct the design errors, to allow more components to be machine soldered and to reduce MC. This eliminated rejects, reduced repairs, saved US dollars 581495/year and improved operators' OHS. The customer also saved US dollars 142105/year on loss of business.

The Molecular Design of High-Performance Carbon Materials

DTIC Science & Technology

2008-06-30

Thies MC. Control of mesophase pitch properties by supercritical fluid extraction. Carbon 1998; 36(7-8):953-61. 7] Zhuang M, Gast K, Thies MC...pitch with supercritical toluene. J Supercrit Fluids 1991; 4(1):7-14. 16] Herod AA, Bartle KD, Kandiyoti R. Characterization of heavy...MALDI, mass spectrometry, mesophase, extraction, supercritical , fractionation. 16. SECURITY CLASSIFICATION OF: a. REPORT u b. ABSTRACT u c. THIS

Astronaut William McArthur in medical experiment in SLS-2

NASA Technical Reports Server (NTRS)

1993-01-01

Astronaut William S. McArthur, mission specialist, participates in an experiment using the rebreathing assembly and a gas analyzer mass spectrometer that investigates in-space distribution and movement of blood and gas in the pulmonary system. The data gathered during the two-week flight will be compared with results of tests performed on Earth to determine the changes that occur in pulmonary functions.

Genetic effects on stand-level uniformity, and above- and belowground dry mass production in juvenile loblolly pine

Treesearch

Michael J. Aspinwall; John S. King; Steven E. McKeand; Bronson P. Bullock

2012-01-01

Several decades of tree improvement operations have drastically increased loblolly pine plantation productivity in the southern U.S. (McKeand et al., 2003). This work has lead to the availability of a number of highly productive open-pollinated and full-sib families (McKeand et al., 2006). In addition, vegetative propagation (somatic embryogenesis) has also made it...

SDSS-IV MaNGA: a distinct mass distribution explored in slow-rotating early-type galaxies

NASA Astrophysics Data System (ADS)

Rong, Yu; Li, Hongyu; Wang, Jie; Gao, Liang; Li, Ran; Ge, Junqiang; Jing, Yingjie; Pan, Jun; Fernández-Trincado, J. G.; Valenzuela, Octavio; Ortíz, Erik Aquino

2018-06-01

We study the radial acceleration relation (RAR) for early-type galaxies (ETGs) in the SDSS MaNGA MPL5 data set. The complete ETG sample show a slightly offset RAR from the relation reported by McGaugh et al. (2016) at the low-acceleration end; we find that the deviation is due to the fact that the slow rotators show a systematically higher acceleration relation than the McGaugh's RAR, while the fast rotators show a consistent acceleration relation to McGaugh's RAR. There is a 1σ significant difference between the acceleration relations of the fast and slow rotators, suggesting that the acceleration relation correlates with the galactic spins, and that the slow rotators may have a different mass distribution compared with fast rotators and late-type galaxies. We suspect that the acceleration relation deviation of slow rotators may be attributed to more galaxy merger events, which would disrupt the original spins and correlated distributions of baryons and dark matter orbits in galaxies.

The relationship of gross upper and lower limb motor competence to measures of health and fitness in adolescents aged 13–14 years

PubMed Central

Liu, Francesca; Mahmoud, Wala; Metz, Renske; Beunder, Kyle; Delextrat, Anne; Morris, Martyn G; Esser, Patrick; Collett, Johnny; Meaney, Andy; Howells, Ken; Dawes, Helen

2018-01-01

Introduction Motor competence (MC) is an important factor in the development of health and fitness in adolescence. Aims This cross-sectional study aims to explore the distribution of MC across school students aged 13–14 years old and the extent of the relationship of MC to measures of health and fitness across genders. Methods A total of 718 participants were tested from three different schools in the UK, 311 girls and 407 boys (aged 13–14 years), pairwise deletion for correlation variables reduced this to 555 (245 girls, 310 boys). Assessments consisted of body mass index, aerobic capacity, anaerobic power, and upper limb and lower limb MC. The distribution of MC and the strength of the relationships between MC and health/fitness measures were explored. Results Girls performed lower for MC and health/fitness measures compared with boys. Both measures of MC showed a normal distribution and a significant linear relationship of MC to all health and fitness measures for boys, girls and combined genders. A stronger relationship was reported for upper limb MC and aerobic capacity when compared with lower limb MC and aerobic capacity in boys (t=−2.21, degrees of freedom=307, P=0.03, 95% CI −0.253 to –0.011). Conclusion Normally distributed measures of upper and lower limb MC are linearly related to health and fitness measures in adolescents in a UK sample. Trial registration number NCT02517333. PMID:29629179

Diet-genotype interactions in the development of the obese, insulin-resistant phenotype of C57BL/6J mice lacking melanocortin-3 or -4 receptors.

PubMed

Sutton, Gregory M; Trevaskis, James L; Hulver, Matthew W; McMillan, Ryan P; Markward, Nathan J; Babin, M Josephine; Meyer, Emily A; Butler, Andrew A

2006-05-01

Loss of brain melanocortin receptors (Mc3rKO and Mc4rKO) causes increased adiposity and exacerbates diet-induced obesity (DIO). Little is known about how Mc3r or Mc4r genotype, diet, and obesity affect insulin sensitivity. Insulin resistance, assessed by insulin and glucose tolerance tests, Ser(307) phosphorylation of insulin receptor substrate 1, and activation of protein kinase B, was examined in control and DIO wild-type (WT), Mc3rKO and Mc4rKO C57BL/6J mice. Mc4rKO mice were hyperphagic and had increased metabolic efficiency (weight gain per kilojoule consumed) relative to WT; both parameters increased further on high-fat diet. Obesity of Mc3rKO was more dependent on fat intake, involving increased metabolic efficiency. Fat mass of DIO Mc3rKO and Mc4rKO was similar, although Mc4rKO gained weight more rapidly. Mc4rKO develop hepatic insulin resistance and severe hepatic steatosis with obesity, independent of diet. DIO caused further deterioration of insulin action in Mc4rKO of either sex and, in male Mc3rKO, compared with controls, associated with increased fasting insulin, severe glucose intolerance, and reduced insulin signaling in muscle and adipose tissue. DIO female Mc3rKO exhibited very modest perturbations in glucose metabolism and insulin sensitivity. Consistent with previous data suggesting impaired fat oxidation, both Mc3rKO and Mc4rKO had reduced muscle oxidative metabolism, a risk factor for weight gain and insulin resistance. Energy expenditure was, however, increased in Mc4rKO compared with Mc3rKO and controls, perhaps due to hyperphagia and metabolic costs associated with rapid growth. In summary, DIO affects insulin sensitivity more severely in Mc4rKO compared with Mc3rKO, perhaps due to a more positive energy balance.

Association between LEPR, FTO, MC4R, and PPARG-2 polymorphisms with obesity traits and metabolic phenotypes in school-aged children.

PubMed

Almeida, Sílvia M; Furtado, José M; Mascarenhas, Paulo; Ferraz, Maria E; Ferreira, José C; Monteiro, Mariana P; Vilanova, Manuel; Ferraz, Fernando P

2018-06-01

Evaluate the relationship of leptin receptor (LEPR) rs1137101, fat mass obesity-associated (FTO) receptors 9939609, melanocortin-4 receptors (MC4R) rs2229616 and rs17782313, and proliferator-activated receptor-gamma (PPARG) rs1801282 with clinical and metabolic phenotypes in prepubertal children. What is the effect of polymorphisms on clinical and metabolic phenotypes in prepubertal children? A cross-sectional descriptive study was performed to evaluate anthropometric features, percentage body fat (%BF), biochemical parameters, and genotype in 773 prepubertal children. FTO rs9939609 was associated with an increase in body mass index (BMI) and BMI z-score (zBMI). MC4R rs17782313 was associated with a decrease in BMI and +0.06 units in zBMI. LEPR, and PPARG-2 polymorphisms were associated with decreases in BMI and an increase and decrease units in zBMI, respectively. The homozygous SNPs demonstrated increases (FTO rs993609 and MC4R rs17782313) and decreases (LEPR rs1137101, PPARG rs1801282) in zBMI than the homozygous form of the major allele. In the overweight/obese group, the MC4R rs17782313 CC genotype showed higher average weight, zBMI, waist circumference, waist-circumference-to-height ratio, and waist-hip ratio, and lower BMI, mid-upper arm circumference, calf circumference, and %BF (P< 0.05). FTO rs9939609 AT and AA genotypes were associated with lower triglycerides (P < 0.05). We showed that MC4R rs17782313 and FTO rs9939609 were positively associated with zBMI, with weak and very weak effects, respectively, suggesting a very scarce contribution to childhood obesity. LEPR rs1137101 and PPARG-2 rs1801282 had weak and medium negative effects on zBMI, respectively, and may slightly protect against childhood obesity.

Constructing conceptual meaning from a popular scientific paper—the case of E = mc2

NASA Astrophysics Data System (ADS)

Kapon, Shulamit

2013-01-01

Although high school physics students solve problems using the expression E = mc2, the origin of this expression and its deep conceptual meaning are hardly ever discussed due to students’ limited prior knowledge. In 1946, a year after the atomic bombs were first dropped, Albert Einstein published a popular scientific paper explaining the equivalence between mass and energy to the general public and the implications of this principle for our daily lives. This paper describes the utilization of Einstein’s paper in a high-school physics lesson on the equivalence of mass and energy, and discusses the instructional affordances of discussing exemplary popular scientific texts in a physics lesson.

Health-Related Fitness, Motor Coordination, and Physical and Sedentary Activities of Urban and Rural Children in Suriname.

PubMed

Walhain, Fenna; van Gorp, Marloes; Lamur, Kenneth S; Veeger, Dirkjan H E J; Ledebt, Annick

2016-10-01

Health-related fitness (HRF) and motor coordination (MC) can be influenced by children's environment and lifestyle behavior. This study evaluates the association between living environment and HRF, MC, and physical and sedentary activities of children in Suriname. Tests were performed for HRF (morphological, muscular, and cardiorespiratory component), gross MC (Körperkoordinations Test für Kinder), fine MC (Movement Assessment Battery for Children), and self-reported activities in 79 urban and 77 rural 7-year-old Maroon children. Urban-rural differences were calculated by an independent sample t test (Mann-Whitney U test if not normally distributed) and χ 2 test. No difference was found in body mass index, muscle strength, and the overall score of gross and fine MC. However, urban children scored lower in HRF on the cardiorespiratory component (P ≤ .001), in gross MC on walking backward (P = .014), and jumping sideways (P = 0.011). They scored higher in the gross MC component moving sideways (P ≤ .001) and lower in fine MC on the trail test (P = .036) and reported significantly more sedentary and fewer physical activities than rural children. Living environment was associated with certain components of HRF, MC, and physical and sedentary activities of 7-year-old children in Suriname. Further research is needed to evaluate the development of urban children to provide information for possible intervention and prevention strategies.

Apparatus and Method for Low-Temperature Training of Shape Memory Alloys

NASA Technical Reports Server (NTRS)

Swanger, A. M.; Fesmire, J. E.; Trigwell, S.; Gibson, T. L.; Williams, M. K.; Benafan, O.

2015-01-01

An apparatus and method for the low-temperature thermo-mechanical training of shape memory alloys (SMA) has been developed. The experimental SMA materials are being evaluated as prototypes for applicability in novel thermal management systems for future cryogenic applications. Alloys providing two-way actuation at cryogenic temperatures are the chief target. The mechanical training regimen was focused on the controlled movement of rectangular strips, with S-bend configurations, at temperatures as low as 30 K. The custom holding fixture included temperature sensors and a low heat-leak linear actuator with a magnetic coupling. The fixture was mounted to a Gifford-McMahon cryocooler providing up to 25 W of cooling power at 20 K and housed within a custom vacuum chamber. Operations included both training cycles and verification of shape memory movement. The system design and operation are discussed. Results of the training for select prototype alloys are presented.

Apparatus and method for low-temperature training of shape memory alloys

NASA Astrophysics Data System (ADS)

Swanger, A. M.; Fesmire, J. E.; Trigwell, S.; Gibson, T. L.; Williams, M. K.; Benafan, O.

2015-12-01

An apparatus and method for the low-temperature thermo-mechanical training of shape memory alloys (SMA) has been developed. The experimental SMA materials are being evaluated as prototypes for applicability in novel thermal management systems for future cryogenic applications. Alloys providing two-way actuation at cryogenic temperatures are the chief target. The mechanical training regimen was focused on the controlled movement of rectangular strips, with S-bend configurations, at temperatures as low as 30 K. The custom holding fixture included temperature sensors and a low heat-leak linear actuator with a magnetic coupling. The fixture was mounted to a Gifford-McMahon cryocooler providing up to 25 W of cooling power at 20 K and housed within a custom vacuum chamber. Operations included both training cycles and verification of shape memory movement. The system design and operation are discussed. Results of the training for select prototype alloys are presented.

The Solar Connection of Enhanced Heavy Ion Charge States in the Interplanetary Medium: Implications for the Flux-Rope Structure of CMEs

NASA Technical Reports Server (NTRS)

Gopalswamy, N.; Makela, P.; Akiyama, S.; Xie, H.; Yashiro, S.; Reinard, A. A.

2013-01-01

We investigated a set of 54 interplanetary coronal mass ejection (ICME) events whose solar sources are very close to the disk center (within +/- 15deg from the central meridian). The ICMEs consisted of 23 magnetic-cloud (MC) events and 31 non-MC events. Our analyses suggest that the MC and non-MC ICMEs have more or less the same eruption characteristics at the Sun in terms of soft X-ray flares and CMEs. Both types have significant enhancements in ion charge states, although the non-MC structures have slightly lower levels of enhancement. The overall duration of charge-state enhancement is also considerably smaller than that in MCs as derived from solar wind plasma and magnetic signatures. We find very good correlation between the Fe and O charge-state measurements and the flare properties such as soft X-ray flare intensity and flare temperature for both MCs and non-MCs. These observations suggest that both MC and non-MC ICMEs are likely to have a flux-rope structure and the unfavorable observational geometry may be responsible for the appearance of non-MC structures at 1 AU. We do not find any evidence for an active region expansion resulting in ICMEs lacking a flux-rope structure because the mechanism of producing high charge states and the flux-rope structure at the Sun is the same for MC and non-MC events.

McMillan Magnet School: A Case History of a School Acquiring a Critical Mass of Computer Technology and Internet Connectivity.

ERIC Educational Resources Information Center

Grandgenett, Neal; And Others

McMillan Magnet Center is located in urban Omaha, Nebraska, and specializes in math, computers, and communications. Once a junior high school, it was converted to a magnet center for seventh and eighth graders in the 1983-84 school year as part of Omaha's voluntary desegregation plan. Now the ethnic makeup of the student population is about 50%…

A stability analysis of the power-law steady state of marine size spectra.

PubMed

Datta, Samik; Delius, Gustav W; Law, Richard; Plank, Michael J

2011-10-01

This paper investigates the stability of the power-law steady state often observed in marine ecosystems. Three dynamical systems are considered, describing the abundance of organisms as a function of body mass and time: a "jump-growth" equation, a first order approximation which is the widely used McKendrick-von Foerster equation, and a second order approximation which is the McKendrick-von Foerster equation with a diffusion term. All of these yield a power-law steady state. We derive, for the first time, the eigenvalue spectrum for the linearised evolution operator, under certain constraints on the parameters. This provides new knowledge of the stability properties of the power-law steady state. It is shown analytically that the steady state of the McKendrick-von Foerster equation without the diffusion term is always unstable. Furthermore, numerical plots show that eigenvalue spectra of the McKendrick-von Foerster equation with diffusion give a good approximation to those of the jump-growth equation. The steady state is more likely to be stable with a low preferred predator:prey mass ratio, a large diet breadth and a high feeding efficiency. The effects of demographic stochasticity are also investigated and it is concluded that these are likely to be small in real systems.

Identification and differentiation of methcathinone analogs by gas chromatography-mass spectrometry.

PubMed

Tsujikawa, Kenji; Mikuma, Toshiyasu; Kuwayama, Kenji; Miyaguchi, Hajime; Kanamori, Tatsuyuki; Iwata, Yuko T; Inoue, Hiroyuki

2013-08-01

To overcome a number of challenges involved in analyzing methcathinone (MC) analogues, we performed gas chromatography-mass spectrometry (GC-MS) analysis, including sample preparation, of nine MC analogues - 4-methylmethcathinone, three positional isomers of fluoromethcathinones, 4-methoxymethcathinone, N-ethylcathinone, N,N-dimethylcathinone, buphedrone, and pentedrone. The MC analogues underwent dehydrogenation when the free bases were analyzed using splitless injection. Most of this thermal degradation was prevented using split injection. This indicated that a shorter residence time in the hot injector prevented decomposition. Uniquely, 2-fluoromethcathinone degraded to another product in a process that could not be prevented by the split injection. Replacing the liner with a new, clean one was also effective in preventing thermal degradation. Most of the analytes showed a substantial loss (>30%) when the free base solution in ethyl acetate was evaporated under a nitrogen stream. Adding a small amount of dimethylformamide as a solvent keeper had a noticeable effect, but it did not completely prevent the loss. Three positional isomers of fluoromethcathinones were separated with baseline resolution by heptafluorobutyrylation with a slow column heating rate (8 °C/min) using a non-polar DB-5 ms capillary column. These results will be useful for the forensic analysis of MC analogues in confiscated materials. Copyright © 2012 John Wiley & Sons, Ltd.

Kinetic and mechanistic study of microcystin-LR degradation by nitrous acid under ultraviolet irradiation.

PubMed

Ma, Qingwei; Ren, Jing; Huang, Honghui; Wang, Shoubing; Wang, Xiangrong; Fan, Zhengqiu

2012-05-15

Degradation of microcystin-LR (MC-LR) in the presence of nitrous acid (HNO(2)) under irradiation of 365nm ultraviolet (UV) was studied for the first time. The influence of initial conditions including pH value, NaNO(2) concentration, MC-LR concentration and UV intensity were studied. MC-LR was degraded in the presence of HNO(2); enhanced degradation of MC-LR was observed with 365nm UV irradiation, caused by the generation of hydroxyl radicals through the photolysis of HNO(2). The degradation processes of MC-LR could well fit the pseudo-first-order kinetics. Mass spectrometry was applied for identification of the byproducts and the analysis of degradation mechanisms. Major degradation pathways were proposed according to the results of LC-MS analysis. The degradation of MC-LR was initiated via three major pathways: attack of hydroxyl radicals on the conjugated carbon double bonds of Adda, attack of hydroxyl radicals on the benzene ring of Adda, and attack of nitrosonium ion on the benzene ring of Adda. Copyright © 2012 Elsevier B.V. All rights reserved.

The classification of gunshot residue using laser electrospray mass spectrometry and offline multivariate statistical analysis

USDA-ARS?s Scientific Manuscript database

Nonresonant laser vaporization combined with high-resolution electrospray time-of-flight mass spectrometry enables analysis of a casing after discharge of a firearm revealing organic signature molecules including methyl centralite (MC), diphenylamine (DPA), N-nitrosodiphenylamine (N-NO-DPA), 4-nitro...

Measurement of isotope abundance variations in nature by gravimetric spiking isotope dilution analysis (GS-IDA).

PubMed

Chew, Gina; Walczyk, Thomas

2013-04-02

Subtle variations in the isotopic composition of elements carry unique information about physical and chemical processes in nature and are now exploited widely in diverse areas of research. Reliable measurement of natural isotope abundance variations is among the biggest challenges in inorganic mass spectrometry as they are highly sensitive to methodological bias. For decades, double spiking of the sample with a mix of two stable isotopes has been considered the reference technique for measuring such variations both by multicollector-inductively coupled plasma mass spectrometry (MC-ICPMS) and multicollector-thermal ionization mass spectrometry (MC-TIMS). However, this technique can only be applied to elements having at least four stable isotopes. Here we present a novel approach that requires measurement of three isotope signals only and which is more robust than the conventional double spiking technique. This became possible by gravimetric mixing of the sample with an isotopic spike in different proportions and by applying principles of isotope dilution for data analysis (GS-IDA). The potential and principle use of the technique is demonstrated for Mg in human urine using MC-TIMS for isotopic analysis. Mg is an element inaccessible to double spiking methods as it consists of three stable isotopes only and shows great potential for metabolically induced isotope effects waiting to be explored.

Comparative performance study of different sample introduction techniques for rapid and precise selenium isotope ratio determination using multi-collector inductively coupled plasma mass spectrometry (MC-ICP/MS).

PubMed

Elwaer, Nagmeddin; Hintelmann, Holger

2007-11-01

The analytical performance of five sample introduction systems, a cross flow nebulizer spray chamber, two different solvent desolvation systems, a multi-mode sample introduction system (MSIS), and a hydride generation (LI2) system were compared for the determination of Se isotope ratio measurements using multi-collector inductively coupled plasma mass spectrometry (MC-ICP/MS). The optimal operating parameters for obtaining the highest Se signal-to-noise (S/N) ratios and isotope ratio precision for each sample introduction were determined. The hydride generation (LI2) system was identified as the most suitable sample introduction method yielding maximum sensitivity and precision for Se isotope ratio measurement. It provided five times higher S/N ratios for all Se isotopes compared to the MSIS, 20 times the S/N ratios of both desolvation units, and 100 times the S/N ratios produced by the conventional spray chamber sample introduction method. The internal precision achieved for the (78)Se/(82)Se ratio at 100 ng mL(-1) Se with the spray chamber, two desolvation, MSIS, and the LI2 systems coupled to MC-ICP/MS was 150, 125, 114, 13, and 7 ppm, respectively. Instrument mass bias factors (K) were calculated using an exponential law correction function. Among the five studied sample introduction systems the LI2 showed the lowest mass bias of -0.0265 and the desolvation system showed the largest bias with -0.0321.

An observational estimate of the probability of encounters between mass-losing evolved stars and molecular clouds

NASA Astrophysics Data System (ADS)

Kastner, Joel H.; Myers, P. C.

1994-02-01

One hypothesis for the elevated abundance of Al-26 present during the formation of the solar system is that an asymptotic giant branch (AGB) star expired within the molecular cloud (MC) containing the protosolar nebula. To test this hypothesis for star-forming clouds at the present epoch, we compared nearly complete lists of rapidly mass-losing AGB stars and MCs in the solar neighborhood and identified those stars which are most likely to encounter a nearby cloud. Roughly 10 stars satisfy our selection criteria. We estimated probabilities of encounter for these stars from the position of each star relative to cloud CO emission and the likely star-cloud distance along the line of sight. Typical encounter probabilities are approximately 1%. The number of potential encounters and the probability for each star-cloud pair to result in an encounter suggests that within 1 kpc of the Sun, there is a approximately 1% chance that a given cloud will be visited by a mass-losing AGB star over the next million years. The estimate is dominated by the possibility of encounters involving the stars IRC +60041 and S Cep. Over a MC lifetime, the probability for AGB encounter may be as high as approximately 70%. We discuss the implications of these results for theories of AL-26 enrichment of processed and unprocessed meteoritic inclusions. If the Al-26 in either type of inclusion arose from AGB-MC interaction, the low probability estimated here seems to require that AGB-MC encounters trigger multiple star formation and/or that the production rate of AGB stars was higher during the epoch of solar system formation than at present. Various lines of evidence suggest only the more massive (5-8 solar mass) AGB stars can produce significant AL-26 enrichment of star-forming clouds.

Surface Geometry and Chemistry of Hydrothermally Synthesized Single Crystal Thorium Dioxide

DTIC Science & Technology

2015-03-01

meeting the larger goals. I appreciate Dr. McClory’s skeptical views and critical thinking that kept me from straying into scientific error. I...Secondary Ion Mass Spectrometry .....................20 UPS ......................Ultraviolet Photoemission Spectrometry...19 M1/M2 ................... Mass of atom 1 and atom 2 ..........................................................18 Mm ........................Molar

Mass Communication: A Guide to Reference Sources.

ERIC Educational Resources Information Center

McGill Univ., Montreal (Quebec). McLennan Library.

For the study of mass communication in social, cultural and political contexts, this annotated resource guide presents a list of materials available in the McGill University Libraries in Montreal, Canada. As a select bibliography, the guide concentrates on current sources, although some historical coverage of newspaper and journalism is included.…

The interplay between customer participation and difficulty of design examples in the online designing process and its effect on customer satisfaction: mediational analyses.

PubMed

Chang, Chia-Chi; Chen, Hui-Yun; Huang, I-Chiang

2009-04-01

In the current consumer-centric economy, consumers increasingly desire the opportunity to design their own products in order to express more effectively their self-image. Mass customization, based on efficient and flexible modulization designs, has provided individualized products to satisfy this desire. This work presents an experiment employed to demonstrate that customer participation leads to higher satisfaction. Specifically, the increment in customer satisfaction due to participation is greater when an easy example is provided than when either no example or a difficult one is provided. Additionally, self-congruity plays a mediating role on the customer participation-satisfaction relationship, and this mediating effect varies across different levels of the design example provided in the design process. When an easy design example is present, customer participation has a direct effect on satisfaction, in addition to the indirect effect of self-congruity. When a difficult example is provided, customer participation does not have incremental effects on either self-congruity or customer satisfaction. Finally, when no design example is shown to customers, contrary to our expectation, participation still enhances customer satisfaction due to an increased sense of self-congruity.

Sociodemographic disparities among fast-food restaurant customers who notice and use calorie menu labels.

PubMed

Green, Jessie E; Brown, Alan G; Ohri-Vachaspati, Punam

2015-07-01

As part of the recently passed Patient Protection and Affordable Care Act, chain restaurants with 20 or more locations nationwide will soon be required to post calorie information on menus with the aim of helping customers make healthier food choices. To be effective, this policy must affect all customers, especially those most at risk for poor health and diet outcomes. To determine whether noticing or using calorie menu labels was associated with demographic characteristics of customers at a national fast-food chain currently implementing calorie menu labeling. Cross-sectional analysis. Customer receipts and survey data were collected from 329 participants using street-intercept survey methodology at 29 McDonald's restaurant locations in low- and high-income neighborhoods throughout the Phoenix, AZ, metropolitan area. Calorie menu labeling awareness and use were assessed. The total number of calories purchased was evaluated using participants' itemized receipts. Multivariate logistic regression analyses were used to calculate the odds of customers noticing or using calorie menu labels. Approximately 60% of participants noticed calorie menu labels, whereas only 16% reported using the information for food or beverage purchases. Higher-income individuals had twice the odds of noticing calorie labels (P=0.029) and three times the odds of using them (P=0.004). Significant positive associations were found between individuals with a bachelor's degree or higher and use of calorie menu labels (odds ratio 3.25; P=0.023). Noticing calorie menu labels was not associated with purchasing fewer calories; however, those who reported using calorie information purchased 146 fewer calories than those who did not (P=0.001). Using calorie menu labels is associated with purchasing fewer calories. However, there are significant socioeconomic disparities among customers who notice and use calorie menu labels. Targeted education campaigns are needed to improve the use of menu labeling across all sociodemographic groups. Copyright © 2015 Academy of Nutrition and Dietetics. Published by Elsevier Inc. All rights reserved.

VERSE: a novel approach to detect virus integration in host genomes through reference genome customization.

PubMed

Wang, Qingguo; Jia, Peilin; Zhao, Zhongming

2015-01-01

Fueled by widespread applications of high-throughput next generation sequencing (NGS) technologies and urgent need to counter threats of pathogenic viruses, large-scale studies were conducted recently to investigate virus integration in host genomes (for example, human tumor genomes) that may cause carcinogenesis or other diseases. A limiting factor in these studies, however, is rapid virus evolution and resulting polymorphisms, which prevent reads from aligning readily to commonly used virus reference genomes, and, accordingly, make virus integration sites difficult to detect. Another confounding factor is host genomic instability as a result of virus insertions. To tackle these challenges and improve our capability to identify cryptic virus-host fusions, we present a new approach that detects Virus intEgration sites through iterative Reference SEquence customization (VERSE). To the best of our knowledge, VERSE is the first approach to improve detection through customizing reference genomes. Using 19 human tumors and cancer cell lines as test data, we demonstrated that VERSE substantially enhanced the sensitivity of virus integration site detection. VERSE is implemented in the open source package VirusFinder 2 that is available at http://bioinfo.mc.vanderbilt.edu/VirusFinder/.

Proceedings of the Annual Meeting of the Association for Education in Journalism and Mass Communication (85th, Miami, Florida, August 5-8, 2002). Mass Communication and Society Division.

ERIC Educational Resources Information Center

2002

The Mass Communication and Society Division of the proceedings contains the following 11 papers: "Evaluating the Credibility of Online Information: A Test of Source and Advertising Influence" (Jennifer Greer, Jane Baughman, Patricia Cunningham-Wong, Ethnie Groves, Catherine McCarthy, Megan Myers and Cindy Petterson); "Disruptive and…

A McOndo Writer's Take on Literature in the Era of Audiovisual and Digital Communication: The Case of Alberto Fuguet's "Las Peliculas de mi vida"

ERIC Educational Resources Information Center

Maier, Linda S.

2011-01-01

Alberto Fuguet, one of the leaders of the McOndo writers who seek cultural direction from the United States and exploit mass-media formulas, is a polarizing figure in contemporary Latin American culture. His most recent full-length novel, the semi-autobiographical "Las peliculas de mi vida" (2003), has led many to conclude that Fuguet is simply a…

Demonstration/Validation of the Snap Sampler Passive Groundwater Sampling Device at the Former McClellan Air Force Base

DTIC Science & Technology

2011-02-01

and Development Center Fe Iron gpd Gallons per Day HDPE High Density Polyethylene Hg Mercury ICP Inductively Coupled Plasma ICP/MS...Inductively Coupled Plasma Mass Spectrometry IROD Interim Record of Decision ITRC Interstate Technology and Regulatory Council K Potassium Kow...alkaline earth metals, alkali metals, and a metalloid, were sampled. This particular demonstration took place at the McClellan Air Force Base (AFB) in

Proceedings of the 7th Annual TARDEC Ground Vehicle Survivability Symposium, March 26-28, 1996, Naval Postgraduate School, Monterey, CA Volume 1 - Unclassified Session Papers

DTIC Science & Technology

1996-05-01

McClelland, Technical Director, U.S. Army Submitted TARDEC 9:25 A.M. Keynote None Dr. Kenneth J. Oscar, Deputy Assistant Secretary of the Army...Submitted for Procurement 9:50 A.M. Industry Perspective Vol. 1 .3 Dr. Kenneth M. Krall, Vice President - Advanced Programs & Technology, Loral Vought...Project Manager (PM), Light Tactical Vehicles 12:00 A.M. Defense Supply Center Business Processes - Meeting Vol. 1 57 Customer Needs COL Joseph M

An Observational Study of Consumers’ Accessing of Nutrition Information in Chain Restaurants

PubMed Central

Agnew, Henry; Brownell, Kelly D.

2009-01-01

In this observational study, we determined how frequently consumers accessed on-premises nutrition information provided at chain restaurants. The number of patrons entering and accessing nutrition information was recorded at 8 locations that were part of 4 major restaurant chains (McDonald's, Burger King, Starbucks, and Au Bon Pain). Only 6 (0.1%) of 4311 patrons accessed on-premises nutrition information before purchasing food. This very small percentage suggests that such information should be more prominently displayed, such as on restaurant menu boards, to help customers make informed decisions. PMID:19299679

An observational study of consumers' accessing of nutrition information in chain restaurants.

PubMed

Roberto, Christina A; Agnew, Henry; Brownell, Kelly D

2009-05-01

In this observational study, we determined how frequently consumers accessed on-premises nutrition information provided at chain restaurants. The number of patrons entering and accessing nutrition information was recorded at 8 locations that were part of 4 major restaurant chains (McDonald's, Burger King, Starbucks, and Au Bon Pain). Only 6 (0.1%) of 4311 patrons accessed on-premises nutrition information before purchasing food. This very small percentage suggests that such information should be more prominently displayed, such as on restaurant menu boards, to help customers make informed decisions.

Precise and accurate in situ Pb-Pb dating of apatite, monazite, and sphene by laser ablation multiple-collector ICP-MS

NASA Astrophysics Data System (ADS)

Willigers, B. J. A.; Baker, J. A.; Krogstad, E. J.; Peate, D. W.

2002-03-01

To evaluate in situ Pb dating by laser ablation multiple-collector inductively coupled plasma mass spectrometry (LA-MC-ICP-MS), we analysed apatite, sphene, and monazite from Paleoproterozoic metamorphic rocks from West Greenland. Pb isotope ratios were also determined in the National Institute of Standards and Technology (NIST) 610 glass standard and were corrected for mass fractionation by reference to the measured thallium isotope ratio. The NIST 610 glass was used to monitor Pb isotope mass fractionation in the low Tl/Pb accessory minerals. Replicate analyses of the glass (1 to 2 min) yielded ratios with an external reproducibility comparable to conventional analyses of standard reference material 981 by thermal ionisation mass spectrometry (TIMS). Mineral grains were generally analysed with a 100-μm laser beam, although some monazite crystals were analysed at smaller spot sizes (10 and 25 μm). The common Pb isotope ratios required for age calculations were either measured on coexisting plagioclase by LA-MC-ICP-MS or could be ignored, as individual crystals exhibit sufficient Pb isotopic heterogeneity to perform isochron calculations on replicate analyses of single crystals. Mean mineral ages with the 204Pb ion beam measured in the multiplier were as follows: apatite, 1715 ± 23 m.y.; sphene, 1789 ± 11 m.y.; and monazite, 1783 to 1888 m.y., with relative uncertainties on individual monazite ages of <0.2% but highly reproducible age determinations on single monazite crystals (≪1%). Isochron ages calculated from several mineral analyses without assumption of common Pb also yield precise age determinations. Apatite and monazite Pb ages determined by in situ Pb isotope analysis are identical to those determined by conventional TIMS analysis of bulk mineral separates, and the analytical uncertainties of these short laser analyses with no prior mechanical or chemical separation are comparable to those obtained by TIMS. Detailed examination of the sphene in situ age data does, however, show a small discrepancy between the LA-MC-ICP-MS and TIMS ages (˜1% younger). High-resolution mass scans of the sphene during ablation clearly showed several small and as yet unidentified isobaric interferences that overlap with the 207Pb peak at the resolution conditions for measurement of isotope ratios. These might account for the age discrepancy between the LA-MC-ICP-MS and TIMS sphene ages. LA-MC-ICP-MS is a rapid, accurate, and precise method for in situ determination of Pb isotope ratios that can be used for geochronological studies in a manner similar to an ion microprobe, albeit currently at a somewhat degraded spatial resolution. Further modifications to the LA-MC-ICP-MS system, such as improved sensitivity, ion transmission, and LA methodology, may lead to this type of instrument becoming the method of choice for many types of in situ Pb isotope dating.

Liquid chromatography/negative electrospray ionization ion trap MS(2) mass spectrometry application for the determination of microcystins occurrence in Southern Portugal water reservoirs.

PubMed

Rodrigues, M A; Reis, M P; Mateus, M C

2013-11-01

Microcystins (MCs) are toxins produced by cyanobacteria which are common organisms in the phytoplankton of eutrophic lakes, rivers and freshwater reservoirs. In the present work, a novel method of liquid chromatography-electrospray ion trap tandem mass spectrometry (LC/ESI/Ion trap-MS/MS), operated in the negative ionization mode, was developed for the analysis of these cyanotoxins. The method was applied to determine the amounts of total microcystins-LR, -YR and -RR in two water reservoirs in Southern Portugal, namely Alqueva and Beliche. A total of 30 water samples were analysed along 2011. Solid phase extraction (SPE) was used for sample cleaning-up and analyte enrichment. The extracted toxins were separated on a C18 column with a gradient of acetonitrile/water with 0.1% formic acid. Detection of microcystins was carried out using multiple reaction monitoring (MRM) in the negative polarity mode, as this method gave a higher selectivity. The MC-RR, YR and LR quantification limits were 17.9, 31.7 and 15.8 ng/L, respectively; quite below the limits recommended by WHO guidelines for drinking water (1 μg/L). Total MC highest concentrations were found in the warm months of June, July and September in Alqueva sampling sites, with concentrations of MC LR and RR ranging 17-344 and 25-212 ng/L, respectively, showing comparable results for MC-RR and LR and slightly lower concentration of MC-YR. Detected values for Beliche reservoir were below quantification limits. Copyright © 2013 Elsevier Ltd. All rights reserved.

SU-E-J-205: Monte Carlo Modeling of Ultrasound Probes for Real-Time Ultrasound Image-Guided Radiotherapy

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hristov, D; Schlosser, J; Bazalova, M

2014-06-01

Purpose: To quantify the effect of ultrasound (US) probe beam attenuation for radiation therapy delivered under real-time US image guidance by means of Monte Carlo (MC) simulations. Methods: MC models of two Philips US probes, an X6-1 matrix-array transducer and a C5-2 curved-array transducer, were built based on their CT images in the EGSnrc BEAMnrc and DOSXYZnrc codes. Due to the metal parts, the probes were scanned in a Tomotherapy machine with a 3.5 MV beam. Mass densities in the probes were assigned based on an electron density calibration phantom consisting of cylinders with mass densities between 0.2–8.0 g/cm{sup 3}.more » Beam attenuation due to the probes was measured in a solid water phantom for a 6 MV and 15 MV 15x15 cm{sup 2} beam delivered on a Varian Trilogy linear accelerator. The dose was measured with the PTW-729 ionization chamber array at two depths and compared to MC simulations. The extreme case beam attenuation expected in robotic US image guided radiotherapy for probes in upright position was quantified by means of MC simulations. Results: The 3.5 MV CT number to mass density calibration curve was found to be linear with R{sup 2} > 0.99. The maximum mass densities were 4.6 and 4.2 g/cm{sup 3} in the C5-2 and X6-1 probe, respectively. Gamma analysis of the simulated and measured doses revealed that over 98% of measurement points passed the 3%/3mm criteria for both probes and measurement depths. The extreme attenuation for probes in upright position was found to be 25% and 31% for the C5-2 and X6-1 probe, respectively, for both 6 and 15 MV beams at 10 cm depth. Conclusion: MC models of two US probes used for real-time image guidance during radiotherapy have been built. As a Result, radiotherapy treatment planning with the imaging probes in place can now be performed. J Schlosser is an employee of SoniTrack Systems, Inc. D Hristov has financial interest in SoniTrack Systems, Inc.« less

[Research on the threshold of Chl-a in Lake Taihu based on microcystins].

PubMed

Wei, Dai-chun; Su, Jing; Ji, Dan-feng; Fu, Xiao-yong; Wang, Ji; Huo, Shou-liang; Cui, Chi-fei; Tang, Jun; Xi, Bei-dou

2014-12-01

Water samples were collected in Lake Taihu from June to October in 2013 in order to investigate the threshold of chlorophyll a (Chl-a). The concentrations of three microcystins isomers (MC-LR, MC-RR, MC-YR) were detected by means of solid phase extraction and high performance liquid chromatography-tandem mass spectrometry. The correlations between various MCs and eutrophication factors, for instance of total nitrogen (TN), total phosphorus (TP), chlorophyll a, permanganate index etc were analyzed. The threshold of Chl-a was studied based on the relationships between MC-LR, MCs and Chl-a. The results showed that Lake Taihu was severely polluted by MCs and its spatial distribution could be described as follows: the concentration in Meiliang Bay was the highest, followed by Gonghu Bay and Western Lake, and Lake Center; the least polluted areas were in Lake Xuhu and Southern Lake. The concentration of MC-LR was the highest among the 3 MCs. The correlation analysis indicated that MC-LR, MC-RR, MC-YR and MCs had very positive correlation with permanganate index, TN, TP and Chl-a (P < 0.01). The threshold value of Chl-a was 12.26 mg x m(-3) according to the standard thresholds of MC-LR and MCs in drinking water. The threshold value of Chl-a in Lake Taihu was very close to the standard in the State of North Carolina, which demonstrated that the threshold value provided in this study was reasonable.

Reproductive success of Horned Lark and McCown's Longspur in relation to wind energy infrastructure

USGS Publications Warehouse

Mahoney, Anika; Chalfoun, Anna D.

2016-01-01

Wind energy is a rapidly expanding industry with potential indirect effects to wildlife populations that are largely unexplored. In 2011 and 2012, we monitored 211 nests of 2 grassland songbirds, Horned Lark (Eremophila alpestris) and McCown's Longspur (Rhynchophanes mccownii), at 3 wind farms and 2 undeveloped reference sites in Wyoming, USA. We evaluated several indices of reproductive investment and success: clutch size, size-adjusted nestling mass, daily nest survival rate, and number of fledglings. We compared reproductive success between wind farms and undeveloped sites and modeled reproductive success within wind farms as a function of wind energy infrastructure and habitat. Size-adjusted nestling mass of Horned Lark was weakly negatively related to turbine density. In 2011, nest survival of Horned Lark decreased 55% as turbine density increased from 10 to 39 within 2 km of the nest. In 2012, however, nest survival of Horned Lark was best predicted by the combination of vegetation height, distance to shrub edge, and turbine density, with survival increasing weakly with increasing vegetation height. McCown's Longspur nest survival was weakly positively related to vegetation density at the nest site when considered with the amount of grassland habitat in the neighborhood and turbine density within 1 km of the nest. Habitat and distance to infrastructure did not explain clutch size or number of fledglings for either species, or size-adjusted nestling mass for McCown's Longspur. Our results suggest that the influence of wind energy infrastructure varies temporally and by species, even among species using similar habitats. Turbine density was repeatedly the most informative measure of wind energy development. Turbine density could influence wildlife responses to wind energy production and may become increasingly important to consider as development continues in areas with high-quality wind resources.

THE EVIL-MC MODEL FOR ELLIPSOIDAL VARIATIONS OF PLANET-HOSTING STARS AND APPLICATIONS TO THE HAT-P-7 SYSTEM

DOE Office of Scientific and Technical Information (OSTI.GOV)

Jackson, Brian K.; Lewis, Nikole K.; Showman, Adam P.

2012-06-01

We present a new model for Ellipsoidal Variations Induced by a Low-Mass Companion, the EVIL-MC model. We employ several approximations appropriate for planetary systems to substantially increase the computational efficiency of our model relative to more general ellipsoidal variation models and improve upon the accuracy of simpler models. This new approach gives us a unique ability to rapidly and accurately determine planetary system parameters. We use the EVIL-MC model to analyze Kepler Quarter 0-2 (Q0-2) observations of the HAT-P-7 system, an F-type star orbited by a {approx} Jupiter-mass companion. Our analysis corroborates previous estimates of the planet-star mass ratio qmore » = (1.10 {+-} 0.06) Multiplication-Sign 10{sup -3}, and we have revised the planet's dayside brightness temperature to 2680{sup +10}{sub -20} K. We also find a large difference between the day- and nightside planetary flux, with little nightside emission. Preliminary dynamical+radiative modeling of the atmosphere indicates that this result is qualitatively consistent with high altitude absorption of stellar heating. Similar analyses of Kepler and CoRoT photometry of other planets using EVIL-MC will play a key role in providing constraints on the properties of many extrasolar systems, especially given the limited resources for follow-up and characterization of these systems. However, as we highlight, there are important degeneracies between the contributions from ellipsoidal variations and planetary emission and reflection. Consequently, for many of the hottest and brightest Kepler and CoRoT planets, accurate estimates of the planetary emission and reflection, diagnostic of atmospheric heat budgets, will require accurate modeling of the photometric contribution from the stellar ellipsoidal variation.« less

Effects of Different Lifting Cadences on Ground Reaction Forces during the Squat Exercise

NASA Technical Reports Server (NTRS)

Bentley, Jason R.; Amonette, William E.; Hagan, R. Donald

2008-01-01

The purpose of this investigation was to determine the effect of different cadences on the ground reaction force (GRF(sub R)) during the squat exercise. It is known that squats performed with greater acceleration will produce greater inertial forces; however, it is not well understood how different squat cadences affect GRF(sub R). It was hypothesized that faster squat cadences will result in greater peak GRF(sub R). METHODS: Six male subjects (30.8+/-4.4 y, 179.5+/-8.9 cm, 88.8+/-13.3 kg) with previous squat experience performed three sets of three squats using three different cadences (FC = 1 sec descent/1 sec ascent; MC = 3 sec descent/1 sec ascent; SC = 4 sec descent/2 sec ascent) with barbell mass equal to body mass. Ground reaction force was used to calculate inertial force trajectories of the body plus barbell (FI(sub system)). Forces were normalized to body mass. RESULTS: Peak GRF(sub R) and peak FI(sub system) were significantly higher in FC squats compared to MC (p=0.0002) and SC (p=0.0002). Range of GRF(sub R) and FI(sub system) were also significantly higher in FC compared to MC (p<0.05), and MC were significantly higher than SC (p<0.05). DISCUSSION: Faster squat cadences result in significantly greater peak GRF(sub R) due to the inertia of the system. GRF(sub R) was more dependent upon decent cadence than on ascent cadence. PRACTICAL APPLICATION: This study demonstrates that faster squat cadences produce greater ground reaction forces. Therefore, the use of faster squat cadences might enhance strength and power adaptations to long-term resistance exercise training. Key Words: velocity, weight training, resistive exercise

The biodegradation of microcystins in temperate freshwater bodies with previous cyanobacterial history.

PubMed

Dziga, Dariusz; Maksylewicz, Anna; Maroszek, Magdalena; Budzyńska, Agnieszka; Napiorkowska-Krzebietke, Agnieszka; Toporowska, Magdalena; Grabowska, Magdalena; Kozak, Anna; Rosińska, Joanna; Meriluoto, Jussi

2017-11-01

Cyanobacterial blooms and cyanotoxins occur in freshwater lakes and reservoirs all over the world. Bacterial degradation of microcystins (MC), hepatotoxins produced by several cyanobacterial species, has also been broadly documented. However, information regarding MC biodegradation in European water bodies is very limited. In this paper, the occurrence and identification of MC biodegradation products was documented for 21 European lakes and reservoirs, many of which have well-documented cyanobacterial bloom histories. Varying cyanobacterial abundance and taxonomical composition were documented and MC producers were found in all the analysed samples. Planktothrix agardhii was the most common cyanobacterial species and it formed mass occurrences in four lakes. MC biodegradation was observed in 86% of the samples (18 out of 21), and four products of dmMC-LR decomposition were detected by HPLC and LC-MS methods. The two main products were cyclic dmMC-LR with modifications in the Arg-Asp-Leu region; additionally one product was recognized as the tetrapeptide Adda-Glu-Mdha-Ala. The composition of the detected products suggested a new biochemical pathway of MC degradation. The results confirmed the hypothesis that microcystin biodegradation is a common phenomenon in central European waters and that it may occur by a mechanism which is different from the one previously reported. Such a finding implies the necessity to develop a more accurate methodology for screening bacteria with MC biodegradation ability. Furthermore, it warrants new basic and applied studies on the characterization and utilization of new MC-degrading strains and biodegradation pathways. Copyright © 2017. Published by Elsevier Inc.

Determination of microcystin-LR in drinking water using UPLC tandem mass spectrometry-matrix effects and measurement.

PubMed

Li, Wei; Duan, Jinming; Niu, Chaoying; Qiang, Naichen; Mulcahy, Dennis

2011-10-01

A simple detection method using ultra-performance liquid chromatography electrospray ionisation tandem mass spectrometry (UPLC-ESI-MS-MS) coupled with the sample dilution method for determining trace microcystin-LR (MC-LR) in drinking water is presented. The limit of detection (LOD) was 0.04 µg/L and the limit of quantitation (LOQ) was 0.1 µg/L. Water matrix effects of ionic strength, dissolved organic carbon (DOC) and pH were examined. The results indicate that signal detection intensity for MC-LR was significantly suppressed as the ionic strength increased from ultrapure water condition, whereas it increased slightly with solution pH and DOC at low concentrations. However, addition of methanol (MeOH) into the sample was able to counter the signal suppression effects. In this study, dilution of the tap water sample by adding 4% MeOH (v/v) was observed to be adequate to compensate for the signal suppression. The recoveries of the samples fortified with MC-LR (0.2, 1, and 10 µg/L) for three different tap water samples ranged from 84.4% to 112.9%.

Development of routines for simultaneous in situ chemical composition and stable Si isotope ratio analysis by femtosecond laser ablation inductively coupled plasma mass spectrometry.

PubMed

Frick, Daniel A; Schuessler, Jan A; von Blanckenburg, Friedhelm

2016-09-28

Stable metal (e.g. Li, Mg, Ca, Fe, Cu, Zn, and Mo) and metalloid (B, Si, Ge) isotope ratio systems have emerged as geochemical tracers to fingerprint distinct physicochemical reactions. These systems are relevant to many Earth Science questions. The benefit of in situ microscale analysis using laser ablation (LA) over bulk sample analysis is to use the spatial context of different phases in the solid sample to disclose the processes that govern their chemical and isotopic compositions. However, there is a lack of in situ analytical routines to obtain a samples' stable isotope ratio together with its chemical composition. Here, we evaluate two novel analytical routines for the simultaneous determination of the chemical and Si stable isotope composition (δ(30)Si) on the micrometre scale in geological samples. In both routines, multicollector inductively coupled plasma mass spectrometry (MC-ICP-MS) is combined with femtosecond-LA, where stable isotope ratios are corrected for mass bias using standard-sample-bracketing with matrix-independent calibration. The first method is based on laser ablation split stream (LASS), where the laser aerosol is split and introduced simultaneously into both the MC-ICP-MS and a quadrupole ICP-MS. The second method is based on optical emission spectroscopy using direct observation of the MC-ICP-MS plasma (LA-MC-ICP-MS|OES). Both methods are evaluated using international geological reference materials. Accurate and precise Si isotope ratios were obtained with an uncertainty typically better than 0.23‰, 2SD, δ(30)Si. With both methods major element concentrations (e.g., Na, Al, Si, Mg, Ca) can be simultaneously determined. However, LASS-ICP-MS is superior over LA-MC-ICP-MS|OES, which is limited by its lower sensitivity. Moreover, LASS-ICP-MS offers trace element analysis down to the μg g(-1)-range for more than 28 elements due to lower limits of detection, and with typical uncertainties better than 15%. For in situ simultaneous stable isotope measurement and chemical composition analysis LASS-ICP-MS in combination with MC-ICP-MS is the method of choice. Copyright © 2016 Elsevier B.V. All rights reserved.

Customer loads of two-wheeled vehicles

NASA Astrophysics Data System (ADS)

Gorges, C.; Öztürk, K.; Liebich, R.

2017-12-01

Customer usage profiles are the most unknown influences in vehicle design targets and they play an important role in durability analysis. This publication presents a customer load acquisition system for two-wheeled vehicles that utilises the vehicle's onboard signals. A road slope estimator was developed to reveal the unknown slope resistance force with the help of a linear Kalman filter. Furthermore, an automated mass estimator was developed to consider the correct vehicle loading. The mass estimation is performed by an extended Kalman filter. Finally, a model-based wheel force calculation was derived, which is based on the superposition of forces calculated from measured onboard signals. The calculated wheel forces were validated by measurements with wheel-load transducers through the comparison of rainflow matrices. The calculated wheel forces correspond with the measured wheel forces in terms of both quality and quantity. The proposed methods can be used to gather field data for improved vehicle design loads.

Advantages of utilizing DMD based rapid manufacturing systems in mass customization applications

NASA Astrophysics Data System (ADS)

El-Siblani, A.

2010-02-01

The Use of DMD based Rapid Manufacturing Systems has proven to be very advantageous in the production of highly accurate plastic based components for use in mass customization market such as hearing aids, and dental markets. The voxelization process currently afforded with the DLP technology eliminates any layering effect associated with all existing additive Rapid Manufacturing technologies. The smooth accurate surfaces produced in an additive process utilizing DLP technology, through the voxelization approach, allow for the production of custom finished products. The implementation of DLP technology in rapid prototyping and rapid manufacturing systems allow for the usage of highly viscous photopolymer based liquid and paste composites for rapid manufacturing that could not be used in any other additive process prior to implementation of DLP technology in RP and RM systems. It also allowed for the greater throughput in production without sacrificing quality and accuracy.

Characteristics and development report for the MC3246A thermal battery

NASA Astrophysics Data System (ADS)

Scharrer, G. L.; Lasky, F. P. R.; Moya, L. M.

1991-09-01

This report describes the design intent, design considerations, system use, development, product characteristics, and early production history of the MC3246A Thermal Battery. This battery has a required operating life of 50 ms above 18.0 V across a 0.68 ohm load. The MC3246A employs the Li(Si)/LiBr-LiCl-LiF/FeS2 electrochemical system. The battery is a hermetically sealed right circular cylinder, 51 mm long and 38 mm in diameter. The mass of the battery is 176 grams. The battery was designed and developed to replace the MC3246 (used on the B83 and B61-7 Preflight Controllers) and to provide the power needed by the Preflight Controllers for the B61-6,8 and the B90. This is the first DOE thermal battery to use the all-lithium electrolyte.

Evaluation of a mass flow sensor at a gin

USDA-ARS?s Scientific Manuscript database

As part of a system to optimize the cotton ginning process, a custom-built mass flow sensor was evaluated at USDA-ARS Cotton Ginning Research Unit at Stoneville, Mississippi. The mass flow sensor was fabricated based on the principle of the sensor patented by Thomasson and Sui. The optical and ele...

The propulsive capability of explosives heavily loaded with inert materials

NASA Astrophysics Data System (ADS)

Loiseau, J.; Georges, W.; Frost, D. L.; Higgins, A. J.

2018-01-01

The effect of inert dilution on the accelerating ability of high explosives for both grazing and normal detonations was studied. The explosives considered were: (1) neat, amine-sensitized nitromethane (NM), (2) packed beds of glass, steel, or tungsten particles saturated with amine-sensitized NM, (3) NM gelled with PMMA containing dispersed glass microballoons, (4) NM gelled with PMMA containing glass microballoons and steel particles, and (5) C-4 containing varying mass fractions of glass or steel particles. Flyer velocity was measured via photonic Doppler velocimetry, and the results were analysed using a Gurney model augmented to include the influence of the diluent. Reduction in accelerating ability with increasing dilution for the amine-sensitized NM, gelled NM, and C-4 was measured experimentally. Variation of flyer terminal velocity with the ratio of flyer mass to charge mass (M/C) was measured for both grazing and normally incident detonations in gelled NM containing 10% microballoons by mass and for steel beads saturated with amine-sensitized NM. Finally, flyer velocity was measured in grazing versus normal loading for a number of explosive admixtures. The augmented Gurney model predicted the effect of dilution on accelerating ability and the scaling of flyer velocity with M/C for mixtures containing low-density diluents. The augmented Gurney model failed to predict the scaling of flyer velocity with M/C for mixtures heavily loaded with dense diluents. In all cases, normally incident detonations propelled flyers to higher velocity than the equivalent grazing detonations because of material velocity imparted by the incident shock wave and momentum/energy transfer from the slapper used to uniformly initiate the charge.

Precise U and Pu isotope ratio measurements in nuclear samples by hyphenating capillary electrophoresis and MC-ICPMS.

PubMed

Martelat, Benoit; Isnard, Helene; Vio, Laurent; Dupuis, Erwan; Cornet, Terence; Nonell, Anthony; Chartier, Frederic

2018-06-22

Precise isotopic and elemental characterization of spent nuclear fuel is a major concern for the validation of the neutronic calculation codes and waste management strategy in the nuclear industry. Generally, the elements of interest, particularly U and Pu which are the two major elements present in spent fuel, are purified by ion exchange or extractant resins before off-line measurements by thermal ionization mass spectrometry. The aim of the present work was to develop a new analytical approach based on capillary electrophoresis (CE) hyphenated to a multicollector inductively coupled plasma mass spectrometer (MC-ICPMS) for online isotope ratio measurements. An electrophoretic separation protocol of U, Pu and the fraction containing fission products and minor actinides (Am and Cm) was developed using acetic acid as the electrolyte and complexing agent. The instrumentation for CE was designed to be used in a glove box and a laboratory-built interface was developed for hyphenation with MC-ICPMS. The separation was realized with only a few nL of a solution of spent nuclear fuel and the reproducibilities obtained on the U and Pu isotope ratios were on the order of a few ‰ which is comparable to those obtained by thermal ionization mass spectrometer (TIMS). This innovative protocol allowed a tremendous reduction of the analyte masses from μg to ng and also a drastic reduction of the liquid waste production from mL to μL. In addition, the time of analysis was shorted by at least a factor three. All of these improved parameters are of major interest for nuclear applications.

A Barnard's Star Perturbation Search Using McCormick Observatory Photographic Plate Material

NASA Astrophysics Data System (ADS)

Bartlett, J.; Ianna, P.

2001-05-01

Barnard's Star is of particular interest due to its high proper motion, nearness to the Solar System, and previous claims of planetary companions. Based upon observations made at the Sproul Observatory between 1916 and 1962, Peter van de Kamp claimed the star had a 24-year period and a planetary companion of about 1.6 Jupiter masses (Van de Kamp, AJ, 68, 515, 1963). Later, based on Sproul observations from 1938 to 1974, Van de Kamp found that the perturbation was better fit by two companions with 11.5- and 20 or 25-year orbits and corresponding masses of 1 and 0.5 Jupiter masses (Van de Kamp, ARA&A, 13, 295, 1975). Searches by other observers over shorter periods of time or with fewer exposures failed to find clear indications of planetary companions (Gatewood and Eichhorn, AJ, 78, 769, 1973). However, the McCormick Observatory has more than 900 exposures made on photographic plates between 1969 and 1998. In view of the continuing controversy, reviewing these data to identify any perturbations indicative of a companion is worthwhile. Therefore, we scanned the plates on the microdensitometer (PDS) at the McCormick Observatory. We present the results of a time-series analysis to search these observations for one or more perturbations. We acknowledge support from NSF grant AST 98-20711 and from Litton Marine Systems, Incorporated.

Monte Carlo modeling of ultrasound probes for image guided radiotherapy

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bazalova-Carter, Magdalena, E-mail: bazalova@uvic.ca; Schlosser, Jeffrey; Chen, Josephine

2015-10-15

Purpose: To build Monte Carlo (MC) models of two ultrasound (US) probes and to quantify the effect of beam attenuation due to the US probes for radiation therapy delivered under real-time US image guidance. Methods: MC models of two Philips US probes, an X6-1 matrix-array transducer and a C5-2 curved-array transducer, were built based on their megavoltage (MV) CT images acquired in a Tomotherapy machine with a 3.5 MV beam in the EGSnrc, BEAMnrc, and DOSXYZnrc codes. Mass densities in the probes were assigned based on an electron density calibration phantom consisting of cylinders with mass densities between 0.2 andmore » 8.0 g/cm{sup 3}. Beam attenuation due to the US probes in horizontal (for both probes) and vertical (for the X6-1 probe) orientation was measured in a solid water phantom for 6 and 15 MV (15 × 15) cm{sup 2} beams with a 2D ionization chamber array and radiographic films at 5 cm depth. The MC models of the US probes were validated by comparison of the measured dose distributions and dose distributions predicted by MC. Attenuation of depth dose in the (15 × 15) cm{sup 2} beams and small circular beams due to the presence of the probes was assessed by means of MC simulations. Results: The 3.5 MV CT number to mass density calibration curve was found to be linear with R{sup 2} > 0.99. The maximum mass densities in the X6-1 and C5-2 probes were found to be 4.8 and 5.2 g/cm{sup 3}, respectively. Dose profile differences between MC simulations and measurements of less than 3% for US probes in horizontal orientation were found, with the exception of the penumbra region. The largest 6% dose difference was observed in dose profiles of the X6-1 probe placed in vertical orientation, which was attributed to inadequate modeling of the probe cable. Gamma analysis of the simulated and measured doses showed that over 96% of measurement points passed the 3%/3 mm criteria for both probes placed in horizontal orientation and for the X6-1 probe in vertical orientation. The X6-1 probe in vertical orientation caused the highest attenuation of the 6 and 15 MV beams, which at 10 cm depth accounted for 33% and 43% decrease compared to the respective (15 × 15) cm{sup 2} open fields. The C5-2 probe in horizontal orientation, on the other hand, caused a dose increase of 10% and 53% for the 6 and 15 MV beams, respectively, in the buildup region at 0.5 cm depth. For the X6-1 probe in vertical orientation, the dose at 5 cm depth for the 3-cm diameter 6 MV and 5-cm diameter 15 MV beams was attenuated compared to the corresponding open fields to a greater degree by 65% and 43%, respectively. Conclusions: MC models of two US probes used for real-time image guidance during radiotherapy have been built. Due to the high beam attenuation of the US probes, the authors generally recommend avoiding delivery of treatment beams that intersect the probe. However, the presented MC models can be effectively integrated into US-guided radiotherapy treatment planning in cases for which beam avoidance is not practical due to anatomy geometry.« less

Metabolism of 18-methoxycoronaridine, an ibogaine analog, to 18-hydroxycoronaridine by genetically variable CYP2C19.

PubMed

Zhang, Wenjiang; Ramamoorthy, Yamini; Tyndale, Rachel F; Glick, Stanley D; Maisonneuve, Isabelle M; Kuehne, Martin E; Sellers, Edward M

2002-06-01

18-Methoxycoronaridine, a newly developed ibogaine analog, has been reported to decrease the self-administration of morphine, cocaine, ethanol, and nicotine. It has also been reported to attenuate naltrexone-precipitated signs of morphine withdrawal. In this study, three metabolites of 18-methoxycoronaridine (18-MC) were separated and identified by high-performance liquid chromatography-electrospray ionization-mass spectrometry-mass spectrometry (HPLC-ESI-MS-MS); the major metabolite was 18-hydroxycoronaridine (18-HC). The other two metabolites were elucidated as hydroxylated metabolites on the basis of their MS-MS spectra. Catalytic studies of 18-MC O-demethylase activity in human liver microsomes indicate that one high affinity enzyme is involved in this reaction (K(m) from 2.81 to 7.9 microM; V(max) from 0.045 to 0.29 nmol/mg/min). In cDNA-expressing microsomes, only CYP2C19 displayed significant 18-MC O-demethylase activity (K(m) 1.34 microM; V(max) 0.21 nmol/mg/min). S-Mephenytoin, a selective CYP2C19 inhibitor, inhibited 18-MC O-demethylation by 65% at a concentration of 2 times its K(I), and antibodies against rat 2C (human CYP2C8, 2C9, 2C19) inhibited 18-HC formation by 70%. Studies with other cytochrome P450 (P450)-selective chemical inhibitors and antibodies failed to demonstrate an appreciable role for other P450s in this reaction. In addition, in microsomes from five different human livers, 18-MC O-demethylation correlated with S-mephenytoin 4'hydroxylase activity but not with other P450 probe reactions. These data indicate that 18-HC formation is the predominant pathway of 18-MC metabolism in vitro in human liver microsomes and that this metabolic pathway is primarily catalyzed by the polymorphic CYP2C19. The apparent selectivity of this pathway for CYP2C19 suggests 18-MC as a potentially useful probe of CYP2C19 activity in vitro and in vivo.

Emission factors for fugitive dust from bulldozers working on a coal pile.

PubMed

Mueller, Stephen F; Mallard, Jonathan W; Mao, Qi; Shaw, Stephanie L

2015-01-01

A study of a Powder River Basin (PRB) coal pile found that fugitive emissions from natural and human activity each produced similar levels of downwind fine + coarse (i.e., smaller than 10 µm, or PM10) particle mass concentrations. Natural impacts were statistically removed from downwind measurements to estimate emission factor Ev for bulldozers working on the pile. The Ev determined here was similar in magnitude to emission factors (EFs) computed using a U.S. Environmental Protection Agency (EPA) formulation for unpaved surfaces at industrial sites, even though the latter was not based on data for coal piles. EF formulations from this study and those in the EPA guidance yield values of similar magnitude but differ in the variables used to compute Ev variations. EPA studies included effects of surface silt fraction and vehicle weight, while the present study captured the influence of coal moisture. Our data indicate that the relationship between PRB coal fugitive dust Ev (expressed as mass of PM10 emitted per minute of bulldozer operation) and coal moisture content Mc (in percent) at the study site is best expressed as Ev =10(f(Mc())) where f(Mc) is a function of moisture. This function was determined by statistical regression between log10(Ev) and Mc where both Ev and Mc are expressed as daily averages of observations based on 289 hours sampled during 44 days from late June through mid-November of 2012. A methodology is described that estimates Mc based on available meteorological data (precipitation amount and solar radiation flux). An example is given of computed variations in daily Ev for an entire year. This illustrates the sensitivity of the daily average particulate EF to meteorological variability at one location. Finally, a method is suggested for combining the moisture-sensitive formulation for Ev with the EPA formulation to accommodate a larger number of independent variables that influence fugitive emissions.

Interaction between obesity-related genes, FTO and MC4R, associated to an increase of breast cancer risk.

PubMed

da Cunha, Patrícia Amorim; de Carlos Back, Lia Kubelka; Sereia, Aline Fernanda Rodrigues; Kubelka, Clara; Ribeiro, Maria Cecíia Menks; Fernandes, Bráulio Leal; de Souza, Ilíada Rainha

2013-12-01

Breast cancer (BC) is a complex disease and obesity is a well-known risk factor for its development, especially after menopause. Several studies have shown Single Nucleotide Polymorphisms (SNPs) linked to overweight and obesity, such as: rs1121980 (T/C) and rs9939609 (A/T) in Fat Mass and Obesity Associated gene (FTO) and rs17782313 (T/C) in Melanocortin 4 Receptor gene (MC4R). Thus, we aimed to investigate the association between these obesity-related SNPs and BC risk. One hundred BC patients and 148 healthy women from Santa Catarina, Brazil entered the study. SNPs were genotyped using Taqman assays. For statistical analyses SNPStats and SPSS softwares were used. Association analyses were performed by logistic regression and were adjusted for age and Body mass index (BMI). Multiple SNPs inheritance models (log-additive, dominant, recessive, codominant) were performed to determine odds ratios (ORs), assuming 95 % confidence interval (CI) and P value = 0.05 as the significance limit. When analyzed alone, FTO rs1121980 and rs9939609 did not show significant associations with BC development, however MC4R rs17782313 showed increased risk for BC even after adjustments (P-value = 0.032). Interestingly, the interaction of FTO and MC4R polymorphisms showed a powerful association with BC. We observed a 4.59-fold increased risk for woman who have the allele combination C/T/C (FTO rs1121980/FTO rs9939609/MC4R rs17782313) (P-value = 0.0011, adjusted for age and BMI). We found important and unpublished associations between these obesity-related genes and BC risk. These associations seem to be independent of their effect on BMI, indicating a direct role of the interaction between FTO and MC4R polymorphisms in BC development.

McDonald versus Shirodkar cervical cerclage for the prevention of preterm birth: impact of body mass index.

PubMed

Figueroa, Reinaldo; Crowell, Rebecca; Martinez, Alvin; Morgan, Marielle; Wakefield, Dorothy

2018-04-30

To compare obstetrical outcomes on women undergoing a McDonald or Shirodkar cerclage and to estimate the impact of maternal body mass index (BMI) on these outcomes. We conducted a retrospective review of the medical records of all women with singleton pregnancies who underwent placement of a McDonald or Shirodkar cerclage at St. Francis Hospital from January 2008 to October 2013. The subjects were categorized based on BMI groups (normal: less than 25 kg/m 2 , overweight: 25-29 kg/m 2 , obese: 30 kg/m 2 or more). The primary outcome was gestational age at delivery. Statistical analyses included chi-square, Student's t-test, and multivariable regression analysis. Of 95 women, 47 (49.5%) received a Shirodkar, and 48 (50.5%) a McDonald cerclage. 16 women (16.8%) were categorized as normal weight, 35 (36.8%) as overweight, and 44 (46.3%) as obese. Gestational age at delivery differed significantly by group, decreasing with each categorical increase in BMI (normal: 39.0 ± 0.3 weeks; overweight: 36.6 ± 0.7 weeks; obese: 33.0 ± 1.1 weeks; p < .01). Overall, women receiving a Shirodkar cerclage had significantly longer pregnancies than women with a McDonald cerclage (36.7 ± 0.6 weeks versus 33.9 ± 1.0 weeks; p = .02). However, analysis showed a significant interaction between weight status and gestational age at delivery. Obese women had significantly longer pregnancies when they received a Shirodkar cerclage versus a McDonald cerclage (32.6 ± 1.0 weeks versus 28.8 ± 0.9 weeks; p < .01). However, there was no significant difference in gestational age at delivery between women categorized as normal/overweight (Shirodkar: 33.5 ± 0.9 weeks; McDonald: 32.9 ± 0.9 weeks; p = .63). Compared to obese women receiving a McDonald cerclage, obese women receiving a Shirodkar cerclage had significantly longer pregnancies. No significant differences in pregnancy duration were found in normal/overweight women regardless of cerclage technique. Pregnancy duration in obese women receiving a Shirodkar cerclage was similar to the pregnancy duration of normal/overweight women.

A rapid and high-precision method for sulfur isotope δ(34)S determination with a multiple-collector inductively coupled plasma mass spectrometer: matrix effect correction and applications for water samples without chemical purification.

PubMed

Lin, An-Jun; Yang, Tao; Jiang, Shao-Yong

2014-04-15

Previous studies have indicated that prior chemical purification of samples, although complex and time-consuming, is essential in obtaining precise and accurate results for sulfur isotope ratios using multiple-collector inductively coupled plasma mass spectrometry (MC-ICP-MS). In this study, we introduce a new, rapid and precise MC-ICP-MS method for sulfur isotope determination from water samples without chemical purification. The analytical work was performed on an MC-ICP-MS instrument with medium mass resolution (m/Δm ~ 3000). Standard-sample bracketing (SSB) was used to correct samples throughout the analytical sessions. Reference materials included an Alfa-S (ammonium sulfate) standard solution, ammonium sulfate provided by the lab of the authors and fresh seawater from the South China Sea. A range of matrix-matched Alfa-S standard solutions and ammonium sulfate solutions was used to investigate the matrix (salinity) effect (matrix was added in the form of NaCl). A seawater sample was used to confirm the reliability of the method. Using matrix-matched (salinity-matched) Alfa-S as the working standard, the measured δ(34)S value of AS (-6.73 ± 0.09‰) was consistent with the reference value (-6.78 ± 0.07‰) within the uncertainty, suggesting that this method could be recommended for the measurement of water samples without prior chemical purification. The δ(34)S value determination for the unpurified seawater also yielded excellent results (21.03 ± 0.18‰) that are consistent with the reference value (20.99‰), thus confirming the feasibility of the technique. The data and the results indicate that it is feasible to use MC-ICP-MS and matrix-matched working standards to measure the sulfur isotopic compositions of water samples directly without chemical purification. In comparison with the existing MC-ICP-MS techniques, the new method is better for directly measuring δ(34)S values in water samples with complex matrices; therefore, it can significantly accelerate analytical turnover. Copyright © 2014 John Wiley & Sons, Ltd.

Process optimization for microcystin-LR degradation by Response Surface Methodology and mechanism analysis in gas-liquid hybrid discharge system.

PubMed

Zhang, Yi; Wei, Hanyu; Xin, Qing; Wang, Mingang; Wang, Qi; Wang, Qiang; Cong, Yanqing

2016-12-01

A gas-liquid hybrid discharge system was applied to microcystin-LR (MC-LR) degradation. MC-LR degradation was completed after 1 min under a pulsed high voltage of 16 kV, gas-liquid interface gap of 10 mm and oxygen flow rate of 160 L/h. The Box-Behnken Design was proposed in Response Surface Methodology to evaluate the influence of pulsed high voltage, electrode distance and oxygen flow rate on MC-LR removal efficiency. Multiple regression analysis, focused on multivariable factors, was employed and a reduced cubic model was developed. The ANOVA analysis shows that the model is significant and the model prediction on MC-LR removal was also validated with experimental data. The optimum conditions for the process are obtained at pulsed voltage of 16 kV, gas-liquid interface gap of 10 mm and oxygen flow rate of 120 L/h with ta removal efficiency of MC-LR of 96.6%. The addition of catalysts (TiO 2 or Fe 2+ ) in the gas-liquid hybrid discharge system was found to enhance the removal of MC-LR. The intermediates of MC-LR degradation were analyzed by liquid chromatography/mass spectrometry. The degradation pathway proposed envisaged the oxidation of hydroxyl radicals and ozone, and attack of high-energy electrons on the unsaturated double bonds of Adda and Mdha, with MC-LR finally decomposing into small molecular products. Copyright © 2016 Elsevier Ltd. All rights reserved.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Mao, Shoudi; He, Jiansen; Yang, Liping

The impact of an overtaking fast shock on a magnetic cloud (MC) is a pivotal process in CME–CME (CME: coronal mass ejection) interactions and CME–SIR (SIR: stream interaction region) interactions. MC with a strong and rotating magnetic field is usually deemed a crucial part of CMEs. To study the impact of a fast shock on an MC, we perform a 2.5 dimensional numerical magnetohydrodynamic simulation. Two cases are run in this study: without and with impact by fast shock. In the former case, the MC expands gradually from its initial state and drives a relatively slow magnetic reconnection with themore » ambient magnetic field. Analyses of forces near the core of the MC as a whole body indicates that the solar gravity is quite small compared to the Lorentz force and the pressure gradient force. In the second run, a fast shock propagates, relative to the background plasma, at a speed twice that of the perpendicular fast magnetosonic speed, catches up with and takes over the MC. Due to the penetration of the fast shock, the MC is highly compressed and heated, with the temperature growth rate enhanced by a factor of about 10 and the velocity increased to about half of the shock speed. The magnetic reconnection with ambient magnetic field is also sped up by a factor of two to four in reconnection rate as a result of the enhanced density of the current sheet, which is squeezed by the forward motion of the shocked MC.« less

Fresh produce and their soils accumulate cyanotoxins from irrigation water: Implications for public health and food security.

PubMed

Lee, Seungjun; Jiang, Xuewen; Manubolu, Manjunath; Riedl, Ken; Ludsin, Stuart A; Martin, Jay F; Lee, Jiyoung

2017-12-01

Microcystin (MC), a hepatotoxin that can adversely affect human health, has become more prevalent in freshwater ecosystems worldwide, owing to an increase in toxic cyanobacteria blooms. While consumption of water and fish are well-documented exposure pathways of MCs to humans, less is known about the potential transfer to humans through consumption of vegetables that have been irrigated with MC-contaminated water. Likewise, the impact of MC on the performance of food crops is understudied. To help fill these information gaps, we conducted a controlled laboratory experiment in which we exposed lettuce, carrots, and green beans to environmentally relevant concentrations of MC-LR (0, 1, 5, and 10μg/L) via two irrigation methods (drip and spray). We used ELISA and LC-MS/MS to quantify MC-LR concentrations and in different parts of the plant (edible vs. inedible fractions), measured plant performance (e.g., size, mass, edible leaves, color), and calculated human exposure risk based on accumulation patterns. MC-LR accumulation was positively dose-dependent, with it being greater in the plants (2.2-209.2μg/kg) than in soil (0-19.4μg/kg). MC-LR accumulation varied among vegetable types, between plant parts, and between irrigation methods. MC-LR accumulation led to reduced crop growth and quality, with MC-LR persisting in the soil after harvest. Observed toxin accumulation patterns in edible fractions of plants also led to estimates of daily MC-LR intake that exceeded both the chronic reference dose (0.003μg/kg of body weight) and total daily intake guidelines (0.04μg/kg of body weight). Because the use of MC-contaminated water is common in many parts of the world, our collective findings highlight the need for guidelines concerning the use of MC-contaminated water in irrigation, as well as consumption of these crops. Copyright © 2017 Elsevier Ltd. All rights reserved.

Characterization of the Mamestra configurata (Lepidoptera: Noctuidae) larval midgut protease complement and adaptation to feeding on artificial diet, Brassica species, and protease inhibitor.

PubMed

Erlandson, Martin A; Hegedus, Dwayne D; Baldwin, Douglas; Noakes, Amy; Toprak, Umut

2010-10-01

The midgut protease profiles from 5th instar Mamestra configurata larvae fed various diets (standard artificial diet, low protein diet, low protein diet with soybean trypsin inhibitor [SBTI], or Brassica napus) were characterized by one-dimensional enzymography in gelatin gels. The gut protease profile of larvae fed B. napus possessed protease activities of molecular masses of approximately 33 and 55 kDa, which were not present in the guts of larvae fed artificial diet. Similarly, larvae fed artificial diet had protease activities of molecular masses of approximately 21, 30, and 100 kDa that were absent in larvae fed B. napus. Protease profiles changed within 12 to 24 h after switching larvae from artificial diet to plant diet and vice versa. The gut protease profiles from larvae fed various other brassicaceous species and lines having different secondary metabolite profiles did not differ despite significant differences in larval growth rates on the different host plants. Genes encoding putative digestive proteolytic enzymes, including four carboxypeptidases, five aminopeptidases, and 48 serine proteases, were identified in cDNA libraries from 4th instar M. configurata midgut tissue. Many of the protease-encoding genes were expressed at similar levels on all diets; however, three chymoptrypsin-like genes (McSP23, McSP27, and McSP37) were expressed at much higher levels on standard artificial diet and diet containing SBTI as was the trypsin-like gene McSP34. The expression of the trypsin-like gene McSP50 was highest on B. napus. The adaptation of M. configurata digestive biochemistry to different diets is discussed in the context of the flexibility of polyphagous insects to changing diet sources.

Body mass index and motor coordination: Non-linear relationships in children 6-10 years.

PubMed

Lopes, V P; Malina, R M; Maia, J A R; Rodrigues, L P

2018-05-01

Given the concern for health-related consequences of an elevated body mass index (BMI; obesity), the potential consequences of a low BMI in children are often overlooked. The purpose was to evaluate the relationship between the BMI across its entire spectrum and motor coordination (MC) in children 6-10 years. Height, weight, and MC (Körperkoordinationstest für Kinder, KTK test battery) were measured in 1,912 boys and 1,826 girls of 6-10 years of age. BMI (kg/m 2 ) was calculated. KTK scores for each of the four tests were also converted to a motor quotient (MQ). One-way ANOVA was used to test differences in the BMI, individual test items, and MQ among boys and girls within age groups. Sex-specific quadratic regressions of individual KTK items and the MQ on the BMI were calculated. Girls and boys were also classified into four weight status groups using International Obesity Task Force criteria: thin, normal, overweight, and obese. Differences in specific test items and MQ between weight status groups were evaluated by age group in each sex. Thirty-one percent of the sample was overweight or obese, whereas 5% was thin. On average, normal weight children had the highest MQ in both sexes across the age range with few exceptions. Overweight/obese children had a lower MQ than normal weight and thin children. The quadratic regression lines generally presented an inverted parabolic relationship between the BMI and MC and suggested a decrease in MC with an increase in the BMI. In general, BMI shows a curvilinear, inverted parabolic relationship with MC in children 6-10 years. © 2018 John Wiley & Sons Ltd.

SIRIUS - A new 6 MV accelerator system for IBA and AMS at ANSTO

NASA Astrophysics Data System (ADS)

Pastuovic, Zeljko; Button, David; Cohen, David; Fink, David; Garton, David; Hotchkis, Michael; Ionescu, Mihail; Long, Shane; Levchenko, Vladimir; Mann, Michael; Siegele, Rainer; Smith, Andrew; Wilcken, Klaus

2016-03-01

The Centre for Accelerator Science (CAS) facility at ANSTO has been expanded with a new 6 MV tandem accelerator system supplied by the National Electrostatic Corporation (NEC). The beamlines, end-stations and data acquisition software for the accelerator mass spectrometry (AMS) were custom built by NEC for rare isotope mass spectrometry, while the beamlines with end-stations for the ion beam analysis (IBA) are largely custom designed at ANSTO. An overview of the 6 MV system and its performance during testing and commissioning phase is given with emphasis on the IBA end-stations and their applications for materials modification and characterisation.

Melanocortin 1 receptor-signaling deficiency results in an articular cartilage phenotype and accelerates pathogenesis of surgically induced murine osteoarthritis.

PubMed

Lorenz, Julia; Seebach, Elisabeth; Hackmayer, Gerit; Greth, Carina; Bauer, Richard J; Kleinschmidt, Kerstin; Bettenworth, Dominik; Böhm, Markus; Grifka, Joachim; Grässel, Susanne

2014-01-01

Proopiomelanocortin-derived peptides exert pleiotropic effects via binding to melanocortin receptors (MCR). MCR-subtypes have been detected in cartilage and bone and mediate an increasing number of effects in diathrodial joints. This study aims to determine the role of MC1-receptors (MC1) in joint physiology and pathogenesis of osteoarthritis (OA) using MC1-signaling deficient mice (Mc1re/e). OA was surgically induced in Mc1re/e and wild-type (WT) mice by transection of the medial meniscotibial ligament. Histomorphometry of Safranin O stained articular cartilage was performed with non-operated controls (11 weeks and 6 months) and 4/8 weeks past surgery. µCT-analysis for assessing epiphyseal bone architecture was performed as a longitudinal study at 4/8 weeks after OA-induction. Collagen II, ICAM-1 and MC1 expression was analysed by immunohistochemistry. Mc1re/e mice display less Safranin O and collagen II stained articular cartilage area compared to WT prior to OA-induction without signs of spontaneous cartilage surface erosion. This MC1-signaling deficiency related cartilage phenotype persisted in 6 month animals. At 4/8 weeks after OA-induction cartilage erosions were increased in Mc1re/e knees paralleled by weaker collagen II staining. Prior to OA-induction, Mc1re/e mice do not differ from WT with respect to bone parameters. During OA, Mc1re/e mice developed more osteophytes and had higher epiphyseal bone density and mass. Trabecular thickness was increased while concomitantly trabecular separation was decreased in Mc1re/e mice. Numbers of ICAM-positive chondrocytes were equal in non-operated 11 weeks Mc1re/e and WT whereas number of positive chondrocytes decreased during OA-progression. Unchallenged Mc1re/e mice display smaller articular cartilage covered area without OA-related surface erosions indicating that MC1-signaling is critical for proper cartilage matrix integrity and formation. When challenged with OA, Mc1re/e mice develop a more severe OA-pathology. Our data suggest that MC1-signaling protects against cartilage degradation and subchondral bone sclerosis in OA indicating a beneficial role of the POMC system in joint pathophysiology.

Melanocortin 1 Receptor-Signaling Deficiency Results in an Articular Cartilage Phenotype and Accelerates Pathogenesis of Surgically Induced Murine Osteoarthritis

PubMed Central

Hackmayer, Gerit; Greth, Carina; Bauer, Richard J.; Kleinschmidt, Kerstin; Bettenworth, Dominik; Böhm, Markus; Grifka, Joachim; Grässel, Susanne

2014-01-01

Proopiomelanocortin-derived peptides exert pleiotropic effects via binding to melanocortin receptors (MCR). MCR-subtypes have been detected in cartilage and bone and mediate an increasing number of effects in diathrodial joints. This study aims to determine the role of MC1-receptors (MC1) in joint physiology and pathogenesis of osteoarthritis (OA) using MC1-signaling deficient mice (Mc1re/e). OA was surgically induced in Mc1re/e and wild-type (WT) mice by transection of the medial meniscotibial ligament. Histomorphometry of Safranin O stained articular cartilage was performed with non-operated controls (11 weeks and 6 months) and 4/8 weeks past surgery. µCT–analysis for assessing epiphyseal bone architecture was performed as a longitudinal study at 4/8 weeks after OA-induction. Collagen II, ICAM-1 and MC1 expression was analysed by immunohistochemistry. Mc1re/e mice display less Safranin O and collagen II stained articular cartilage area compared to WT prior to OA-induction without signs of spontaneous cartilage surface erosion. This MC1-signaling deficiency related cartilage phenotype persisted in 6 month animals. At 4/8 weeks after OA-induction cartilage erosions were increased in Mc1re/e knees paralleled by weaker collagen II staining. Prior to OA-induction, Mc1re/e mice do not differ from WT with respect to bone parameters. During OA, Mc1re/e mice developed more osteophytes and had higher epiphyseal bone density and mass. Trabecular thickness was increased while concomitantly trabecular separation was decreased in Mc1re/e mice. Numbers of ICAM-positive chondrocytes were equal in non-operated 11 weeks Mc1re/e and WT whereas number of positive chondrocytes decreased during OA-progression. Unchallenged Mc1re/e mice display smaller articular cartilage covered area without OA-related surface erosions indicating that MC1-signaling is critical for proper cartilage matrix integrity and formation. When challenged with OA, Mc1re/e mice develop a more severe OA-pathology. Our data suggest that MC1-signaling protects against cartilage degradation and subchondral bone sclerosis in OA indicating a beneficial role of the POMC system in joint pathophysiology. PMID:25191747

The Mass Media: A Student's Guide to Reference Sources.

ERIC Educational Resources Information Center

McGill Univ., Montreal (Quebec). McLennan Library.

This guide to materials available in the McLennan Library is intended to assist students in locating information and literature necessary for sociological studies of the mass media (excluding film). It does not deal with the more technical aspects of the media or the "how to" literature. The annotations are arranged under the following headings:…

Model Construct and Calibration of an Integrated Water Quality Model (LM2-Toxic) for the Lake Michigan Mass Balance Project

EPA Science Inventory

The Lake Michigan Mass Balance Project (LMMBP) is a part of the Enhanced Monitoring Plan (EMP) for Lake Michigan (McCarty, et al., 2006). PCBs (polychlorinated biphenyls) were one of the targeted pollutants studied in the project. As one of the components in the overall LMMBP mod...

Association between melanocortin-4 receptor mutations and eating behaviors in obese patients: a case--control study.

PubMed

Valette, M; Poitou, C; Kesse-Guyot, E; Bellisle, F; Carette, C; Le Beyec, J; Hercberg, S; Clément, K; Czernichow, S

2014-06-01

Melanocortin-4 receptor (MC4R) gene mutations are involved in the leptin-melanocortin pathways that control food intake. The effect of these mutations on eating behavior phenotypes is still debated. To determine the association between functional MC4R mutations and eating behaviors, dietary intake and physical activity, we sequenced the MC4R gene in 4653 obese adults. Among them, 19 adults carriers of functional MC4R mutation were matched on age, sex and body mass index with two randomly-paired controls without MC4R mutation (n=57). We found that eating behaviors and physical activity did not differ between groups. In particular, cases were not at increased risk of binge eating disorders. Subjects carriers of MC4R mutation reported a higher proportion of dietary carbohydrates intakes (43.2±7.1 and 39.2±8.1% of total energy intake, respectively, P=0.048) and a lower proportion of dietary lipids (34.3±6.7 and 38.5±6.7% of total energy intake, respectively, P=0.018). In conclusion, mutation carriers differ from controls by a higher consumption of carbohydrates counterbalanced by a lower consumption of lipids expressed as percentage of total energy intake. However, functional MC4R mutations do not have a higher risk of compulsive eating contrary to what was previously suggested.

Simultaneous Moisture Content and Mass Flow Measurements in Wood Chip Flows Using Coupled Dielectric and Impact Sensors.

PubMed

Pan, Pengmin; McDonald, Timothy; Fulton, John; Via, Brian; Hung, John

2016-12-23

An 8-electrode capacitance tomography (ECT) sensor was built and used to measure moisture content (MC) and mass flow of pine chip flows. The device was capable of directly measuring total water quantity in a sample but was sensitive to both dry matter and moisture, and therefore required a second measurement of mass flow to calculate MC. Two means of calculating the mass flow were used: the first being an impact sensor to measure total mass flow, and the second a volumetric approach based on measuring total area occupied by wood in images generated using the capacitance sensor's tomographic mode. Tests were made on 109 groups of wood chips ranging in moisture content from 14% to 120% (dry basis) and wet weight of 280 to 1100 g. Sixty groups were randomly selected as a calibration set, and the remaining were used for validation of the sensor's performance. For the combined capacitance/force transducer system, root mean square errors of prediction (RMSEP) for wet mass flow and moisture content were 13.42% and 16.61%, respectively. RMSEP using the combined volumetric mass flow/capacitance sensor for dry mass flow and moisture content were 22.89% and 24.16%, respectively. Either of the approaches was concluded to be feasible for prediction of moisture content in pine chip flows, but combining the impact and capacitance sensors was easier to implement. In situations where flows could not be impeded, however, the tomographic approach would likely be more useful.

Evaluation of an experimental mass-flow sensor of cotton-lint at the gin

USDA-ARS?s Scientific Manuscript database

As part of a system to optimize the cotton ginning process, a custom built mass-flow sensor was evaluated at USDA-ARS Cotton Ginning Research Unit at Stoneville, Mississippi. The mass-flow sensor was fabricated based on the principle of the senor patented by Thomasson and Sui (2004). The optical a...

Direct lead isotope analysis in Hg-rich sulfides by LA-MC-ICP-MS with a gas exchange device and matrix-matched calibration.

PubMed

Zhang, Wen; Hu, Zhaochu; Günther, Detlef; Liu, Yongsheng; Ling, Wenli; Zong, Keqing; Chen, Haihong; Gao, Shan

2016-12-15

In situ Pb isotope data of sulfide samples measured by LA-MC-ICP-MS provide valuable geochemical information for studies of the origin and evolution of ore deposits. However, the severe isobaric interference of 204 Hg on 204 Pb and the lack of matrix-matched sulfide reference materials limit the precision of Pb isotopic analyses for Hg-rich sulfides. In this study, we observe that Hg forms vapor and can be completely removed from sample aerosol particles produced by laser ablation using a gas exchange device. Additionally, this device does not influence the signal intensities of Pb isotopes. The within-run precision, the external reproducibility and the analytical accuracy are significantly improved for the Hg-rich sulfide samples using this mercury-vapor-removing device. Matrix effects are observed when using silicate glass reference materials as the external standards to assess the relationship of mass fractionation factors between Tl and Pb in sulfide samples, resulting in a maximum deviation of ∼0.20% for 20x Pb/ 204 Pb. Matrix-matched reference materials are therefore required for the highly precise and accurate Pb isotope analyses of sulfide samples. We investigated two sulfide samples, MASS-1 (the Unites States Geological Survey reference materials) and Sph-HYLM (a natural sphalerite), as potential candidates. Repeated analyses of the two proposed sulfide reference materials by LA-MC-ICP-MS yield good external reproducibility of <0.04% (RSD, k = 2) for 20x Pb/ 206 Pb and <0.06% (RSD, k = 2) for 20x Pb/ 204 Pb with the exception of 20x Pb/ 204 Pb in MASS-1, which provided an external reproducibility of 0.24% (RSD, k = 2). Because the concentration of Pb in MASS-1 (76 μg g -1 ) is ∼5.2 times lower than that in Sph-HYLM (394 ± 264 μg g -1 ). The in situ analytical results of MASS-1 and Sph-HYLM are consistent with the values obtained by solution MC-ICP-MS, demonstrating the reliability and robustness of our analytical protocol. Copyright © 2016 Elsevier B.V. All rights reserved.

Geomagnetic and Solar Indices Data at NGDC

NASA Astrophysics Data System (ADS)

Mabie, J. J.

2012-12-01

The National Geophysical Data Center, Solar and Terrestrial Physics Indices program is a central repository for global indices derived at numerous organizations around the world. These datasets are used by customers to drive models, evaluate the solar and geomagnetic environment, and to understand space climate. Our goal is to obtain and disseminate this data in a timely and accurate manner, and to provide the short term McNish-Lincoln sunspot number prediction. NGDC is in partnership with the NOAA Space Weather Prediction Center (SWPC), University Center for Atmospheric Sciences (UCAR), the Potsdam Helmholtz Center (GFZ), the Solar Indices Data Center (SIDC), the World Data Center for Geomagnetism Kyoto and many other organizations. The large number of available indices and the complexity in how they are derived makes understanding the data one of the biggest challenges for the users of indices. Our data services include expertise in our indices and related datasets to provide feedback and analysis for our global customer base.

Birth weight and childhood growth in daughters of women with irregular menstrual cycles.

PubMed

Wang, Erica T; Cirillo, Piera M; Kao, Chia-Ning; Cohn, Barbara A; Cedars, Marcelle I

2013-06-01

Menstrual irregularity has been associated with insulin resistance, type 2 diabetes mellitus and markers of metabolic dysfunction. This study aimed to determine whether irregular menstrual cycles (MCs) in reproductive-age women are associated with the weight of their daughters at birth and growth up to age five. We studied 4863 pregnant women with menstrual history data in a prospective cohort, recruited from the Kaiser Health Plan (1959-1966). Serial measures of their daughters' weight and height were abstracted from medical records. We used analysis of covariance, stratified by maternal body mass index, to explore the association between maternal MC and infant birth weight (BW). We included 4774 daughters in a repeated measures analysis to compare the effect of maternal MC on childhood weight through age five. Daughters of non-obese women with irregular MC had a statistically significant lower BW compared to daughters of women with regular MC; this difference was notably amplified among obese women. The daughters' weights were not statistically different when growth was assessed from birth to five years. We conclude that daughters of obese women with irregular MC, in particular, had significantly lower BW compared to daughters of women with regular MC, which did not persist over five years of follow-up.

Fast microcalcification detection in ultrasound images using image enhancement and threshold adjacency statistics

NASA Astrophysics Data System (ADS)

Cho, Baek Hwan; Chang, Chuho; Lee, Jong-Ha; Ko, Eun Young; Seong, Yeong Kyeong; Woo, Kyoung-Gu

2013-02-01

The existence of microcalcifications (MCs) is an important marker of malignancy in breast cancer. In spite of the benefits in mass detection for dense breasts, ultrasonography is believed that it might not reliably detect MCs. For computer aided diagnosis systems, however, accurate detection of MCs has the possibility of improving the performance in both Breast Imaging-Reporting and Data System (BI-RADS) lexicon description for calcifications and malignancy classification. We propose a new efficient and effective method for MC detection using image enhancement and threshold adjacency statistics (TAS). The main idea of TAS is to threshold an image and to count the number of white pixels with a given number of adjacent white pixels. Our contribution is to adopt TAS features and apply image enhancement to facilitate MC detection in ultrasound images. We employed fuzzy logic, tophat filter, and texture filter to enhance images for MCs. Using a total of 591 images, the classification accuracy of the proposed method in MC detection showed 82.75%, which is comparable to that of Haralick texture features (81.38%). When combined, the performance was as high as 85.11%. In addition, our method also showed the ability in mass classification when combined with existing features. In conclusion, the proposed method exploiting image enhancement and TAS features has the potential to deal with MC detection in ultrasound images efficiently and extend to the real-time localization and visualization of MCs.

Role of net baryon density on rapidity width of identified particles from the lowest energies available at the CERN Super Proton Synchrotron to those at the BNL Relativistic Heavy Ion Collider and at the CERN Large Hadron Collider

NASA Astrophysics Data System (ADS)

Hussain, Nur; Bhattacharjee, Buddhadeb

2017-08-01

Widths of the rapidity distributions of various identified hadrons generated with the UrQMD-3.4 event generator at all the Super Proton Synchrotron (SPS) energies have been presented and compared with the existing experimental results. An increase in the width of the rapidity distribution of Λ could be seen with both Monte Carlo (MC) and experimental data for the studied energies. Using MC data, the study has been extended to Relativistic Heavy Ion Collider (RHIC) and Large Hadron Collider (LHC) energies. A similar jump, as observed in the plot of rapidity width versus rest mass at Alternating Gradient Synchrotron (AGS) and all SPS energies, persists even at RHIC and LHC energies, confirming its universal nature from AGS to the highest LHC energies. Such observation indicates that pair production may not be the only mechanism of particle production at the highest LHC energies. However, with MC data, the separate mass scaling for mesons and baryons is found to exist even at the top LHC energy.

Determination of tin isotope ratios in cassiterite by femtosecond laser ablation multicollector inductively coupled plasma mass spectrometry

NASA Astrophysics Data System (ADS)

Schulze, Marie; Ziegerick, Marco; Horn, Ingo; Weyer, Stefan; Vogt, Carla

2017-04-01

In comparison to isotope analysis of dissolved samples femtosecond laser ablation multicollector inductively coupled plasma mass spectrometry (fs-LA-MC-ICP-MS) enables precise isotope ratio analyses consuming much less sample material and with a minimum effort in sample preparation. This is especially important for the investigation of valuable historical objects for which visual traces of sampling are unwanted. The present study provides a basis for tin isotope ratio measurements using LA-MC-ICP-MS technique. For this, in house isotope standards had to be defined. Investigations on interferences and matrix effects illustrate that beside Sb only high Te contents (with values above those to be expected in cassiterite) result in a significant shift of the measured tin isotope ratios. This effect can partly be corrected for using natural isotope abundances. However, a natural isotope fractionation of Te cannot be excluded. Tin beads reduced from cassiterite were analysed by laser ablation and after dissolution. It was shown that tin isotope ratios can be determined accurately by using fs-LA-MC-ICP-MS. Furthermore the homogeneity of tin isotope ratios in cassiterite was proven.

The Effect of Collimating Lens Focusing on Laser Beam Shape in Matrix Assisted Laser Desorption/Ionization Mass Spectrometry (MALDI-MS)

NASA Astrophysics Data System (ADS)

O'Rourke, Matthew B.; Raymond, Benjamin B. A.; Djordjevic, Steven P.; Padula, Matthew P.

2018-03-01

Tissue imaging using matrix assisted laser desorption/ionization mass spectrometry (MALDI-MS) is a well-established technique that, in recent years, has seen wider adoption and novel application. Applications such imaging mass spectrometry (IMS) and biotyping are beginning to gain greater exposure and use; however, with limitations in optimization methods, producing the best result often relies on the ability to customize the physical characteristics of the instrumentation, a task that is challenging for most mass spectrometry laboratories. With this in mind, we have described the effect of making simple adjustments to the laser optics at the final collimating lens area, to adjust the laser beam size and shape in order to allow greater customization of the instrument for improving techniques such as IMS. We have therefore been able to demonstrate that improvements can be made without requiring the help of an electrical engineer or external funding in a way that only costs a small amount of time. [Figure not available: see fulltext.

The Effect of Collimating Lens Focusing on Laser Beam Shape in Matrix Assisted Laser Desorption/Ionization Mass Spectrometry (MALDI-MS).

PubMed

O'Rourke, Matthew B; Raymond, Benjamin B A; Djordjevic, Steven P; Padula, Matthew P

2018-03-01

Tissue imaging using matrix assisted laser desorption/ionization mass spectrometry (MALDI-MS) is a well-established technique that, in recent years, has seen wider adoption and novel application. Applications such imaging mass spectrometry (IMS) and biotyping are beginning to gain greater exposure and use; however, with limitations in optimization methods, producing the best result often relies on the ability to customize the physical characteristics of the instrumentation, a task that is challenging for most mass spectrometry laboratories. With this in mind, we have described the effect of making simple adjustments to the laser optics at the final collimating lens area, to adjust the laser beam size and shape in order to allow greater customization of the instrument for improving techniques such as IMS. We have therefore been able to demonstrate that improvements can be made without requiring the help of an electrical engineer or external funding in a way that only costs a small amount of time. Graphical Abstract ᅟ.

Isotope-ratio measurements of lead in NIST standard reference materials by multiple-collector inductively coupled plasma mass spectrometry.

PubMed

Platzner, I; Ehrlich, S; Halicz, L

2001-07-01

The capability of a second-generation Nu Instruments multiple collector inductively coupled plasma mass spectrometer (MC-ICP-MS) has been evaluated for precise and accurate isotope-ratio determinations of lead. Essentially the mass spectrometer is a double-focusing instrument of Nier-Johnson analyzer geometry equipped with a newly designed variable-dispersion ion optical device, enabling the measured ion beams to be focused into a fixed array of Faraday collectors and an ion-counting assembly. NIST SRM Pb 981, 982, and 983 isotopic standards were used. Addition of thallium to the lead standards and subsequent simultaneous measurement of the thallium and lead isotopes enabled correction for mass discrimination, by use of the exponential correction law and 205Tl/203Tl = 2.3875. Six measurements of SRM Pb-982 furnished the results 206Pb/204Pb = 36.7326(68), 207Pb/204Pb = 17.1543(30), 208Pb/204Pb = 36.7249(69), 207Pb/206Pb = 0.46700(1), and 208Pb/206Pb = 0.99979(2); the NIST-certified values were 36.738(37), 17.159(25), 36.744(50), 0.46707(20), and 1.00016(36), respectively. Direct isotope lead analysis in silicates can be performed without any chemical separation. NIST SRM 610 glass was dissolved and introduced into the MC-ICP-MS by means of a micro concentric nebulizer. The ratios observed were in excellent agreement with previously reported data obtained by TIMS and laser ablation MC-ICP-MS, despite the high Ca/Pb concentration ratio (200/1) and the presence of many other elements at levels comparable with that of lead. Approximately 0.2 microg lead are sufficient for isotope analysis with ratio uncertainties between 240 and 530 ppm.

Development of a direct procedure for the measurement of sulfur isotope variability in beers by MC-ICP-MS.

PubMed

Giner Martínez-Sierra, J; Santamaria-Fernandez, R; Hearn, R; Marchante Gayón, J M; García Alonso, J I

2010-04-14

In this work, a multi-collector inductively coupled plasma mass spectrometer (MC-ICP-MS) was evaluated for the direct measurement of sulfur stable isotope ratios in beers as a first step toward a general study of the natural isotope variability of sulfur in foods and beverages. Sample preparation consisted of a simple dilution of the beers with 1% (v/v) HNO(3). It was observed that different sulfur isotope ratios were obtained for different dilutions of the same sample indicating that matrix effects affected differently the transmission of the sulfur ions at masses 32, 33, and 34 in the mass spectrometer. Correction for mass bias related matrix effects was evaluated using silicon internal standardization. For that purpose, silicon isotopes at masses 29 and 30 were included in the sulfur cup configuration and the natural silicon content in beers used for internal mass bias correction. It was observed that matrix effects on differential ion transmission could be corrected adequately using silicon internal standardization. The natural isotope variability of sulfur has been evaluated by measuring 26 different beer brands. Measured delta(34)S values ranged from -0.2 to 13.8 per thousand. Typical combined standard uncertainties of the measured delta(34)S values were < or = 2 per thousand. The method has therefore great potential to study sulfur isotope variability in foods and beverages.

Enhancing Student Learning in Knowledge-Based Courses: Integrating Team-Based Learning in Mass Communication Theory Classes

ERIC Educational Resources Information Center

Han, Gang; Newell, Jay

2014-01-01

This study explores the adoption of the team-based learning (TBL) method in knowledge-based and theory-oriented journalism and mass communication (J&MC) courses. It first reviews the origin and concept of TBL, the relevant theories, and then introduces the TBL method and implementation, including procedures and assessments, employed in an…

Mass as a Form of Energy in a Simple Example

ERIC Educational Resources Information Center

Dib, Claudio

2013-01-01

A major consequence of special relativity, expressed in the relation E[subscript 0] = mc[superscript 2], is that the total energy content of an object at rest, including its thermal motion and binding energy among its constituents, is a measure of its inertia, i.e., its mass. This relation was first stated by Einstein. He showed that, in order to…

METHOD 544. DETERMINATION OF MICROCYSTINS AND NODULARIN IN DRINKING WATER BY SOLID PHASE EXTRACTION AND LIQUID CHROMATOGRAPHY/TANDEM MASS SPECTROMETRY (LC/MS/MS)

EPA Science Inventory

Method 544 is an accurate and precise analytical method to determine six microcystins (including MC-LR) and nodularin in drinking water using solid phase extraction and liquid chromatography tandem mass spectrometry (SPE-LC/MS/MS). The advantage of this SPE-LC/MS/MS is its sensi...

WE-F-16A-01: Commissioning and Clinical Use of PC-ISO for Customized, 3D Printed, Gynecological Brachytherapy Applicators

DOE Office of Scientific and Technical Information (OSTI.GOV)

Cunha, J; Sethi, R; Mellis, K

Purpose: (1) Evaluate the safety and radiation attenuation properties of PCISO, a bio-compatible, sterilizable 3D printing material by Stratasys, (2) establish a method for commissioning customized multi- and single-use 3D printed applicators, (3) report on use of customized vaginal cylinders used to treat a series of serous endometrial cancer patient. Methods: A custom film dosimetry apparatus was designed to hold a Gafchromic radio film segment between two blocks of PC-ISO and 3D-printed using a Fortus 400mc (StrataSys). A dose plan was computed using 13 dwell positions at 2.5 mm spacing and normalized to 1500 cGy at 1 cm. Film exposuremore » was compared to control tests in only air and only water. The average Hounsfield Unit (HU) was computed and used to verify water equivalency. For the clinical use cases, the physician specifies the dimensions and geometry of a custom applicator from which a CAD model is designed and printed. Results: The doses measured from the PC-ISO Gafchromic film test were within 1% of the dose measured in only water between 1cm and 6cm from the channel. Doses increased 7–4% measured in only air. HU range was 11–43. The applicators were sterilized using the Sterrad system multiple times without damage. As of submission 3 unique cylinders have been designed, printed, and used in the clinic. A standardizable workflow for commissioning custom 3D printed applicators was codified and will be reported. Conclusions: Quality assurance (QA) evaluation of the PC-ISO 3D-printing material showed that PC-ISO is a suitable material for a gynecological brachytherapy vaginal cylinder in a clinical setting. With the material commissioning completed, if the physician determines that a better treatment would Result, a customized design is fabricated with limited additional QA necessary. Although this study was specific to PC-ISO, the same setup can be used to evaluate other 3D-printing materials.« less

SU-E-T-404: Evaluation of the Effect of Spine Hardware for CyberKnife Spinal Stereotactic Radiosurgery

DOE Office of Scientific and Technical Information (OSTI.GOV)

Yuan, J; Zhang, Y; Zheng, Y

2015-06-15

Purpose: Spine hardware made of high-Z materials such as titanium has the potential to affect the dose distribution around the metal rods in CyberKnife spinal stereotactic radiosurgery (SRS) treatments. The purpose of this work was to evaluate the magnitude of such effect retrospectively for clinical CyberKnife plans. Methods: The dose calculation was performed within the MultiPlan treatment planning system using the ray tracing (RT) and Monte Carlo (MC) method. A custom density model was created by extending the CT-to-Density table to titanium density of 4.5 g/cm3 with the CT number of 4095. To understand the dose perturbation caused by themore » titanium rod, a simple beam setup (7.5 mm IRIS collimator) was used to irradiate a mimic rod (5 mm) with overridden high density. Five patient spinal SRS cases were found chronologically from 2010 to 2015 in our institution. For each case, the hardware was contoured manually. The original plan was re-calculated using both RT and MC methods with and without rod density override without changing clinical beam parameters. Results: The simple beam irradiation shows that there is 10% dose increase at the interface because of electron backscattering and 7% decrease behind the rod because of photon attenuation. For actual clinical plans, the iso-dose lines and DVHs are almost identical (<2%) for calculations with and without density override for both RT and MC methods. However, there is a difference of more than 10% for D90 between RT and MC method. Conclusion: Although the dose perturbation around the metal rods can be as large as 10% for a single beam irradiation, for clinical treatments with complex beam composition the effect of spinal hardware to the PTV and spinal dose is minimal. As such, the MC dose algorithm without rod density override for CyberKnife spinal SRS is acceptable.« less

Feasibility assessment of the interactive use of a Monte Carlo algorithm in treatment planning for intraoperative electron radiation therapy

NASA Astrophysics Data System (ADS)

Guerra, Pedro; Udías, José M.; Herranz, Elena; Santos-Miranda, Juan Antonio; Herraiz, Joaquín L.; Valdivieso, Manlio F.; Rodríguez, Raúl; Calama, Juan A.; Pascau, Javier; Calvo, Felipe A.; Illana, Carlos; Ledesma-Carbayo, María J.; Santos, Andrés

2014-12-01

This work analysed the feasibility of using a fast, customized Monte Carlo (MC) method to perform accurate computation of dose distributions during pre- and intraplanning of intraoperative electron radiation therapy (IOERT) procedures. The MC method that was implemented, which has been integrated into a specific innovative simulation and planning tool, is able to simulate the fate of thousands of particles per second, and it was the aim of this work to determine the level of interactivity that could be achieved. The planning workflow enabled calibration of the imaging and treatment equipment, as well as manipulation of the surgical frame and insertion of the protection shields around the organs at risk and other beam modifiers. In this way, the multidisciplinary team involved in IOERT has all the tools necessary to perform complex MC dosage simulations adapted to their equipment in an efficient and transparent way. To assess the accuracy and reliability of this MC technique, dose distributions for a monoenergetic source were compared with those obtained using a general-purpose software package used widely in medical physics applications. Once accuracy of the underlying simulator was confirmed, a clinical accelerator was modelled and experimental measurements in water were conducted. A comparison was made with the output from the simulator to identify the conditions under which accurate dose estimations could be obtained in less than 3 min, which is the threshold imposed to allow for interactive use of the tool in treatment planning. Finally, a clinically relevant scenario, namely early-stage breast cancer treatment, was simulated with pre- and intraoperative volumes to verify that it was feasible to use the MC tool intraoperatively and to adjust dose delivery based on the simulation output, without compromising accuracy. The workflow provided a satisfactory model of the treatment head and the imaging system, enabling proper configuration of the treatment planning system and providing good accuracy in the dosage simulation.

Ultrasonic detection of solid phase mass flow ratio of pneumatic conveying fly ash

NASA Astrophysics Data System (ADS)

Duan, Guang Bin; Pan, Hong Li; Wang, Yong; Liu, Zong Ming

2014-04-01

In this paper, ultrasonic attenuation detection and weight balance are adopted to evaluate the solid mass ratio in this paper. Fly ash is transported on the up extraction fluidization pneumatic conveying workbench. In the ultrasonic test. McClements model and Bouguer-Lambert-Beer law model were applied to formulate the ultrasonic attenuation properties of gas-solid flow, which can give the solid mass ratio. While in the method of weigh balance, the averaged mass addition per second can reveal the solids mass flow ratio. By contrast these two solid phase mass ratio detection methods, we can know, the relative error is less.

Mass Customization of Education by an Institution of HE: What Can We Learn from Industry?

ERIC Educational Resources Information Center

Schuwer, Robert; Kusters, Rob

2014-01-01

One of the claims the OER movement makes is that availability of (open) digital learning materials improves the quality of education. The promise is the ability to offer educational programs that take into account specific demands of the learner. The question is how to reach a situation where a customized demand can be met using OER with…

Evaluation of operational parameters role on the emission of fumes.

PubMed

Sajedifar, Javad; Kokabi, Amir Hossein; Farhang Dehghan, Somayeh; Mehri, Ahmad; Azam, Kamal; Golbabaei, Farideh

2017-12-12

Electric arc welding is a routine operation in the construction of metallic structures, but the fumes generated during the welding process can threaten the health of welders. Fumes are undesirable products of the majority of welding operations and may have various detrimental effects on health. The purpose of this study was to investigate the effect of operational parameters of the shielded metal arc welding (SMAW) process on the emission of fumes. A dust monitor was used to measure the number and mass concentration of fumes generated by SMAW. Measurements were made at the distances of 23cm (hood inlet) and 41cm (welder\\'s breathing zone) from the weld point, with different values assigned to three operational parameters, namely current intensity, travel speed, and heat input (HI). Number concentration (NC) decreased with the increase in particle size. The highest mass concentrations (MC) were observed for MC1 (0.35μm-0.5μm) and MC8 (Larger than 6.5μm). For reducing exposures to fumes, welders are recommended to use the lowest voltage and amperage and the highest travel speed to the extent that does not compromise in the quality of welds. For assessment of exposure to airborne particles in industrial workplaces and specially in welding operations, it is thought that taking, solely, mass concentration in to consideration and lack of attention to number concentration would not be able to reflect accurate assessment of the adverse effects of particles on the body organs.

A Lithium Abundance Study of Solar-type Stars in Blanco 1 using the 2.1m McDonald Telescope: Developing Undergraduate Research Experiences.

NASA Astrophysics Data System (ADS)

Cargile, Phillip; James, D. J.; Villalon, K.; Girgenti, S.; Mermilliod, J.

2007-12-01

We present a new catalog of lithium equivalent widths for 20 solar-type stars in the young (60-100 Myr), nearby (250 pc) open cluster Blanco 1, measured from high-resolution spectra (R 30,000), taken during an observing run on the 2.1m telescope at McDonald Observatory. These new lithium data, coupled with the 20 or so extant measurements in the literature, are used in combination with the results of a recently completed standardized BVIc CCD survey, and corresponding 2MASS near-infrared colors, to derive precise lithium abundances for solar-type stars in Blanco 1. Comparing these new results with the existing lithium dataset for other open clusters, we investigate the mass- and age-dependent lithium depletion distribution among early-epoch (< 1Gyr) solar-type stars, and specifically, the lithium abundance scatter as a function of mass in Blanco 1. Our scientific project is highly synergystic with a pedagogical philosophy. We have instituted a program whereby undergraduate students - typically majoring in Liberal Arts and performing an independent study in Astronomy - receive hands-on research experience observing with the 2.1m telescope at the McDonald Observatory. After their observing run, these undergraduates take part in the reduction and analysis of the acquired spectra, and their research experience typically culminates in writing an undergraduate thesis and/or giving a professional seminar to the Astronomy group at Vanderbilt University.

Omori Law After Exogenous Shocks on Supplier-Customer Network

NASA Astrophysics Data System (ADS)

Fujiwara, Yoshi

We study the relaxation process of a supplier-customer network after mass destruction due to two giant earthquakes, Kobe 1995 and East Japan 2011, by investigating the number of chained failures. Firstly, a mass destruction and intervention of business activities in the damaged areas can be considered as a main shock. The exogenous shock was propagated on the supplier-customer network deteriorating financial states of other firms, even if they are not located in geographical neighbors. To quantify such aftershocks, we use chained failures on the network assuming that they indicate the trace of propagation of shocks. We show that the number of chained failures in its temporal change obeys an Omori-law, a power-law relaxation. This finding implies that the relaxation is much more sluggish than one would naively expect, and that it might be possible to estimate the extent and duration of aftershocks by using the empirical law. Several issues are discussed including the origin of the long-time relaxation.

Oxidation of Microcystins by Permanganate: pH and Temperature-Dependent Kinetics, Effect of DOM Characteristics, and Oxidation Mechanism Revisited.

PubMed

Kim, Min Sik; Lee, Hye-Jin; Lee, Ki-Myeong; Seo, Jiwon; Lee, Changha

2018-05-23

Oxidative degradation of six representative microcystins (MCs) (MC-RR, -LR, -YR, -LF, -LW and -LA) by potassium permanganate (KMnO4; Mn(VII)) was investigated, focusing on the temperature- and pH-dependent reaction kinetics, the effect of dissolved organic matter (DOM), and the oxidation mechanisms. Second-order rate constants for the reactions of the six MCs with Mn(VII) (kMn(VII),MC) were determined to be 160.4-520.1 M-1 s-1 (MC-RR > -LR  -YR > -LF  -LW > -LA) at pH 7.2 and 21°C. The kMn(VII),MC values exhibited activation energies ranging from 15.1 to 22.4 kJ mol-1. With increasing pH from 2 to 11, the kMn(VII),MC values decreased until pH 5, and plateaued over the pH range of 5-11, except for that of MC-YR (which increased at pH > 8). Species-specific second-order rate constants were calculated using predicted pKa values of MCs. The oxidation of MCs in natural waters was accurately predicted by the kinetic model using kMn(VII),MC and Mn(VII) exposure ([Mn(VII)]dt) values. Among different characteristics of DOM in natural waters, UV254, SUVA254, and the abundance of humic-like substances characterized by fluorescence spectroscopy exhibited good correlation with [Mn(VII)]dt. A thorough product study of MC-LR oxidation by Mn(VII) was performed using liquid chromatography-mass spectrometry.

A mass reconstruction technique for a heavy resonance decaying to τ + τ -

NASA Astrophysics Data System (ADS)

Xia, Li-Gang

2016-11-01

For a resonance decaying to τ + τ -, it is difficult to reconstruct its mass accurately because of the presence of neutrinos in the decay products of the τ leptons. If the resonance is heavy enough, we show that its mass can be well determined by the momentum component of the τ decay products perpendicular to the velocity of the τ lepton, p ⊥, and the mass of the visible/invisible decay products, m vis/inv, for τ decaying to hadrons/leptons. By sampling all kinematically allowed values of p ⊥ and m vis/inv according to their joint probability distributions determined by the MC simulations, the mass of the mother resonance is assumed to lie at the position with the maximal probability. Since p ⊥ and m vis/inv are invariant under the boost in the τ lepton direction, the joint probability distributions are independent upon the τ’s origin. Thus this technique is able to determine the mass of an unknown resonance with no efficiency loss. It is tested using MC simulations of the physics processes pp → Z/h(125)/h(750) + X → ττ + X at 13 TeV. The ratio of the full width at half maximum and the peak value of the reconstructed mass distribution is found to be 20%-40% using the information of missing transverse energy. Supported by General Financial Grant from the China Postdoctoral Science Foundation (2015M581062)

A review on the determination of isotope ratios of boron with mass spectrometry.

PubMed

Aggarwal, Suresh Kumar; You, Chen-Feng

2017-07-01

The present review discusses different mass spectrometric techniques-viz, thermal ionization mass spectrometry (TIMS), inductively coupled plasma mass spectrometry (ICPMS), and secondary ion mass spectrometry (SIMS)-used to determine 11 B/ 10 B isotope ratio, and concentration of boron required for various applications in earth sciences, marine geochemistry, nuclear technology, environmental, and agriculture sciences, etc. The details of the techniques-P-TIMS, which uses Cs 2 BO 2 + , N-TIMS, which uses BO 2 - , and MC-ICPMS, which uses B + ions for bulk analysis or B - and B + ions for in situ micro-analysis with SIMS-are highlighted. The capabilities, advantages, limitations, and problems in each mass spectrometric technique are summarized. The results of international interlaboratory comparison experiments conducted at different times are summarized. The certified isotopic reference materials available for boron are also listed. Recent developments in laser ablation (LA) ICPMS and QQQ-ICPMS for solids analysis and MS/MS analysis, respectively, are included. The different aspects of sample preparation and analytical chemistry of boron are summarized. Finally, the future requirements of boron isotope ratios for future applications are also given. Presently, MC-ICPMS provides the best precision and accuracy (0.2-0.4‰) on isotope ratio measurements, whereas N-TIMS holds the potential to analyze smallest amount of boron, but has the issue of bias (+2‰ to 4‰) which needs further investigations. © 2016 Wiley Periodicals, Inc. Mass Spec Rev 36:499-519, 2017. © 2016 Wiley Periodicals, Inc.

The GALEX Catalog of UV Sources in the Magellanic Clouds

NASA Astrophysics Data System (ADS)

Thilker, David A.; Bianchi, L.; Simons, R.

2014-01-01

The Galaxy Evolution Explorer (GALEX) has performed unprecedented imaging surveys of the Magellanic Clouds (MC) and their surrounding areas including the Magellanic Bridge (MB) in near-UV (NUV, 1771-2831 Å) and far-UV (FUV, 1344-1786 Å) bands at 5″ resolution. Substantially more area was covered in the NUV than FUV, particularly in the bright central regions, because of the GALEX FUV detector failure. The 5σ depth of the NUV imaging varies between 20.8 and 22.7 (ABmag). Such imaging provides the first sensitive view of the entire content of hot stars in the Magellanic System, revealing the presence of young populations even in sites with extremely low star-formation rate surface density like the MB, owing to high sensitivity of the UV data to hot stars and the dark sky at these wavelengths. Crowding limits the quality of source detection and photometry from the standard mission pipeline processing. Therefore, we performed custom PSF-fitting photometry of the GALEX data in the MC survey region (<15° from the LMC, <10° from the SMC). After merging multiple detections of sources in overlapping images, the resulting catalog we have produced contains many million unique NUV point sources. This poster provides a first look at the GALEX MC survey and highlights some of the science investigations that the catalog and imaging dataset will make possible.

Data visualization, time-series analysis, and mass-balance modeling of hydrologic and water-quality data for the McTier Creek watershed, South Carolina, 2007-2009

USGS Publications Warehouse

Benedict, Stephen T.; Conrads, Paul; Feaster, Toby D.; Journey, Celeste A.; Golden, Heather E.; Knightes, Christopher D.; Davis, Gary M.; Bradley, Paul M.

2012-01-01

The McTier Creek watershed is located in the headwaters of the Edisto River Basin, which is in the Coastal Plain region of South Carolina. The Edisto ecosystem has some of the highest recorded fish-tissue mercury concentrations in the United States. In an effort to advance the understanding of the fate and transport of mercury in stream ecosystems, the U.S. Geological Survey, as part of its National Water-Quality Assessment Program, initiated a field investigation of mercury in the McTier Creek watershed in 2006. The initial efforts of the investigation included the collection of extensive hydrologic and water-quality field data, along with the development of several hydrologic and water-quality models. This series of measured and modeled data forms the primary source of information for this investigation to assess the fate and transport of mercury within the McTier Creek watershed.

PATCH - STS-33/51-L (TEACHER IN SPACE)

NASA Image and Video Library

1985-08-02

S85-38312 (September 1985) --- Logo designed for use by the 10 finalists in NASA’s Teacher in Space Project, who were at JSC for training and orientation the week of July 8–12, 1985. They are David M. Marquart, Boise High, Boise, Idaho; Michael W. Metcalf, Hazen Union School, Hardwick, Vermont; Judith Marie Garcia, Thomas Jefferson School for Science and Technology, Alexandria, Virginia; Peggy J. Lathlaen, Westwood Elementary, Friendswood, Texas; Niki Mason Wenger, Vandevender Junior High, Parkersburg, West Virginia; Barbara R. Morgan, McCall-Donnelly Elementary, McCall, Idaho; Kathleen Anne Beres, Kenwood High, Baltimore, Maryland; Richard A. Methia, New Bedford High, New Bedford, Mass.; Sharon Christa McAuliffe, Concord High, Concord, New Hampshire; and Robert S. Foerster, Cumberland Elementary School, West Lafayette, Indiana. Photo credit: NASA

STS-54 Pilot McMonagle with DSO 802 and Physics of Toys top on OV-105's middeck

NASA Technical Reports Server (NTRS)

1993-01-01

STS-54 Pilot Donald R. McMonagle watches as a top spins above his head on the middeck of the Earth-orbiting Endeavour, Orbiter Vehicle (OV) 105. The demonstration was part of Application Specific Preprogrammed Experiment Culture System Physics of Toys (ASPEC) and Detailed Supplementary Objective (DSO) 802, Educational activities. Through telephone and television (TV) downlinks, students at Westwood Elementary School in Flint, Michigan -- McMonagle's hometown -- asked him questions about the several toys he demonstrated. The top demonstrates gyroscopic motion, the center of mass and angular momentum. The entire collection of toys will be videotaped for an educational program to be distributed to schools in the autumn. This scene was downlinked at 18:01:59:11 GMT.

DO THE LEGS OF MAGNETIC CLOUDS CONTAIN TWISTED FLUX-ROPE MAGNETIC FIELDS?

DOE Office of Scientific and Technical Information (OSTI.GOV)

Owens, M. J.

2016-02-20

Magnetic clouds (MCs) are a subset of interplanetary coronal mass ejections (ICMEs) characterized primarily by a smooth rotation in the magnetic field direction indicative of the presence of a magnetic flux rope. Energetic particle signatures suggest MC flux ropes remain magnetically connected to the Sun at both ends, leading to widely used model of global MC structure as an extended flux rope, with a loop-like axis stretching out from the Sun into the heliosphere and back to the Sun. The time of flight of energetic particles, however, suggests shorter magnetic field line lengths than such a continuous twisted flux ropemore » would produce. In this study, two simple models are compared with observed flux rope axis orientations of 196 MCs to show that the flux rope structure is confined to the MC leading edge. The MC “legs,” which magnetically connect the flux rope to the Sun, are not recognizable as MCs and thus are unlikely to contain twisted flux rope fields. Spacecraft encounters with these non-flux rope legs may provide an explanation for the frequent observation of non-MC ICMEs.« less

Asymmetry distributions and mass effects in dijet events at a polarized HERA

NASA Astrophysics Data System (ADS)

Maul, M.; Schäfer, A.; Mirkes, E.; Rädel, G.

1998-09-01

The asymmetry distributions for several kinematic variables are considered for finding a systematic way to maximize the signal for the extraction of the polarized gluon density. The relevance of mass effects for the corresponding dijet cross section is discussed and the different approximations for including mass effects are compared. We also compare via the programs Pepsi and Mepjet two different Monte Carlo (MC) approaches for simulating the expected signal in the dijet asymmetry at a polarized HERA.

The Origin of Mass and the Feebleness of Gravity

ScienceCinema

Wilczek, Frank

2017-12-09

BSA Distinguished Lecture presented by Frank Wilczek, co-winner of the 2004 Nobel Prize in Physics. Einstein's famous equation E=mc^2 asserts that energy and mass are different aspects of the same reality. The general public usually associates the equation with the idea that small amounts of mass can be converted into large amounts of energy, as in nuclear reactors and bombs. For physicists who study the basic nature of matter, however, the more important idea is just the opposite.

Iron-Isotopic Fractionation Studies Using Multiple Collector Inductively Coupled Plasma Mass Spectrometry

NASA Technical Reports Server (NTRS)

Anbar, A. D.; Zhang, C.; Barling, J.; Roe, J. E.; Nealson, K. H.

1999-01-01

The importance of Fe biogeochemistry has stimulated interest in Fe isotope fractionation. Recent studies using thermal ionization mass spectrometry (TIMS) and a "double spike" demonstrate the existence of biogenic Fe isotope effects. Here, we assess the utility of multiple-collector inductively-coupled plasma mass spectrometry(MC-ICP-MS) with a desolvating sample introduction system for Fe isotope studies, and present data on Fe biominerals produced by a thermophilic bacterium. Additional information is contained in the original extended abstract.

Establishing Alpha Oph as a Prototype Rotator: Improved Astrometric Orbit

DTIC Science & Technology

2011-01-10

astrometric characterization of the companion orbit. We also use photometry from these observations to derive a model-based estimate of the companion mass. A...uncertainties. In addition to the dynamically derived masses, we use IJHK photometry to derive a model-based mass for α Oph B, of 0.77 ± 0.05 M...man 1966; Gatewood 2005) with a 8.62 yr period, well estab- lished over several decades of monitoring and first resolved by McCarthy (1983). But a

Simultaneous moisture content and mass flow measurements in wood chip flows using coupled dielectric and impact sensors

DOE Office of Scientific and Technical Information (OSTI.GOV)

Pan, Pengmin; McDonald, Timothy; Fulton, John

An 8-electrode capacitance tomography (ECT) sensor was built and used to measure moisture content (MC) and mass flow of pine chip flows. The device was capable of directly measuring total water quantity in a sample but was sensitive to both dry matter and moisture, and therefore required a second measurement of mass flow to calculate MC. Two means of calculating the mass flow were used: the first being an impact sensor to measure total mass flow, and the second a volumetric approach based on measuring total area occupied by wood in images generated using the capacitance sensor’s tomographic mode. Testsmore » were made on 109 groups of wood chips ranging in moisture content from 14% to 120% (dry basis) and wet weight of 280 to 1100 g. Sixty groups were randomly selected as a calibration set, and the remaining were used for validation of the sensor’s performance. For the combined capacitance/force transducer system, root mean square errors of prediction (RMSEP) for wet mass flow and moisture content were 13.42% and 16.61%, respectively. RMSEP using the combined volumetric mass flow/capacitance sensor for dry mass flow and moisture content were 22.89% and 24.16%, respectively. Either of the approaches was concluded to be feasible for prediction of moisture content in pine chip flows, but combining the impact and capacitance sensors was easier to implement. As a result, in situations where flows could not be impeded, however, the tomographic approach would likely be more useful.« less

Simultaneous moisture content and mass flow measurements in wood chip flows using coupled dielectric and impact sensors

DOE PAGES

Pan, Pengmin; McDonald, Timothy; Fulton, John; ...

2016-12-23

An 8-electrode capacitance tomography (ECT) sensor was built and used to measure moisture content (MC) and mass flow of pine chip flows. The device was capable of directly measuring total water quantity in a sample but was sensitive to both dry matter and moisture, and therefore required a second measurement of mass flow to calculate MC. Two means of calculating the mass flow were used: the first being an impact sensor to measure total mass flow, and the second a volumetric approach based on measuring total area occupied by wood in images generated using the capacitance sensor’s tomographic mode. Testsmore » were made on 109 groups of wood chips ranging in moisture content from 14% to 120% (dry basis) and wet weight of 280 to 1100 g. Sixty groups were randomly selected as a calibration set, and the remaining were used for validation of the sensor’s performance. For the combined capacitance/force transducer system, root mean square errors of prediction (RMSEP) for wet mass flow and moisture content were 13.42% and 16.61%, respectively. RMSEP using the combined volumetric mass flow/capacitance sensor for dry mass flow and moisture content were 22.89% and 24.16%, respectively. Either of the approaches was concluded to be feasible for prediction of moisture content in pine chip flows, but combining the impact and capacitance sensors was easier to implement. As a result, in situations where flows could not be impeded, however, the tomographic approach would likely be more useful.« less

Simultaneous Moisture Content and Mass Flow Measurements in Wood Chip Flows Using Coupled Dielectric and Impact Sensors

PubMed Central

Pan, Pengmin; McDonald, Timothy; Fulton, John; Via, Brian; Hung, John

2016-01-01

An 8-electrode capacitance tomography (ECT) sensor was built and used to measure moisture content (MC) and mass flow of pine chip flows. The device was capable of directly measuring total water quantity in a sample but was sensitive to both dry matter and moisture, and therefore required a second measurement of mass flow to calculate MC. Two means of calculating the mass flow were used: the first being an impact sensor to measure total mass flow, and the second a volumetric approach based on measuring total area occupied by wood in images generated using the capacitance sensor’s tomographic mode. Tests were made on 109 groups of wood chips ranging in moisture content from 14% to 120% (dry basis) and wet weight of 280 to 1100 g. Sixty groups were randomly selected as a calibration set, and the remaining were used for validation of the sensor’s performance. For the combined capacitance/force transducer system, root mean square errors of prediction (RMSEP) for wet mass flow and moisture content were 13.42% and 16.61%, respectively. RMSEP using the combined volumetric mass flow/capacitance sensor for dry mass flow and moisture content were 22.89% and 24.16%, respectively. Either of the approaches was concluded to be feasible for prediction of moisture content in pine chip flows, but combining the impact and capacitance sensors was easier to implement. In situations where flows could not be impeded, however, the tomographic approach would likely be more useful. PMID:28025536

Rapid Quantitative Analysis of Microcystins in Raw Surface Waters with MALDI MS Utilizing Easily Synthesized Internal Standards

PubMed Central

Roegner, Amber F.; Schirmer, Macarena Pírez; Puschner, Birgit; Brena, Beatriz; Gonzalez-Sapienza, Gualberto

2014-01-01

The freshwater cyanotoxins, microcystins (MCs), pose a global public health threat as potent hepatotoxins in cyanobacterial blooms; their persistence in drinking and recreational water has been associated with potential chronic effects in addition to acute intoxications. Rapid and accurate detection of the over 80 structural congeners is challenged by the rigorous and time consuming clean up required to overcome interference found in raw water samples. MALDI-MS has shown promise for rapid quantification of individual congeners in raw water samples, with very low operative cost, but so far limited sensitivity and lack of available and versatile internal standards (ISs) has limited its use. Two easily synthesized S-hydroxyethyl–Cys(7)-MC-LR and –RR ISs were used to generate linear standard curves in a reflectron MALDI instrument, reproducible across several orders of magnitude for MC –LR, - RR and –YR. Minimum quantification limits in direct water samples with no clean up or concentration step involved were consistently below 7 μg/L, with recoveries from spiked samples between 80 and 119%. This method improves sensitivity by 30 fold over previous reports of quantitative MALDI-TOF applications to MCs and provides a salient option for rapid throughput analysis for multiple MC congeners in untreated raw surface water blooms as a means to identify source public health threats and target intervention strategies within a watershed. As demonstrated by analysis of a set of samples from Uruguay, utilizing the reaction of different MC congeners with alternate sulfhydryl compounds, the m/z of the IS can be customized to avoid overlap with interfering compounds in local surface water samples. PMID:24388801

Melanocortin-4 receptor pathway dysfunction in obesity: Patient stratification aimed at MC4R agonist treatment.

PubMed

Ayers, Kristin L; Glicksberg, Benjamin S; Garfield, Alastair S; Longerich, Simonne; White, Joseph A; Yang, Pengwei; Du, Lei; Chittenden, Thomas W; Gulcher, Jeffery R; Roy, Sophie; Fiedorek, Fred; Gottesdiener, Keith; Cohen, Sarah; North, Kari E; Schadt, Eric E; Li, Shuyu D; Chen, Rong; Van der Ploeg, Lex H T

2018-05-02

The hypothalamic melanocortin 4 receptor (MC4R)-pathway serves a critical role in regulating bodyweight. Loss of function (LoF) mutations in the MC4R pathway including mutations in the POMC (1), PCSK1, LEPR (2) or the MC4R genes (3) have been shown to be causative of early-onset severe obesity. Through a comprehensive epidemiological analysis of known and predicted LoF variants in the POMC, PCSK1 and LEPR genes, we sought to estimate the number of US individuals with bi-allelic MC4R pathway LoF variants. We predict approximately 650 α-MSH/POMC, 8,500 PCSK1 and 3,600 LEPR homozygous and compound heterozygous individuals in the US, cumulatively enumerating over 12,800 MC4R pathway deficient obese patients. Very few of these have been genetically diagnosed to date. These estimates increase when we include a small subset of less rare variants: β-MSH/POMC, PCSK1 N221D, and a novel PCSK1 LoF variant (T640A). To further define the MC4R pathway and its potential impact on obesity we tested associations between body-mass index (BMI) and LoF mutation-burden in the POMC, PCSK1 and LEPR genes in various populations. We show that the cumulative allele burden in individuals with two or more LoF alleles in one or more genes in the MC4R pathway predisposes to a higher BMI than non-carriers or heterozygous LoF carriers with a defect in only one gene. Our analysis represents a genetically-rationalized study of the hypothalamic MC4R pathway aimed at genetic patient stratification to determine which obese sub-populations should be studied to understand MC4R agonist (e.g., setmelanotide) treatment responsiveness.

Atypical Depression, Body Mass, and Left Ventricular Mass: Analysis of Data from CARDIA

DTIC Science & Technology

2005-01-01

The other symptoms include: insomnia or hypersomnia , significant increase or decrease in appetite or weight, psychomotor agitation or retardation...symptoms: overeating (hyperphagia), oversleeping ( hypersomnia ), “leaden paralysis,” and interpersonal rejection sensitivity. Research aimed at testing the...implications for idiopathic dilated cardiomyopathy. Psychiatry Res, 32(1), 55-61. Kendler, K.S., Eaves, L.J., Walters, E.E., Neale, M.C., Heath

Mass Spectrometric Investigation of Silicon Extremely Enriched in (28)Si: From (28)SiF4 (Gas Phase IRMS) to (28)Si Crystals (MC-ICP-MS).

PubMed

Pramann, Axel; Rienitz, Olaf

2016-06-07

A new generation of silicon crystals even further enriched in (28)Si (x((28)Si) > 0.999 98 mol/mol), recently produced by companies and institutes in Russia within the framework of a project initiated by PTB, were investigated with respect to their isotopic composition and molar mass M(Si). A modified isotope dilution mass spectrometric (IDMS) method treating the silicon as the matrix containing a so-called virtual element (VE) existing of the isotopes (29)Si and (30)Si solely and high resolution multicollector inductively coupled plasma mass spectrometry (MC-ICP-MS) were applied in combination. This method succeeds also when examining the new materials holding merely trace amounts of (29)Si (x((29)Si) ≈ 5 × 10(-6) mol/mol) and (30)Si (x((30)Si) ≈ 7 × 10(-7) mol/mol) extremely difficult to detect with lowest uncertainty. However, there is a need for validating the enrichment in (28)Si already in the precursor material of the final crystals, silicon tetrafluoride (SiF4) gas prior to crystal production. For that purpose, the isotopic composition of selected SiF4 samples was determined using a multicollector magnetic sector field gas-phase isotope ratio mass spectrometer. Contaminations of SiF4 by natural silicon due to storing and during the isotope ratio mass spectrometry (IRMS) measurements were observed and quantified. The respective MC-ICP-MS measurements of the corresponding crystal samples show-in contrast-several advantages compared to gas phase IRMS. M(Si) of the new crystals were determined to some extent with uncertainties urel(M) < 1 × 10(-9). This study presents a clear dependence of the uncertainty urel(M(Si)) on the degree of enrichment in (28)Si. This leads to a reduction of urel(M(Si)) during the past decade by almost 3 orders of magnitude and thus further reduces the uncertainty of the Avogadro constant NA which is one of the preconditions for the redefinition of the SI unit kilogram.

Field Validity and Feasibility of Four Techniques for the Detection of Trichuris in Simians: A Model for Monitoring Drug Efficacy in Public Health?

PubMed Central

Levecke, Bruno; De Wilde, Nathalie; Vandenhoute, Els; Vercruysse, Jozef

2009-01-01

Background Soil-transmitted helminths, such as Trichuris trichiura, are of major concern in public health. Current efforts to control these helminth infections involve periodic mass treatment in endemic areas. Since these large-scale interventions are likely to intensify, monitoring the drug efficacy will become indispensible. However, studies comparing detection techniques based on sensitivity, fecal egg counts (FEC), feasibility for mass diagnosis and drug efficacy estimates are scarce. Methodology/Principal Findings In the present study, the ether-based concentration, the Parasep Solvent Free (SF), the McMaster and the FLOTAC techniques were compared based on both validity and feasibility for the detection of Trichuris eggs in 100 fecal samples of nonhuman primates. In addition, the drug efficacy estimates of quantitative techniques was examined using a statistical simulation. Trichuris eggs were found in 47% of the samples. FLOTAC was the most sensitive technique (100%), followed by the Parasep SF (83.0% [95% confidence interval (CI): 82.4–83.6%]) and the ether-based concentration technique (76.6% [95% CI: 75.8–77.3%]). McMaster was the least sensitive (61.7% [95% CI: 60.7–62.6%]) and failed to detect low FEC. The quantitative comparison revealed a positive correlation between the four techniques (Rs = 0.85–0.93; p<0.0001). However, the ether-based concentration technique and the Parasep SF detected significantly fewer eggs than both the McMaster and the FLOTAC (p<0.0083). Overall, the McMaster was the most feasible technique (3.9 min/sample for preparing, reading and cleaning of the apparatus), followed by the ether-based concentration technique (7.7 min/sample) and the FLOTAC (9.8 min/sample). Parasep SF was the least feasible (17.7 min/sample). The simulation revealed that the sensitivity is less important for monitoring drug efficacy and that both FLOTAC and McMaster were reliable estimators. Conclusions/Significance The results of this study demonstrated that McMaster is a promising technique when making use of FEC to monitor drug efficacy in Trichuris. PMID:19172171

Production of recombinant rat proopiomelanocortin1-74 and characterization of its mitogenic action on pituitary lactotrophs.

PubMed

Bert, C; Vande Vijver, V; Andries, M; Verhaert, P; Proost, P; De Vreese, B; Van Beeumen, J; Vankelecom, H; Denef, C

1999-08-20

We report the production of biologically active recombinant rat Gly-2-Ser-1-POMC1-74 (rrPOMC1-74) in a prokaryotic expression system. The polypeptide was produced as a fusion protein with glutathione-S-transferase (GST), using the pGEX-4T-1 vector and subsequently cleaved by thrombin. Amino acid sequencing, up to residue 45, showed a correct primary structure including the two additional amino acids at the N-terminus, Gly and Ser, derived from the thrombin cleavage site. Electrospray ionization mass spectrometry showed a Mr of 8358.5 Da which was 14-16 Da heavier (oxidation or methylation) than the calculated mass. Combined digestion with trypsin and endoproteinase Glu-C followed by MALDI-TOF mass spectrometry and N-terminal sequencing of the separated fragments showed a correct disulphide bridge configuration. In reaggregate cell cultures of immature rat pituitary, rrPOMC1-74 displayed biological activity similar to that of natural human (h) POMC1-76 or rat POMC1-74: it stimulated DNA replication in lactotrophs but not in other pituitary cell types. However, its efficacy was significantly lower than that of the natural product. Gamma3-MSH, a peptide that can be generated from POMC1-74 and a typical ligand of the melanocortin-3 (MC-3) receptor, also stimulated DNA replication in lactotrophs and, in contrast to rrPOMC1-74, also in somatotrophs and thyrotrophs. rrPOMC1-74 increased cAMP levels in 293HEK cells stably transfected with the MC-3 receptor with an intrinsic activity and potency similar to that of gamma3-MSH. However, natural hPOMC1-76 was inactive in the latter test system. These data show that rrPOMC1-74 mimics the selective mitogenic action of natural POMC1-74 on lactotrophs. Since natural POMC1-74 is N- and O-glycosylated and rrPOMC1-74 is not, glycosylation does not seem to determine the selectivity for lactotrophs. In spite of the feature that rrPOMC1-74 is an agonist at the MC-3 receptor and the reported evidence that the MC-3 receptor is expressed in the anterior pituitary, the mitogenic action of rrPOMC1-74 on lactotrophs does not seem to be mediated by the MC-3 receptor.

Preliminary Concept of Operations for the Deep Space Array-Based Network

NASA Astrophysics Data System (ADS)

Bagri, D. S.; Statman, J. I.

2004-05-01

The Deep Space Array-Based Network (DSAN) will be an array-based system, part of a greater than 1000 times increase in the downlink/telemetry capability of the Deep Space Network. The key function of the DSAN is provision of cost-effective, robust telemetry, tracking, and command services to the space missions of NASA and its international partners. This article presents an expanded approach to the use of an array-based system. Instead of using the array as an element in the existing Deep Space Network (DSN), relying to a large extent on the DSN infrastructure, we explore a broader departure from the current DSN, using fewer elements of the existing DSN, and establishing a more modern concept of operations. For example, the DSAN will have a single 24 x 7 monitor and control (M&C) facility, while the DSN has four 24 x 7 M&C facilities. The article gives the architecture of the DSAN and its operations philosophy. It also briefly describes the customer's view of operations, operations management, logistics, anomaly analysis, and reporting.

Isothiocyanate-rich Moringa oleifera extract reduces weight gain, insulin resistance, and hepatic gluconeogenesis in mice.

PubMed

Waterman, Carrie; Rojas-Silva, Patricio; Tumer, Tugba Boyunegmez; Kuhn, Peter; Richard, Allison J; Wicks, Shawna; Stephens, Jacqueline M; Wang, Zhong; Mynatt, Randy; Cefalu, William; Raskin, Ilya

2015-06-01

Moringa oleifera (moringa) is tropical plant traditionally used as an antidiabetic food. It produces structurally unique and chemically stable moringa isothiocyanates (MICs) that were evaluated for their therapeutic use in vivo. C57BL/6L mice fed very high fat diet (VHFD) supplemented with 5% moringa concentrate (MC, delivering 66 mg/kg/d of MICs) accumulated fat mass, had improved glucose tolerance and insulin signaling, and did not develop fatty liver disease compared to VHFD-fed mice. MC-fed group also had reduced plasma insulin, leptin, resistin, cholesterol, IL-1β, TNFα, and lower hepatic glucose-6-phosphatase (G6P) expression. In hepatoma cells, MC and MICs at low micromolar concentrations inhibited gluconeogenesis and G6P expression. MICs and MC effects on lipolysis in vitro and on thermogenic and lipolytic genes in adipose tissue in vivo argued these are not likely primary targets for the anti-obesity and anti-diabetic effects observed. Data suggest that MICs are the main anti-obesity and anti-diabetic bioactives of MC, and that they exert their effects by inhibiting rate-limiting steps in liver gluconeogenesis resulting in direct or indirect increase in insulin signaling and sensitivity. These conclusions suggest that MC may be an effective dietary food for the prevention and treatment of obesity and type 2 diabetes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

The influence of room temperature on Mg isotope measurements by MC-ICP-MS.

PubMed

Zhang, Xing-Chao; Zhang, An-Yu; Zhang, Zhao-Feng; Huang, Fang; Yu, Hui-Min

2018-03-24

We observed that the accuracy and precision of magnesium (Mg) isotope analyses could be affected if the room temperature oscillated during measurements. To achieve high quality Mg isotopic data, it is critical to evaluate how the unstable room temperature affects Mg isotope measurements by multi-collector inductively coupled plasma mass spectrometry (MC-ICP-MS). We measured the Mg isotopes for the reference material DSM-3 using MC-ICP-MS under oscillating room temperatures in spring. For a comparison, we also measured the Mg isotopes under stable room temperatures, which was achieved by the installation of an improved temperature control system in the laboratory. The δ 26 Mg values measured under oscillating room temperatures have a larger deviation (δ 26 Mg from -0.09 to 0.08‰, with average δ 26 Mg = 0.00 ± 0.08 ‰) than those measured under a stable room temperature (δ 26 Mg from -0.03 to 0.03‰, with average δ 26 Mg = 0.00 ± 0.02 ‰) using the same MC-ICP-MS system. The room temperature variation can influence the stability of MC-ICP-MS. Therefore, it is critical to keep the room temperature stable to acquire high precise and accurate isotopic data when using MC-ICP-MS, especially when using the sample-standard bracketing (SSB) correction method. This article is protected by copyright. All rights reserved.

[Association of polymorphic variants of FTO and MC4R genes with obesity in a Tatar population].

PubMed

Kochetova, O V; Korytina, G F; Akhmadishina, L Z; Semenov, E E; Viktorova, T V

2015-02-01

Obesity is a chronic relapsing disease that leads to numerous ailments and requires lifelong treatment. Genetic predisposition is one of the mostly discussed aspects of obesity development, and genome-wide association studies have provided evidence that several variants of the FTO and MC4R genes are significantly associated with obesity. In this study the association of FTO (rs9939609, rs7202116, and rs9930506) and MC4R (rs12970134 and rs17782313) genes' SNPs with obesity in Tatar women has been analyzed. In the investigation 340 women with obesity (Body Mass Index (BMI) ≥ 30 kg/m2) and 330 women from a control group (BMI up to 24.9 kg/m2) took part. The FTO rs9939609 (p = 0.0002) and rs9930506 (p = 0.0005) SNPs were shown to be associated with obesity risk following an additive model, while the MC4R rs12970134 (p = 0.0076) and rs1778231 (p = 0.021) SNPs were associated by a recessive model. We also showed an association of quantitative parameters (age, weight, and BMI) with two the FTO rs9939609 and rs9930506 SNPs and the association of age and the MC4R rs12970134 SNP. Our study demonstrates the role of genetic variability in FTO and MC4R genes in obesity development in Tatar women from Russia.

Reconstruction of a mandibular segmental defect with a customized 3-dimensional-printed titanium prosthesis in a cat with a mandibular osteosarcoma.

PubMed

Liptak, Julius M; Thatcher, Graham P; Bray, Jonathan P

2017-04-15

CASE DESCRIPTION A 12-year-old neutered male domestic shorthair cat had been treated for a mass arising from the lingual aspect of the caudal right mandibular body. Cytoreductive surgery of the mass had been performed twice over a 2-year period, but the mass recurred following both surgeries. The mass was diagnosed as an osteosarcoma, and the cat was referred for further evaluation and treatment. CLINICAL FINDINGS Clinical findings were unremarkable, except for a 2-cm-diameter mass arising from the lingual aspect of the right mandible and mild anemia and lymphopenia. Pre- and postcontrast CT scans of the head, neck, and thorax were performed, revealing that the osteosarcoma was confined to the caudal right mandibular body, with no evidence of lymph node or pulmonary metastasis. TREATMENT AND OUTCOME The stereolithographic files of the CT scan of the head were sent for computer-aided design and manufacture of a customized 3-D-printed titanium prosthesis. Segmental mandibulectomy was performed, and the mandibular defect was reconstructed in a single stage with the 3-D-printed titanium prosthesis. The cat had 1 minor postoperative complication but had no signs of eating difficulties at any point after surgery. The cat was alive and disease free 14 months postoperatively. CLINICAL RELEVANCE Reconstruction of the mandible of a cat following mandibulectomy was possible with computer-aided design and manufacture of a customized 3-D-printed titanium prosthesis. Cats have a high rate of complications following mandibulectomy, and these initial findings suggested that mandibular reconstruction may reduce the risk of these complications and result in a better functional outcome.

The Fraction of Interplanetary Coronal Mass Ejections That Are Magnetic Clouds: Evidence for a Solar Cycle Variation

NASA Technical Reports Server (NTRS)

Richardson, I. G.; Cane, H. V.

2004-01-01

"Magnetic clouds" (MCs) are a subset of interplanetary coronal mass ejections (ICMEs) characterized by enhanced magnetic fields with an organized rotation in direction, and low plasma beta. Though intensely studied, MCs only constitute a fraction of all the ICMEs that are detected in the solar wind. A comprehensive survey of ICMEs in the near- Earth solar wind during the ascending, maximum and early declining phases of solar cycle 23 in 1996 - 2003 shows that the MC fraction varies with the phase of the solar cycle, from approximately 100% (though with low statistics) at solar minimum to approximately 15% at solar maximum. A similar trend is evident in near-Earth observations during solar cycles 20 - 21, while Helios 1/2 spacecraft observations at 0.3 - 1.0 AU show a weaker trend and larger MC fraction.

McSnow: A Monte-Carlo Particle Model for Riming and Aggregation of Ice Particles in a Multidimensional Microphysical Phase Space

NASA Astrophysics Data System (ADS)

Brdar, S.; Seifert, A.

2018-01-01

We present a novel Monte-Carlo ice microphysics model, McSnow, to simulate the evolution of ice particles due to deposition, aggregation, riming, and sedimentation. The model is an application and extension of the super-droplet method of Shima et al. (2009) to the more complex problem of rimed ice particles and aggregates. For each individual super-particle, the ice mass, rime mass, rime volume, and the number of monomers are predicted establishing a four-dimensional particle-size distribution. The sensitivity of the model to various assumptions is discussed based on box model and one-dimensional simulations. We show that the Monte-Carlo method provides a feasible approach to tackle this high-dimensional problem. The largest uncertainty seems to be related to the treatment of the riming processes. This calls for additional field and laboratory measurements of partially rimed snowflakes.

Rapid determination of 237Np in soil samples by multi-collector inductively-coupled plasma mass spectrometry and gamma spectrometry.

PubMed

Yi, Xiaowei; Shi, Yanmei; Xu, Jiang; He, Xiaobing; Zhang, Haitao; Lin, Jianfeng

A radiochemical procedure is developed for the determination of 237 Np in soil with multi-collector inductively-coupled plasma mass spectrometry (MC-ICP-MS) and gamma-spectrometry. 239 Np (milked from 243 Am) was used as an isotopic tracer for chemical yield determination. The neptunium in the soil is separated by thenoyl-trifluoracetone extraction from 1 M HNO 3 solution after reducing Np to Np(IV) with ferrous sulfamate, and then purified with Dowex 1 × 2 anion exchange resin. 239 Np in the resulting solution is measured with gamma-spectrometry for chemical yield determination while the 237 Np is measured with MC-ICP-MS. Measurement results for soil samples are presented together with those for two reference samples. By comparing the determined value with the reference value of the 237 Np activity concentration, the feasibility of the procedure was validated.

Non-equilibrium ionization around clouds evaporating in the interstellar medium

NASA Technical Reports Server (NTRS)

Ballet, J.; Luciani, J. F.; Mora, P.

1986-01-01

It is of prime importance for global models of the interstellar medium to know whether dense clouds do or do not evaporate in the hot coronal gas. The rate of mass exchanges between phases depends very much on that. McKee and Ostriker's model, for instance, assumes that evaporation is important enough to control the expansion of supernova remnants, and that mass loss obeys the law derived by Cowie and McKee. In fact, the geometry of the magnetic field is nearly unknown, and it might totally inhibit evaporation, if the clouds are not regularly connected to the hot gas. Up to now, the only test of the theory is the U.V. observation (by the Copernicus and IUE satellites) of absorption lines of ions such as OVI or NV, that exist at temperatures of a few 100,000 K typical of transition layers around evaporating clouds. Other means of testing the theory are discussed.

Coronal Mass Ejection Data Clustering and Visualization of Decision Trees

NASA Astrophysics Data System (ADS)

Ma, Ruizhe; Angryk, Rafal A.; Riley, Pete; Filali Boubrahimi, Soukaina

2018-05-01

Coronal mass ejections (CMEs) can be categorized as either “magnetic clouds” (MCs) or non-MCs. Features such as a large magnetic field, low plasma-beta, and low proton temperature suggest that a CME event is also an MC event; however, so far there is neither a definitive method nor an automatic process to distinguish the two. Human labeling is time-consuming, and results can fluctuate owing to the imprecise definition of such events. In this study, we approach the problem of MC and non-MC distinction from a time series data analysis perspective and show how clustering can shed some light on this problem. Although many algorithms exist for traditional data clustering in the Euclidean space, they are not well suited for time series data. Problems such as inadequate distance measure, inaccurate cluster center description, and lack of intuitive cluster representations need to be addressed for effective time series clustering. Our data analysis in this work is twofold: clustering and visualization. For clustering we compared the results from the popular hierarchical agglomerative clustering technique to a distance density clustering heuristic we developed previously for time series data clustering. In both cases, dynamic time warping will be used for similarity measure. For classification as well as visualization, we use decision trees to aggregate single-dimensional clustering results to form a multidimensional time series decision tree, with averaged time series to present each decision. In this study, we achieved modest accuracy and, more importantly, an intuitive interpretation of how different parameters contribute to an MC event.

A novel insulin receptor-binding protein from Momordica charantia enhances glucose uptake and glucose clearance in vitro and in vivo through triggering insulin receptor signaling pathway.

PubMed

Lo, Hsin-Yi; Ho, Tin-Yun; Li, Chia-Cheng; Chen, Jaw-Chyun; Liu, Jau-Jin; Hsiang, Chien-Yun

2014-09-10

Diabetes, a common metabolic disorder, is characterized by hyperglycemia. Insulin is the principal mediator of glucose homeostasis. In a previous study, we identified a trypsin inhibitor, named Momordica charantia insulin receptor (IR)-binding protein (mcIRBP) in this study, that might interact with IR. The physical and functional interactions between mcIRBP and IR were clearly analyzed in the present study. Photo-cross-linking coupled with mass spectrometry showed that three regions (17-21, 34-40, and 59-66 residues) located on mcIRBP physically interacted with leucine-rich repeat domain and cysteine-rich region of IR. IR-binding assay showed that the binding behavior of mcIRBP and insulin displayed a cooperative manner. After binding to IR, mcIRBP activated the kinase activity of IR by (5.87 ± 0.45)-fold, increased the amount of phospho-IR protein by (1.31 ± 0.03)-fold, affected phosphoinositide-3-kinase/Akt pathways, and consequently stimulated the uptake of glucose in 3T3-L1 cells by (1.36 ± 0.12)-fold. Intraperitoneal injection of 2.5 nmol/kg mcIRBP significantly decreased the blood glucose levels by 20.9 ± 3.2% and 10.8 ± 3.6% in normal and diabetic mice, respectively. Microarray analysis showed that mcIRBP affected genes involved in insulin signaling transduction pathway in mice. In conclusion, our findings suggest that mcIRBP is a novel IRBP that binds to sites different from the insulin-binding sites on IR and stimulates both the glucose uptake in cells and the glucose clearance in mice.

f-Mode Secular Instabilities in Deleptonizing Fizzlers

NASA Astrophysics Data System (ADS)

Imamura, James N.; Durisen, Richard H.

2004-12-01

Fizzlers are intermediate states that may form between white dwarf and neutron star densities during the collapse of massive rotating stars. This paper studies the gravitational radiation reaction (GRR) driven f-mode secular instabilities of fizzlers with angular momentum distributions h(mc) appropriate to the core collapse of massive rotating stars, where h is the specific angular momentum and mc is the cylindrical mass fraction. For core collapses that maintain axial symmetry, the h(mc) of the remnant reflects the conditions in the precollapse stellar core, and, thus, the h(mc) will resemble that of a uniformly rotating star supported by the pressure of relativistically degenerate electrons. Such an h(mc) concentrates most angular momentum toward the equatorial region of the object. The onset of f-mode secular instabilities in such fizzlers is affected strongly by the h(mc), whereas instability depends only weakly on compressibility. For a broad range of fizzler equations of state and the core h(mc), the f-mode secular instability thresholds drop to T/W~0.034-0.042, 0.019-0.021, and 0.012-0.0135, for m=2, 3, and 4, respectively. These same thresholds with the Maclaurin spheroid h(mc) are T/W=0.13-0.15, 0.10-0.11, and 0.08-0.09, respectively. The growth times τgw for GRR-driven m=2 modes are long. For fizzlers with specific angular momentum J/M~1.5×1016 cm2 s-1 and T/W<~0.24 (ρc<~1014 g cm-3), τgw>400 s. For these fizzlers, τgw>>τde, the deleptonization timescale, and GRR-driven secular instabilities will not grow along a deleptonizing fizzler sequence except, possibly, at T/W near the dynamic bar mode instability threshold, T/W~0.27.

A novel MC4R deletion coexisting with FTO and MC1R gene variants, causes severe early onset obesity.

PubMed

Neocleous, Vassos; Shammas, Christos; Phelan, Marie M; Fanis, Pavlos; Pantelidou, Maria; Skordis, Nicos; Mantzoros, Christos; Phylactou, Leonidas A; Toumba, Meropi

2016-07-01

Heterozygous mutations on the melanocortin-4-receptor gene (MC4R) are the most frequent cause of monogenic obesity. We describe a novel MC4R deletion in a girl with severe early onset obesity, tall stature, pale skin and red hair. Clinical and hormonal parameters were evaluated in a girl born full-term by non-consanguineous parents. Her body mass index (BMI) at presentation (3 years) was 30 kg/m 2 (z-score: +4.5SDS). By the age of 5.2 years, she exhibited extreme linear growth acceleration and developed hyperinsulinemia. Direct sequencing of the MC4R, MC1Rand for the knownFTOsingle nucleotide polymorphism (SNP) rs9939609was performed for the patient and her family. A novel heterozygous MC4R p.Met215del (c.643_645delATG) deletion was identified in the patient, her father and her brother, both of whom exhibited a milder phenotype. 3D structural dynamic simulation studies investigated the conformational changes induced by the p.Met215del. The patient and her mother were also found to be carriers of the obesity risk associated FTOrs9939609SNP. Finally, the identification of the known p.Arg160Trp MC1Rvariant in the patient accounts for the red hair and pale skin phenotypic features. The p.Met215del causes global conformational and functional changes as it is localized at the alpha-helical transmembrane regions and the membrane spanning regions of the beta-barrel. This novel mutation produces a severe overgrowth phenotype that is apparent as from infancy and is progressive in childhood. The additional negative effect of environmental and unhealthy lifestyle habits as well as a possible co-interaction of FTOrs9939609 SNP may worsen the phenotype.

Microcystin-LR Detected in a Low Molecular Weight Fraction from a Crude Extract of Zoanthus sociatus

PubMed Central

Domínguez-Pérez, Dany; Alexei Rodríguez, Armando; Osorio, Hugo; Azevedo, Joana; Castañeda, Olga; Vasconcelos, Vítor; Antunes, Agostinho

2017-01-01

Cnidarian constitutes a great source of bioactive compounds. However, research involving peptides from organisms belonging to the order Zoanthidea has received very little attention, contrasting to the numerous studies of the order Actiniaria, from which hundreds of toxic peptides and proteins have been reported. In this work, we performed a mass spectrometry analysis of a low molecular weight (LMW) fraction previously reported as lethal to mice. The low molecular weight (LMW) fraction was obtained by gel filtration of a Zoanthus sociatus (order Zoanthidea) crude extract with a Sephadex G-50, and then analyzed by matrix-assisted laser desorption/ionization time-of-flight/time-of-flight (MALDI-TOF/TOF) mass spectrometry (MS) in positive ion reflector mode from m/z 700 to m/z 4000. Afterwards, some of the most intense and representative MS ions were fragmented by MS/MS with no significant results obtained by Protein Pilot protein identification software and the Mascot algorithm search. However, microcystin masses were detected by mass-matching against libraries of non-ribosomal peptide database (NORINE). Subsequent reversed-phase C18 HPLC (in isocratic elution mode) and mass spectrometry analyses corroborated the presence of the cyanotoxin Microcystin-LR (MC-LR). To the best of our knowledge, this finding constitutes the first report of MC-LR in Z. sociatus, and one of the few evidences of such cyanotoxin in cnidarians. PMID:28257074

Small battery operated unattended radar sensor for security systems

NASA Astrophysics Data System (ADS)

Plummer, Thomas J.; Brady, Stephen; Raines, Robert

2013-06-01

McQ has developed, tested, and is supplying to Unattended Ground Sensor (UGS) customers a new radar sensor. This radar sensor is designed for short range target detection and classification. The design emphasis was to have low power consumption, totally automated operation, a very high probability of detection coupled with a very low false alarm rate, be able to locate and track targets, and have a price compatible with the UGS market. The radar sensor complements traditional UGS sensors by providing solutions for scenarios that are difficult for UGS. The design of this radar sensor and the testing are presented in this paper.

[Fast food promotes weight gain].

PubMed

Stender, Steen; Dyerberg, Jørn; Astrup, Arne V

2007-05-07

The total amounts of fat in a fast food menu consisting of French fries and fried Chicken Nuggets from McDonald's and KFC, respectively, bought in 35 different countries vary from 41 to 71 gram. In most countries the menu contained unacceptably high amounts of industrially-produced trans fat which contributes to an increased risk of ischaemic heart disease, weight gain, abdominal fat accumulation and type 2 diabetes. The quality of the ingredients in fast food ought to be better and the size of the portions smaller and less energy-dense so that frequent fast food meals do not increase the risk of obesity and diseases among customers.

Branding strategies discussed by the experts. Trends that will shape strategy in 1998.

PubMed

Windhorst, C E

1998-02-01

This month the focus is on branding. The Alliance Advisory Council's discussion of this topic, led by Joel English (a senior vice president with BVK/McDonald, Milwaukee, WI), identifies the key issues on branding as: 1) the debate between the local and regional nature of healthcare delivery, and the need to provide customers with the trust and security of a larger entity behind the individual provider; 2) the challenge of identifying and agreeing on a consistent message for all parts of the system; and 3) the difficulty of keeping the promise implied by a brand across these many components.

Effect of geomagnetic storms of different solar origin on the ionospheric TEC

NASA Astrophysics Data System (ADS)

Mansoori, Azad A.; Khan, Parvaiz A.; Purohit, P. K.

2018-05-01

We have studied the behaviour of ionospheric Total Electron Content (TEC) at a mid latitude station Usuda (36.130N, 138.360E), Japan during intense geomagnetic storms which were observed during 23 solar cycle (1998-2006). For the present study we have selected 47 intense geomagnetic storms (Dst≤-100nT), for the given period, which were then categorised into four categories depending upon their solar and interplanetary sources like Magnetic Cloud (MC), Co-rotating Interaction Region (CIR), Sheath driven Interplanetary Coronal Mass Ejection (SH+ICME) and Sheath driven Magnetic cloud (SH+MC). From our study we found that the geomagnetic storms significantly affect the ionosphere having any of the solar origin. However the geomagnetic storms which are either caused by SH+MC or SH+ICME produced maximum effect in TEC.

Effect of the melanocortin-3 receptor Thr6Lys and Val81Ile genetic variants on body composition and substrate oxidation in Chilean obese children.

PubMed

Obregón, Ana M; Diaz, Erik; Santos, Jose L

2012-03-01

Mice genetically deficient in the melanocortin-3 receptor gene are characterized by normal body weight, increased body fat, mild hypophagia, reduced locomotor activity, and increased respiratory quotient compared with wild-type mice. In humans, the 6Lys-81Ile haplotype of melanocortin-3 receptor (MC3R) gene has been associated with childhood obesity, higher body fat percentage, and reduced fat oxidation compared to non-carriers. The aim of this study was to evaluate the association between MC3R 6Lys-81Ile haplotype with body composition and substrate oxidation in response to moderate exercise in obese children. Eight Chilean obese children (aged 8-12) carriers of MC3R 6Lys-81Ile haplotype were compared with eight age-gender-matched obese non-carriers. Children were identified through a previous cross-sectional study on genetic determinants of childhood obesity (n = 229). Genotypes for MC3R Thr6Lys and Val81Ile were determined by polymerase chain reaction-restriction fragment length polymorphism. Body composition was assessed by the four-compartment model (dual-energy X-ray absorptiometry, total body water by the deuterium dilution technique, and total fat mass by air-displacement plethysmography). Substrate oxidation was assessed by indirect calorimetry in response to moderate exercise (60% VO(2 max)). Wilcoxon matched-pairs test was used to compare quantitative variables. No significant differences among carriers and non-carriers were found in anthropometrical and body composition measurements. The Carriers of the 6Lys-81Ile haplotype showed higher respiratory quotient (p = 0.06) and a significantly higher glucose oxidation (p = 0.01) compared with non-carriers after standardization for fat-free mass. Our results are consistent with a possible participation of MC3R 6Lys-81Ile variants in glucose oxidation in response to moderate exercise.

Determination of oxidation products of 5-methylcytosine in plants by chemical derivatization coupled with liquid chromatography/tandem mass spectrometry analysis.

PubMed

Tang, Yang; Xiong, Jun; Jiang, Han-Peng; Zheng, Shu-Jian; Feng, Yu-Qi; Yuan, Bi-Feng

2014-08-05

Cytosine methylation (5-methylcytosine, 5-mC) in DNA is an important epigenetic mark that has regulatory roles in various biological processes. In plants, active DNA demethylation can be achieved through direct cleavage by DNA glycosylases, followed by replacement of 5-mC with cytosine by base excision repair (BER) machinery. Recent studies in mammals have demonstrated 5-mC can be sequentially oxidized to 5-hydroxymethylcytosine (5-hmC), 5-formylcytosine (5-foC), and 5-carboxylcytosine (5-caC) by Ten-eleven translocation (TET) proteins. The consecutive oxidations of 5-mC constitute the active DNA demethylation pathway in mammals, which raised the possible presence of oxidation products of 5-mC (5-hmC, 5-foC, and 5-caC) in plant genomes. However, there is no definitive evidence supporting the presence of these modified bases in plant genomic DNA, especially for 5-foC and 5-caC. Here we developed a chemical derivatization strategy combined with liquid chromatography-electrospray ionization tandem mass spectrometry (LC/ESI-MS/MS) method to determine 5-formyl-2'-deoxycytidine (5-fodC) and 5-carboxyl-2'-deoxycytidine (5-cadC). Derivatization of 5-fodC and 5-cadC by Girard's reagents (GirD, GirT, and GirP) significantly increased the detection sensitivities of 5-fodC and 5-cadC by 52-260-fold. Using this method, we demonstrated the widespread existence of 5-fodC and 5-cadC in genomic DNA of various plant tissues, indicating that active DNA demethylation in plants may go through an alternative pathway similar to mammals besides the pathway of direct DNA glycosylases cleavage combined with BER. Moreover, we found that environmental stresses of drought and salinity can change the contents of 5-fodC and 5-cadC in plant genomes, suggesting the functional roles of 5-fodC and 5-cadC in response to environmental stresses.

Influence of Earth-directed Coronal Mass Ejections on the Sun’s Shadow Observed by the Tibet-III Air Shower Array

NASA Astrophysics Data System (ADS)

Amenomori, M.; Bi, X. J.; Chen, D.; Chen, T. L.; Chen, W. Y.; Cui, S. W.; Danzengluobu; Ding, L. K.; Feng, C. F.; Feng, Zhaoyang; Feng, Z. Y.; Gou, Q. B.; Guo, Y. Q.; He, H. H.; He, Z. T.; Hibino, K.; Hotta, N.; Hu, Haibing; Hu, H. B.; Huang, J.; Jia, H. Y.; Jiang, L.; Kajino, F.; Kasahara, K.; Katayose, Y.; Kato, C.; Kawata, K.; Kozai, M.; Labaciren; Le, G. M.; Li, A. F.; Li, H. J.; Li, W. J.; Liu, C.; Liu, J. S.; Liu, M. Y.; Lu, H.; Meng, X. R.; Miyazaki, T.; Munakata, K.; Nakajima, T.; Nakamura, Y.; Nanjo, H.; Nishizawa, M.; Niwa, T.; Ohnishi, M.; Ohta, I.; Ozawa, S.; Qian, X. L.; Qu, X. B.; Saito, T.; Saito, T. Y.; Sakata, M.; Sako, T. K.; Shao, J.; Shibata, M.; Shiomi, A.; Shirai, T.; Sugimoto, H.; Takita, M.; Tan, Y. H.; Tateyama, N.; Torii, S.; Tsuchiya, H.; Udo, S.; Wang, H.; Wu, H. R.; Xue, L.; Yamamoto, Y.; Yamauchi, K.; Yang, Z.; Yuan, A. F.; Zhai, L. M.; Zhang, H. M.; Zhang, J. L.; Zhang, X. Y.; Zhang, Y.; Zhang, Yi; Zhang, Ying; Zhaxisangzhu; Zhou, X. X.; Tibet ASγ Collaboration

2018-06-01

We examine the possible influence of Earth-directed coronal mass ejections (ECMEs) on the Sun’s shadow in the 3 TeV cosmic-ray intensity observed by the Tibet-III air shower (AS) array. We confirm a clear solar-cycle variation of the intensity deficit in the Sun’s shadow during ten years between 2000 and 2009. This solar-cycle variation is overall reproduced by our Monte Carlo (MC) simulations of the Sun’s shadow based on the potential field model of the solar magnetic field averaged over each solar rotation period. We find, however, that the magnitude of the observed intensity deficit in the Sun’s shadow is significantly less than that predicted by MC simulations, particularly during the period around solar maximum when a significant number of ECMEs is recorded. The χ 2 tests of the agreement between the observations and the MC simulations show that the difference is larger during the periods when the ECMEs occur, and the difference is reduced if the periods of ECMEs are excluded from the analysis. This suggests the first experimental evidence of the ECMEs affecting the Sun’s shadow observed in the 3 TeV cosmic-ray intensity.

Is natural defense capacity correlated with allocation of dry mass to the stem in loblolly pine?

Treesearch

Mary Anne Sword Sayer; Michael C. Tyree; Michael A. Blazier; Shi-Jean Susana Sung; Lori G. Eckhardt

2016-01-01

In addition to selecting loblolly pine (Pinus taeda L.) genotypes for superior growth, the concept of customized genetic selection may apply where tree vigor is threatened by insects and disease. A study conducted with seedlings from 15 loblolly pine genotypes found significant correlation between phenolic production and foliage mass when dry mass allocation to the...

Wandering off the centre: a characterization of the random motion of intermediate-mass black holes in star clusters

NASA Astrophysics Data System (ADS)

de Vita, Ruggero; Trenti, Michele; MacLeod, Morgan

2018-04-01

Despite recent observational efforts, unequivocal signs for the presence of intermediate-mass black holes (IMBHs) in globular clusters (GCs) have not been found yet. Especially when the presence of IMBHs is constrained through dynamical modelling of stellar kinematics, it is fundamental to account for the displacement that the IMBH might have with respect to the GC centre. In this paper, we analyse the IMBH wandering around the stellar density centre using a set of realistic direct N-body simulations of star cluster evolution. Guided by the simulation results, we develop a basic yet accurate model that can be used to estimate the average IMBH radial displacement (〈rbh〉) in terms of structural quantities as the core radius (rc), mass (Mc), and velocity dispersion (σc), in addition to the average stellar mass (mc) and the IMBH mass (Mbh). The model can be expressed by the equation < r_bh > /r_c=A(m_c/M_bh)^α [σ _c^2r_c/(GM_c)]^β, in which the free parameters A, α, and β are calculated through comparison with the numerical results on the IMBH displacement. The model is then applied to Galactic GCs, finding that for an IMBH mass equal to 0.1 per cent of the GC mass, the typical expected displacement of a putative IMBH is around 1 arcsec for most Galactic GCs, but IMBHs can wander to larger angular distances in some objects, including a prediction of a 2.5 arcsec displacement for NGC 5139 (ω Cen), and >10 arcsec for NGC5053, NGC6366, and ARP2.

Hyperphagia in male melanocortin 4 receptor deficient mice promotes growth independently of growth hormone.

PubMed

Tan, H Y; Steyn, F J; Huang, L; Cowley, M; Veldhuis, J D; Chen, C

2016-12-15

Loss of function of the melanocortin 4 receptor (MC4R) results in hyperphagia, obesity and increased growth. Despite knowing that MC4Rs control food intake, we are yet to understand why defects in the function of the MC4R receptor contribute to rapid linear growth. We show that hyperphagia following germline loss of MC4R in male mice promotes growth while suppressing the growth hormone-insulin-like growth factor-1 (GH-IGF-1) axis. We propose that hyperinsulinaemia promotes growth while suppressing the GH-IGF-1 axis. It is argued that physiological responses essential to maintain energy flux override conventional mechanisms of pubertal growth to promote the storage of excess energy while ensuring growth. Defects in melanocortin-4-receptor (MC4R) signalling result in hyperphagia, obesity and increased growth. Clinical observations suggest that loss of MC4R function may enhance growth hormone (GH)-mediated growth, although this remains untested. Using male mice with germline loss of the MC4R, we assessed pulsatile GH release and insulin-like growth factor-1 (IGF-1) production and/or release relative to pubertal growth. We demonstrate early-onset suppression of GH release in rapidly growing MC4R deficient (MC4RKO) mice, confirming that increased linear growth in MC4RKO mice does not occur in response to enhanced activation of the GH-IGF-1 axis. The progressive suppression of GH release in MC4RKO mice occurred alongside increased adiposity and the progressive worsening of hyperphagia-associated hyperinsulinaemia. We next prevented hyperphagia in MC4RKO mice through restricting calorie intake in these mice to match that of wild-type (WT) littermates. Pair feeding of MC4RKO mice did not prevent increased adiposity, but attenuated hyperinsulinaemia, recovered GH release, and normalized linear growth rate to that seen in pair-fed WT littermate controls. We conclude that the suppression of GH release in MC4RKO mice occurs independently of increased adipose mass, and is a consequence of hyperphagia-associated hyperinsulinaemia. It is proposed that physiological responses essential to maintain energy flux (hyperinsulinaemia and the suppression of GH release) override conventional mechanisms of pubertal growth to promote the storage of excess energy while ensuring growth. Implications of these findings are likely to extend beyond individuals with defects in MC4R signalling, encompassing physiological changes central to mechanisms of growth and energy homeostasis universal to hyperphagia-associated childhood-onset obesity. © 2016 The Authors. The Journal of Physiology © 2016 The Physiological Society.

Hyperphagia in male melanocortin 4 receptor deficient mice promotes growth independently of growth hormone

PubMed Central

Tan, H. Y.; Huang, L.; Cowley, M.; Veldhuis, J. D.; Chen, C.

2016-01-01

Key points Loss of function of the melanocortin 4 receptor (MC4R) results in hyperphagia, obesity and increased growth.Despite knowing that MC4Rs control food intake, we are yet to understand why defects in the function of the MC4R receptor contribute to rapid linear growth.We show that hyperphagia following germline loss of MC4R in male mice promotes growth while suppressing the growth hormone–insulin‐like growth factor‐1 (GH–IGF‐1) axis.We propose that hyperinsulinaemia promotes growth while suppressing the GH–IGF‐1 axis.It is argued that physiological responses essential to maintain energy flux override conventional mechanisms of pubertal growth to promote the storage of excess energy while ensuring growth. Abstract Defects in melanocortin‐4‐receptor (MC4R) signalling result in hyperphagia, obesity and increased growth. Clinical observations suggest that loss of MC4R function may enhance growth hormone (GH)‐mediated growth, although this remains untested. Using male mice with germline loss of the MC4R, we assessed pulsatile GH release and insulin‐like growth factor‐1 (IGF‐1) production and/or release relative to pubertal growth. We demonstrate early‐onset suppression of GH release in rapidly growing MC4R deficient (MC4RKO) mice, confirming that increased linear growth in MC4RKO mice does not occur in response to enhanced activation of the GH–IGF‐1 axis. The progressive suppression of GH release in MC4RKO mice occurred alongside increased adiposity and the progressive worsening of hyperphagia‐associated hyperinsulinaemia. We next prevented hyperphagia in MC4RKO mice through restricting calorie intake in these mice to match that of wild‐type (WT) littermates. Pair feeding of MC4RKO mice did not prevent increased adiposity, but attenuated hyperinsulinaemia, recovered GH release, and normalized linear growth rate to that seen in pair‐fed WT littermate controls. We conclude that the suppression of GH release in MC4RKO mice occurs independently of increased adipose mass, and is a consequence of hyperphagia‐associated hyperinsulinaemia. It is proposed that physiological responses essential to maintain energy flux (hyperinsulinaemia and the suppression of GH release) override conventional mechanisms of pubertal growth to promote the storage of excess energy while ensuring growth. Implications of these findings are likely to extend beyond individuals with defects in MC4R signalling, encompassing physiological changes central to mechanisms of growth and energy homeostasis universal to hyperphagia‐associated childhood‐onset obesity. PMID:27558671

Recent Advances in Water Analysis with Gas Chromatograph Mass Spectrometers

NASA Technical Reports Server (NTRS)

MacAskill, John A.; Tsikata, Edem

2014-01-01

We report on progress made in developing a water sampling system for detection and analysis of volatile organic compounds in water with a gas chromatograph mass spectrometer (GCMS). Two approaches are described herein. The first approach uses a custom water pre-concentrator for performing trap and purge of VOCs from water. The second approach uses a custom micro-volume, split-splitless injector that is compatible with air and water. These water sampling systems will enable a single GC-based instrument to analyze air and water samples for VOC content. As reduced mass, volume, and power is crucial for long-duration, manned space-exploration, these water sampling systems will demonstrate the ability of a GCMS to monitor both air and water quality of the astronaut environment, thereby reducing the amount of required instrumentation for long duration habitation. Laboratory prototypes of these water sampling systems have been constructed and tested with a quadrupole ion trap mass spectrometer as well as a thermal conductivity detector. Presented herein are details of these water sampling system with preliminary test results.

The Influence of Non-spectral Matrix Effects on the Accuracy of Isotope Ratio Measurement by MC-ICP-MS

NASA Astrophysics Data System (ADS)

Barling, J.; Shiel, A.; Weis, D.

2006-12-01

Non-spectral interferences in ICP-MS are caused by matrix elements effecting the ionisation and transmission of analyte elements. They are difficult to identify in MC-ICP-MS isotopic data because affected analyses exhibit normal mass dependent isotope fractionation. We have therefore investigated a wide range of matrix elements for both stable and radiogenic isotope systems using a Nu Plasma MC-ICP-MS. Matrix elements commonly enhance analyte sensitivity and change the instrumental mass bias experienced by analyte elements. These responses vary with element and therefore have important ramifications for the correction of data for instrumental mass bias by use of an external element (e.g. Pb and many non-traditional stable isotope systems). For Pb isotope measurements (Tl as mass bias element), Mg, Al, Ca, and Fe were investigated as matrix elements. All produced signal enhancement in Pb and Tl. Signal enhancement varied from session to session but for Ca and Al enhancement in Pb was less than for Tl while for Mg and Fe enhancement levels for Pb and Tl were similar. After correction for instrumental mass fractionation using Tl, Mg effected Pb isotope ratios were heavy (e.g. ^{208}Pb/204Pbmatrix > ^{208}Pb/204Pbtrue) for both moderate and high [Mg] while Ca effected Pb showed little change at moderate [Ca] but were light at high [Ca]. ^{208}Pb/204Pbmatrix - ^{208}Pb/204Pbtrue for all elements ranged from +0.0122 to - 0.0177. Isotopic shifts of similar magnitude are observed between Pb analyses of samples that have seen either one or two passes through chemistry (Nobre Silva et al, 2005). The double pass purified aliquots always show better reproducibility. These studies show that the presence of matrix can have a significant effect on the accuracy and reproducibility of replicate Pb isotope analyses. For non-traditional stable isotope systems (e.g. Mo(Zr), Cd(Ag)), the different responses of analyte and mass bias elements to the presence of matrix can result in del/amu for measured & mass bias corrected data that disagree outside of error. Either or both values can be incorrect. For samples, unlike experiments, the correct del/amu is not known in advance. Therefore, for sample analyses to be considered accurate, both measured and exponentially corrected del/amu should agree.

Predicting Resource Needs for Multiple and Mass Casualty Events in Combat: Lessons Learned From Combat Support Hospital Experience in Operation Iraqi Freedom

DTIC Science & Technology

2009-04-01

from rocket attack near a forward operating base (Photo courtesy of Tommy A. Brown). Predicting Resource Needs for Mass Casualty in Combat Volume 66...combat support hospital. J Trauma 2008; 64(2 suppl):S79–S85. 19. Wedmore I, McManus JG, Pusateri AE, et al. A special report on the chitosan -based

Association between MC4R rs17782313 polymorphism and overeating behaviors.

PubMed

Yilmaz, Z; Davis, C; Loxton, N J; Kaplan, A S; Levitan, R D; Carter, J C; Kennedy, J L

2015-01-01

Melanocortins have a crucial role in appetite and weight regulation. Although the melanocortin 4 receptor (MC4R) gene has been repeatedly linked to obesity and antipsychotic-induced weight gain, the mechanism behind how it leads to this effect in still undetermined. The goal of this study was to conduct an in-depth and sophisticated analysis of MC4R polymorphisms, body mass index (BMI), eating behavior and depressed mood. We genotyped 328 individuals of European ancestry on the following MC4R markers based on the relevant literature on obesity and antipsychotic-induced weight gain: rs571312, rs17782313, rs489693, rs11872992, and rs8087522. Height and weight were measured, and information on depressed mood and overeating behaviors was obtained during the in-person assessment. BMI was associated with rs17782313 C allele; however, this finding did not survive correction for multiple testing (P = 0.018). Although rs17782313 was significantly associated with depressed mood and overeating behaviors, tests of indirect effects indicated that emotional eating and food cravings, rather than depressed mood, uniquely accounted for the effect of this marker and BMI (n = 152). To our knowledge, this is the first study to investigate the link between MC4R rs17782313, mood and overeating behavior, as well as to demonstrate possible mechanisms behind MC4R's influence on body weight. If replicated in a larger sample, these results may have important clinical implications, including potential for the use of MC4R agonists in the treatment of obesity and disordered eating.

Association between MC4R rs17782313 Polymorphism and Overeating Behaviours

PubMed Central

Yilmaz, Zeynep; Davis, Caroline; Loxton, Natalie J.; Kaplan, Allan S.; Levitan, Robert D.; Carter, Jacqueline C.; Kennedy, James L.

2014-01-01

Background/Objectives Melanocortins play a crucial role in appetite and weight regulation. Although the melanocortin 4 receptor (MC4R) gene has been repeatedly linked to obesity and antipsychotic-induced weight gain, the mechanism behind how it leads to this effect in still undetermined. The goal of this study was to conduct an in-depth and sophisticated analysis of MC4R polymorphisms, body mass index (BMI), eating behaviour, and depressed mood. Subjects/Methods We genotyped 328 individuals of European ancestry on the following MC4R markers based on the relevant literature on obesity and antipsychotic-induced weight gain: rs571312, rs17782313, rs489693, rs11872992, and rs8087522. Height and weight were measured, and information on depressed mood and overeating behaviours was obtained during the in-person assessment. Results BMI was associated with rs17782313 C allele; however this finding did not survive correction for multiple testing (p=0.018). Although rs17782313 was significantly associated with depressed mood and overeating behaviours, tests of indirect effects indicated that emotional eating and food cravings, rather than depressed mood, uniquely accounted for the effect of this marker and BMI (n=152). Conclusions To our knowledge, this is the first study to investigate the link between MC4R rs17782313, mood and overeating behaviour, as well as to demonstrate possible mechanisms behind MC4R’s influence on body weight. If replicated in a larger sample, these results may have important clinical implications, including potential for the use of MC4R agonists in the treatment of obesity and disordered eating. PMID:24827639

Every Mass or Mass Group When Created Will have No Motion, Linear, Rotational or Vibratory Motion, Singly or in Some Combination, Which May Be Later Modified by External Forces--A Natural Law

NASA Astrophysics Data System (ADS)

Brekke, Stewart

2010-03-01

Every mass or mass group, from atoms and molecules to stars and galaxies,has no motion, is vibrating, rotating,or moving linearly, singularly or in some combination. When created, the excess energy of creation will generate a vibration, rotation and/or linear motion besides the mass or mass group. Curvilinear or orbital motion is linear motion in an external force field. External forces, such as photon, molecular or stellar collisions may over time modify the inital rotational, vibratory or linear motions of the mass of mass group. The energy equation for each mass or mass group is E=mc^2 + 1/2mv^2 + 1/2I2̂+ 1/2kx0^2 + WG+ WE+ WM.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Simpson, Susanne

A woman in the early 1700s who became one of Europe’s leading interpreters of mathematics and a poor bookbinder who became one of the giants of nineteenth-century science are just two of the pioneers whose stories NOVA explored in Einstein’s Big Idea. This two-hour documentary premiered on PBS in October 2005 and is based on the best-selling book by David Bodanis, E=mc2: A Biography of the World’s Most Famous Equation. The film and book chronicle the scientific challenges and discoveries leading up to Einstein’s startling conclusion that mass and energy are one, related by the formula E = mc 2.

Identification of Microcystis aeruginosa Peptides Responsible for Allergic Sensitization and Characterization of Functional Interactions between Cyanobacterial Toxins and Immunogenic Peptides

PubMed Central

Geh, Esmond N.; Ghosh, Debajyoti; McKell, Melanie; de la Cruz, Armah A.; Stelma, Gerard

2015-01-01

Background The cyanobacterium species Microcystis aeruginosa produces microcystin and an array of diverse metabolites believed responsible for their toxicity and/or immunogenicity. Previously, chronic rhinitis patients were demonstrated to elicit a specific IgE response to nontoxic strains of M. aeruginosa by skin-prick testing, indicating that cyanobacteria allergenicity resides in a non-toxin–producing component of the organism. Objectives We sought to identify and characterize M. aeruginosa peptide(s) responsible for allergic sensitization in susceptible individuals, and we investigated the functional interactions between cyanobacterial toxins and their coexpressed immunogenic peptides. Methods Sera from patients and extracts from M. aeruginosa toxic [MC(+)] and nontoxic [MC(–)] strains were used to test IgE-specific reactivity by direct and indirect ELISAs; 2D gel electrophoresis, followed by immunoblots and mass spectrometry (MS), was performed to identify the relevant sensitizing peptides. Cytotoxicity and mediator release assays were performed using the MC(+) and MC(–) lysates. Results We found specific IgE to be increased more in response to the MC(–) strain than the MC(+) strain. This response was inhibited by preincubation of MC(–) lysate with increasing concentrations of microcystin. MS revealed that phycocyanin and the core-membrane linker peptide are the responsible allergens, and MC(–) extracts containing these proteins induced β-hexosaminidase release in rat basophil leukemia cells. Conclusions Phycobiliprotein complexes in M. aeruginosa have been identified as the relevant sensitizing proteins. Our finding that allergenicity is inhibited in a dose-dependent manner by microcystin toxin suggests that further investigation is warranted to understand the interplay between immunogenicity and toxicity of cyanobacteria under diverse environmental conditions. Citation Geh EN, Ghosh D, McKell M, de la Cruz AA, Stelma G, Bernstein JA. 2015. Identification of Microcystis aeruginosa peptides responsible for allergic sensitization and characterization of functional interactions between cyanobacterial toxins and immunogenic peptides. Environ Health Perspect 123:1159–1166; http://dx.doi.org/10.1289/ehp.1409065 PMID:25902363

The use of an Ossis custom 3D-printed tri-flanged acetabular implant for major bone loss: minimum 2-year follow-up: Short title: Ossis custom 3D-Printed tri-flanged acetabular implant.

PubMed

Kieser, David C; Ailabouni, Ramez; Kieser, Sandra C J; Wyatt, Michael C; Armour, Paul C; Coates, Mark H; Hooper, Gary J

2018-05-01

Custom 3D-printed acetabular implants are a new technology used in hip surgery with ever-increasing frequency. They offer patient-specific implants to optimise filling of bone defects and implant-bone contact, without the need for excessive bone resection. This is a retrospective cohort study of 46 consecutive patients who underwent an Ossis unilateral custom 3D-printed acetabular implant. Clinical (Oxford Hip Score OHS-60), Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC), Harris Hip Score (HHS) and radiological (restoration of biomechanical hip centre, osteointegration, wear, heterotrophic ossification) results were assessed. Patient mean age was 68 years and follow-up was 38 months (minimum 24 months). 10 patients were excluded from the outcome analysis; 2 patients died, 1 required revision for deep infection and 7 were lost to follow-up. Of the 36 patients included, 21 had severe osteolysis. 7 were revised for infection, 3 for tumoural defects, 3 for metallosis, 1 for dysplasia and 1 for trauma (Paprosky 2a [n=6], 2b [n=2], 2c [n=5], 3a [n=6], 3b [n=11], pelvic dissociation [n=6]). OHS significantly improved postoperatively (16-8-48.4 p=0.027). Postoperative functional scores were good (WOMAC 98; HHS 79). The biomechanical hip centre was restored in all patients. 1 patient had early implant migration with subsequent stabilisation. 2 patients had radiographs concerning for failure of osteointegration. 1 patient had recurrent dislocations. The mid-term results of the Ossis custom 3D-printed tri-flanged acetabular implant for the management of severe acetabular defects are encouraging. The improvement in functional scores and radiographic outcomes are comparable to similar designs. In addition, no cases have required revision for aseptic loosening.

Aspect of Fermion Mass Hierarchy within Flavor Democracy for Yukawa Couplings

NASA Astrophysics Data System (ADS)

Higuchi, Katsuichi; Yamamoto, Katsuji

We discuss the fermion mass hierarchy by including vector-like fermions which are accommodated in E6 GUTs within flavor democracy for Yukawa couplings. In this framework, all Yukawa couplings for the standard Higgs doublet have the same strength, and all Yukawa couplings for the singlet Higgs have the same strength (New ansatz). In addition, singlet Higgs and right-handed neutrinos exist. Under this condition, the mass hierarchy mt ≫ mb ˜ mτ as well as mt ≫ mc, mu can be naturally explained.

Molecular mechanism of mast cell–mediated innate defense against endothelin and snake venom sarafotoxin

PubMed Central

Schneider, Lars A.; Schlenner, Susan M.; Feyerabend, Thorsten B.; Wunderlin, Markus; Rodewald, Hans-Reimer

2007-01-01

Mast cells are protective against snake venom sarafotoxins that belong to the endothelin (ET) peptide family. The molecular mechanism underlying this recently recognized innate defense pathway is unknown, but secretory granule proteases have been invoked. To specifically disrupt a single protease function without affecting expression of other proteases, we have generated a mouse mutant selectively lacking mast cell carboxypeptidase A (Mc-cpa) activity. Using this mutant, we have now identified Mc-cpa as the essential protective mast cell enzyme. Mass spectrometry of peptide substrates after cleavage by normal or mutant mast cells showed that removal of a single amino acid, the C-terminal tryptophan, from ET and sarafotoxin by Mc-cpa is the principle molecular mechanism underlying this very rapid mast cell response. Mast cell proteases can also cleave ET and sarafotoxin internally, but such “nicking” is not protective because intramolecular disulfide bridges maintain peptide function. We conclude that mast cells attack ET and sarafotoxin exactly at the structure required for toxicity, and hence sarafotoxins could not “evade” Mc-cpa's substrate specificity without loss of toxicity. PMID:17923505

Common variants in the obesity-associated genes FTO and MC4R are not associated with risk of colorectal cancer

PubMed Central

Yang, Baiyu; Thrift, Aaron P.; Figueiredo, Jane C.; Jenkins, Mark A.; Schumacher, Fredrick R.; Conti, David V.; Lin, Yi; Win, Aung Ko; Limburg, Paul J.; Berndt, Sonja I.; Brenner, Hermann; Chan, Andrew T.; Chang-Claude, Jenny; Hoffmeister, Michael; Hudson, Thomas J.; Marchand, Loïc Le; Newcomb, Polly A.; Slattery, Martha L.; White, Emily; Peters, Ulrike; Casey, Graham; Campbell, Peter T.

2016-01-01

Background Obesity is a convincing risk factor for colorectal cancer. Genetic variants in or near FTO and MC4R are consistently associated with body mass index and other body size measures, but whether they are also associated with colorectal cancer risk is unclear. Methods In the discovery stage, we tested associations of 677 FTO and 323 MC4R single nucleotide polymorphisms (SNPs) 100kb upstream and 300kb downstream from each respective locus with risk of colorectal cancer in data from the Colon Cancer Family Registry (CCFR: 1,960 cases; 1,777 controls). Next, all SNPs that were nominally statistically signif icant (p<0.05) in the discovery stage were included in replication analyses in data from the Genetics and Epidemiology of Colorectal Cancer Consortium (GECCO: 9,716 cases; 9,844 controls). Results In the discovery stage, 43 FTO variants and 18 MC4R variants were associated with colorectal cancer risk (p<0.05). No SNPs remained statistically significant in the replication analysis after accounting for multiple comparisons. Conclusion We found no evidence that individual variants in or near the obesity-related genes FTO and MC4R are associated with risk of colorectal cancer. PMID:27449576

Changes in secondary metabolic profiles of Microcystis aeruginosa strains in response to intraspecific interactions

PubMed Central

Briand, Enora; Bormans, Myriam; Gugger, Muriel; Dorrestein, Pieter C.; Gerwick, William H.

2016-01-01

Summary The cyanobacteria Microcystis proliferate in freshwater ecosystems and produce bioactive compounds including the harmful toxins microcystins (MC). These secondary metabolites play an important role in shaping community composition through biotic interactions although their role and mode of regulation are poorly understood. As natural cyanobacterial populations include producing and non-producing strains, we tested if the production of a range of peptides by coexisting cells could be regulated through intraspecific interactions. With an innovative co-culturing chamber together with advanced mass spectrometry (MS) techniques, we monitored the growth and compared the metabolic profiles of a MC-producing as well as two non-MC-producing Microcystis strains under mono- and co-culture conditions. In monocultures, these strains grew comparably; however, the non-MC-producing mutant produced higher concentrations of cyanopeptolins, aerucyclamides and aeruginosins than the wild type. Physiological responses to co-culturing were reflected in a quantitative change in the production of the major peptides. Using a MS/MS-based molecular networking approach, we identified new analogues of known classes of peptides as well as new compounds. This work provides new insights into the factors that regulate the production of MC and other secondary metabolites in cyanobacteria, and suggests interchangeable or complementary functions allowing bloom-forming cyanobacteria to efficiently colonize and dominate in fluctuating aquatic environments. PMID:25980449

Common variants in the obesity-associated genes FTO and MC4R are not associated with risk of colorectal cancer.

PubMed

Yang, Baiyu; Thrift, Aaron P; Figueiredo, Jane C; Jenkins, Mark A; Schumacher, Fredrick R; Conti, David V; Lin, Yi; Win, Aung Ko; Limburg, Paul J; Berndt, Sonja I; Brenner, Hermann; Chan, Andrew T; Chang-Claude, Jenny; Hoffmeister, Michael; Hudson, Thomas J; Marchand, Loïc Le; Newcomb, Polly A; Slattery, Martha L; White, Emily; Peters, Ulrike; Casey, Graham; Campbell, Peter T

2016-10-01

Obesity is a convincing risk factor for colorectal cancer. Genetic variants in or near FTO and MC4R are consistently associated with body mass index and other body size measures, but whether they are also associated with colorectal cancer risk is unclear. In the discovery stage, we tested associations of 677 FTO and 323 MC4R single nucleotide polymorphisms (SNPs) 100kb upstream and 300kb downstream from each respective locus with risk of colorectal cancer in data from the Colon Cancer Family Registry (CCFR: 1960 cases; 1777 controls). Next, all SNPs that were nominally statistically significant (p<0.05) in the discovery stage were included in replication analyses in data from the Genetics and Epidemiology of Colorectal Cancer Consortium (GECCO: 9716 cases; 9844 controls). In the discovery stage, 43 FTO variants and 18 MC4R variants were associated with colorectal cancer risk (p<0.05). No SNPs remained statistically significant in the replication analysis after accounting for multiple comparisons. We found no evidence that individual variants in or near the obesity-related genes FTO and MC4R are associated with risk of colorectal cancer. Copyright © 2016 Elsevier Ltd. All rights reserved.

In vitro biocorrosion of Ti-6Al-4V implant alloy by a mouse macrophage cell line.

PubMed

Lin, Hsin-Yi; Bumgardner, Joel D

2004-03-15

Corrosion of implant alloys releasing metal ions has the potential to cause adverse tissue reactions and implant failure. We hypothesized that macrophage cells and their released reactive chemical species (RCS) affect the alloy's corrosion properties. A custom cell culture corrosion box was used to evaluate how cell culture medium, macrophage cells and RCS altered the Ti-6Al-4V corrosion behaviors in 72 h and how corrosion products affected the cells. There was no difference in the charge transfer in the presence (75.2 +/- 17.7 mC) and absence (62.3 +/- 18.8 mC) of cells. The alloy had the lowest charge transfer (28.2 +/- 4.1 mC) and metal ion release (Ti < 10 ppb, V < 2 ppb) with activated cells (releasing RCS) compared with the other two conditions. This was attributed to an enhancement of the surface oxides by RCS. Metal ion release was very low (Ti < 20 ppb, V < 10 ppb) with nonactivated cells and did not change cell morphology, viability, and NO and ATP release compared with controls. However, IL-1beta released from the activated cells and the proliferation of nonactivated cells were greater on the alloy than the controls. In summary, macrophage cells and RCS reduced the corrosion of Ti-6Al-4V alloys as hypothesized. These data are important in understanding host tissue-material interactions. Copyright 2004 Wiley Periodicals, Inc. J Biomed Mater Res 68A: 717-724, 2004

Precise determination of triple Sr isotopes (δ⁸⁷Sr and δ⁸⁸Sr) using MC-ICP-MS.

PubMed

Liu, Hou-Chun; You, Chen-Feng; Huang, Kuo-Fang; Chung, Chuan-Hsiung

2012-01-15

The non-traditional stable strontium (Sr) isotopes have received increasing attention recently as new geochemical tracers for studying Sr isotopic fractionation and source identification. This has been attributed to the advancement in multiple-collector inductively coupled plasma mass spectrometry (MC-ICP-MS), allows to determine precisely and simultaneously of the triple Sr isotopes. In this study, we applied a modified empirical external normalization (EEN) MC-ICPMS procedure for mass bias correction in Sr isotopic measurement using (92)Zr/(90)Zr. High-purity Zr Standard was spiked into sample solutions and the degree of fractionation was calculated off-line using an exponential law. The long-term external reproducibility for NIST SRM 987 δ(87)Sr and δ(88)Sr was better than 0.040‰ and 0.018‰ (2SD), respectively. The IAPSO standard seawater was used as a secondary standard to validate the analytical protocol and the absolute ratios measured were 0.709161±0.000018 for (87)Sr/(86)Sr, 0.177±0.021‰ for δ(87)Sr, and 0.370±0.026‰ for δ(88)Sr (2SD, n=7). These values are in good agreement with the literature data analyzed by thermal ionization mass spectrometry (TIMS) double spike technique. Rock standards, BHVO-2, BCR-2 and AGV-2 were also analyzed to validate the robustness of the methodology and showed identical results with literature data. Compared to previous (91)Zr/(90)Zr correction, we obtained improved results based on (92)Zr/(90)Zr, probably due to similar mass difference between (92)Zr/(90)Zr and measured Sr isotopes. The new analytical protocol presented in this study not only improves the analytical precision but also increases sample efficiency by omitting the use of the standard-sample bracketing (SSB) procedure. Copyright © 2011 Elsevier B.V. All rights reserved.

STS-54 Pilot McMonagle with DSO 802 & Physics of Toys top on OV-105's middeck

NASA Image and Video Library

1993-01-15

STS054-S-020 (15 Jan 1993) --- McMonagle watches as a top spins above his head on the middeck of the Earth-orbiting Endeavour. The demonstration was part of a lengthy "physics of toys" program conducted by all five crewmembers on their third day aboard the Shuttle. Through telephone and TV downlinks, students in four schools around the country participated in a special lesson to discover how specific toys function differently in the classroom compared to those on the Shuttle. Students at Westwood Elementary School in Flint, Michigan -- McMonagle's hometown -- asked him questions about the several toys he demonstrated. The top demonstrates gyroscopic motion, the center of mass and angular momentum. The entire collection of toys will be videotaped for an educational program to be distributed to schools in the autumn. The scene was downlinked at 18:01:59:11 GMT, Jan. 15, 1993.

Non-traditional isotopes in analytical ecogeochemistry assessed by MC-ICP-MS

NASA Astrophysics Data System (ADS)

Prohaska, Thomas; Irrgeher, Johanna; Horsky, Monika; Hanousek, Ondřej; Zitek, Andreas

2014-05-01

Analytical ecogeochemistry deals with the development and application of tools of analytical chemistry to study dynamic biological and ecological processes within ecosystems and across ecosystem boundaries in time. It can be best described as a linkage between modern analytical chemistry and a holistic understanding of ecosystems ('The total human ecosystem') within the frame of transdisciplinary research. One focus of analytical ecogeochemistry is the advanced analysis of elements and isotopes in abiotic and biotic matrices and the application of the results to basic questions in different research fields like ecology, environmental science, climatology, anthropology, forensics, archaeometry and provenancing. With continuous instrumental developments, new isotopic systems have been recognized for their potential to study natural processes and well established systems could be analyzed with improved techniques, especially using multi collector inductively coupled plasma mass spectrometry (MC-ICP-MS). For example, in case of S, isotope ratio measurements at high mass resolution could be achieved at much lower S concentrations with ICP-MS as compared to IRMS, still keeping suitable uncertainty. Almost 50 different isotope systems have been investigated by ICP-MS, so far, with - besides Sr, Pb and U - Ca, Mg, Cd, Li, Hg, Si, Ge and B being the most prominent and considerably pushing the limits of plasma based mass spectrometry also by applying high mass resolution. The use of laser ablation in combination with MC-ICP-MS offers the possibility to achieve isotopic information on high spatial (µm-range) and temporal scale (in case of incrementally growing structures). The information gained with these analytical techniques can be linked between different hierarchical scales in ecosystems, offering means to better understand ecosystem processes. The presentation will highlight the use of different isotopic systems in ecosystem studies accomplished by ICP-MS. Selected examples on combining isotopic systems for the study of ecosystem processes on different spatial scales will underpin the great opportunities substantiated by the field of analytical ecogeochemistry. Moreover, recent developments in plasma mass spectrometry and the application of new isotopic systems require sound metrological approaches in order to prevent scientific conclusions drawn from analytical artifacts.

Application of laser ablation multicollector inductively coupled plasma mass spectrometry for the measurement of calcium and lead isotope ratios in packaging for discriminatory purposes.

PubMed

Santamaria-Fernandez, Rebeca; Wolff, Jean-Claude

2010-07-30

The potential of high-precision calcium and lead isotope ratio measurements using laser ablation coupled to multicollector inductively coupled plasma mass spectrometry (LA-MC-ICP-MS) to aid distinction between four genuine and five counterfeit pharmaceutical packaging samples and further classification of counterfeit packaging samples has been evaluated. We highlight the lack of reference materials for LA-MC-ICP-MS isotope ratio measurements in solids. In this case the problem is minimised by using National Institute of Standards and Technology Standard Reference Material (NIST SRM) 915a calcium carbonate (as solid pellets) and NIST SRM610 glass disc for sample bracketing external standardisation. In addition, a new reference material, NIST SRM915b calcium carbonate, has been characterised in-house for Ca isotope ratios and is used as a reference sample. Significant differences have been found between genuine and counterfeit samples; the method allows detection of counterfeits and aids further classification of packaging samples. Typical expanded uncertainties for measured-corrected Ca isotope ratio values ((43)Ca/(44)Ca and (42)Ca/(44)Ca) were found to be below 0.06% (k = 2, 95% confidence) and below 0.2% for measured-corrected Pb isotope ratios ((207)Pb/(206)Pb and (208)Pb/(206)Pb). This is the first time that Ca isotope ratios have been measured in packaging materials using LA coupled to a multicollector (MC)-ICP-MS instrument. The use of LA-MC-ICP-MS for direct measurement of Ca and Pb isotopic variations in cardboard/ink in packaging has definitive potential to aid counterfeit detection and classification. Copyright 2010 John Wiley & Sons, Ltd.

SU-E-T-155: Calibration of Variable Longitudinal Strength 103Pd Brachytherapy Sources

DOE Office of Scientific and Technical Information (OSTI.GOV)

Reed, J; Radtke, J; Micka, J

Purpose: Brachytherapy sources with variable longitudinal strength (VLS) allow for a customized intensity along the length of the source. These have applications in focal brachytherapy treatments of prostate cancer where dose boosting can be achieved through modulation of intra-source strengths. This work focused on development of a calibration methodology for VLS sources based on measurements and Monte Carlo (MC) simulations of five 1 cm {sup 10} {sup 3}Pd sources each containing four regions of variable {sup 103}Pd strength. Methods: The air-kerma strengths of the sources were measured with a variable-aperture free-air chamber (VAFAC). Source strengths were also measured using amore » well chamber. The in-air azimuthal and polar anisotropy of the sources were measured by rotating them in front of a NaI scintillation detector and were calculated with MC simulations. Azimuthal anisotropy results were normalized to their mean intensity values. Polar anisotropy results were normalized to their average transverse axis intensity values. The relative longitudinal strengths of the sources were measured via on-contact irradiations with radiochromic film, and were calculated with MC simulations. Results: The variable {sup 103}Pd loading of the sources was validated by VAFAC and well chamber measurements. Ratios of VAFAC air-kerma strengths and well chamber responses were within ±1.3% for all sources. Azimuthal anisotropy results indicated that ≥95% of the normalized values for all sources were within ±1.7% of the mean values. Polar anisotropy results indicated variations within ±0.3% for a ±7.6° angular region with respect to the source transverse axis. Locations and intensities of the {sup 103}Pd regions were validated by radiochromic film measurements and MC simulations. Conclusion: The calibration methodology developed in this work confirms that the VLS sources investigated have a high level of polar uniformity, and that the strength and longitudinal intensity can be verified experimentally and through MC simulations. {sup 103}Pd sources were provided by CivaTech Oncology, Inc.« less

Strontium isotope measurement of basaltic glasses by laser ablation multiple collector inductively coupled plasma mass spectrometry based on a linear relationship between analytical bias and Rb/Sr ratios.

PubMed

Zhang, Le; Ren, Zhong-Yuan; Wu, Ya-Dong; Li, Nan

2018-01-30

In situ strontium (Sr) isotope analysis of geological samples by laser ablation multiple collector inductively coupled plasma mass spectrometry (LA-MC-ICP-MS) provides useful information about magma mixing, crustal contamination and crystal residence time. Without chemical separation, during Sr isotope analysis with laser ablation, many kinds of interference ions (such as Rb + and Kr + ) are on the Sr isotope spectrum. Most previous in situ Sr isotope studies only focused on Sr-enriched minerals (e.g. plagioclase, calcite). Here we established a simple method for in situ Sr isotope analysis of basaltic glass with Rb/Sr ratio less than 0.14 by LA-MC-ICP-MS. Seven Faraday cups, on a Neptune Plus MC-ICP-MS instrument, were used to receive the signals on m/z 82, 83, 84, 85, 86, 87 and 88 simultaneously for the Sr isotope analysis of basaltic glass. The isobaric interference of 87 Rb was corrected by the peak stripping method. The instrumental mass fractionation of 87 Sr/ 86 Sr was corrected to 86 Sr/ 88 Sr = 0.1194 with an exponential law. Finally, the residual analytical biases of 87 Sr/ 86 Sr were corrected with a relationship between the deviation of 87 Sr/ 86 Sr from the reference values and the measured 87 Rb/ 86 Sr. The validity of the protocol present here was demonstrated by measuring the Sr isotopes of four basaltic glasses, a plagioclase crystal and a piece of modern coral. The measured 87 Sr/ 86 Sr ratios of all these samples agree within 100 ppm with the reference values. In addition, the Sr isotopes of olivine-hosted melt inclusions from the Emeishan large igneous province (LIP) were measured to show the application of our method to real geological samples. A simple but accurate approach for in situ Sr isotope measurement by LA-MC-ICP-MS has been established, which should greatly facilitate the wider application of in situ Sr isotope geochemistry, especially to volcanic rock studies. Copyright © 2017 John Wiley & Sons, Ltd.

Identification of prominence ejecta by the proton distribution function and magnetic fine structure in interplanetary coronal mass ejections in the inner heliosphere

NASA Astrophysics Data System (ADS)

Yao, Shuo; Marsch, Eckart; Tu, Chuan-Yi; Schwenn, Rainer

2010-05-01

This work presents in situ solar wind observations of three magnetic clouds (MCs) that contain cold high-density material when Helios 2 was located at 0.3 AU on 9 May 1979, 0.5 AU on 30 March 1976, and 0.7 AU on 24 December 1978. In the cold high-density regions embedded in the interplanetary coronal mass ejections we find (1) that the number density of protons is higher than in other regions inside the magnetic cloud, (2) the possible existence of He+, (3) that the thermal velocity distribution functions are more isotropic and appear to be colder than in the other regions of the MC, and the proton temperature is lower than that of the ambient plasma, and (4) that the associated magnetic field configuration can for all three MC events be identified as a flux rope. This cold high-density region is located at the polarity inversion line in the center of the bipolar structure of the MC magnetic field (consistent with previous solar observation work that found that a prominence lies over the neutral line of the related bipolar solar magnetic field). Specifically, for the first magnetic cloud event on 8 May 1979, a coronal mass ejection (CME) was related to an eruptive prominence previously reported as a result of the observation of Solwind (P78-1). Therefore, we identify the cold and dense region in the MC as the prominence material. It is the first time that prominence ejecta were identified by both the plasma and magnetic field features inside 1 AU, and it is also the first time that the thermal ion velocity distribution functions were used to investigate the microstate of the prominence material. Moreover, from our three cases, we also found that this material tended to fall behind the magnetic cloud and become smaller as it propagated farther away from the Sun, which confirms speculations in previous work. Overall, our in situ observations are consistent with three-part CME models.

Simulation of substrate degradation in composting of sewage sludge

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zhang Jun; Gao Ding, E-mail: gaod@igsnrr.ac.c; Chen Tongbin

2010-10-15

To simulate the substrate degradation kinetics of the composting process, this paper develops a mathematical model with a first-order reaction assumption and heat/mass balance equations. A pilot-scale composting test with a mixture of sewage sludge and wheat straw was conducted in an insulated reactor. The BVS (biodegradable volatile solids) degradation process, matrix mass, MC (moisture content), DM (dry matter) and VS (volatile solid) were simulated numerically by the model and experimental data. The numerical simulation offered a method for simulating k (the first-order rate constant) and estimating k{sub 20} (the first-order rate constant at 20 {sup o}C). After comparison withmore » experimental values, the relative error of the simulation value of the mass of the compost at maturity was 0.22%, MC 2.9%, DM 4.9% and VS 5.2%, which mean that the simulation is a good fit. The k of sewage sludge was simulated, and k{sub 20}, k{sub 20s} (first-order rate coefficient of slow fraction of BVS at 20 {sup o}C) of the sewage sludge were estimated as 0.082 and 0.015 d{sup -1}, respectively.« less

Microcystin-LR Detected in a Low Molecular Weight  Fraction from a Crude Extract of Zoanthus sociatus.

PubMed

Domínguez-Pérez, Dany; Rodríguez, Armando Alexei; Osorio, Hugo; Azevedo, Joana; Castañeda, Olga; Vasconcelos, Vítor; Antunes, Agostinho

2017-03-01

Cnidarian constitutes a great source of bioactive compounds. However, research involving peptides from organisms belonging to the order Zoanthidea has received very little attention, contrasting to the numerous studies of the order Actiniaria, from which hundreds of toxic peptides and proteins have been reported. In this work, we performed a mass spectrometry analysis of a low molecular weight (LMW) fraction previously reported as lethal to mice. The low molecular weight (LMW) fraction was obtained by gel filtration of a Zoanthus sociatus (order Zoanthidea) crude extract with a Sephadex G-50, and then analyzed by matrix-assisted laser desorption/ionization time-of-flight/time-of-flight (MALDI-TOF/TOF) mass spectrometry (MS) in positive ion reflector mode from m/z 700 to m/z 4000. Afterwards, some of the most intense and representative MS ions were fragmented by MS/MS with no significant results obtained by Protein Pilot protein identification software and the Mascot algorithm search. However, microcystin masses were detected by mass-matching against libraries of non-ribosomal peptide database (NORINE). Subsequent reversed-phase C18 HPLC (in isocratic elution mode) and mass spectrometry analyses corroborated the presence of the cyanotoxin Microcystin-LR (MC-LR). To the best of our knowledge, this finding constitutes the first report of MC-LR in Z. sociatus, and one of the few evidences of such cyanotoxin in cnidarians.

V and K-band Mass-Luminosity Relations for M Dwarf Stars

NASA Astrophysics Data System (ADS)

Benedict, George Frederick; Henry, Todd J.; McArthur, Barbara E.; Franz, Otto; Wasserman, Larry H.; Dieterich, Sergio

2015-08-01

Applying Hubble Space Telescope Fine Guidance Sensor astrometric techniques developed to establish relative orbits for binary stars (Franz et al. 1998, AJ, 116, 1432), determine masses of binary components (Benedict et al. 2001, AJ, 121, 1607), and measure companion masses of exoplanet host stars (McArthur et al. 2010, ApJ, 715, 1203), we derive masses with an average 2% error for 28 components of 14 M dwarf binary star systems. With these and other published masses we update the lower Main Sequence V-band Mass-Luminosity Relation first shown in Henry et al. 1999, ApJ, 512, 864. We demonstrate that a Mass-Luminosity Relation in the K-band has far less scatter. These relations can be used to estimate the masses of the ubiquitous red dwarfs (75% of all stars) to an accuracy of better than 5%.

Effects of opioid and nonopioid analgesics on canine wheal formation and cultured human mast cell degranulation.

PubMed

Schmidt-Rondon, Eric; Wang, Zhenping; Malkmus, Shelle A; Di Nardo, Anna; Hildebrand, Keith; Page, Linda; Yaksh, Tony L

2018-01-01

Mast cell (MC) degranulation has been implicated in the side effect profile of a variety of clinically useful agents. Thus, after intrathecal delivery, formation of space-occupying, meningeally-derived masses may be related to local MC degranulation. We systematically characterized degranulating effects of opioid and nonopioid analgesics on cutaneous flares in the dog and in primary human MC (hMC) cultures. Dogs were anesthetized with IV propofol and received intradermal (ID) injections (50μL). Flare diameters were measured at 30min. Drugs showing flare responses were tested after intramuscular (IM) cromolyn (10mg/kg), a MC stabilizer. Human primary MCs (human cord blood CD34 + /CD45 + cells) were employed and β-hexosaminidase in cell-free supernatants were measured to assess degranulation. A significant skin flare for several classes of agents was observed including opioids, ziconotide, ketamine, ST-91, neostigmine, adenosine, bupivacaine, lidocaine, MK-801 and 48/80. Tizanidine, fentanyl, alfentanil, gabapentin and baclofen produced no flare. Flare produced by all ID agents, except adenosine, bupivacaine and lidocaine, was reduced by cromolyn. Naloxone had no effect upon opiate or 48/80 evoked flares. In hMC studies, 48/80 resulted in a concentration-dependent release of β-hexosaminidase. The rank order of drug-induced hMC β-hexosaminidase release was similar to that for flares. A variety of therapeutically useful drugs degranulate MCs. This action may account for side effects such as the intrathecal granuloma resulting from spinally-delivered opioids. This degranulating effect may be useful in predicting potential intrathecal toxicity in the development of novel agents. Copyright © 2017 Elsevier Inc. All rights reserved.

Identification of the Mamestra configurata (Lepidoptera: Noctuidae) peritrophic matrix proteins and enzymes involved in peritrophic matrix chitin metabolism.

PubMed

Toprak, Umut; Erlandson, Martin; Baldwin, Doug; Karcz, Steve; Wan, Lianglu; Coutu, Cathy; Gillott, Cedric; Hegedus, Dwayne D

2016-10-01

The peritrophic matrix (PM) is essential for insect digestive system physiology as it protects the midgut epithelium from damage by food particles, pathogens, and toxins. The PM is also an attractive target for development of new pest control strategies due to its per os accessibility. To understand how the PM performs these functions, the molecular architecture of the PM was examined using genomic and proteomic approaches in Mamestra configurata (Lepidoptera: Noctuidae), a major pest of cruciferous oilseed crops in North America. Liquid chromatography-tandem mass spectrometry analyses of the PM identified 82 proteins classified as: (i) peritrophins, including a new class with a CBDIII domain; (ii) enzymes involved in chitin modification (chitin deacetylases), digestion (serine proteases, aminopeptidases, carboxypeptidases, lipases and α-amylase) or other reactions (β-1,3-glucanase, alkaline phosphatase, dsRNase, astacin, pantetheinase); (iii) a heterogenous group consisting of polycalin, REPATs, serpin, C-Type lectin and Lsti99/Lsti201 and 3 novel proteins without known orthologs. The genes encoding PM proteins were expressed predominantly in the midgut. cDNAs encoding chitin synthase-2 (McCHS-2), chitinase (McCHI), and β-N-acetylglucosaminidase (McNAG) enzymes, involved in PM chitin metabolism, were also identified. McCHS-2 expression was specific to the midgut indicating that it is responsible for chitin synthesis in the PM, the only chitinous material in the midgut. In contrast, the genes encoding the chitinolytic enzymes were expressed in multiple tissues. McCHS-2, McCHI, and McNAG were expressed in the midgut of feeding larvae, and NAG activity was present in the PM. This information was used to generate an updated model of the lepidopteran PM architecture. © 2015 Institute of Zoology, Chinese Academy of Sciences.

The synthesis and characterization of 7-hydroxy-4-methylcoumarin and the investigation of the fluorescence properties of its 7-hydroxy-4-methylcoumarin-chitosan films

DOE Office of Scientific and Technical Information (OSTI.GOV)

Wahyuningrum, Deana, E-mail: deana@chem.itb.ac.id; Zulqarnaen, Muhammad; Suendo, Veinardi

Chitosan fluorescent films containing 7-hydroxy-4-methylcoumarin (7H4MC) have been successfully prepared. Used chitosan was obtained from chitin isolated from skin of tiger prawns (Penaeus monodon) through the deproteination, demineralization, and deacetylation process. The yields of chitin and chitosan are 10.66% and 23.83%, respectively. The chitosan has 55.00% degree of deacetylation based on FTIR spectroscopy. Average molecular mass of chitosan which was determined by Ostwald viscometry method is 8.55 × 10{sup 6} g/mol. The 7H4MC was synthesized from resorcinol and ethyl acetoacetate using amberlyst-15 as catalyst based on Pechmann reaction with chemical yields of 90.01% and the melting point of 189–190°C. Themore » FTIR, {sup 1}H–NMR, and {sup 13}C–NMR spectroscopies confirmed the structure which corresponds to the structure of 7H4MC. The films of chitosan containing 7H4MC were prepared by solvent evaporation method in 2% (v/v) acetic acid. The 7H4MC content in each film was 0% (blank), 0.2%, 0.4%, 0.6%, and 0.8% (w/w). The UV-Vis spectrum of 7H4MC in methanol showed λ{sub max} at 235 and 337 nm. The observed fluorescence is the fluorescence color of cyan. The excitation wavelengths are 200, 235, 275, 337, and 365 nm. The highest intensity of cyan color fluorescence of chitosan containing 7H4MC films was obtained at the concentration of 0.2% of 7-hydroxy-4-methylcoumarin at the excitation wavelength of 275 nm.« less

Voluntary exercise prevents the obese and diabetic metabolic syndrome of the melanocortin-4 receptor knockout mouse.

PubMed

Haskell-Luevano, Carrie; Schaub, Jay W; Andreasen, Amy; Haskell, Kim R; Moore, Marcus C; Koerper, Lorraine M; Rouzaud, Francois; Baker, Henry V; Millard, William J; Walter, Glenn; Litherland, S A; Xiang, Zhimin

2009-02-01

Exercise is a mechanism for maintenance of body weight in humans. Morbidly obese human patients have been shown to possess single nucleotide polymorphisms in the melanocortin-4 receptor (MC4R). MC4R knockout mice have been well characterized as a genetic model that possesses phenotypic metabolic disorders, including obesity, hyperphagia, hyperinsulinemia, and hyperleptinemia, similar to those observed in humans possessing dysfunctional hMC4Rs. Using this model, we examined the effect of voluntary exercise of MC4R knockout mice that were allowed access to a running wheel for a duration of 8 wk. Physiological parameters that were measured included body weight, body composition of fat and lean mass, food consumption, body length, and blood levels of cholesterol and nonfasted glucose, insulin, and leptin. At the termination of the experiment, hypothalamic mRNA expression levels of neuropeptide Y (NPY), agouti-related protein (AGRP), proopiomelanocortin (POMC), cocaine- and amphetamine-regulated transcript (CART), orexin, brain-derived neurotropic factor (BDNF), phosphatase with tensin homology (Pten), melanocortin-3 receptor (MC3R), and NPY-Y1R were determined. In addition, islet cell distribution and function in the pancreas were examined. In the exercising MC4R knockout mice, the pancreatic islet cell morphology and other physiological parameters resembled those observed in the wild-type littermate controls. Gene expression profiles identified exercise as having a significant effect on hypothalamic POMC, orexin, and MC3R levels. Genotype had a significant effect on AGRP, POMC, CART, and NPY-Y1R, with an exercise and genotype interaction effect on NPY gene expression. These data support the hypothesis that voluntary exercise can prevent the genetic predisposition of melanocortin-4 receptor-associated obesity and diabetes.

Gene variants and binge eating as predictors of comorbidity and outcome of treatment in severe obesity.

PubMed

Potoczna, Natascha; Branson, Ruth; Kral, John G; Piec, Grazyna; Steffen, Rudolf; Ricklin, Thomas; Hoehe, Margret R; Lentes, Klaus-Ulrich; Horber, Fritz F

2004-12-01

Melanocortin-4 receptor gene (MC4R) variants are associated with obesity and binge eating disorder (BED), whereas the more prevalent proopiomelanocortin (POMC) and leptin receptor gene (LEPR) mutations are rarely associated with obesity or BED. The complete coding regions of MC4R, POMC, and leptin-binding domain of LEPR were comparatively sequenced in 300 patients (233 women and 67 men; mean +/- SEM age, 42 +/- 1 years; mean +/- SEM body mass index, 43.5 +/- 0.3 kg/m2) undergoing laparoscopic gastric banding. Eating behavior, esophagogastric pathology, metabolic syndrome prevalence, and postoperative weight loss and complications were retrospectively compared between carriers and noncarriers of gene variants with and without BED during 36 +/- 3-month follow-up. Nineteen patients (6.3%) carried 8 MC4R variants, 144 (48.0%) carried 13 POMC variants, and 247 (82.3%) carried 11 LEPR variants. All MC4R variant carriers had BED, compared with 18.1% of noncarriers (P < 0.001). BED rates were similar among POMC and LEPR variant carriers and noncarriers. Gastroscopy revealed more erosive esophagitis in bingers than in nonbingers before and after banding (P < 0.04), regardless of genotype. MC4R variant carriers lost less weight (P=0.003), showed less improvement in metabolic syndrome (P < 0.001), had dilated esophagi (P < 0.001) and more vomiting (P < 0.05), and had fivefold more gastric complications (P < 0.001) than noncarriers. Overall outcome was poorest in MC4R variant carriers, better in noncarriers with BED (P < 0.05), and best in noncarriers without BED (P < 0.001). MC4R variants influence comorbidities and treatment outcomes in severe obesity.

Comparison of Magnetic Properties in a Magnetic Cloud and Its Solar Source on 2013 April 11-14

NASA Astrophysics Data System (ADS)

Vemareddy, P.; Möstl, C.; Amerstorfer, T.; Mishra, W.; Farrugia, C.; Leitner, M.

2016-09-01

In the context of the Sun-Earth connection of coronal mass ejections and magnetic flux ropes (MFRs), we studied the solar active region (AR) and the magnetic properties of magnetic cloud (MC) event during 2013 April 14-15. We use in situ observations from the Advanced Composition Explorer and source AR measurements from the Solar Dynamics Observatory. The MCs magnetic structure is reconstructed from the Grad-Shafranov method, which reveals a northern component of the axial field with left handed helicity. The MC invariant axis is highly inclined to the ecliptic plane pointing northward and is rotated by 117° with respect to the source region PIL. The net axial flux and current in the MC are comparatively higher than from the source region. Linear force-free alpha distribution (10-7-10-6 m-1) at the sigmoid leg matches the range of twist number in the MC of 1-2 au MFR. The MFR is nonlinear force-free with decreasing twist from the axis (9 turns/au) toward the edge. Therefore, a Gold-Hoyle (GH) configuration, assuming a constant twist, is more consistent with the MC structure than the Lundquist configuration of increasing twist from the axis to boundary. As an indication of that, the GH configuration yields a better fitting to the global trend of in situ magnetic field components, in terms of rms, than the Lundquist model. These cylindrical configurations improved the MC fitting results when the effect of self-similar expansion of MFR was considered. For such twisting behavior, this study suggests an alternative fitting procedure to better characterize the MC magnetic structure and its source region links.

COMPARISON OF MAGNETIC PROPERTIES IN A MAGNETIC CLOUD AND ITS SOLAR SOURCE ON 2013 APRIL 11–14

DOE Office of Scientific and Technical Information (OSTI.GOV)

Vemareddy, P.; Möstl, C.; Amerstorfer, T.

2016-09-01

In the context of the Sun–Earth connection of coronal mass ejections and magnetic flux ropes (MFRs), we studied the solar active region (AR) and the magnetic properties of magnetic cloud (MC) event during 2013 April 14–15. We use in situ observations from the Advanced Composition Explorer and source AR measurements from the Solar Dynamics Observatory . The MCs magnetic structure is reconstructed from the Grad–Shafranov method, which reveals a northern component of the axial field with left handed helicity. The MC invariant axis is highly inclined to the ecliptic plane pointing northward and is rotated by 117° with respect tomore » the source region PIL. The net axial flux and current in the MC are comparatively higher than from the source region. Linear force-free alpha distribution (10{sup −7}–10{sup −6} m{sup −1}) at the sigmoid leg matches the range of twist number in the MC of 1–2 au MFR. The MFR is nonlinear force-free with decreasing twist from the axis (9 turns/au) toward the edge. Therefore, a Gold–Hoyle (GH) configuration, assuming a constant twist, is more consistent with the MC structure than the Lundquist configuration of increasing twist from the axis to boundary. As an indication of that, the GH configuration yields a better fitting to the global trend of in situ magnetic field components, in terms of rms, than the Lundquist model. These cylindrical configurations improved the MC fitting results when the effect of self-similar expansion of MFR was considered. For such twisting behavior, this study suggests an alternative fitting procedure to better characterize the MC magnetic structure and its source region links.« less

Simulating radiative feedback and star cluster formation in GMCs - II. Mass dependence of cloud destruction and cluster properties

NASA Astrophysics Data System (ADS)

Howard, Corey S.; Pudritz, Ralph E.; Harris, William E.

2017-09-01

The process of radiative feedback in giant molecular clouds (GMCs) is an important mechanism for limiting star cluster formation through the heating and ionization of the surrounding gas. We explore the degree to which radiative feedback affects early (≲5 Myr) cluster formation in GMCs having masses that range from 104 to 106 M⊙ using the flash code. The inclusion of radiative feedback lowers the efficiency of cluster formation by 20-50 per cent relative to hydrodynamic simulations. Two models in particular - 5 × 104 and 105 M⊙ - show the largest suppression of the cluster formation efficiency, corresponding to a factor of ˜2. For these clouds only, the internal energy, a measure of the energy injected by radiative feedback, exceeds the gravitational potential for a significant amount of time. We find a clear relation between the maximum cluster mass, Mc,max, formed in a GMC and the mass of the GMC itself, MGMC: Mc,max ∝ M_{GMC}^{0.81}. This scaling result suggests that young globular clusters at the necessary scale of 106 M⊙ form within host GMCs of masses near ˜5 × 107 M⊙. We compare simulated cluster mass distributions to the observed embedded cluster mass function [d log (N)/dlog (M) ∝ Mβ where β = -1] and find good agreement (β = -0.99 ± 0.14) only for simulations including radiative feedback, indicating this process is important in controlling the growth of young clusters. However, the high star formation efficiencies, which range from 16 to 21 per cent, and high star formation rates compared to locally observed regions suggest other feedback mechanisms are also important during the formation and growth of stellar clusters.

A common variant near BDNF is associated with dietary calcium intake in adolescents.

PubMed

Dušátková, Lenka; Zamrazilová, Hana; Aldhoon-Hainerová, Irena; Sedláčková, Barbora; Včelák, Josef; Hlavatý, Petr; Bendlová, Běla; Kunešová, Marie; Hainer, Vojtěch

2015-09-01

Specific targets for most obesity candidate genes discovered by genomewide association studies remain unknown. Such genes are often highly expressed in the hypothalamus, indicating their role in energy homeostasis. We aimed to evaluate the associations of selected gene variants with adiposity and dietary traits. Anthropometric parameters, fat mass, dietary intake (total energy, fat, protein, carbohydrate, fiber, and calcium) and 10 gene variants (in/near TMEM18, SH2B1, KCTD15, PCSK1, BDNF, SEC16B, MC4R and FTO) were analyzed in 1953 Czech individuals aged 10.0 to 18.0 years (1035 nonoverweight and 918 overweight: body mass index [BMI] ≥90th percentile). Obesity risk alleles of TMEM18 rs7561317, SEC16B rs10913469, and FTO rs9939609 were related to increased body weight and BMI (P < .005). The FTO variant also showed a significant positive association with waist circumference and fat mass (P < .001). Overweight adolescents had a lower total energy intake (P < .001) but a higher percentage of fat (P = .009) and protein intake (P < .001) than the nonoverweight subjects. There was also a lower calcium intake in the overweight group (P < .001). An association with at least one component of dietary intake was found in 3 of 10 studied gene variants. The MC4R rs17782313 was associated negatively with protein (P = .012) and positively associated with fiber (P = .032) intakes. The obesity risk alleles of BDNF rs925946 and FTO rs9939609 were related to a lower calcium intake (P = .001 and .037). The effects of FTO and MC4R variants, however, disappeared after corrections for multiple testing. Our results suggest that the common BDNF variant may influence dietary calcium intake independent of BMI. Copyright © 2015 Elsevier Inc. All rights reserved.

Gas-surface interactions using accommodation coefficients for a dilute and a dense gas in a micro- or nanochannel: heat flux predictions using combined molecular dynamics and Monte Carlo techniques.

PubMed

Nedea, S V; van Steenhoven, A A; Markvoort, A J; Spijker, P; Giordano, D

2014-05-01

The influence of gas-surface interactions of a dilute gas confined between two parallel walls on the heat flux predictions is investigated using a combined Monte Carlo (MC) and molecular dynamics (MD) approach. The accommodation coefficients are computed from the temperature of incident and reflected molecules in molecular dynamics and used as effective coefficients in Maxwell-like boundary conditions in Monte Carlo simulations. Hydrophobic and hydrophilic wall interactions are studied, and the effect of the gas-surface interaction potential on the heat flux and other characteristic parameters like density and temperature is shown. The heat flux dependence on the accommodation coefficient is shown for different fluid-wall mass ratios. We find that the accommodation coefficient is increasing considerably when the mass ratio is decreased. An effective map of the heat flux depending on the accommodation coefficient is given and we show that MC heat flux predictions using Maxwell boundary conditions based on the accommodation coefficient give good results when compared to pure molecular dynamics heat predictions. The accommodation coefficients computed for a dilute gas for different gas-wall interaction parameters and mass ratios are transferred to compute the heat flux predictions for a dense gas. Comparison of the heat fluxes derived using explicit MD, MC with Maxwell-like boundary conditions based on the accommodation coefficients, and pure Maxwell boundary conditions are discussed. A map of the heat flux dependence on the accommodation coefficients for a dense gas, and the effective accommodation coefficients for different gas-wall interactions are given. In the end, this approach is applied to study the gas-surface interactions of argon and xenon molecules on a platinum surface. The derived accommodation coefficients are compared with values of experimental results.

Allelic Variants of Melanocortin 3 Receptor Gene (MC3R) and Weight Loss in Obesity: A Randomised Trial of Hypo-Energetic High- versus Low-Fat Diets

PubMed Central

Santos, José L.; De la Cruz, Rolando; Holst, Claus; Grau, Katrine; Naranjo, Carolina; Maiz, Alberto; Astrup, Arne; Saris, Wim H. M.; MacDonald, Ian; Oppert, Jean-Michel; Hansen, Torben; Pedersen, Oluf; Sorensen, Thorkild I. A.; Martinez, J. Alfredo

2011-01-01

Introduction The melanocortin system plays an important role in energy homeostasis. Mice genetically deficient in the melanocortin-3 receptor gene have a normal body weight with increased body fat, mild hypophagia compared to wild-type mice. In humans, Thr6Lys and Val81Ile variants of the melanocortin-3 receptor gene (MC3R) have been associated with childhood obesity, higher BMI Z-score and elevated body fat percentage compared to non-carriers. The aim of this study is to assess the association in adults between allelic variants of MC3R with weight loss induced by energy-restricted diets. Subjects and Methods This research is based on the NUGENOB study, a trial conducted to assess weight loss during a 10-week dietary intervention involving two different hypo-energetic (high-fat and low-fat) diets. A total of 760 obese patients were genotyped for 10 single nucleotide polymorphisms covering the single exon of MC3R gene and its flanking regions, including the missense variants Thr6Lys and Val81Ile. Linear mixed models and haplotype-based analysis were carried out to assess the potential association between genetic polymorphisms and differential weight loss, fat mass loss, waist change and resting energy expenditure changes. Results No differences in drop-out rate were found by MC3R genotypes. The rs6014646 polymorphism was significantly associated with weight loss using co-dominant (p = 0.04) and dominant models (p = 0.03). These p-values were not statistically significant after strict control for multiple testing. Haplotype-based multivariate analysis using permutations showed that rs3827103–rs1543873 (p = 0.06), rs6014646–rs6024730 (p = 0.05) and rs3746619–rs3827103 (p = 0.10) displayed near-statistical significant results in relation to weight loss. No other significant associations or gene*diet interactions were detected for weight loss, fat mass loss, waist change and resting energy expenditure changes. Conclusion The study provided overall sufficient evidence to support that there is no major effect of genetic variants of MC3R and differential weight loss after a 10-week dietary intervention with hypo-energetic diets in obese Europeans. PMID:21695122

Searching for the QCD Axion with Gravitational Microlensing

NASA Astrophysics Data System (ADS)

Fairbairn, Malcolm; Marsh, David J. E.; Quevillon, Jérémie

2017-07-01

The phase transition responsible for axion dark matter (DM) production can create large amplitude isocurvature perturbations, which collapse into dense objects known as axion miniclusters. We use microlensing data from the EROS survey and from recent observations with the Subaru Hyper Suprime Cam to place constraints on the minicluster scenario. We compute the microlensing event rate for miniclusters, treating them as spatially extended objects. Using the published bounds on the number of microlensing events, we bound the fraction of DM collapsed into miniclusters fMC. For an axion with temperature-dependent mass consistent with the QCD axion, we find fMC<0.083 (ma/100 μ eV )0.12 , which represents the first observational constraint on the minicluster fraction. We forecast that a high-efficiency observation of around ten nights with Subaru would be sufficient to constrain fMC≲0.004 over the entire QCD axion mass range. We make various approximations to derive these constraints, and dedicated analyses by the observing teams of EROS and Subaru are necessary to confirm our results. If accurate theoretical predictions for fMC can be made in the future, then microlensing can be used to exclude or discover the QCD axion. Further details of our computations are presented in a companion paper [M. Fairbairn, D. J. E. Marsh, J. Quevillon, and S. Rozier (to be published)].

Direct separation of boron from Na- and Ca-rich matrices by sublimation for stable isotope measurement by MC-ICP-MS.

PubMed

Wang, Bo-Shian; You, Chen-Feng; Huang, Kuo-Fang; Wu, Shein-Fu; Aggarwal, Suresh Kumar; Chung, Chuan-Hsiung; Lin, Pei-Ying

2010-09-15

An improved technique for precise and accurate determination of boron isotopic composition in Na-rich natural waters (groundwater, seawater) and marine biogenic carbonates was developed. This study used a 'micro-sublimation' technique to separate B from natural sample matrices in place of the conventional ion-exchange extraction. By adjusting analyte to appropriate pH, quantitative recovery of boron can be achieved (>98%) and the B procedural blank is limited to <8 pg. An additional mass bias effect in MC-ICP-MS was observed which could not be improved via the standard-sample-standard bracketing or the 'pseudo internal' normalization by Li. Therefore a standard other than NBS SRM 951 was used to monitor plasma condition in order to maintain analytical accuracy. An isotope cross-calibration with results from TIMS shows that the space-charge mass bias on MC-ICP-MS can be successfully corrected using off-line mathematical manipulation. Several reference materials, including the seawater IAPSO and two groundwater standards IAEA-B-2 and IAEA-B-3, were used to validate this approach. We found that the delta(11)B of the reference coral JCp-1 was 24.22+/-0.28 per thousand, corresponding to seawater pH based on the coral delta(11)B-pH function. Copyright (c) 2010 Elsevier B.V. All rights reserved.

87Sr/86Sr isotope ratio analysis by laser ablation MC-ICP-MS in scales, spines, and fin rays as a nonlethal alternative to otoliths for reconstructing fish life history

USGS Publications Warehouse

Willmes, Malte; Glessner, Justin J. G.; Carleton, Scott A.; Gerrity, Paul C.; Hobbs, James A.

2016-01-01

Strontium isotope ratios (87Sr/86Sr) in otoliths are a well-established tool to determine origins and movement patterns of fish. However, otolith extraction requires sacrificing fish, and when working with protected or endangered species, the use of nonlethal samples such as scales, spines, and fin rays is preferred. Unlike otoliths that are predominantly aragonite, these tissues are composed of biological apatite. Laser ablation multicollector inductively coupled plasma mass spectrometry (LA-MC-ICP-MS) analysis of biological apatite can induce significant interference on mass 87, causing inaccurate 87Sr/86Sr measurements. To quantify this interference, we applied LA-MC-ICP-MS to three marine samples (white seabass (Atractoscion nobilis) otolith; green sturgeon (Acipenser medirostris) pectoral fin ray; salmon shark (Lamna ditropis) tooth), and freshwater walleye (Sander vitreus) otoliths, scales, and spines). Instrument conditions that maximize signal intensity resulted in elevated 87Sr/86Sr isotope ratios in the bioapatite samples, related to a polyatomic interference (40Ca31P16O, 40Ar31P16O). Retuning instrument conditions to reduce oxide levels removed this interference, resulting in accurate 87Sr/86Sr ratios across all tissue samples. This method provides a novel, nonlethal alternative to otolith analysis to reconstruct fish life histories.

Testing Multilateral Comparisons in Africa.

ERIC Educational Resources Information Center

Bender, M. Lionel

In this paper, the multilateral comparison method of classifying languages is described and analyzed. It is suggested that while it is espoused as a simple and reasonable approach to language classification, the method has serious flaws. "Multilateral" or "mass" comparison (MC) is not a method of genetic language…

Coping with the Economic Order through the Big Mac

ERIC Educational Resources Information Center

Akenson, James E.

1977-01-01

Describes an economic education unit for use in the elementary classroom which employs a case study of McDonalds hamburger chain to teach students about multinational corporations, mass production, standardization, advertising, and capital investment. For journal availability, see SO 505 448. (Author/DB)

Effect of the chemical structure of the polymer matrix on the properties of foam polyurethanes at low temperatures

NASA Astrophysics Data System (ADS)

Yakushin, V. A.; Stirna, U. K.; Zhmud', N. P.

1999-07-01

The dependence of physical and mechanical properties of oligoether-based foam polyurethanes on the molecular mass (Mc) of polymer chains between the nodes of the polymer network and on the content of rigid segments in the polymer is investigated at 293 and 98K. The values of Mc at which the foam plastics have the best mechanical properties at low temperatures are determined. The content of rigid segments in the polymer at which foam polyurethanes have the best combination of the linear thermal expansion coefficient and mechanical properties in tension at a temperature of 98K is found.

An order insertion scheduling model of logistics service supply chain considering capacity and time factors.

PubMed

Liu, Weihua; Yang, Yi; Wang, Shuqing; Liu, Yang

2014-01-01

Order insertion often occurs in the scheduling process of logistics service supply chain (LSSC), which disturbs normal time scheduling especially in the environment of mass customization logistics service. This study analyses order similarity coefficient and order insertion operation process and then establishes an order insertion scheduling model of LSSC with service capacity and time factors considered. This model aims to minimize the average unit volume operation cost of logistics service integrator and maximize the average satisfaction degree of functional logistics service providers. In order to verify the viability and effectiveness of our model, a specific example is numerically analyzed. Some interesting conclusions are obtained. First, along with the increase of completion time delay coefficient permitted by customers, the possible inserting order volume first increases and then trends to be stable. Second, supply chain performance reaches the best when the volume of inserting order is equal to the surplus volume of the normal operation capacity in mass service process. Third, the larger the normal operation capacity in mass service process is, the bigger the possible inserting order's volume will be. Moreover, compared to increasing the completion time delay coefficient, improving the normal operation capacity of mass service process is more useful.

Applying an intelligent model and sensitivity analysis to inspect mass transfer kinetics, shrinkage and crust color changes of deep-fat fried ostrich meat cubes.

PubMed

Amiryousefi, Mohammad Reza; Mohebbi, Mohebbat; Khodaiyan, Faramarz

2014-01-01

The objectives of this study were to use image analysis and artificial neural network (ANN) to predict mass transfer kinetics as well as color changes and shrinkage of deep-fat fried ostrich meat cubes. Two generalized feedforward networks were separately developed by using the operation conditions as inputs. Results based on the highest numerical quantities of the correlation coefficients between the experimental versus predicted values, showed proper fitting. Sensitivity analysis results of selected ANNs showed that among the input variables, frying temperature was the most sensitive to moisture content (MC) and fat content (FC) compared to other variables. Sensitivity analysis results of selected ANNs showed that MC and FC were the most sensitive to frying temperature compared to other input variables. Similarly, for the second ANN architecture, microwave power density was the most impressive variable having the maximum influence on both shrinkage percentage and color changes. Copyright © 2013 Elsevier Ltd. All rights reserved.

Onyx embolization of an intraosseous pseudoaneurysm of the middle meningeal artery in a patient with meningiomatosis, McCune-Albright syndrome, and gray platelet syndrome.

PubMed

Settecase, Fabio; Nicholson, Andrew D; Amans, Matthew R; Higashida, Randall T; Halbach, Van V; Cooke, Daniel L; Dowd, Christopher F; Hetts, Steven W

2016-03-01

A 13-year-old boy with meningiomatosis, McCune-Albright syndrome, and gray platelet syndrome presented with an enlarging "lump" on his right forehead. A head CT scan revealed a polyostotic fibrous dysplasia involving the entire skull. A 3.4-cm right frontal osseous cavity and an overlying right forehead subcutaneous soft-tissue mass were seen, measuring 5.2 cm in diameter and 1.6 cm thick. Ultrasound of the cavity and overlying mass showed swirling of blood and an arterialized waveform. MRI revealed an en plaque meningioma underlying the cavity. An intraosseous pseudoaneurysm fed by 3 distal anterior division branches of the right middle meningeal artery (MMA) with contrast extravasation was found on angiography. Two MMA feeders were embolized with Onyx, with anterograde filling of the intraosseous cavity with Onyx. A small pocket of residual intracavity contrast filling postembolization from a smaller third MMA feeder eventually thrombosed and the forehead lump regressed.

Theoretical implications of the galactic radial acceleration relation of McGaugh, Lelli, and Schombert

NASA Astrophysics Data System (ADS)

Nesbet, Robert K.

2018-05-01

Velocities in stable circular orbits about galaxies, a measure of centripetal gravitation, exceed the expected Kepler/Newton velocity as orbital radius increases. Standard Λ cold dark matter (ΛCDM) attributes this anomaly to galactic dark matter. McGaugh et al. have recently shown for 153 disc galaxies that observed radial acceleration is an apparently universal function of classical acceleration computed for observed galactic baryonic mass density. This is consistent with the empirical modified Newtonian dynamics (MOND) model, not requiring dark matter. It is shown here that suitably constrained ΛCDM and conformal gravity (CG) also produce such a universal correlation function. ΛCDM requires a very specific dark matter distribution, while the implied CG non-classical acceleration must be independent of galactic mass. All three constrained radial acceleration functions agree with the empirical baryonic v4 Tully-Fisher relation. Accurate rotation data in the nominally flat velocity range could distinguish between MOND, ΛCDM, and CG.

Absolute dimensions and masses of eclipsing binaries. V. IQ Persei

DOE Office of Scientific and Technical Information (OSTI.GOV)

Lacy, C.H.; Frueh, M.L.

1985-08-01

New photometric and spectroscopic observations of the 1.7 day eclipsing binary IQ Persei (B8 + A6) have been analyzed to yield very accurate fundamental properties of the system. Reticon spectroscopic observations obtained at McDonald Observatory were used to determine accurate radial velocities of both stars in this slightly eccentric large light-ratio binary. A new set of VR light curves obtained at McDonald Observatory were analyzed by synthesis techniques, and previously published UBV light curves were reanalyzed to yield accurate photometric orbits. Orbital parameters derived from both sets of photometric observations are in excellent agreement. The absolute dimensions, masses, luminosities, andmore » apsidal motion period (140 yr) derived from these observations agree well with the predictions of theoretical stellar evolution models. The A6 secondary is still very close to the zero-age main sequence. The B8 primary is about one-third of the way through its main-sequence evolution. 27 references.« less

Comparison of Radiation Exposure during Endovascular Treatment of Peripheral Arterial Disease with Flat-Panel Detectors on Mobile C-arm versus Fixed Systems.

PubMed

Guillou, Marie; Maurel, Blandine; Necib, Hatem; Vent, Pierre-Alexandre; Costargent, Alain; Chaillou, Philippe; Gouëffic, Yann; Kaladji, Adrien

2018-02-01

Flat-panel detectors on mobile C-arm (MC-arm) systems are currently challenging fixed C-arm (FC-arm) systems used in hybrid operating rooms. MC-arm systems offer an alternative to FC-arm systems in the endovascular treatment of peripheral arterial disease (PAD) but their efficiency has not been evaluated comparatively. Two series of patients undergoing arteriography with intention to treat were included. Each series consisted of 2 nonrandomized groups: an MC-arm group and an FC-arm group. Series 1 evaluated exposure to the patient (MC-arm, n = 113; FC-arm, n = 206) while series 2 evaluated exposure to patients and also health care personnel (MC-arm, n = 24; FC-arm, n = 76). The primary end points for evaluating exposure were air kerma (AK, in mGy) for patients and effective dose for health care personnel (in μSv). After adjustment for the effect of body mass index (analysis of covariance test), AK was found to be lower in the MC-arm group than in the FC-arm group (124.1 ± 142 vs. 173.3 ± 248.7, P = 0.025). There was no difference between the groups with regard to effective dose recorded for senior surgeons or for operating room nurses. However, a higher effective dose was recorded by the MC-arm group external dosimeter for the trainee resident and for nurse anesthetists. In endovascular treatment of lower limb PAD, use of an FC-arm system is associated with more radiation exposure to the patient than an MC-arm system. However, this type of imaging system does not appear to affect exposure to health care personnel. Copyright © 2017 Elsevier Inc. All rights reserved.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Pawlowski, Alex E.; Splitter, Derek A.; Muth, Thomas R.

Additive manufacturing by itself provides many benefits, but by combining different materials processing techniques like traditional casting with additive manufacturing to create hybrid processes, custom materials can be tailor-made and mass produced for applications with specific performance needs.

Mass Energy Equivalence Formula Must Include Rotational and Vibrational Kinetuic Energies as Well As Potential Energies

NASA Astrophysics Data System (ADS)

Brekke, Stewart

2010-11-01

Originally Einstein proposed the the mass-energy equivalence at low speeds as E=mc^2 + 1/2 mv^2. However, a mass may also be rotating and vibrating as well as moving linearly. Although small, these kinetic energies must be included in formulating a true mathematical statement of the mass-energy equivalence. Also, gravitational, electromagneic and magnetic potential energies must be included in the mass-energy equivalence mathematical statement. While the kinetic energy factors may differ in each physical situation such as types of vibrations and rotations, the basic equation for the mass- energy equivalence is therefore E = m0c^2 + 1/2m0v^2 + 1/2I2̂+ 1/2kx^2 + WG+ WE+ WM.

Balance Calibration – A Method for Assigning a Direct-Reading Uncertainty to an Electronic Balance.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Mike Stears

2010-07-01

Paper Title: Balance Calibration – A method for assigning a direct-reading uncertainty to an electronic balance. Intended Audience: Those who calibrate or use electronic balances. Abstract: As a calibration facility, we provide on-site (at the customer’s location) calibrations of electronic balances for customers within our company. In our experience, most of our customers are not using their balance as a comparator, but simply putting an unknown quantity on the balance and reading the displayed mass value. Manufacturer’s specifications for balances typically include specifications such as readability, repeatability, linearity, and sensitivity temperature drift, but what does this all mean when themore » balance user simply reads the displayed mass value and accepts the reading as the true value? This paper discusses a method for assigning a direct-reading uncertainty to a balance based upon the observed calibration data and the environment where the balance is being used. The method requires input from the customer regarding the environment where the balance is used and encourages discussion with the customer regarding sources of uncertainty and possible means for improvement; the calibration process becomes an educational opportunity for the balance user as well as calibration personnel. This paper will cover the uncertainty analysis applied to the calibration weights used for the field calibration of balances; the uncertainty is calculated over the range of environmental conditions typically encountered in the field and the resulting range of air density. The temperature stability in the area of the balance is discussed with the customer and the temperature range over which the balance calibration is valid is decided upon; the decision is based upon the uncertainty needs of the customer and the desired rigor in monitoring by the customer. Once the environmental limitations are decided, the calibration is performed and the measurement data is entered into a custom spreadsheet. The spreadsheet uses measurement results, along with the manufacturer’s specifications, to assign a direct-read measurement uncertainty to the balance. The fact that the assigned uncertainty is a best-case uncertainty is discussed with the customer; the assigned uncertainty contains no allowance for contributions associated with the unknown weighing sample, such as density, static charges, magnetism, etc. The attendee will learn uncertainty considerations associated with balance calibrations along with one method for assigning an uncertainty to a balance used for non-comparison measurements.« less

What Happened to Leo P's Metals?

NASA Astrophysics Data System (ADS)

Kohler, Susanna

2015-12-01

Measurements of metal abundances in galaxies present a conundrum: compared to expectations, there are not nearly enough metals observed within galaxies. New observations of a nearby dwarf galaxy may help us understand where this enriched material went.Removal ProcessesStar formation is responsible for the build-up of metals (elements heavier than helium) in a galaxy. But when we use a galaxys star-formation history to estimate the amount of enriched material it should contain, our predictions are inconsistent with measured abundances: large galaxies contain only about 2025% of the expected metals, and small dwarf galaxies contain as little as 1%!So what happens to galaxies metals after they have been formed? The favored explanation is that metals are removed from galaxies via stellar feedback: stars that explode in violent supernovae can drive high-speed winds, expelling the enriched material from a galaxy. This process should be more efficient in low-mass galaxies due to their smaller gravitational wells, which would explain why low-mass galaxies have especially low metallicities.But external processes may also contribute to the removal of metals, such as tidal stripping during interactions between galaxies. To determine the role of stellar feedback alone, an ideal test would be to observe an isolated low-mass, star-forming galaxy i.e., one that is not affected by external processes.Luckily, such an isolated, low-mass galaxy has recently been discovered just outside of the Local Group: Leo P, a gas-rich dwarf galaxy with a total stellar mass of 5.6 x 105 solar masses.Isolated ResultsPercentage of oxygen lost in Leo P compared to the percentage of metals lost in three other, similar-size dwarfs that are not isolated. If the gas-phase oxygen in Leo P were removed, Leo Ps measurements would be consistent with those of the other dwarfs. [McQuinn et al. 2015]Led by Kristen McQuinn (University of Minnesota, University of Texas at Austin), a team of researchers has used Hubble observations to reconstruct Leo Ps star formation history. McQuinn and collaborators use this history to determine the dwarf galaxys total oxygen production used as a tracer of its metal production over its lifetime. They then compare this to the abundance of oxygen currently observed within Leo P.In non-isolated dwarf-spheroidal galaxies of similar mass to Leo P, 99% of their expected metals are missing. In comparison, the authors find that Leo P is missing 95% of its expected metals. From these results, it seems that expulsion of enriched material by stellar feedback alone can explain most of the missing metals in such galaxies; external factors only remove an additional few percent.This explanation is further supported by the fact that, of the oxygen remaining in Leo P, 25% is locked up in stars, whereas 75% is found to be in gas form in the galaxys interstellar medium. If this 75% were stripped away by external processes, Leo Ps measurements would become consistent with those of the non-isolated dwarf galaxies.CitationKristen B. W. McQuinn et al 2015 ApJ 815 L17. doi:10.1088/2041-8205/815/2/L17

Students Across Texas Celebrate Astronomy Day

NASA Astrophysics Data System (ADS)

Preston, S.; Wetzel, M.; Hemenway, M. K.

2010-08-01

Over the past three years, McDonald Observatory has offered special Astronomy Day videoconference programs to students across Texas—the second largest state in the U.S. (Only Alaska is larger). Videoconferencing allows many students and teachers access to our Observatory, which is remotely located 180 miles (290 kilometers) from any major city. McDonald Observatory partners with Connect2Texas to advertise the Astronomy Day event. Connect2Texas provides the electronic bridge between schools and the Observatory. They also provide an online evaluation for teachers to complete. In 2009 the Astronomy Day videoconference celebrated the International Year of Astronomy and the historic observations made by Galileo Galilei. During the videoconference, the classes explore the Moon or Venus by making real-time telescopic observations. Students also receive an introduction to the Observatory, an opportunity to perform an activity relating to Galileo's observations, and an interview with an astronomer. A website provides teachers pre-and post-video conference materials, instructions, and a certificate of completion that can be customized for each student. The website also lists content alignment with state science education standards.

Degradation of microcystin-RR using boron-doped diamond electrode.

PubMed

Zhang, Chunyong; Fu, Degang; Gu, Zhongze

2009-12-30

Microcystins (MCs), produced by blue-green algae, are one of the most common naturally occurring toxins found in natural environment. The presence of MCs in drinking water sources poses a great threat to people's health. In this study, the degradation behavior of microcystin-RR on boron-doped diamond (BDD) electrode was investigated under galvanostatic conditions. Such parameters as reaction time, supporting electrolyte and applied current density were varied in order to determine their effects on this oxidation process. The experimental results revealed the suitability of electrochemical processes employing BDD electrode for removing MC-RR from the solution. However, the efficient removal of MC-RR only occurred in the presence of sodium chloride that acted as redox mediators and the reaction was mainly affected by the chloride concentration (c(NaCl)) and applied current density (I(appl)). Full and quick removal of 0.50 microg/ml MC-RR in solution was achieved when the operating conditions of c(NaCl) and I(appl) were 20mM and 46.3 mA/cm(2), or 35 mM and 18.2 mA/cm(2) respectively. The kinetics for MC-RR degradation followed a pesudo-first order reaction in most cases, indicating the process was under mass transfer control. As a result of its excellent performance, the BDD technology could be considered as a promising alternative to promote the degradation of MC-RR than chlorination in drinking water supplies.

Flexibility is associated with motor competence in schoolchildren.

PubMed

Lopes, L; Póvoas, S; Mota, J; Okely, A D; Coelho-E-Silva, M J; Cliff, D P; Lopes, V P; Santos, R

2017-12-01

Available data on the associations between motor competence (MC) and flexibility are limited and result inconclusive. This study aims to examine the relationship between flexibility and MC in children. The sample comprised 596 Portuguese children (47.1% girls) aged 9.7 ± 0.6 years. Motor competence was evaluated with the body coordination test, Körperkoordination Test für Kinder. Cardiorespiratory fitness (20-m shuttle run), muscular strength (curl-up and push-up tests), and flexibility (back-saver sit and reach and trunk-lift tests) were evaluated using the Fitnessgram Test Battery. Z-scores by age and gender for the physical fitness tests were constructed. Analysis of variance and regression analysis were performed. Participants in the healthy zone groups of both flexibility tests exhibited significantly better scores of MC than the participants under the healthy zone (P < 0.001). Back-saver sit and reach and trunk-lift Z-scores, either individually or as a sum, were significant predictors of MC (P < 0.05 for all) after adjustments for the other physical fitness components, age, body mass index, and socioeconomic status, in both genders. Our findings highlight the importance of promoting and developing flexibility, as well as the other health-related physical fitness components in schoolchildren to reach adequate levels of MC. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

The effect of zoledronic acid on type and volume of Modic changes among patients with low back pain.

PubMed

Koivisto, Katri; Järvinen, Jyri; Karppinen, Jaro; Haapea, Marianne; Paananen, Markus; Kyllönen, Eero; Tervonen, Osmo; Niinimäki, Jaakko

2017-06-23

Modic changes (MC) are associated with low back pain (LBP). In this study, we compared changes in size and type of MC, after a single intravenous infusion of 5 mg zoledronic acid (ZA) or placebo, among chronic LBP patients with MC on magnetic resonance imaging (MRI), and evaluated whether the MRI changes correlate with symptoms. All patients (N = 19 in ZA, 20 in placebo) had MRI at baseline (0.23-1.5 T) and at one year (1.5-3 T). We evaluated the level, type and volume of all the MC. The MC were classified into M1 (M1 (100%)), predominating M1 (M1/2 (65:35%)) or predominating M2 (M1/2 (35:65%)), and M2 (M2 (100%)). The first two were considered M1-dominant, and the latter two M2-dominant. Volumes of M1 and M2 were calculated separately for the primary MC, which was assumed to cause the symptoms, and the other MC. We analysed the one-year treatment differences in M1 and M2 volumes using analysis of covariance with adjustments for age, sex, body mass index, and smoking. The correlations between the MRI changes and the changes in LBP symptoms were analysed using Pearson correlations. In the ZA group, 84.2% of patients had M1-dominant primary MC at baseline, compared to 50% in the placebo group (p = 0.041). The primary MC in the ZA group converted more likely to M2-dominant (42.1% ZA, 15% placebo; p = 0.0119). The other MC (15 ZA, 8 placebo) were on average 42% smaller and remained largely M2-dominant. The M1 volume of the primary MC decreased in the ZA group, but increased in the placebo group (-0.83 cm 3 vs 0.91 cm 3 ; p = 0.21). The adjusted treatment difference for M1 volume was -1.9 cm 3 (95% CI -5.0 to 1.2; p = 0.22) and for M2 volume 0.23 cm 3 (p = 0.86). In the MC that remained M1-dominant, volume change correlated positively with increased symptoms in the placebo group, whereas the correlations were negative and weak in the ZA group. Zoledronic acid tended to speed up the conversion of M1-dominant into M2-dominant MC and decrease the volume of M1-dominant MC, although statistical significance was not demonstrated. The registration number in ClinicalTrials.gov is NCT01330238 and the date of registration February 11, 2011.

Slotting optimization of automated storage and retrieval system (AS/RS) for efficient delivery of parts in an assembly shop using genetic algorithm: A case Study

NASA Astrophysics Data System (ADS)

Yue, L.; Guan, Z.; He, C.; Luo, D.; Saif, U.

2017-06-01

In recent years, the competitive pressure on manufacturing companies shifted them from mass production to mass customization to produce large variety of products. It is a great challenge for companies nowadays to produce customized mixed flow mode of production to meet customized demand on time. Due to large variety of products, the storage system to deliver variety of products to production lines influences on the timely production of variety of products, as investigated from by simulation study of an inefficient storage system of a real Company, in the current research. Therefore, current research proposed a slotting optimization model with mixed model sequence to assemble in consideration of the final flow lines to optimize whole automated storage and retrieval system (AS/RS) and distribution system in the case company. Current research is aimed to minimize vertical height of centre of gravity of AS/RS and total time spent for taking the materials out from the AS/RS simultaneously. Genetic algorithm is adopted to solve the proposed problem and computational result shows significant improvement in stability and efficiency of AS/RS as compared to the existing method used in the case company.

Magnetic porous β-cyclodextrin polymer for magnetic solid-phase extraction of microcystins from environmental water samples.

PubMed

Zhang, Wenmin; Lin, Mingxia; Wang, Meili; Tong, Ping; Lu, Qiaomei; Zhang, Lan

2017-06-23

Microcystins (MCs) are cyclic heptapeptide toxins and tumor promoters produced by cyanobacteria, which threaten the health of humans. In this study, magnetic porous β-cyclodextrin polymer (Fe 3 O 4 @SiO 2 @P-CDP) was synthesized and characterized by transmission electron microscopy, scanning electron microscopy, energy dispersive X-ray spectrometry, Fourier transform infrared spectrometry, X-ray diffraction, nitrogen adsorption porosimetry and vibrating sample magnetometer. The synthesized Fe 3 O 4 @SiO 2 @P-CDP particles were then used for magnetic solid-phase extraction (MSPE) of MCs from environmental water samples, and exhibited excellent extraction performance, especially for MC-RR. Coupled with high-performance liquid chromatography with tandem mass spectrometry (HPLC-MS/MS), a simple, efficient and sensitive method for determination of trace levels of MCs was established. After the optimization of conditions, wide linear ranges (2.0-1000pgmL -1 ), good linearity (r 2 ≥0.9996) and acceptable repeatability (RSD≤9.4%, n=5) were obtained. The limits of detection (LODs, S/N=3) and limits of quantification (LOQs, S/N=10) for three MCs (MC-LR, MC-RR and MC-YR) were in the range of 1.0-2.0pgmL -1 and 2.0-5.0pgmL -1 , respectively. Typical water samples were analyzed by the developed method, and trace levels of MC-LR and MC-RR were detected. The results demonstrate that the developed method has great potential for the determination of MCs in complicated matrix. Copyright © 2017 Elsevier B.V. All rights reserved.

Is Molecular Cloud Turbulence Driven by External Supernova Explosions?

NASA Astrophysics Data System (ADS)

Seifried, Daniel; Walch, Stefanie; Haid, Sebastian; Girichidis, Philipp; Naab, Thorsten

2018-03-01

We present high-resolution (∼0.1 pc), hydrodynamical and magnetohydrodynamical simulations to investigate whether the observed level of molecular cloud (MC) turbulence can be generated and maintained by external supernova (SN) explosions. The MCs are formed self-consistently within their large-scale galactic environment following the non-equilibrium formation of H2 and CO, including (self-) shielding and important heating and cooling processes. The MCs inherit their initial level of turbulence from the diffuse ISM, where turbulence is injected by SN explosions. However, by systematically exploring the effect of individual SNe going off outside the clouds, we show that at later stages the importance of SN-driven turbulence is decreased significantly. This holds for different MC masses as well as for MCs with and without magnetic fields. The SN impact also decreases rapidly with larger distances. Nearby SNe (d ∼ 25 pc) boost the turbulent velocity dispersions of the MC by up to 70% (up to a few km s‑1). For d > 50 pc, however, their impact decreases fast with increasing d and is almost negligible. For all probed distances the gain in velocity dispersion decays rapidly within a few 100 kyr. This is significantly shorter than the average timescale for an MC to be hit by a nearby SN under solar neighborhood conditions (∼2 Myr). Hence, at these conditions SNe are not able to sustain the observed level of MC turbulence. However, in environments with high gas surface densities and SN rates, like the Central Molecular Zone, observed elevated MC dispersions could be triggered by external SNe.

Influence of standing position on mechanical and energy costs in uphill cycling.

PubMed

Bouillod, Anthony; Pinot, Julien; Valade, Aurélien; Cassirame, Johan; Soto-Romero, Georges; Grappe, Frédéric

2018-04-27

This study was designed to examine the influence of standing position (vs. seated) during uphill cycling on both mechanical cost (MC) and energy cost (EC) in elite cyclists. For the study, thirteen elite cyclists (VO 2max : 71.4 ± 8.0 ml·min -1 ·kg -1 ) performed, in a randomised order, three sets of exercises. Each set comprised 2 min of exercise, alternating every 30 s between seated and standing postures, using different slopes and intensity levels on a motorised treadmill. MC was calculated from the measurement of power output and speed, whereas EC was calculated from the measurement of oxygen consumption and speed. MC was significantly higher (+4.3%, p < 0.001) in standing position compared to seated position when all slopes and intensities were considered. However, EC was not significantly affected by the change in position. The standing position also induced a significant increase in rolling resistance power (p < 0.001), rolling resistance coefficient (p < 0.001) and lateral sways (p < 0.001). The significant increase in MC observed in standing position was due to a higher rolling resistance induced by bicycle sways and a shift forward of the centre of mass compared to seated position. This result should lead bicycle tire manufacturers to reduce the increase in rolling resistance between the two positions. Considering the relationship observed between the MC and bicycle sways, cyclists would be well advised to decrease the bicycle sways in order to reduce the MC of locomotion. Copyright © 2018 Elsevier Ltd. All rights reserved.

Creating the living brand.

PubMed

Bendapudi, Neeli; Bendapudi, Venkat

2005-05-01

It's easy to conclude from the literature and the lore that top-notch customer service is the province of a few luxury companies and that any retailer outside that rarefied atmosphere is condemned to offer mediocre service at best. But even companies that position themselves for the mass market can provide outstanding customer-employee interactions and profit from them, if they train employees to reflect the brand's core values. The authors studied the convenience store industry in depth and focused on two that have developed a devoted following: QuikTrip (QT) and Wawa. Turnover rates at QT and Wawa are 14% and 22% respectively, much lower than the typical rate in retail. The authors found six principles that both firms embrace to create a strong culture of customer service. Know what you're looking for: A focus on candidates' intrinsic traits allows the companies to hire people who will naturally bring the right qualities to the job. Make the most of talent: In mass-market retail, talent is generally viewed as a commodity, but that outlook becomes a self-fulfilling prophesy. Create pride in the brand: Service quality depends directly on employees' attachment to the brand. Build community: Wawa and QT have made concerted efforts to build customer loyalty through a sense of community. Share the business context: Employees need a clear understanding of how their company operates and how it defines success. Satisfy the soul: To win an employee's passionate engagement, a company must meet his or her needs for security, esteem, and justice.

Detection of RNA nucleoside modifications with the uridine-specific ribonuclease MC1 from Momordica charantia

PubMed Central

Addepalli, Balasubrahmanym; Lesner, Nicholas P.; Limbach, Patrick A.

2015-01-01

A codon-optimized recombinant ribonuclease, MC1 is characterized for its uridine-specific cleavage ability to map nucleoside modifications in RNA. The published MC1 amino acid sequence, as noted in a previous study, was used as a template to construct a synthetic gene with a natural codon bias favoring expression in Escherichia coli. Following optimization of various expression conditions, the active recombinant ribonuclease was successfully purified as a C-terminal His-tag fusion protein from E. coli [Rosetta 2(DE3)] cells. The isolated protein was tested for its ribonuclease activity against oligoribonucleotides and commercially available E. coli tRNATyr I. Analysis of MC1 digestion products by ion-pairing reverse phase liquid-chromatography coupled with mass spectrometry (IP-RP-LC-MS) revealed enzymatic cleavage of RNA at the 5′-termini of uridine and pseudouridine, but cleavage was absent if the uridine was chemically modified or preceded by a nucleoside with a bulky modification. Furthermore, the utility of this enzyme to generate complementary digestion products to other common endonucleases, such as RNase T1, which enables the unambiguous mapping of modified residues in RNA is demonstrated. PMID:26221047

Simulating Mercury And Methyl Mercury Stream Concentrations At Multiple Scales in a Wetland Influenced Coastal Plain Watershed (McTier Creek, SC, USA)

EPA Science Inventory

Use of Mechanistic Models to?Improve Understanding: Differential, mass balance, process-based Spatial and temporal resolution Necessary simplifications of system complexity Combing field monitoring and modeling efforts Balance between capturing complexity and maintaining...

In-situ Strontium Isotopes Analysis on Single Conodont Apatite by LA-MC-ICP-MS

NASA Astrophysics Data System (ADS)

Zhao, L.; Zhang, L.; Chen, Z. Q.; Ma, D.; Qiu, H.; Lv, Z.; Hu, Z.; Wang, F.

2014-12-01

Strontium isotope played an important role in stratigraphic chronology and sedimentary geochemistry research (McArthur et al., 2001). Conodonts is a kind of extinct species of marine animals and widely distributed in marine sediments all over the world. Rich in radiogenic Sr contents and difficulty to be affected during diagenesis alteration makes conodonts a good choice in seawater Sr isotope composition studies (John et al., 2008). Conodont samples were collected from 24th to 39th layer across Permian-Triassic boundary at Meishan D section (GSSP), Zhejiang Province, South China (Yin et al., 2001). Conodonts was originated from fresh limestone and only conodont elements with CAI<2 were chosen for in-situ strontium isotope analysis using laser-ablation multi-collector inductively coupled plasma mass spectrometry (LA-MC-ICP-MS). Conodont samples are from totally 25 layers in seven conodont zones making it possible for a high resolution 87Sr/ 86Sr curve reconstruction during the Permian-Triassic transition. 87Sr/ 86Sr ratio kept a relatively high value (0.70752) in the middle part of the Clarkina yini zone and a lower value (0.70634) in the upperpart of Clarkina taylorae zone. Of which, 87Sr/ 86Sr ratio emerged a rapid decrease within the Clarkina taylorae zone. After a subsequent increase, 87Sr/ 86Sr ratio dropped to 0.70777 in the Isarcicella staeschei zone. These results helps providing reference data for the biological mass extinction events during the Permian-Triassic transition. Our study also makes is possible for high resolution 87Sr/ 86Sr ratio testing on the single conodont apatite and riched the in-situ studies on the conodont apatite, which of great significance for the future conodont Sr isotope research (Zhao et al., 2009; Zhao et al., 2013). Keywords: Conodonts, Strontium isotope, LA-MC-ICP-MS, Permian-Triassic transition, Meishan D section [1] John et al., 2008 3P[2] McArthur et al., 2001 J. of Geology [3] Yin et al., 2001 Episodes [4] Zhao et al., 2009 Earth Science J. of CUG [5] Zhao et al., 2013 GPC.

Analysis of intracellular and extracellular microcystin variants in sediments and pore waters by accelerated solvent extraction and high performance liquid chromatography-tandem mass spectrometry.

PubMed

Zastepa, Arthur; Pick, Frances R; Blais, Jules M; Saleem, Ammar

2015-05-04

The fate and persistence of microcystin cyanotoxins in aquatic ecosystems remains poorly understood in part due to the lack of analytical methods for microcystins in sediments. Existing methods have been limited to the extraction of a few extracellular microcystins of similar chemistry. We developed a single analytical method, consisting of accelerated solvent extraction, hydrophilic-lipophilic balance solid phase extraction, and reversed phase high performance liquid chromatography-tandem mass spectrometry, suitable for the extraction and quantitation of both intracellular and extracellular cyanotoxins in sediments as well as pore waters. Recoveries of nine microcystins, representing the chemical diversity of microcystins, and nodularin (a marine analogue) ranged between 75 and 98% with one, microcystin-RR (MC-RR), at 50%. Chromatographic separation of these analytes was achieved within 7.5 min and the method detection limits were between 1.1 and 2.5 ng g(-1) dry weight (dw). The robustness of the method was demonstrated on sediment cores collected from seven Canadian lakes of diverse geography and trophic states. Individual microcystin variants reached a maximum concentration of 829 ng g(-1) dw on sediment particles and 132 ng mL(-1) in pore waters and could be detected in sediments as deep as 41 cm (>100 years in age). MC-LR, -RR, and -LA were more often detected while MC-YR, -LY, -LF, and -LW were less common. The analytical method enabled us to estimate sediment-pore water distribution coefficients (K(d)), MC-RR had the highest affinity for sediment particles (log K(d)=1.3) while MC-LA had the lowest affinity (log K(d)=-0.4), partitioning mainly into pore waters. Our findings confirm that sediments serve as a reservoir for microcystins but suggest that some variants may diffuse into overlying water thereby constituting a new route of exposure following the dissipation of toxic blooms. The method is well suited to determine the fate and persistence of different microcystins in aquatic systems. Copyright © 2015 Elsevier B.V. All rights reserved.

Mass Spectrometry in the Home and Garden

NASA Astrophysics Data System (ADS)

Pulliam, Christopher J.; Bain, Ryan M.; Wiley, Joshua S.; Ouyang, Zheng; Cooks, R. Graham

2015-02-01

Identification of active components in a variety of chemical products used directly by consumers is described at both trace and bulk levels using mass spectrometry. The combination of external ambient ionization with a portable mass spectrometer capable of tandem mass spectrometry provides high chemical specificity and sensitivity as well as allowing on-site monitoring. These experiments were done using a custom-built portable ion trap mass spectrometer in combination with the ambient ionization methods of paper spray, leaf spray, and low temperature plasma ionization. Bactericides, garden chemicals, air fresheners, and other products were examined. Herbicide applied to suburban lawns was detected in situ on single leaves 5 d after application.

Quadrupole Ion Mass Spectrometer for Masses of 2 to 50 Da

NASA Technical Reports Server (NTRS)

Helms, William; Griffin, Timothy P.; Ottens, Andrew; Harrison, Willard

2005-01-01

A customized quadrupole ion-trap mass spectrometer (QITMS) has been built to satisfy a need for a compact, rugged instrument for measuring small concentrations of hydrogen, helium, oxygen, and argon in a nitrogen atmosphere. This QITMS can also be used to perform quantitative analyses of other gases within its molecular-mass range, which is 2 to 50 daltons (Da). (More precisely, it can be used to perform quantitative analysis of gases that, when ionized, are characterized by m/Z ratios between 2 and 50, where m is the mass of an ion in daltons and Z is the number of fundamental electric charges on the ion.

The ultraviolet view of the Magellanic Clouds from GALEX: A first look at the LMC source catalog

NASA Astrophysics Data System (ADS)

Simons, Raymond; Thilker, David; Bianchi, Luciana; Wyder, Ted

2014-03-01

The Galaxy Evolution Exporer (GALEX) has performed unprecedented imaging surveys of the Magellanic Clouds (MC) and their surrounding areas including the Magellanic Bridge (MB) in near-UV (NUV, 1771-2831 Å) and far-UV (FUV, 1344-1786 Å) bands at 5″ resolution. Substantially more area was covered in the NUV than FUV, particularly in the bright central regions, because of the GALEX FUV detector failure. The 5σ depth of the NUV imaging varies between 20.8 and 22.7 (ABmag). Such imaging provides the first sensitive view of the entire content of hot stars in the Magellanic System, revealing the presence of young populations even in sites with extremely low star-formation rate surface density like the MB, owing to high sensitivity of the UV data to hot stars and the dark sky at these wavelengths. The density of UV sources is quite high in many areas of the LMC and SMC. Crowding limits the quality of source detection and photometry from the standard mission pipeline processing. We performed custom-photometry of the GALEX data in the MC survey region (<15° from the LMC, <10° from the SMC). After merging multiple detections of sources in overlapping images, the resulting catalog we have produced for the LMC contains nearly six million unique NUV point sources within 15° and is briefly presented herein. This paper provides a first look at the GALEX MC survey and highlights some of the science investigations that the entire catalog and imaging dataset will make possible.

Development of the Accelerator Mass Spectrometry technology at the Comenius University in Bratislava

NASA Astrophysics Data System (ADS)

Povinec, Pavel P.; Masarik, Jozef; Ješkovský, Miroslav; Kaizer, Jakub; Šivo, Alexander; Breier, Robert; Pánik, Ján; Staníček, Jaroslav; Richtáriková, Marta; Zahoran, Miroslav; Zeman, Jakub

2015-10-01

An Accelerator Mass Spectrometry (AMS) laboratory has been established at the Centre for Nuclear and Accelerator Technologies (CENTA) at the Comenius University in Bratislava comprising of a MC-SNICS ion source, 3 MV Pelletron tandem accelerator, and an analyzer of accelerated ions. The preparation of targets for 14C and 129I AMS measurements is described in detail. The development of AMS techniques for potassium, uranium and thorium analysis in radiopure materials required for ultra-low background underground experiments is briefly mentioned.

How Different kinds of Communication and the Mass Media Affect Tourism.

DTIC Science & Technology

1984-12-01

C. Criticism of the Two-Step Flow Model------------------------------ 38 3. The Multi-Step Flow Model or Theory------- 39 4. One-Step Flow Model or... Criticism of the Two-Step Flow Model Researchers have identified deficiencies in the r,,c-w:er :low-model. McNelly, for instance, se,7s mass...evidence of the relative importance of cc munication on the diffusion flow. 38 Rogers ’as criticized ] the theor-y on the grounds that: neither its

Evaluation of the Mg doping approach for Si mass fractionation correction on Nu Instruments MC-ICP Mass Spectrometers

NASA Astrophysics Data System (ADS)

Zhao, Ye; Hsieh, Yu-Te; Belshaw, Nick

2015-04-01

Silicon (Si) stable isotopes have been used in a broad range of geochemical and cosmochemical applications. A precise and accurate determination of Si isotopes is desirable to distinguish their small natural variations (< 0.2‰) in many of these studies. In the past decade, the advent of the MC-ICP-MS has spurred a remarkable improvement in the precision and accuracy of Si isotopic analysis. The instrumental mass fractionation correction is one crucial aspect of the analysis of Si isotopes. Two options are currently available: the sample-standard bracketing approach and the Mg doping approach. However, there has been a debate over the validity of the Mg doping approach. Some studies (Cardinal et al., 2003; Engström et al., 2006) favoured it compared to the sample-standard bracketing approach, whereas some other studies (e.g. De La Rocha, 2002) considered it unsuitable. This study investigates the Mg doping approach on both the Nu Plasma II and the Nu Plasma 1700. Experiments were performed in both the wet plasma and the dry plasma modes, using a number of different combinations of cones. A range of different Mg to Si ratios as well as different matrices have been used in the experiments. A sample-standard bracketing approach has also been adopted for the Si mass fractionation correction to compare with the Mg doping approach. Through assessing the mass fractionation behaviours of both Si and Mg under different instrument settings, this study aims to identity the factors which may affect the Mg doping approach and answer some key questions to the debate.

Mass Media and the School: Descartes or McLuhan?

ERIC Educational Resources Information Center

Schaeffer, Pierre

1980-01-01

Compares the world of learning with the world of the media, with emphasis on the areas of common interest. Discusses areas of potential cooperation, including local audiovisual centers, adaptation of new media to educational content, computer technology, telematics, and accumulation of audiovisual stock on topics pertinent to education. (DB)

Multi-Objective Hybrid Optimal Control for Multiple-Flyby Interplanetary Mission Design Using Chemical Propulsion

NASA Technical Reports Server (NTRS)

Englander, Jacob; Vavrina, Matthew

2015-01-01

The customer (scientist or project manager) most often does not want just one point solution to the mission design problem Instead, an exploration of a multi-objective trade space is required. For a typical main-belt asteroid mission the customer might wish to see the trade-space of: Launch date vs. Flight time vs. Deliverable mass, while varying the destination asteroid, planetary flybys, launch year, etcetera. To address this question we use a multi-objective discrete outer-loop which defines many single objective real-valued inner-loop problems.

Assessing the accuracy of body mass estimation equations from pelvic and femoral variables among modern British women of known mass.

PubMed

Young, Mariel; Johannesdottir, Fjola; Poole, Ken; Shaw, Colin; Stock, J T

2018-02-01

Femoral head diameter is commonly used to estimate body mass from the skeleton. The three most frequently employed methods, designed by Ruff, Grine, and McHenry, were developed using different populations to address different research questions. They were not specifically designed for application to female remains, and their accuracy for this purpose has rarely been assessed or compared in living populations. This study analyzes the accuracy of these methods using a sample of modern British women through the use of pelvic CT scans (n = 97) and corresponding information about the individuals' known height and weight. Results showed that all methods provided reasonably accurate body mass estimates (average percent prediction errors under 20%) for the normal weight and overweight subsamples, but were inaccurate for the obese and underweight subsamples (average percent prediction errors over 20%). When women of all body mass categories were combined, the methods provided reasonable estimates (average percent prediction errors between 16 and 18%). The results demonstrate that different methods provide more accurate results within specific body mass index (BMI) ranges. The McHenry Equation provided the most accurate estimation for women of small body size, while the original Ruff Equation is most likely to be accurate if the individual was obese or severely obese. The refined Ruff Equation was the most accurate predictor of body mass on average for the entire sample, indicating that it should be utilized when there is no knowledge of the individual's body size or if the individual is assumed to be of a normal body size. The study also revealed a correlation between pubis length and body mass, and an equation for body mass estimation using pubis length was accurate in a dummy sample, suggesting that pubis length can also be used to acquire reliable body mass estimates. This has implications for how we interpret body mass in fossil hominins and has particular relevance to the interpretation of the long pubic ramus that is characteristic of Neandertals. Copyright © 2017 Elsevier Ltd. All rights reserved.

Toward Customized Care

PubMed Central

Minvielle, Etienne

2018-01-01

Patients want their personal needs to be taken into account. Accordingly, the management of care has long involved some degree of personalization. In recent times, patients’ wishes have become more pressing in a moving context. As the population ages, the number of patients requiring sophisticated combinations of longterm care is rising. Moreover, we are witnessing previously unvoiced demands, preferences and expectations (eg, demand for information about treatment, for care complying with religious practices, or for choice of appointment dates). In view of the escalating costs and the concerns about quality of care, the time has now come to rethink healthcare delivery. Part of this reorganization can be related to customization: what is needed is a customized business model that is effective and sustainable. Such business model exists in different service sectors, the customization being defined as the development of tailored services to meet consumers’ diverse and changing needs at near mass production prices. Therefore, its application to the healthcare sector needs to be seriously considered. PMID:29524957

Customer Characteristics and Shopping Patterns Associated with Healthy and Unhealthy Purchases at Small and Non-traditional Food Stores.

PubMed

Lenk, Kathleen M; Caspi, Caitlin E; Harnack, Lisa; Laska, Melissa N

2018-02-01

Small and non-traditional food stores (e.g., corner stores) are often the most accessible source of food for residents of lower income urban neighborhoods in the U.S. Although healthy options are often limited at these stores, little is known about customers who purchase healthy, versus less healthy, foods/beverages in these venues. We conducted 661 customer intercept interviews at 105 stores (corner stores, gas marts, pharmacies, dollar stores) in Minneapolis/St. Paul, Minnesota, assessing all food and beverage items purchased. We defined three categories of "healthy" and four categories of "unhealthy" purchases. Interviews assessed customer characteristics [e.g., demographics, body-mass index (BMI)]. We examined associations between healthy versus unhealthy purchases categories and customer characteristics. Overall, 11% of customers purchased ≥1 serving of healthy foods/beverages in one or more of the three categories: 8% purchased fruits/vegetables, 2% whole grains, and 1% non-/low-fat dairy. Seventy-one percent of customers purchased ≥1 serving of unhealthy foods/beverages in one or more of four categories: 46% purchased sugar-sweetened beverages, 17% savory snacks, 15% candy, and 13% sweet baked goods. Male (vs. female) customers, those with a lower education levels, and those who reported shopping at the store for convenience (vs. other reasons) were less likely to purchase fruits/vegetables. Unhealthy purchases were more common among customers with a BMI ≥30 kg/m 2 (vs. lower BMI). Results suggest intervention opportunities to increase healthy purchases at small and non-traditional food stores, particularly interventions aimed at male residents, those with lower education levels and residents living close to the store.

An X-ray outburst from the rapidly accreting young star that illuminates McNeil's nebula.

PubMed

Kastner, J H; Richmond, M; Grosso, N; Weintraub, D A; Simon, T; Frank, A; Hamaguchi, K; Ozawa, H; Henden, A

2004-07-22

Young, low-mass stars are luminous X-ray sources whose powerful X-ray flares may exert a profound influence over the process of planet formation. The origin of the X-ray emission is uncertain. Although many (or perhaps most) recently formed, low-mass stars emit X-rays as a consequence of solar-like coronal activity, it has also been suggested that X-ray emission may be a direct result of mass accretion onto the forming star. Here we report X-ray imaging spectroscopy observations which reveal a factor approximately 50 increase in the X-ray flux from a young star that is at present undergoing a spectacular optical/infrared outburst (this star illuminates McNeil's nebula). The outburst seems to be due to the sudden onset of a phase of rapid accretion. The coincidence of a surge in X-ray brightness with the optical/infrared eruption demonstrates that strongly enhanced high-energy emission from young stars can occur as a consequence of high accretion rates. We suggest that such accretion-enhanced X-ray emission from erupting young stars may be short-lived, because intense star-disk magnetospheric interactions are quenched rapidly by the subsequent flood of new material onto the star.

Usage of pumice as bulking agent in sewage sludge composting.

PubMed

Wu, Chuandong; Li, Weiguang; Wang, Ke; Li, Yunbei

2015-08-01

In this study, the impacts of reused and sucrose-decorated pumice as bulking agents on the composting of sewage sludge were evaluated in the lab-scale reactor. The variations of temperature, pH, NH3 and CO2 emission rate, moisture content (MC), volatile solid, dissolved organic carbon, C/N and the water absorption characteristics of pumice were detected during the 25days composting. The MC of pumice achieved 65.23% of the 24h water absorptivity within the first 2h at the mass ratio of 0.6:1 (pumice:sewage sludge). Reused pumice increased 23.68% of CO2 production and reduced 21.25% of NH3 emission. The sucrose-decorated pumice reduced 43.37% of nitrogen loss. These results suggested that adding pumice and sucrose-decorated pumice in sludge composting matrix could not only adjust the MC of materials, but also improve the degradation of organic matters and reduce nitrogen loss. Copyright © 2015 Elsevier Ltd. All rights reserved.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Rajaguru, S. P.; Antia, H. M., E-mail: rajaguru@iiap.res.in

We present and discuss results from time–distance helioseismic measurements of meridional circulation (MC) in the solar convection zone using 4 yr of Doppler velocity observations by the Helioseismic and Magnetic Imager on board the Solar Dynamics Observatory. Using a built-in mass conservation constraint in terms of the stream function, we invert helioseismic travel times to infer the MC in the solar convection zone. We find that the return flow that closes the MC is possibly beneath the depth of 0.77 R{sub ⊙}. We discuss the significance of this result in relation to other helioseismic inferences published recently and possible reasons for the differences inmore » the results. Our results show clearly the pitfalls involved in the measurements of material flows in the deep solar interior given the current limits on the signal-to-noise ratio and our limited understanding of systematics in the data. We also discuss the implications of our results for the dynamics of solar interior and popular solar dynamo models.« less

The performance of single and multi-collector ICP-MS instruments for fast and reliable 34S/32S isotope ratio measurements†

PubMed Central

Pröfrock, Daniel; Irrgeher, Johanna; Prohaska, Thomas

2016-01-01

The performance and validation characteristics of different single collector inductively coupled plasma mass spectrometers based on different technical principles (ICP-SFMS, ICP-QMS in reaction and collision modes, and ICP-MS/MS) were evaluated in comparison to the performance of MC ICP-MS for fast and reliable S isotope ratio measurements. The validation included the determination of LOD, BEC, measurement repeatability, within-lab reproducibility and deviation from certified values as well as a study on instrumental isotopic fractionation (IIF) and the calculation of the combined standard measurement uncertainty. Different approaches of correction for IIF applying external intra-elemental IIF correction (aka standard-sample bracketing) using certified S reference materials and internal inter-elemental IIF (aka internal standardization) correction using Si isotope ratios in MC ICP-MS are explained and compared. The resulting combined standard uncertainties of examined ICP-QMS systems were not better than 0.3–0.5% (uc,rel), which is in general insufficient to differentiate natural S isotope variations. Although the performance of the single collector ICP-SFMS is better (single measurement uc,rel = 0.08%), the measurement reproducibility (>0.2%) is the major limit of this system and leaves room for improvement. MC ICP-MS operated in the edge mass resolution mode, applying bracketing for correction of IIF, provided isotope ratio values with the highest quality (relative combined measurement uncertainty: 0.02%; deviation from the certified value: <0.002%). PMID:27812369

The performance of single and multi-collector ICP-MS instruments for fast and reliable 34S/32S isotope ratio measurements.

PubMed

Hanousek, Ondrej; Brunner, Marion; Pröfrock, Daniel; Irrgeher, Johanna; Prohaska, Thomas

2016-11-14

The performance and validation characteristics of different single collector inductively coupled plasma mass spectrometers based on different technical principles (ICP-SFMS, ICP-QMS in reaction and collision modes, and ICP-MS/MS) were evaluated in comparison to the performance of MC ICP-MS for fast and reliable S isotope ratio measurements. The validation included the determination of LOD, BEC, measurement repeatability, within-lab reproducibility and deviation from certified values as well as a study on instrumental isotopic fractionation (IIF) and the calculation of the combined standard measurement uncertainty. Different approaches of correction for IIF applying external intra-elemental IIF correction (aka standard-sample bracketing) using certified S reference materials and internal inter-elemental IIF (aka internal standardization) correction using Si isotope ratios in MC ICP-MS are explained and compared. The resulting combined standard uncertainties of examined ICP-QMS systems were not better than 0.3-0.5% ( u c,rel ), which is in general insufficient to differentiate natural S isotope variations. Although the performance of the single collector ICP-SFMS is better (single measurement u c,rel = 0.08%), the measurement reproducibility (>0.2%) is the major limit of this system and leaves room for improvement. MC ICP-MS operated in the edge mass resolution mode, applying bracketing for correction of IIF, provided isotope ratio values with the highest quality (relative combined measurement uncertainty: 0.02%; deviation from the certified value: <0.002%).

Potassium Stable Isotopic Compositions Measured by High-Resolution MC-ICP-MS

NASA Technical Reports Server (NTRS)

Morgan, Leah E.; Lloyd, Nicholas S.; Ellam, Robert M.; Simon, Justin I.

2012-01-01

Potassium isotopic (K-41/K-39) compositions are notoriously difficult to measure. TIMS measurements are hindered by variable fractionation patterns throughout individual runs and too few isotopes to apply an internal spike method for instrumental mass fractionation corrections. Internal fractionation corrections via the K-40/K-39 ratio can provide precise values but assume identical K-40/K-39 ratios (e.g. 0.05% (1sigma) in [1]); this is appropriate in some cases (e.g. identifying excess K-41) but not others (e.g., determining mass fractionation effects and metrologically traceable isotopic abundances). SIMS analyses have yielded measurements with 0.25% precisions (1sigma) [2]. ICP-MS analyses are significantly affected by interferences from molecular species such as Ar-38H(+) and Ar-40H(+) and instrument mass bias. Single collector ICP-MS instruments in "cold plasma" mode have yielded uncertainties as low as 2% (1sigma, e.g. [3]). Although these precisions may be acceptable for some concentration determinations, they do not resolve isotopic variation in terrestrial materials. Here we present data from a series of measurements made on the Thermo Scientific NEPTUNE Plus multi-collector ICP-MS that demonstrate the ability to make K-41/K-39 ratio measurements with 0.07% precisions (1sigma). These data, collected on NIST K standards, indicate the potential for MC-ICP-MS measurements to look for K isotopic variations at the sub-permil level. The NEPTUNE Plus can sufficiently resolve 39K and 41K from the interfering 38ArH+ and 40ArH+ peaks in wet cold plasma and high-resolution mode. Measurements were made on small but flat, interference-free, plateaus (ca. 50 ppm by mass width for K-41). Although ICP-MS does not yield accurate K-41/K-39 values due to significant instrumental mass fractionation (ca. 6%), this bias can be sufficiently stable over the time required for several measurements so that relative K-41/K-39 values can be precisely determined via sample-standard bracketing. As cold plasma conditions can amplify matrix effects, experiments were conducted to test the matrix tolerance of measurements; the use of clean, matrix-matched samples and standards is critical. Limitations of the cold-plasma high-resolution MC-ICP-MS methodology with respect to matrix tolerance are discussed and compared with the limitations of TIMS methodologies.

Design and Performance of McRas in SCMs and GEOS I/II GCMs

NASA Technical Reports Server (NTRS)

Sud, Yogesh C.; Einaudi, Franco (Technical Monitor)

2000-01-01

The design of a prognostic cloud scheme named McRAS (Microphysics of clouds with Relaxed Arakawa-Schubert Scheme) for general circulation models (GCMs) will be discussed. McRAS distinguishes three types of clouds: (1) convective, (2) stratiform, and (3) boundary-layer types. The convective clouds transform and merge into stratiform clouds on an hourly time-scale, while the boundary-layer clouds merge into the stratiform clouds instantly. The cloud condensate converts into precipitation following the auto-conversion equations of Sundqvist that contain a parametric adaptation for the Bergeron-Findeisen process of ice crystal growth and collection of cloud condensate by precipitation. All clouds convect, advect, as well as diffuse both horizontally and vertically with a fully interactive cloud-microphysics throughout the life-cycle of the cloud, while the optical properties of clouds are derived from the statistical distribution of hydrometeors and idealized cloud geometry. An evaluation of McRAS in a single column model (SCM) with the GATE Phase III and 5-ARN CART datasets has shown that together with the rest of the model physics, McRAS can simulate the observed temperature, humidity, and precipitation without many systematic errors. The time history and time mean incloud water and ice distribution, fractional cloudiness, cloud optical thickness, origin of precipitation in the convective anvil and towers, and the convective updraft and downdraft velocities and mass fluxes all show a realistic behavior. Performance of McRAS in GEOS 11 GCM shows several satisfactory features but some of the remaining deficiencies suggest need for additional research involving convective triggers and inhibitors, provision for continuously detraining updraft, a realistic scheme for cumulus gravity wave drag, and refinements to physical conditions for ascertaining cloud detrainment level.

Submarine geology and geomorphology of active Sub-Antarctic volcanoes: Heard and McDonald Islands

NASA Astrophysics Data System (ADS)

Watson, S. J.; Coffin, M. F.; Whittaker, J. M.; Lucieer, V.; Fox, J. M.; Carey, R.; Arculus, R. J.; Bowie, A. R.; Chase, Z.; Robertson, R.; Martin, T.; Cooke, F.

2016-12-01

Heard and McDonald Islands (HIMI) are World Heritage listed sub-Antarctic active volcanic islands in the Southern Indian Ocean. Built atop the Kerguelen Plateau by Neogene-Quaternary volcanism, HIMI represent subaerial exposures of the second largest submarine Large Igneous Province globally. Onshore, processes influencing island evolution include glaciers, weathering, volcanism, vertical tectonics and mass-wasting (Duncan et al. 2016). Waters surrounding HIMI are largely uncharted, due to their remote location. Hence, the extent to which these same processes shape the submarine environment around HIMI has not been investigated. In early 2016, we conducted marine geophysical and geologic surveys around HIMI aboard RV Investigator (IN2016_V01). Results show that volcanic and sedimentary features prominently trend east-west, likely a result of erosion by the eastward flowing Antarctic Circumpolar Current and tidal currents. However, spatial patterns of submarine volcanism and sediment distribution differ substantially between the islands. >70 sea knolls surround McDonald Island suggesting substantial submarine volcanism. Geophysical data reveals hard volcanic seafloor around McDonald Island, whereas Heard Island is characterised by sedimentary sequences tens of meters or more thick and iceberg scours - indicative of glacial processes. Differences in submarine geomorphology are likely due to the active glaciation of Heard Island and differing rock types (Heard: alkali basalt, McDonald: phonolite), and dominant products (clastics vs. lava). Variations may also reflect different magmatic plumbing systems beneath the two active volcanoes (Heard produces larger volumes of more focused lava, whilst McDonald extrudes smaller volumes of more evolved lavas from multiple vents across the edifice). Using geophysical data, corroborated with new and existing geologic data, we present the first geomorphic map revealing the processes that shape the submarine environment around HIMI.

Identification and functional characterization of three novel human melanocortin-4 receptor gene variants in an obese Chinese population.

PubMed

Rong, Rong; Tao, Ya-Xiong; Cheung, Bernard M Y; Xu, Aimin; Cheung, Grace C N; Lam, Karen S L

2006-08-01

Mutations in the melanocortin-4 receptor gene (MC4R) are the most common monogenic form of human obesity. However, the contribution of MC4R mutations to obesity in Chinese has not been investigated. We studied the frequency of MC4R mutations in an obese southern Chinese population and the functional consequences of the novel variants identified. We screened for MC4R mutations in 227 obese [body mass index (BMI) 35.29 +/- 5.75 kg/m2] and 100 lean (BMI 21.57 +/- 0.29 kg/m2) southern Chinese subjects using PCR-direct sequencing. In vitro functional studies, including cell surface expression, ligand binding, and cyclic adenosine monophosphate (cAMP) accumulation, were performed to examine the functional properties of three novel missense mutations. Apart from two previously reported polymorphisms, V103I and -176 A > C, three novel missense heterozygous variants (Y35C, C40R and M218T) were identified. The polymorphisms -176 A > C and Y35C were detected in both obese and normal subjects with similar frequency. C40R was identified only in an obese subject. Pedigree analysis revealed M218T carriers in both lean and obese subjects. The prevalence of V103I carriers in normal-weight controls was significantly higher than that in obese subjects (5.3%vs. 1.3%, P < 0.05). In vitro functional studies showed that all three novel missense variants have normal functions. Two known polymorphisms and three novel variants of the MC4R were identified. No overt functional defects were observed for the three novel MC4R variants, suggesting that they might not be the cause of obesity in variant carriers.

Tensor form factor for the D → π(K) transitions with Twisted Mass fermions.

NASA Astrophysics Data System (ADS)

Lubicz, Vittorio; Riggio, Lorenzo; Salerno, Giorgio; Simula, Silvano; Tarantino, Cecilia

2018-03-01

We present a preliminary lattice calculation of the D → π and D → K tensor form factors fT (q2) as a function of the squared 4-momentum transfer q2. ETMC recently computed the vector and scalar form factors f+(q2) and f0(q2) describing D → π(K)lv semileptonic decays analyzing the vector current and the scalar density. The study of the weak tensor current, which is directly related to the tensor form factor, completes the set of hadronic matrix element regulating the transition between these two pseudoscalar mesons within and beyond the Standard Model where a non-zero tensor coupling is possible. Our analysis is based on the gauge configurations produced by the European Twisted Mass Collaboration with Nf = 2 + 1 + 1 flavors of dynamical quarks. We simulated at three different values of the lattice spacing and with pion masses as small as 210 MeV and with the valence heavy quark in the mass range from ≃ 0.7 mc to ≃ 1.2mc. The matrix element of the tensor current are determined for a plethora of kinematical conditions in which parent and child mesons are either moving or at rest. As for the vector and scalar form factors, Lorentz symmetry breaking due to hypercubic effects is clearly observed in the data. We will present preliminary results on the removal of such hypercubic lattice effects.

Baking a mass-spectrometry data PIE with McMC and simulated annealing: predicting protein post-translational modifications from integrated top-down and bottom-up data.

PubMed

Jefferys, Stuart R; Giddings, Morgan C

2011-03-15

Post-translational modifications are vital to the function of proteins, but are hard to study, especially since several modified isoforms of a protein may be present simultaneously. Mass spectrometers are a great tool for investigating modified proteins, but the data they provide is often incomplete, ambiguous and difficult to interpret. Combining data from multiple experimental techniques-especially bottom-up and top-down mass spectrometry-provides complementary information. When integrated with background knowledge this allows a human expert to interpret what modifications are present and where on a protein they are located. However, the process is arduous and for high-throughput applications needs to be automated. This article explores a data integration methodology based on Markov chain Monte Carlo and simulated annealing. Our software, the Protein Inference Engine (the PIE) applies these algorithms using a modular approach, allowing multiple types of data to be considered simultaneously and for new data types to be added as needed. Even for complicated data representing multiple modifications and several isoforms, the PIE generates accurate modification predictions, including location. When applied to experimental data collected on the L7/L12 ribosomal protein the PIE was able to make predictions consistent with manual interpretation for several different L7/L12 isoforms using a combination of bottom-up data with experimentally identified intact masses. Software, demo projects and source can be downloaded from http://pie.giddingslab.org/

An Order Insertion Scheduling Model of Logistics Service Supply Chain Considering Capacity and Time Factors

PubMed Central

Yang, Yi; Wang, Shuqing; Liu, Yang

2014-01-01

Order insertion often occurs in the scheduling process of logistics service supply chain (LSSC), which disturbs normal time scheduling especially in the environment of mass customization logistics service. This study analyses order similarity coefficient and order insertion operation process and then establishes an order insertion scheduling model of LSSC with service capacity and time factors considered. This model aims to minimize the average unit volume operation cost of logistics service integrator and maximize the average satisfaction degree of functional logistics service providers. In order to verify the viability and effectiveness of our model, a specific example is numerically analyzed. Some interesting conclusions are obtained. First, along with the increase of completion time delay coefficient permitted by customers, the possible inserting order volume first increases and then trends to be stable. Second, supply chain performance reaches the best when the volume of inserting order is equal to the surplus volume of the normal operation capacity in mass service process. Third, the larger the normal operation capacity in mass service process is, the bigger the possible inserting order's volume will be. Moreover, compared to increasing the completion time delay coefficient, improving the normal operation capacity of mass service process is more useful. PMID:25276851

Intrapair differences in personality and cognitive ability among young monozygotic twins distinguished by chorion type.

PubMed

Sokol, D K; Moore, C A; Rose, R J; Williams, C J; Reed, T; Christian, J C

1995-09-01

We evaluated placentation effects on behavioral resemblance of 44 pairs of monozygotic (MZ) twin children. Tested at ages 4-6, the twins' zygosity and placental type had been determined at their delivery. The sample included 23 monochorionic (MC) and 21 dichorionic (DC) MZ twin pairs: DC-MZ twins result from separation of blastomeres within 72 h of ovulation; MC-MZ twins arise from later duplication of the inner cell mass. Twins were individually administered the McCarthy Scales of Cognitive Ability, while their mothers separately rated each cotwin on an individualized 280-item form of the Personality Inventory for Children (PIC). Absolute differences between MC-MZ cotwins were smaller than those between DC-MZ cotwins for all 20 PIC scales, significantly so for 3 of 4 factor scales, 8 of 12 clinical scales, and 2 of 4 validity/screening scales from the PIC; in contrast, no consistent differences in intrapair resemblance of mono- and dichorionic MZ twins were found for the McCarthy Scales. The chorion differences found in the PIC data cannot be due to genetic differences, because all pairs are monozygotes; nor are they associated with differences in parity, gestational age, birth weight, maternal education, palmar dermatoglyphic asymmetry, or maternal knowledge of chorion type. We interpret our findings as suggestive evidence that variation in timing of embryological division, with effects on MZ twins' placental vasculature, has significant consequences for some dimensions of their behavioral development, as well.

SUPERNOVA DRIVING. I. THE ORIGIN OF MOLECULAR CLOUD TURBULENCE

DOE Office of Scientific and Technical Information (OSTI.GOV)

Padoan, Paolo; Pan, Liubin; Haugbølle, Troels

2016-05-01

Turbulence is ubiquitous in molecular clouds (MCs), but its origin is still unclear because MCs are usually assumed to live longer than the turbulence dissipation time. Interstellar medium (ISM) turbulence is likely driven by supernova (SN) explosions, but it has never been demonstrated that SN explosions can establish and maintain a turbulent cascade inside MCs consistent with the observations. In this work, we carry out a simulation of SN-driven turbulence in a volume of (250 pc){sup 3}, specifically designed to test if SN driving alone can be responsible for the observed turbulence inside MCs. We find that SN driving establishesmore » a velocity scaling consistent with the usual scaling laws of supersonic turbulence, suggesting that previous idealized simulations of MC turbulence, driven with a random, large-scale volume force, were correctly adopted as appropriate models for MC turbulence, despite the artificial driving. We also find that the same scaling laws extend to the interiors of MCs, and that the velocity–size relation of the MCs selected from our simulation is consistent with that of MCs from the Outer-Galaxy Survey, the largest MC sample available. The mass–size relation and the mass and size probability distributions also compare successfully with those of the Outer Galaxy Survey. Finally, we show that MC turbulence is super-Alfvénic with respect to both the mean and rms magnetic-field strength. We conclude that MC structure and dynamics are the natural result of SN-driven turbulence.« less

Hydrothermal venting on the flanks of Heard and McDonald islands, southern Indian Ocean

NASA Astrophysics Data System (ADS)

Lupton, J. E.; Arculus, R. J.; Coffin, M.; Bradney, A.; Baumberger, T.; Wilkinson, C.

2017-12-01

Heard Island and the nearby McDonald Islands are two sites of active volcanism associated with the so-called Kerguelen mantle plume or hot spot. In fact, it has been proposed that the Kerguelen hot spot is currently located beneath Heard Island. During its maiden maximum endurance voyage (IN2016_V01), the recently commissioned Australian R/V Investigator conducted a detailed bathymetric and water column survey of the waters around Heard Island and the McDonald Islands as well as other sites on the Kerguelen Plateau. Some 50 hydrographic profiles were completed using the CTD/rosette system equipped with trace metal sampling and a nephelometer for suspended particle concentrations. In addition to the hydrographic profiles, 244 bubble plumes were detected in the vicinity of the Heard and McDonald Islands using the ship's multibeam system. It is thought that the bubble plumes observed on sea knolls and other seafloor surrounding the McDonald Islands are likely hydrothermal in origin, while plumes northeast of Heard Island may be biogenic methane from cold seeps. At 29 of the hydrographic stations water samples for helium isotope measurements were drawn from the CTD rosette and hermetically sealed into copper tubing for subsequent shorebased mass spectrometer and gas chromatograph analysis. In this paper we report results for 3He/4He ratios and CO2 and CH4 concentrations in water samples collected with the CTD/rosette, and discuss how these results are correlated with suspended particle concentrations and temperature anomalies.

Observations by Mid-continent Magnetoseismic Chain (McMAC) and their use in space weather research

NASA Astrophysics Data System (ADS)

Chi, P. J.; McMac Team

The Mid-continent Magnetoseismic Chain McMAC consists of nine magnetometer stations that line up across the U S and Mexico along the 330th magnetic meridian These systems sample at 2 Hz and monitor the fluctuations of the geomagnetic field caused by space weather phenomena and they are always on the Internet to allow rapid access of data The McMAC stations can connect to the Fort Churchill Line of the CARISMA Array and two IGPP-LANL stations at the same longitude and form a long magnetometer chain that spans the L-value range from 1 3 to 11 7 the greatest latitudinal coverage in all meridians One of the main advantages of this magnetometer chain is its close separation between adjacent stations enabling the use of the gradient technique to identify field line resonance FLR frequencies and to further estimate the plasma mass density in the magnetosphere The observations of FLR and the derived density can always be collected in the daytime and occasionally in the nighttime as well In this paper we present the observations by the newly completed McMAC and jointly by the CARISMA and IGPP-LANL Arrays The observed plasma density and its wide coverage in L-value can benefit space weather studies such as on magnetosphere-ionosphere coupling and on the wave-particle interaction for modeling the radiation belts Also discussed are other applications of the McMAC observations in space weather research including possible joint observations with satellite missions

Determination of macrolide antibiotics in chicken tissues by liquid chromatography-electrospray mass spectrometry

NASA Astrophysics Data System (ADS)

Salikin, Jamilah; Abdullah, Aminah

2013-11-01

A methodusingliquid chromatography-electrospray mass spectrometry (LC-(ESI)MS) for the simultaneous determination of three macrolides (tylosin, spiramycin and tilmicosin) in poultry muscle has been developed. The drugs were extracted with EDTA McIlvaine buffer, filter through celite 545 and the extracts were cleaned up by SPE Oasis HLB cartridge. Separation was carried out in end-capped silica-based C18 column and mobile phases containing trifluoroacetic acid-acetonitrile with a binary gradient system at a flow rate 0.5 ml/min. Detection was performed by single mass spectrometry with electrospray ionization in the positive mode. Several parameters affecting the mass spectra were studied. Chicken samples from the market were analyzed to check the residue of macrolide antibiotics.

Microphysics of Clouds with the Relaxed Arakawa-Schubert Scheme (McRAS). Part I: Design and Evaluation with GATE Phase III Data.

NASA Astrophysics Data System (ADS)

Sud, Y. C.; Walker, G. K.

1999-09-01

A prognostic cloud scheme named McRAS (Microphysics of Clouds with Relaxed Arakawa-Schubert Scheme) has been designed and developed with the aim of improving moist processes, microphysics of clouds, and cloud-radiation interactions in GCMs. McRAS distinguishes three types of clouds: convective, stratiform, and boundary layer. The convective clouds transform and merge into stratiform clouds on an hourly timescale, while the boundary layer clouds merge into the stratiform clouds instantly. The cloud condensate converts into precipitation following the autoconversion equations of Sundqvist that contain a parametric adaptation for the Bergeron-Findeisen process of ice crystal growth and collection of cloud condensate by precipitation. All clouds convect, advect, as well as diffuse both horizontally and vertically with a fully interactive cloud microphysics throughout the life cycle of the cloud, while the optical properties of clouds are derived from the statistical distribution of hydrometeors and idealized cloud geometry.An evaluation of McRAS in a single-column model (SCM) with the Global Atmospheric Research Program Atlantic Tropical Experiment (GATE) Phase III data has shown that, together with the rest of the model physics, McRAS can simulate the observed temperature, humidity, and precipitation without discernible systematic errors. The time history and time mean in-cloud water and ice distribution, fractional cloudiness, cloud optical thickness, origin of precipitation in the convective anvils and towers, and the convective updraft and downdraft velocities and mass fluxes all simulate a realistic behavior. Some of these diagnostics are not verifiable with data on hand. These SCM sensitivity tests show that (i) without clouds the simulated GATE-SCM atmosphere is cooler than observed; (ii) the model's convective scheme, RAS, is an important subparameterization of McRAS; and (iii) advection of cloud water substance is helpful in simulating better cloud distribution and cloud-radiation interaction. An evaluation of the performance of McRAS in the Goddard Earth Observing System II GCM is given in a companion paper (Part II).

Encouraging Student Participation While Designing Writing Exercises

NASA Astrophysics Data System (ADS)

Narayanan, M.

2017-12-01

Encouraging student participation while designing writing exercises requires a certain pragmatic approach. Wilbert James McKeachie is the author of a widely read textbook on college teaching. McKeachie was a longtime faculty member at the University of Michigan. He served as president of the American Psychological Association, the American Psychological Foundation and the American Association of Higher Education. In his famous book Teaching and Learning in the College Classroom, McKeachie provides an introduction and notes the role of research in identifying new goals for higher education. He also offers a conceptual framework based on a student mediation model and a focuses on the processs-product relationships between faculty teacher behavior and student learning outcomes. McKeachie' s Teaching Tips provides helpful strategies for dealing with both the everyday problems of university teaching and those that arise in trying to maximize learning for every student. The book does not suggest a set of recipes to be followed mechanically; it gives instructors the tools they need to deal with the ever-changing dynamics of teaching and learning. First, it is extremely important to define the target skill areas and means of implementation. Next, the professor can then proceed to focus on the techniques that could be employed to ensure student participation. This includes selection of an appropriate topic that is relevant to the field of study as well as classroom learning experiences. By pragmatically combining these objectives, the teacher can expect both enthusiasm and effective learning among the student population. McKeachie, Wilbert James. (1980) Learning, Cognition and College Teaching. San Francisco: Jossey - Bass McKeachie, Wilbert James. (1980) Teaching Tips: A Guidebook for the Beginning College Teacher Lexington, MASS. : Heath. 1986. ISBN: 0669067520 McKeachie, Wilbert James., et. al. (2001) Teaching Tips (Eleventh Edition): Strategies, Research, and Theory for College and University Teachers by Houghton Mifflin Company. ISBN: 0618116494.

The missense variation landscape of FTO, MC4R, and TMEM18 in obese children of African Ancestry.

PubMed

Deliard, Sandra; Panossian, Saarene; Mentch, Frank D; Kim, Cecilia E; Hou, Cuiping; Frackelton, Edward C; Bradfield, Jonathan P; Glessner, Joseph T; Zhang, Haitao; Wang, Kai; Sleiman, Patrick M A; Chiavacci, Rosetta M; Berkowitz, Robert I; Hakonarson, Hakon; Zhao, Jianhua; Grant, Struan F A

2013-01-01

Common variation at the loci harboring fat mass and obesity (FTO), melanocortin receptor 4 (MC4R), and transmembrane protein 18 (TMEM18) is consistently reported as being statistically most strongly associated with obesity. Investigations if these loci also harbor rarer missense variants that confer substantially higher risk of common childhood obesity in African American (AA) children were conducted. The exons of FTO, MC4R, and TMEM18 in an initial subset of our cohort were sequenced, that is, 200 obese (BMI ≥ 95 th percentile) and 200 lean AA children (BMI ≤ 5 th percentile). Any missense exonic variants that were uncovered went on to be further genotyped in a further 768 obese and 768 lean (BMI≤50th percentile) children of the same ethnicity. A number of exonic variants were observed from our sequencing effort: seven in FTO, of which four were non-synonymous (A163T, G182A, M400V, and A405V), thirteen in MC4R, of which six were non-synonymous (V103I, N123S, S136A, F202L, N240S, and I251L), and four in TMEM18, of which two were non-synonymous (P2S and V113L). Follow-up genotyping of these missense variants revealed only one significant difference in allele frequency between cases and controls, namely with N240S in MC4R (Fisher's exact P = 0.0001). In summary, moderately rare missense variants within the FTO, MC4R, and TMEM18 genes observed in our study did not confer risk of common childhood obesity in African Americans except for a degree of evidence for one known loss-of-function variant in MC4R. Copyright © 2012 The Obesity Society.

Up-, down-, strange-, charm-, and bottom-quark masses from four-flavor lattice QCD

DOE Office of Scientific and Technical Information (OSTI.GOV)

Bazavov, A.; Bernard, C.; Brambilla, N.

We calculate the up-, down-, strange-, charm-, and bottom-quark masses using the MILC highly improved staggered-quark ensembles with four flavors of dynamical quarks. We use ensembles at six lattice spacings ranging frommore » $$a\\approx0.15~$$fm to $0.03~$fm and with both physical and unphysical values of the two light and the strange sea-quark masses. We use a new method based on heavy-quark effective theory (HQET) to extract quark masses from heavy-light pseudoscalar meson masses. Combining our analysis with our separate determination of ratios of light-quark masses we present masses of the up, down, strange, charm, and bottom quarks. Our results for the $$\\overline{\\text{MS}}$$-renormalized masses are $$m_u(2~\\text{GeV}) = 2.118(38)~$$MeV, $$m_d(2~\\text{GeV}) = 4.690(54)~$$MeV, $$m_s(2~\\text{GeV}) = 92.52(69)~$$MeV, $$m_c(3~\\text{GeV}) = 984.3(5.6)~$$MeV, and $$m_c(m_c) = 1273(10)~$$MeV, with four active flavors; and $$m_b(m_b) = 4197(14)~$$MeV with five active flavors. We also obtain ratios of quark masses $$m_c/m_s = 11.784(22)$$, $$m_b/m_s = 53.93(12)$$, and $$m_b/m_c = 4.577(8)$$. The result for $$m_c$$ matches the precision of the most precise calculation to date, and the other masses and all quoted ratios are the most precise to date. Moreover, these results are the first with a perturbative accuracy of $$\\alpha_s^4$$. As byproducts of our method, we obtain the matrix elements of HQET operators with dimension 4 and 5: $$\\overline{\\Lambda}_\\text{MRS}=552(30)~$$MeV in the minimal renormalon-subtracted (MRS) scheme, $$\\mu_\\pi^2 = 0.06(22)~\\text{GeV}^2$$, and $$\\mu_G^2(m_b)=0.38(2)~\\text{GeV}^2$$. The MRS scheme [Phys. Rev. D97, 034503 (2018), arXiv:1712.04983 [hep-ph

SU-F-T-33: Air-Kerma Strength and Dose Rate Constant by the Full Monte Carlo Simulations

DOE Office of Scientific and Technical Information (OSTI.GOV)

Tsuji, S; Oita, M; Narihiro, N

2016-06-15

Purpose: In general, the air-kerma strength (Sk) has been determined by the energy weighting the photon energy fluence and the corresponding mass-energy absorption coefficient or mass-energy transfer coefficient. Kerma is an acronym for kinetic energy released per unit mass, defined as the sum of the initial kinetic energies of all the charged particles. Monte Carlo (MC) simulations can investigate the kinetic energy of the charged particles after photo interactions and sum the energy. The Sk of {sup 192}Ir source is obtained in the full MC simulation and finally the dose rate constant Λ is determine. Methods: MC simulations were performedmore » using EGS5 with the microSelectron HDR v2 type of {sup 192}Ir source. The air-kerma rate obtained to sum the electron kinetic energy after photoelectric absorption or Compton scattering for transverse-axis distance from 1 to 120 cm with a 10 m diameter air phantom. Absorbed dose in water is simulated with a 30 cm diameter water phantom. The transport cut-off energy is 10 keV and primary photons from the source need two hundred and forty billion in the air-kerma rate and thirty billion in absorbed dose in water. Results: Sk is multiplied by the square of the distance in air-kerma rate and determined by fitting a linear function. The result of Sk is (2.7039±0.0085)*10-{sup −11} µGy m{sup 2} Bq{sup −1} s{sup −1}. Absorbed dose rate in water at 1 cm transverse-axis distance D(r{sub 0}, θ{sub 0}) is (3.0114±0.0015)*10{sup −11} cGy Bq{sup −1} s{sup −1}. Conclusion: From the results, dose rate constant Λ of the microSelectron HDR v2 type of {sup 192}Ir source is (1.1137±0.0035) cGy h{sup −1} U{sup −1} by the full MC simulations. The consensus value conΛ is (1.109±0.012) cGy h{sup −1} U{sup −1}. The result value is consistent with the consensus data conΛ.« less

Reactive Nitrogen and its Correlation with O3 and CO Over the Pacific in Winter and Early Spring

NASA Technical Reports Server (NTRS)

Koike, M.; Kondo,Y.; Kawakami, S.; Nakajima, H.; Sachse, G. W.; Singh, H. B.; Browell, E. V.; Merrill, J. T.; Newell, R. E.

1997-01-01

Measurements of NO, NO(y), O3, and CO were made during NASA's Global Tropospheric Experiment/Pacific Exploratory Mission-West B (GTE/PEM-West B) carried out over the western Pacific in February and March 1994. NO(x) was calculated from NO using a photostationary state model ((NO(x)(sub mc)). Correlations between these species are presented, and some insights into the sources of NO(x) and NO(y) are described. The boundaries between the lower, middle, and upper troposphere have been defined at potential temperatures of 311 K and 328 K, which correspond to the geometric altitudes of about 5 and 9 km at 30degN. Enhancements in the mixing ratios of NO(y) and CO were observed in the lower and middle troposphere. A positive correlation was found between these two species suggesting that the high NO(y) values were due to anthropogenic emissions over the continental surface. On the other hand, O3 increased little with increase in CO. As a result, NO(y)/O3 ratios were higher in air more influenced by pollution. NO(y), values in 55 and 28% of the air masses sampled in the lower and middle troposphere, respectively, were higher than the clean free tropospheric NO(y)-O3 range when O3 values simultaneously observed were used. High (NOx)mc/NOy ratios between 0.15 and 0.3 were found in the boundary layer with relatively low mixing ratios of CO and NOy during the three flights. These air masses were transported from a higher altitude (approximately 5 km) and a higher latitude (approximately 50degN) within a few days. The peroxyacetyl nitrate (PAN)/NO(y) ratios were generally high (approximately 0.4) in these air masses, and the thermal decomposition of PAN was a probable source of NO(x). In the middle troposphere the (NO(x))mc mixing ratio did not generally increase with NO(y) or CO, suggesting that the transport of air masses affected by anthropogenic emissions did not increase the NO(x) level significantly. In the upper troposphere, very minor effects from the continental surface sources were seen in the CO mixing ratio. By contrast, NO(y) values in 33% of the air masses were higher than those expected when stratospheric air intrusion is assumed to be a single source of NO(y) based on NO(y)-O3 correlation analyses. This result suggests significant free tropospheric NO(y) sources, namely exhaust from the aircraft and NO production by lightning activity. In fact, spikes in the (NO(x))(sub m)c mixing ratios were observed near the aircraft corridor south of Tokyo at an altitude of 10 km. These two free tropospheric NO(x) sources were considered to be important in determining the levels of the upper tropospheric NO(x) and NO(y) during PEM-West B.

Detection of microcystins, a blue-green algal hepatotoxin, in drinking water sampled in Haimen and Fusui, endemic areas of primary liver cancer in China, by highly sensitive immunoassay.

PubMed

Ueno, Y; Nagata, S; Tsutsumi, T; Hasegawa, A; Watanabe, M F; Park, H D; Chen, G C; Chen, G; Yu, S Z

1996-06-01

An epidemiological survey for the causes of a high incidence of primary liver cancer (PLC) in Haimen city, Jian-Su province and Fusui county, Guangxi province in China, found a close correlation between the incidence of PLC and the drinking of pond and ditch water. With an aim to clarify whether microcystins (MC), a hepatotoxic peptide produced by water bloom algae, contaminate the drinking water in the endemic areas of PLC in China, a highly sensitive enzyme-linked immunosorbent assay with a detection limit of 50 pg/ml, was introduced to monitor the MC. Three trials to survey the drinking water were carried out in 1993-1994. Samples, 1135 in total, were collected from different sources such as: ponds, ditches, rivers, shallow wells and deep wells in Haimen city. The first survey in September 1993 found that three out of 14 ditch water specimens were positive for MC, with a range of 90-460 pg/ml. Several toxic algae such as Oscillatoria agardhii were present in some of the ditches. In the second trial, samples were collected from five ponds/ditches, two rivers, two shallow wells and two deep wells monthly for the whole year of 1994. These data showed that MC was highest in June to September, with a range of 62-296 pg/ml. A third trial on the 989 different water samples collected from the different types of water sources in July 1994 revealed that 17% of the pond/ditch water, 32% of the river water, and 4% of the shallow-well water were positive for MC, with averages of 101, 160 and 68 pg/ml respectively. No MC was detected in deep well water. A similar survey on 26 drinking water samples in Fusui, Guangxi province, demonstrated a high contamination frequency of MC in the water of ponds/ditches and rivers but no MC in shallow and deep wells. These data support a hypothesis that the blue-green algal toxin MC in the drinking water of ponds/ditches and rivers, or both, is one of the risk factors for the high incidence of PLC in China. Based on previous findings on the epidemiology of PLC and the present results from the mass screening of MC in the drinking water, an advisory level of MC in drinking water was proposed to below 0.01 microg/l. The combined effect of a potent hepatocarcinogen AFB1 and an intermittent intake of MC in drinking water in the summer season was discussed as an etiology of PLC.

Lower metabolic rate in individuals heterozygous for either a frameshift or a functional missense MC4R variant.

PubMed

Krakoff, Jonathan; Ma, Lijun; Kobes, Sayuko; Knowler, William C; Hanson, Robert L; Bogardus, Clifton; Baier, Leslie J

2008-12-01

Humans with functional variants in the melanocortin 4 receptor (MC4R) are obese, hyperphagic, and hyperinsulinemic but have been reported to have no difference in energy expenditure. We investigated the association of two MC4R variants, Arg165Gln (R165Q) and A insertion at nucleotide 100 (NT100), with adiposity in 3,074 full-heritage Pima Indians, a subset of whom had metabolic measures including 24-h energy expenditure (n = 252) and resting metabolic rate (RMR) (n = 364). Among the 3,074 subjects, 43 were heterozygous for R165Q and 14 for NT100 (frequency = 0.007 and 0.002). Mean (+/- SD) BMI was higher among subjects with R165Q (39.3 +/- 8.6 kg/m(2)) or NT100 (41.2 +/- 7.8) than subjects without either variant (37.1 +/- 8.4) (P = 0.04 and 0.02, adjusted for age, sex, and birth year and accounting for family membership). The 24-h energy expenditure (four with NT100; three with R165Q) or RMR (six with NT100; two with R165Q) was lower in heterozygous subjects but only met statistical significance when heterozygous subjects were combined and compared with subjects without either variant: least-squares means, 2,163 kcal/24 h (95% CI 2,035-2,291) vs. 2,307 kcal/24 h (2,285-2,328), P = 0.03 for 24-h energy expenditure, and 1,617 kcal/24 h (1,499-1,734) vs. 1,754 kcal/24 h (1,736-1,772), P = 0.02 for RMR; adjusted for age, sex, fat-free mass, and fat mass). For RMR, this difference persisted, even after accounting for family membership. Pima Indians heterozygous for R165Q or NT100 in MC4R have higher BMIs and lower energy expenditure (by approximately 140 kcal/day), indicating that lower energy expenditure was a component of the increased adiposity.

Impact of the Polymorphism Near MC4R (rs17782313) on Obesity- and Metabolic-Related Traits in Women Participating in an Aerobic Training Program.

PubMed

Leońska-Duniec, Agata; Jastrzębski, Zbigniew; Zarębska, Aleksandra; Smółka, Wojciech; Cięszczyk, Paweł

2017-09-01

The C/T polymorphism (rs17782313) mapped 188 kb downstream of the melanocortin-4 receptor gene (MC4R) shows a strong relationship with an increased body mass index (BMI) and the risk of type 2 diabetes. However, the information on polymorphism's potential modifying effect on obesity- and metabolic-related traits achieved through training is still unknown. Therefore, we decided to check if selected body measurements observed in physically active participants would be modulated by the genotype. The genotype distribution was examined in a group of 201 Polish women measured for chosen traits before and after the completion of a 12 week moderate-intensive aerobic training program. A statistically significant relationship between the glucose level and the genotype was identified (p = 0.046). Participants with CC and CT genotypes had a higher glucose level during the entire study period compared with the TT genotype. However, our results did not confirm the relationship between the C allele and an increased BMI or other obesity-related traits. Additionally, we did not observe a near MC4R C/T polymorphism x physical activity interaction. However, our results revealed that majority of obesity-related variables changed significantly during the 12 week training program. The effect sizes (d) of these changes ranged from small to medium (d = 0.11-0.80), whereas the largest effect (d = 0.80; i.e. medium) was reported for the fat mass content (FM). We found a relationship between the near MC4R C/T polymorphism and an increased glucose level, and it is thus a candidate to influence type 2 diabetes. Interestingly, after the 12 week training program, participants with the C (risk) allele with fasting hyperglycemia had a normal glucose level. Although, this change was not statistically significant, it shows an important trend which needs further investigation.

Dietary Protein Modifies the Effect of the MC4R Genotype on 2-Year Changes in Appetite and Food Craving: The POUNDS Lost Trial123

PubMed Central

Huang, Tao; Zheng, Yan; Hruby, Adela; Williamson, Donald A; Bray, George A; Shen, Yiru; Sacks, Frank M; Qi, Lu

2017-01-01

Background: The melanocortin-4 receptor (MC4R) plays a pivotal role in the regulation of appetite and eating behavior. Variants in the MC4R gene have been related to appetite and obesity. Objective: We aimed to examine whether weight-loss diets modified the effect of the “obesity-predisposing” MC4R genotype on appetite-related measures in a randomized controlled trial. Methods: A total of 811 overweight and obese subjects [25 ≤ body mass index (BMI; kg/m2) ≤ 40] aged 30–70 y were included in the 2-y POUNDS Lost (Preventing Overweight Using Novel Dietary Strategies) trial. We genotyped MC4R rs7227255 in 735 overweight adults and assessed appetite-related characteristics, including craving, fullness, hunger, and prospective consumption, as well as a composite appetite score. We examined the effects of the genotype-by-weight-loss diet intervention interaction on appetite variables by using general linear models in both the whole population and in white participants only. Results: We found that dietary protein intake (low compared with high: 15% of energy compared with 25% of energy, respectively) significantly modified MC4R genetic effects on changes in appetite score and craving (P-interaction = 0.03 and 0.02, respectively) at 2 y, after adjustment for age, sex, ethnicity, baseline BMI, weight change, and baseline perspective phenotype. The obesity-predisposing A allele was associated with a greater increase in overall appetite score (β = 0.10, P = 0.05) and craving (β = 0.13, P = 0.008) compared with the non-A allele among participants who consumed a high-protein diet. MC4R genotype did not modify the effects of fat or carbohydrate intakes on appetite measures. Similar interaction patterns were observed in whites. Conclusion: Our data suggest that individuals with the MC4R rs7227255 A allele rather than the non-A allele might experience greater increases in appetite and food craving when consuming a high-protein weight-loss diet. This trial was registered at clinicaltrials.gov as NCT00072995. PMID:28148682

Dietary Protein Modifies the Effect of the MC4R Genotype on 2-Year Changes in Appetite and Food Craving: The POUNDS Lost Trial.

PubMed

Huang, Tao; Zheng, Yan; Hruby, Adela; Williamson, Donald A; Bray, George A; Shen, Yiru; Sacks, Frank M; Qi, Lu

2017-03-01

Background: The melanocortin-4 receptor (MC4R) plays a pivotal role in the regulation of appetite and eating behavior. Variants in the MC4R gene have been related to appetite and obesity. Objective: We aimed to examine whether weight-loss diets modified the effect of the "obesity-predisposing" MC4R genotype on appetite-related measures in a randomized controlled trial. Methods: A total of 811 overweight and obese subjects [25 ≤ body mass index (BMI; kg/m 2 ) ≤ 40] aged 30-70 y were included in the 2-y POUNDS Lost (Preventing Overweight Using Novel Dietary Strategies) trial. We genotyped MC4R rs7227255 in 735 overweight adults and assessed appetite-related characteristics, including craving, fullness, hunger, and prospective consumption, as well as a composite appetite score. We examined the effects of the genotype-by-weight-loss diet intervention interaction on appetite variables by using general linear models in both the whole population and in white participants only. Results: We found that dietary protein intake (low compared with high: 15% of energy compared with 25% of energy, respectively) significantly modified MC4R genetic effects on changes in appetite score and craving ( P -interaction = 0.03 and 0.02, respectively) at 2 y, after adjustment for age, sex, ethnicity, baseline BMI, weight change, and baseline perspective phenotype. The obesity-predisposing A allele was associated with a greater increase in overall appetite score (β = 0.10, P = 0.05) and craving (β = 0.13, P = 0.008) compared with the non-A allele among participants who consumed a high-protein diet. MC4R genotype did not modify the effects of fat or carbohydrate intakes on appetite measures. Similar interaction patterns were observed in whites. Conclusion: Our data suggest that individuals with the MC4R rs7227255 A allele rather than the non-A allele might experience greater increases in appetite and food craving when consuming a high-protein weight-loss diet. This trial was registered at clinicaltrials.gov as NCT00072995. © 2017 American Society for Nutrition.

Serum Proteins and Alkaline Phosphatase Levels in Patients with Tuberous Sclerosis

ERIC Educational Resources Information Center

Fischer, M. H.; And Others

1974-01-01

Six 4- to 37-year-old patients with tuberosis sclerosis (a chronic condition characterized by siezures, intercranial calcification, a reddish-yellow sebaceous glandular mass on the face, and frequent crises in early years), did not exhibit an elevation of the (alpha + beta) globulin fraction in their serum. (Author/MC)

VizieR Online Data Catalog: Infrared excesses of Hipparcos stars (McDonald+, 2012)

NASA Astrophysics Data System (ADS)

McDonald, I.; Zijlstra, A. A.; Boyer, M. L.

2013-08-01

The new Hipparcos (Hp)/Tycho (BT, VT) reduction (van Leeuwen 2007. Cat. I/311) was used as the primary astrometric and photometric catalogue, to which the other catalogues were matched. Additional data were sourced from SDSS DR8, DENIS, 2MASS, MSX, AKARI, IRAS and Wide surveys. (1 data file).

ARC-2002-ACD02-0104-001

NASA Image and Video Library

2002-05-29

Memorandum of Understanding (MOU) to establish a Unmanned Aerial Vehicles (UAV) Applications Center at NASA Research Park (NRP) was signed into being by (L-R) John Bassett Clark University, Worcester, Mass., Dr. Henry McDonald, Director of Ames Research Center and Paul Coleman, Girvan Institute (a non-profit organization lockated in NASA Research Park).

Identification of mud crab reovirus VP12 and its interaction with the voltage-dependent anion-selective channel protein of mud crab Scylla paramamosain.

PubMed

Xu, Hai-Dong; Su, Hong-Jun; Zou, Wei-Bin; Liu, Shan-Shan; Yan, Wen-Rui; Wang, Qian-Qian; Yuan, Li-Li; Chan, Siuming Francis; Yu, Xiao-Qiang; He, Jian-Guo; Weng, Shao-Ping

2015-05-01

Mud crab reovirus (MCRV) is the causative agent of a severe disease in cultured mud crab (Scylla paramamosain), which has caused huge economic losses in China. MCRV is a double-stranded RNA virus with 12 genomic segments. In this paper, SDS-PAGE, mass spectrometry and Western blot analyses revealed that the VP12 protein encoded by S12 gene is a structural protein of MCRV. Immune electron microscopy assay indicated that MCRV VP12 is a component of MCRV outer shell capsid. Yeast two hybrid cDNA library of mud crab was constructed and mud crab voltage-dependent anion-selective channel (mcVDAC) was obtained by MCRV VP12 screening. The full length of mcVDAC was 1180 bp with an open reading frame (ORF) of 849 bp encoding a 282 amino acid protein. The mcVDAC had a constitutive expression pattern in different tissues of mud crab. The interaction between MCRV VP12 and mcVDAC was determined by co-immunoprecipitation assay. The results of this study have provided an insight on the mechanisms of MCRV infection and the interactions between the virus and mud crab. Copyright © 2015 Elsevier Ltd. All rights reserved.

Adsorption of Ten Microcystin Congeners to Common Laboratory-Ware Is Solvent and Surface Dependent.

PubMed

Altaner, Stefan; Puddick, Jonathan; Wood, Susanna A; Dietrich, Daniel R

2017-04-06

Cyanobacteria can produce heptapetides called microcystins (MC) which are harmful to humans due to their ability to inhibit cellular protein phosphatases. Quantitation of these toxins can be hampered by their adsorption to common laboratory-ware during sample processing and analysis. Because of their structural diversity (>100 congeners) and different physico-chemical properties, they vary in their adsorption to surfaces. In this study, the adsorption of ten different MC congeners (encompassing non-arginated to doubly-arginated congeners) to common laboratory-ware was assessed using different solvent combinations. Sample handling steps were mimicked with glass and polypropylene pipettes and vials with increasing methanol concentrations at two pH levels, before analysis by liquid chromatography-tandem mass spectrometry. We demonstrated that MC adsorb to polypropylene surfaces irrespective of pH. After eight successive pipet actions using polypropylene tips ca. 20% of the MC were lost to the surface material, which increased to 25%-40% when solutions were acidified. The observed loss was alleviated by changing the methanol (MeOH) concentration in the final solvent. The required MeOH concentration varied depending on which congener was present. Microcystins only adsorbed to glass pipettes (loss up to 30% after eight pipet actions) when in acidified aqueous solutions. The latter appeared largely dependent on the presence of ionizable groups, such as arginine residues.

Protein-altering variants associated with body mass index implicate pathways that control energy intake and expenditure underpinning obesity

PubMed Central

Turcot, Valérie; Lu, Yingchang; Highland, Heather M; Schurmann, Claudia; Justice, Anne E; Fine, Rebecca S; Bradfield, Jonathan P; Esko, Tõnu; Giri, Ayush; Graff, Mariaelisa; Guo, Xiuqing; Hendricks, Audrey E; Karaderi, Tugce; Lempradl, Adelheid; Locke, Adam E; Mahajan, Anubha; Marouli, Eirini; Sivapalaratnam, Suthesh; Young, Kristin L; Alfred, Tamuno; Feitosa, Mary F; Masca, Nicholas GD; Manning, Alisa K; Medina-Gomez, Carolina; Mudgal, Poorva; Ng, Maggie CY; Reiner, Alex P; Vedantam, Sailaja; Willems, Sara M; Winkler, Thomas W; Abecasis, Goncalo; Aben, Katja K; Alam, Dewan S; Alharthi, Sameer E; Allison, Matthew; Amouyel, Philippe; Asselbergs, Folkert W; Auer, Paul L; Balkau, Beverley; Bang, Lia E; Barroso, Inês; Bastarache, Lisa; Benn, Marianne; Bergmann, Sven; Bielak, Lawrence F; Blüher, Matthias; Boehnke, Michael; Boeing, Heiner; Boerwinkle, Eric; Böger, Carsten A; Bork-Jensen, Jette; Bots, Michiel L; Bottinger, Erwin P; Bowden, Donald W; Brandslund, Ivan; Breen, Gerome; Brilliant, Murray H; Broer, Linda; Brumat, Marco; Burt, Amber A; Butterworth, Adam S; Campbell, Peter T; Cappellani, Stefania; Carey, David J; Catamo, Eulalia; Caulfield, Mark J; Chambers, John C; Chasman, Daniel I; Chen, Yii-Der Ida; Chowdhury, Rajiv; Christensen, Cramer; Chu, Audrey Y; Cocca, Massimiliano; Collins, Francis S; Cook, James P; Corley, Janie; Galbany, Jordi Corominas; Cox, Amanda J; Crosslin, David S; Cuellar-Partida, Gabriel; D'Eustacchio, Angela; Danesh, John; Davies, Gail; de Bakker, Paul IW; de Groot, Mark CH; de Mutsert, Renée; Deary, Ian J; Dedoussis, George; Demerath, Ellen W; den Heijer, Martin; den Hollander, Anneke I; den Ruijter, Hester M; Dennis, Joe G; Denny, Josh C; Di Angelantonio, Emanuele; Drenos, Fotios; Du, Mengmeng; Dubé, Marie-Pierre; Dunning, Alison M; Easton, Douglas F; Edwards, Todd L; Ellinghaus, David; Ellinor, Patrick T; Elliott, Paul; Evangelou, Evangelos; Farmaki, Aliki-Eleni; Farooqi, I. Sadaf; Faul, Jessica D; Fauser, Sascha; Feng, Shuang; Ferrannini, Ele; Ferrieres, Jean; Florez, Jose C; Ford, Ian; Fornage, Myriam; Franco, Oscar H; Franke, Andre; Franks, Paul W; Friedrich, Nele; Frikke-Schmidt, Ruth; Galesloot, Tessel E.; Gan, Wei; Gandin, Ilaria; Gasparini, Paolo; Gibson, Jane; Giedraitis, Vilmantas; Gjesing, Anette P; Gordon-Larsen, Penny; Gorski, Mathias; Grabe, Hans-Jörgen; Grant, Struan FA; Grarup, Niels; Griffiths, Helen L; Grove, Megan L; Gudnason, Vilmundur; Gustafsson, Stefan; Haessler, Jeff; Hakonarson, Hakon; Hammerschlag, Anke R; Hansen, Torben; Harris, Kathleen Mullan; Harris, Tamara B; Hattersley, Andrew T; Have, Christian T; Hayward, Caroline; He, Liang; Heard-Costa, Nancy L; Heath, Andrew C; Heid, Iris M; Helgeland, Øyvind; Hernesniemi, Jussi; Hewitt, Alex W; Holmen, Oddgeir L; Hovingh, G Kees; Howson, Joanna MM; Hu, Yao; Huang, Paul L; Huffman, Jennifer E; Ikram, M Arfan; Ingelsson, Erik; Jackson, Anne U; Jansson, Jan-Håkan; Jarvik, Gail P; Jensen, Gorm B; Jia, Yucheng; Johansson, Stefan; Jørgensen, Marit E; Jørgensen, Torben; Jukema, J Wouter; Kahali, Bratati; Kahn, René S; Kähönen, Mika; Kamstrup, Pia R; Kanoni, Stavroula; Kaprio, Jaakko; Karaleftheri, Maria; Kardia, Sharon LR; Karpe, Fredrik; Kathiresan, Sekar; Kee, Frank; Kiemeney, Lambertus A; Kim, Eric; Kitajima, Hidetoshi; Komulainen, Pirjo; Kooner, Jaspal S; Kooperberg, Charles; Korhonen, Tellervo; Kovacs, Peter; Kuivaniemi, Helena; Kutalik, Zoltán; Kuulasmaa, Kari; Kuusisto, Johanna; Laakso, Markku; Lakka, Timo A; Lamparter, David; Lange, Ethan M; Lange, Leslie A; Langenberg, Claudia; Larson, Eric B; Lee, Nanette R; Lehtimäki, Terho; Lewis, Cora E; Li, Huaixing; Li, Jin; Li-Gao, Ruifang; Lin, Honghuang; Lin, Keng-Hung; Lin, Li-An; Lin, Xu; Lind, Lars; Lindström, Jaana; Linneberg, Allan; Liu, Ching-Ti; Liu, Dajiang J; Liu, Yongmei; Lo, Ken Sin; Lophatananon, Artitaya; Lotery, Andrew J; Loukola, Anu; Luan, Jian'an; Lubitz, Steven A; Lyytikäinen, Leo-Pekka; Männistö, Satu; Marenne, Gaëlle; Mazul, Angela L; McCarthy, Mark I; McKean-Cowdin, Roberta; Medland, Sarah E; Meidtner, Karina; Milani, Lili; Mistry, Vanisha; Mitchell, Paul; Mohlke, Karen L; Moilanen, Leena; Moitry, Marie; Montgomery, Grant W; Mook-Kanamori, Dennis O; Moore, Carmel; Mori, Trevor A; Morris, Andrew D; Morris, Andrew P; Müller-Nurasyid, Martina; Munroe, Patricia B; Nalls, Mike A; Narisu, Narisu; Nelson, Christopher P; Neville, Matt; Nielsen, Sune F; Nikus, Kjell; Njølstad, Pål R; Nordestgaard, Børge G; Nyholt, Dale R; O'Connel, Jeffrey R; O’Donoghue, Michelle L.; Olde Loohuis, Loes M; Ophoff, Roel A; Owen, Katharine R; Packard, Chris J; Padmanabhan, Sandosh; Palmer, Colin NA; Palmer, Nicholette D; Pasterkamp, Gerard; Patel, Aniruddh P; Pattie, Alison; Pedersen, Oluf; Peissig, Peggy L; Peloso, Gina M; Pennell, Craig E; Perola, Markus; Perry, James A; Perry, John RB; Pers, Tune H; Person, Thomas N; Peters, Annette; Petersen, Eva RB; Peyser, Patricia A; Pirie, Ailith; Polasek, Ozren; Polderman, Tinca J; Puolijoki, Hannu; Raitakari, Olli T; Rasheed, Asif; Rauramaa, Rainer; Reilly, Dermot F; Renström, Frida; Rheinberger, Myriam; Ridker, Paul M; Rioux, John D; Rivas, Manuel A; Roberts, David J; Robertson, Neil R; Robino, Antonietta; Rolandsson, Olov; Rudan, Igor; Ruth, Katherine S; Saleheen, Danish; Salomaa, Veikko; Samani, Nilesh J; Sapkota, Yadav; Sattar, Naveed; Schoen, Robert E; Schreiner, Pamela J; Schulze, Matthias B; Scott, Robert A; Segura-Lepe, Marcelo P; Shah, Svati H; Sheu, Wayne H-H; Sim, Xueling; Slater, Andrew J; Small, Kerrin S; Smith, Albert Vernon; Southam, Lorraine; Spector, Timothy D; Speliotes, Elizabeth K; Starr, John M; Stefansson, Kari; Steinthorsdottir, Valgerdur; Stirrups, Kathleen E; Strauch, Konstantin; Stringham, Heather M; Stumvoll, Michael; Sun, Liang; Surendran, Praveen; Swift, Amy J; Tada, Hayato; Tansey, Katherine E; Tardif, Jean-Claude; Taylor, Kent D; Teumer, Alexander; Thompson, Deborah J; Thorleifsson, Gudmar; Thorsteinsdottir, Unnur; Thuesen, Betina H; Tönjes, Anke; Tromp, Gerard; Trompet, Stella; Tsafantakis, Emmanouil; Tuomilehto, Jaakko; Tybjaerg-Hansen, Anne; Tyrer, Jonathan P; Uher, Rudolf; Uitterlinden, André G; Uusitupa, Matti; van der Laan, Sander W; van Duijn, Cornelia M; van Leeuwen, Nienke; van Setten, Jessica; Vanhala, Mauno; Varbo, Anette; Varga, Tibor V; Varma, Rohit; Velez Edwards, Digna R; Vermeulen, Sita H; Veronesi, Giovanni; Vestergaard, Henrik; Vitart, Veronique; Vogt, Thomas F; Völker, Uwe; Vuckovic, Dragana; Wagenknecht, Lynne E; Walker, Mark; Wallentin, Lars; Wang, Feijie; Wang, Carol A; Wang, Shuai; Wang, Yiqin; Ware, Erin B; Wareham, Nicholas J; Warren, Helen R; Waterworth, Dawn M; Wessel, Jennifer; White, Harvey D; Willer, Cristen J; Wilson, James G; Witte, Daniel R; Wood, Andrew R; Wu, Ying; Yaghootkar, Hanieh; Yao, Jie; Yao, Pang; Yerges-Armstrong, Laura M; Young, Robin; Zeggini, Eleftheria; Zhan, Xiaowei; Zhang, Weihua; Zhao, Jing Hua; Zhao, Wei; Zhao, Wei; Zhou, Wei; Zondervan, Krina T; Rotter, Jerome I; Pospisilik, John A; Rivadeneira, Fernando; Borecki, Ingrid B; Deloukas, Panos; Frayling, Timothy M; Lettre, Guillaume; North, Kari E; Lindgren, Cecilia M; Hirschhorn, Joel N; Loos, Ruth JF

2018-01-01

Genome-wide association studies (GWAS) have identified >250 loci for body mass index (BMI), implicating pathways related to neuronal biology. Most GWAS loci represent clusters of common, non-coding variants from which pinpointing causal genes remains challenging. Here, we combined data from 718,734 individuals to discover rare and low-frequency (MAF<5%) coding variants associated with BMI. We identified 14 coding variants in 13 genes, of which eight in genes (ZBTB7B, ACHE, RAPGEF3, RAB21, ZFHX3, ENTPD6, ZFR2, ZNF169) newly implicated in human obesity, two (MC4R, KSR2) previously observed in extreme obesity, and two variants in GIPR. Effect sizes of rare variants are ~10 times larger than of common variants, with the largest effect observed in carriers of an MC4R stop-codon (p.Tyr35Ter, MAF=0.01%), weighing ~7kg more than non-carriers. Pathway analyses confirmed enrichment of neuronal genes and provide new evidence for adipocyte and energy expenditure biology, widening the potential of genetically-supported therapeutic targets to treat obesity. PMID:29273807

Rapid Microcystin Determination Using a Paper Spray Ionization Method with a Time-of-Flight Mass Spectrometry System.

PubMed

Zhu, Xiaoqiang; Huang, Zhengxu; Gao, Wei; Li, Xue; Li, Lei; Zhu, Hui; Mo, Ting; Huang, Bao; Zhou, Zhen

2016-07-13

The eutrophication of surface water sources and climate changes have resulted in an annual explosion of cyanobacterial blooms in many irrigating and drinking water resources. To decrease health risks to the public, a rapid real time method for the synchronous determination of two usually harmful microcystins (MC-RR and MC-LR) in environmental water samples was built by employing a paper spray ionization method coupled with a time-of-flight mass spectrometer system. With this approach, direct analysis of microcystin mixtures without sample preparation has been achieved. Rapid detection was performed, simulating the release process of microcystins in reservoir water samples, and the routine detection frequency was every three minutes. The identification time of microcystins was reduced from several hours to a few minutes. The limit of detection is 1 μg/L, and the limit of quantitation is 3 μg/L. This method displays the ability for carrying out rapid, direct, and high-throughput experiments for determination of microcystins, and it would be of significant interest for environmental and food safety applications.

Effect of Maillard Conjugates on the Physical Stability of Zein Nanoparticles Prepared by Liquid Antisolvent Coprecipitation.

PubMed

Davidov-Pardo, Gabriel; Joye, Iris J; Espinal-Ruiz, Mauricio; McClements, David Julian

2015-09-30

Protein nanoparticles are often not very stable in a complex food matrix because they are primarily stabilized by electrostatic repulsion. In this study, we envisaged the stabilization of zein nanoparticles through Maillard conjugation reactions with polysaccharides of different molecular mass. Zein nanoparticles (0.5% w/v) containing resveratrol (0.025% w/v grape skin extract) were produced by liquid antisolvent precipitation and coated with Maillard conjugates (MC) of sodium caseinate and different molecular mass carbohydrates during particle production. Zein nanoparticles coated with conjugated polysaccharides of 2.8, 37, and 150 kDa had diameters of 198 ± 5, 176 ± 6, and 180 ± 3 nm, respectively. The encapsulation efficiency (∼83%) was not affected by conjugation, but the conjugates significantly improved particle stability against changes in pH (2.0-9.0), CaCl2 addition (up to 100 mM), and heat treatment (30-90 °C, 30 min). Zein nanoparticles coated by MC may therefore be suitable delivery systems for hydrophobic bioactive molecules in a wide range of commercial products.

Rapid Evaporation of Binary Mixture Injections

NASA Astrophysics Data System (ADS)

McCahan, S.; Kessler, C.

1998-11-01

When a fuel under pressure is heated above its normal boiling point and expanded through a nozzle into atmospheric conditions, rapid evaporation can occur. The resulting sprays typically exhibit increased atomization and shorter liquid penetration lengths. When heavy fuels with high specific heats are used, complete evaporation is theoretically possible. This is a continuation of work done by Sloss and McCahan (APS/DFD meeting 1996), in which dodecane, fuel oil, kerosene, and diesel oil were studied, and McCahan and Kessler (APS/DFD meeting 1997), in which preliminary results were presented on decane and tetradecane. At a pressure of 10 bar, the working fluid (decane/tetradecane mixture) is preheated to temperatures ranging from room temperature to the decane saturation temperature and then expanded through a simple converging nozzle into a chamber at 1 bar. From the photographic and mass flow rate data, the effect of degree of superheat on the spray cone angle and mass flow rate is observed. Results show that the addition of a heavier hydrocarbon has the expected damping effects on the spray characteristics.

The total customer relationship in health care: broadening the bandwidth.

PubMed

Berwick, D M

1997-05-01

The health care system is in the midst of a market revolution, driven by cost containment but also fully charged by the idea that competition among providers will lead to reforms that neither the government nor the professions have been able to achieve by themselves. An agenda of "reports to consumers" has been advanced as a bright new hope for improving the health care system. An alternative to this notion of consumerism is far broader--that is the concept of total relationship. In the hands of masters outside the health care domain, the total customer relationship embraces several elements that can be imported into health care and that offer more promise than "report cards," including the following: Customers as assistants in decreasing waste; Mass customization and stratification of need; Shaping demand; Immediate recovery; Delight as the objective; and Customer knowledge and innovation. A CREDO: The next phase of development of total customer relationship might well be guided by a credo including several tenets about the wisdom of those the health care system serves and the nature of its purpose: 1. In a helping profession, the ultimate judge of performance is the person helped. 2. Most people, including sick people, are reasonable most of the time. 3. Different people have different, legitimate needs. 4. Pain and fear produce anxiety in both the victim and the helper. 5. Meeting needs without waste is a strategic and moral imperative.

Magnetically actuated mechanical stimuli on Fe3O4/mineralized collagen coatings to enhance osteogenic differentiation of the MC3T3-E1 cells.

PubMed

Zhuang, Junjun; Lin, Suya; Dong, Lingqing; Cheng, Kui; Weng, Wenjian

2018-04-15

Mechanical stimuli at the bone-implant interface are considered to activate the mechanotransduction pathway of the cell to improve the initial osseointegration establishment and to guarantee clinical success of the implant. However, control of the mechanical stimuli at the bone-implant interface still remains a challenge. In this study, we have designed a strategy of a magnetically responsive coating on which the mechanical stimuli is controlled because of coating deformation under static magnetic field (SMF). The iron oxide nanoparticle/mineralized collagen (IOP-MC) coatings were electrochemically codeposited on titanium substrates in different quantities of IOPs and distributions; the resulting coatings were verified to possess swelling behavior with flexibility same as that of hydrogel. The relative quantity of IOP to collagen and the IOP distribution in the coatings were demonstrated to play a critical role in mediating cell behavior. The cells present on the outer layer of the distributed IOP-MC (O-IOP-MC) coating with a mass ratio of 0.67 revealed the most distinct osteogenic differentiation activity being promoted, which could be attributed to the maximized mechanical stimuli with exposure to SMF. Furthermore, the enhanced osteogenic differentiation of the stimulated MC3T3-E1 cells originated from magnetically actuated mechanotransduction signaling pathway, embodying the upregulated expression of osteogenic-related and mechanotransduction-related genes. This work therefore provides a promising strategy for implementing mechanical stimuli to activate mechanotransduction on the bone-implant interface and thus to promote osseointegration. The magnetically actuated coating is designed to produce mechanical stimuli to cells for promoting osteogenic differentiation based on the coating deformation. Iron oxide nanoparticles (IOPs) were incorporated into the mineralized collagen coatings (MC) forming the composite coatings (IOP-MC) with spatially distributed IOPs, and the IOP-MC coatings with outer distributed IOPs (O-IOPs-MC) shows the maximized mechanical stimuli to cells with enhanced osteogenic differentiation under static magnetic field. The upregulated expression of the associated genes reveals that the enabled mechanotransduction signaling pathway is responsible for the promoted cellular osteogenic differentiation. This work therefore provides a promising strategy for implementing mechanical stimuli to activate mechanotransduction on the bone-implant interface to promote osseointegration. Copyright © 2018 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

Selection Effects in Identifying Magnetic Clouds and the Importance of the Closest Approach Parameter

NASA Technical Reports Server (NTRS)

Lepping, R. P.; Wu, Chin-Chun

2010-01-01

This study is motivated by the unusually low number of magnetic clouds (MCs) that are strictly identified within interplanetary coronal mass ejections (ICMEs), as observed at 1 AU; this is usually estimated to be around 30% or lower. But a looser definition of MCs may significantly increase this percentage. Another motivation is the unexpected shape of the occurrence distribution of the observers' "closest approach distances" (measured from a MC's axis, and called CA) which drops off somewhat rapidly as |CA| (in % of MC radius) approaches 100%, based on earlier studies. We suggest, for various geometrical and physical reasons, that the |CA|-distribution should be somewhere between a uniform one and the one actually observed, and therefore the 30% estimate should be higher. So we ask, When there is a failure to identify a MC within an ICME, is it occasionally due to a large |CA| passage, making MC identification more difficult, i.e., is it due to an event selection effect? In attempting to answer this question we examine WIND data to obtain an accurate distribution of the number of MCs vs. |CA| distance, whether the event is ICME-related or not, where initially a large number of cases (N=98) are considered. This gives a frequence distribution that is far from uniform, confirming earlier studies. This along with the fact that there are many ICME identification-parameters that do not depend on |CA| suggest that, indeed an MC event selection effect may explain at least part of the low ratio of (No. MCs)/(No. ICMEs). We also show that there is an acceptable geometrical and physical consistency in the relationships for both average "normalized" magnetic field intensity change and field direction change vs. |CA| within a MC, suggesting that our estimates of |CA|, B(sub 0) (magnetic field intensity on the axis), and choice of a proper "cloud coordinate" system (all needed in the analysis) are acceptably accurate. Therefore the MC fitting model (Lepping et al., 1990) is adequate, on average, for our analysis. However, this selection effect is not likely to completely answer our original question, on the unexpected ratio of MCs to ICMEs, so we must look for other factors, such as peculiarities of CME birth conditions. As a by-product of this analysis, we determine that the first order structural effects within a MC due to its interaction with the solar wind, plus the MC's usual expansion at 1 AU (i.e., the non-force free components of the MC's field) are, on average, weakly dependent on radial distance from the MC's axis; that is, in the outer reaches of a typical MC the non-force free effects show up, but even there they are rather weak. Finally, we show that it is not likely that a MC's size distribution statistically controls the occurrence distribution of the estimated |CA|s.

A conjoint analysis to consumer choice in Brazil: Defining device attributes for recognizing customized foods characteristics.

PubMed

Calegari, L P; Barbosa, J; Marodin, G A; Fettermann, D C

2018-07-01

the availability of information about food products may be an essential factor in the consumer's value perception in their purchasing decision. As the food product becomes personalized, the customization of this information becomes complex due to the possible combinations of product components. The use of smart technology in devices is one way to provide customers with customized food information. In the following research five attributes were identified in the composition of these devices: (A) portability; (B) precision; (C) diet customization; (D) food quality analysis; and (E) price. This study aims to identify the appropriate combination of possible functionalities or attributes that must be present in a device in order to detect the food composition of customized foods and their relation to market characteristics. One experiment used fractional factorial project to present the attributes in the form of scenarios following the Choice-Based Conjoint Analysis (CBCA) method. The data collection was done using survey methodology, through online questionnaire, with some 303 Brazilian respondents. So, the Logistic Regression was applied to data analysis. The moderating variables-gender, age, gluten restriction, lactose restriction and other restrictions-were also added to verify potential interactions with the primary attributes. From the results obtained, it was possible to observe higher significance for the primary attributes of diet personalization and quality food analyzes function. Our study contributes to the literature by enhancing the understanding about what the attributes should be in a technological device that has the purpose of recognizing food characteristics and is capable of generating information about customized food products. Furthermore, this device can enabler the production of mass customized food with the nutritional labels for each possible combination. Copyright © 2018 Elsevier Ltd. All rights reserved.

Glaciers in Equilibrium - Results from the McMurdo Dry Valleys, Antarctica

NASA Astrophysics Data System (ADS)

Fountain, A. G.; Nylen, T. H.; Doran, P. T.

2004-12-01

Since 1993 the mass balance of two glaciers in the McMurdo Dry Valleys, Antarctica (163° E 77.5° S) has been measured. The magnitude of annual mass gain or loss does not exceed 10 cm water equivalent averaged over each glacier, consistent with the local climate of a polar desert. The overall trend in mass balance shows that the glaciers are in approximate balance with the current climate and no obvious trends exist in either the winter or summer balances. These are similar to a set of mass balance measurements made in another part of the dry valleys during the 1970s (Chinn, 1985). Recent analysis of the climate of the dry valleys shows this region is cooling at a rate of 0.7° C per decade during this period since 1986, which is reflected in the overall lowering of lake levels, decreased primary productivity of the lakes, and declining number of invertebrates (Doran et al., 2002). Although an unusually warm period occurred in the summer of 2001-2002, annual temperatures continue to cool. This region seems to be isolated from the warming elsewhere in Antarctica and the cooling in this part of the Ross Sea region may be due to El Nino forcing (Bertler et al, 2004). The sluggish behavior of the glaciers results from a low mass exchange and an apparent climatic buffering, which supports evidence from the geologic record that these glaciers have not advanced more than a few hundred meters over the past 3 million years (Hall et al., 1993). Many of the glaciers, however, are advancing which probably results from a slow time-scale response from warming conditions in the past millennium.

Universal relations with fermionic dark matter

NASA Astrophysics Data System (ADS)

Krut, A.; Argüelles, C. R.; Rueda, J. A.; Ruffini, R.

2018-01-01

We have recently introduced a new model for the distribution of dark matter (DM) in galaxies, the Ruffini-Argüelles-Rueda (RAR) model, based on a self-gravitating system of massive fermions at finite temperatures. The RAR model, for fermion masses above keV, successfully describes the DM halos in galaxies, and predicts the existence of a denser quantum core towards the center of each configuration. We demonstrate here, for the first time, that the introduction of a cutoff in the fermion phase-space distribution, necessary to account for galaxies finite size and mass, defines a new solution with a compact quantum core which represents an alternative to the central black hole (BH) scenario for SgrA*. For a fermion mass in the range 48keV ≤ mc2 ≤ 345keV, the DM halo distribution fulfills the most recent data of the Milky Way rotation curves while harbors a dense quantum core of 4×106M⊙ within the S2 star pericenter. In particular, for a fermion mass of mc2 ˜ 50keV the model is able to explain the DM halos from typical dwarf spheroidal to normal elliptical galaxies, while harboring dark and massive compact objects from ˜ 103M⊙ tp to 108M⊙ at their respective centers. The model is shown to be in good agreement with different observationally inferred universal relations, such as the ones connecting DM halos with supermassive dark central objects. Finally, the model provides a natural mechanism for the formation of supermassive BHs as heavy as few ˜ 108M⊙. We argue that larger BH masses (few ˜ 109-10M⊙) may be achieved by assuming subsequent accretion processes onto the above heavy seeds, depending on accretion efficiency and environment.

Surface and basal ice shelf mass balance processes of the Southern McMurdo Ice Shelf determined through radar statistical reconnaissance

NASA Astrophysics Data System (ADS)

Grima, C.; Koch, I.; Greenbaum, J. S.; Soderlund, K. M.; Blankenship, D. D.; Young, D. A.; Fitzsimons, S.

2017-12-01

The McMurdo ice shelves (northern and southern MIS), adjacent to the eponymous station and the Ross Ice Shelf, Antarctica, are known for large gradients in surface snow accumulation and snow/ice impurities. Marine ice accretion and melting are important contributors to MIS's mass balance. Due to erosive winds, the southern MIS (SMIS) shows a locally negative surface mass balance. Thus, marine ice once accreted at the ice shelf base crops out at the surface. However, the exact processes that exert primary control on SMIS mass balance have remained elusive. Radar statistical reconnaissance (RSR) is a recent technique that has been used to characterize the surface properties of the Earth's cryosphere, Mars, and Titan from the stochastic character of energy scattered by the surface. Here, we apply RSR to map the surface density and roughness of the SMIS and extend the technique to derive the basal reflectance and scattering coefficients of the ice-ocean interface. We use an airborne radar survey grid acquired over the SMIS in the 2014-2015 austral summer by the University of Texas Institute for Geophysics with the High Capability Radar Sounder (HiCARS2; 60-MHz center frequency and 15-MHz bandwidth). The RSR-derived snow density values and patterns agree with directly -measured ice shelf surface accumulation rates. We also compare the composition of SMIS ice surface samples to test the ability of RSR to discriminate ices with varying dielectric properties (e.g., marine versus meteoric ice) and hypothesize relationships between the RSR-derived basal reflectance/scattered coefficients and accretion or melting at the ice-ocean interface. This improved knowledge of air-ice and ice-ocean boundaries provides a new perspective on the processes governing SMIS surface and basal mass balance.

Producing Hybrid Metal Composites by Combining Additive Manufacturing and Casting

DOE PAGES

Pawlowski, Alex E.; Splitter, Derek A.; Muth, Thomas R.; ...

2017-10-01

Additive manufacturing by itself provides many benefits, but by combining different materials processing techniques like traditional casting with additive manufacturing to create hybrid processes, custom materials can be tailor-made and mass produced for applications with specific performance needs.

Residential Customer Enrollment in Time-based Rate and Enabling Technology Programs: Smart Grid Investment Grant Consumer Behavior Study Analysis

DOE Office of Scientific and Technical Information (OSTI.GOV)

Todd, Annika; Cappers, Peter; Goldman, Charles

2013-05-01

The U.S. Department of Energy’s (DOE’s) Smart Grid Investment Grant (SGIG) program is working with a subset of the 99 SGIG projects undertaking Consumer Behavior Studies (CBS), which examine the response of mass market consumers (i.e., residential and small commercial customers) to time-varying electricity prices (referred to herein as time-based rate programs) in conjunction with the deployment of advanced metering infrastructure (AMI) and associated technologies. The effort presents an opportunity to advance the electric industry’s understanding of consumer behavior.

Higgs production via gluon fusion in k{sub T} factorisation

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hautmann, F.; Jung, H.; Pandis, V.

2011-07-15

Theoretical studies of Higgs production via gluon fusion are frequently carried out in the limit where the top quark mass is much larger than the Higgs mass, an approximation which reduces the top quark loop to an effective vertex. We present a numerical analysis of the error thus introduced by performing a Monte Carlo calculation for gg{yields}h in k{sub T}-factorisation, using the parton shower generator CASCADE. By examining both inclusive and exclusive quantities, we find that retaining the top-mass dependence results in only a small enhancement of the cross-section. We then proceed to compare CASCADE to the collinear Monte Carlosmore » PYTHIA, MC-NLO and POWHEG.« less

VLTI + MIDI Study of the High Mass Protostellar Candidate NGC 3603 IRS 9A

NASA Astrophysics Data System (ADS)

Nürnberger, D. E. A.; Vehoff, S.; Hummel, C. A.; Duschl, W. J.

2010-02-01

The formation and early evolution of high mass stars is among the hottest topics in astrophysics. Interferometric studies of these young stars and their circumstellar environments (envelopes, disks and jets) at near and mid infrared wavelengths are still rare and in terms of data analysis/interpretation very challenging. We here report on observations of the high mass protostellar candidate NGC 3603 IRS 9A which we undertook with VLTI + MIDI in 2005, complemented by near and mid infrared imaging and spectroscopic data. We discuss our results obtained from dedicated modeling efforts, employing both DUSTY and MC3D radiative transfer codes for a selected number of source geometries and surface brightness distributions.

Recent reconstruction of deep-water macrofaunal communities recorded in Continental Margin sediments in the Balearic Basin

NASA Astrophysics Data System (ADS)

Cartes, J. E.; Schirone, A.; Barsanti, M.; Delbono, I.; Martínez-Aliaga, A.; Lombarte, A.

2017-07-01

We present an initial reconstruction of recent (last few centuries) mud-bottom faunal communities on the upper slope (398-667 m) of the continental margin off Catalonia (western Mediterranean), including periods free of any trawling impact. Radiometric dating of marine sediments and identification of faunal remains (e.g., fish otoliths, pteropod shells, coral sclerites) were performed to obtain a sediment geochronology in a 56 cm sediment core (MC4) taken at 398 m off the Ebro Delta in 2011. Core MC4 was especially rich in faunal remains, including, for example, 247 identifiable otoliths. A fine-scale chronology of MC4 was not possible due to sediment mixing. However, the depth of 210Pbxs penetration (20-22 cm) identified sediments older (below 22 cm depth) and younger (from core top to 22 cm) than ca. 100 years. Mass Accumulation Rate (MAR) from the 210Pbxs profile was estimated as 0.23±0.02 g cm-2 y-1. A significant peak of sclerites of the bamboo coral Isidella elongata was found between 4 and 8 cm in MC4, with remains of the axes and bases of Isidella colonies exclusively found at core depths >8-10 cm, which would correspond (MAR results) to the period 1980-1985. Such structures were not found in the 0-8 cm layer, likely an effect of trawling that started in the area in the 1980s. Other changes both in benthos (corals and cirripedes) and zooplankton (pteropods) seemed to be related with Ebro river discharge, with changes coinciding with massive damming of the Ebro and tributary rivers in the 1950s and until 1965. Mesopelagic fish also showed temporal oscillations in MC4. Abundance of some myctophid remains (Lampanyctus croccodilus and Benthosema glaciale) was related with positive NAO periods and with rather high temperature in Levantine Intermediate Waters. By contrast, periods of higher dominance of Ceratoscopelus maderensis off Catalonian coasts could indicate lower salinity during the past and a progressive degree of eutrophication in intermediate waters in recent decades. A general decline in myctophids otolith abundance during the last ca. 100 years could be related to changes in the temperature and salinity of deep-water masses and a decline in ocean productivity that would also have affected open-water fish stocks.

THE INSIDIOUS BOOSTING OF THERMALLY PULSING ASYMPTOTIC GIANT BRANCH STARS IN INTERMEDIATE-AGE MAGELLANIC CLOUD CLUSTERS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Girardi, Léo; Marigo, Paola; Bressan, Alessandro

2013-11-10

In the recent controversy about the role of thermally pulsing asymptotic giant branch (TP-AGB) stars in evolutionary population synthesis (EPS) models of galaxies, one particular aspect is puzzling: TP-AGB models aimed at reproducing the lifetimes and integrated fluxes of the TP-AGB phase in Magellanic Cloud (MC) clusters, when incorporated into EPS models, are found to overestimate, to various extents, the TP-AGB contribution in resolved star counts and integrated spectra of galaxies. In this paper, we call attention to a particular evolutionary aspect, linked to the physics of stellar interiors, that in all probability is the main cause of this conundrum.more » As soon as stellar populations intercept the ages at which red giant branch stars first appear, a sudden and abrupt change in the lifetime of the core He-burning phase causes a temporary 'boost' in the production rate of subsequent evolutionary phases, including the TP-AGB. For a timespan of about 0.1 Gyr, triple TP-AGB branches develop at slightly different initial masses, causing their frequency and contribution to the integrated luminosity of the stellar population to increase by a factor of ∼2. The boost occurs for turn-off masses of ∼1.75 M{sub ☉}, just in the proximity of the expected peak in the TP-AGB lifetimes (for MC metallicities), and for ages of ∼1.6 Gyr. Coincidently, this relatively narrow age interval happens to contain the few very massive MC clusters that host most of the TP-AGB stars used to constrain stellar evolution and EPS models. This concomitance makes the AGB-boosting particularly insidious in the context of present EPS models. As we discuss in this paper, the identification of this evolutionary effect brings about three main consequences. First, we claim that present estimates of the TP-AGB contribution to the integrated light of galaxies derived from MC clusters are biased toward too large values. Second, the relative TP-AGB contribution of single-burst populations falling in this critical age range cannot be accurately derived by approximations such as the fuel consumption theorem, which ignore, by construction, the above evolutionary effect. Third, a careful revision of AGB star populations in intermediate-age MC clusters is urgently demanded, promisingly with the aid of detailed sets of stellar isochrones.« less

STEREO Observations of Interplanetary Coronal Mass Ejections in 2007–2016

NASA Astrophysics Data System (ADS)

Jian, L. K.; Russell, C. T.; Luhmann, J. G.; Galvin, A. B.

2018-03-01

We have conducted a survey of 341 interplanetary coronal mass ejections (ICMEs) using STEREO A/B data, analyzing their properties while extending a Level 3 product through 2016. Among the 192 ICMEs with distinguishable sheath region and magnetic obstacle, the magnetic field maxima in the two regions are comparable, and the dynamic pressure peaks mostly in the sheath. The north/south direction of the magnetic field does not present any clear relationship between the sheath region and the magnetic obstacle. About 71% of ICMEs are expanding at 1 au, and their expansion speed varies roughly linearly with their maximum speed except for ICMEs faster than 700 km s‑1. The total pressure generally peaks near the middle of the well-defined magnetic cloud (MC) passage, while it often declines along with the non-MC ICME passage, consistent with our previous interpretation concerning the effects of sampling geometry on what is observed. The hourly average iron charge state reaches above 12+ ∼31% of the time for MCs, ∼16% of the time for non-MC ICMEs, and ∼1% of the time for non-ICME solar wind. In four ICMEs abrupt deviations of the magnetic field from the nominal field rotations occur in the magnetic obstacles, coincident with a brief drop or increase in field strength—features could be related to the interaction with dust. In comparison with the similar phases of solar cycle 23, the STEREO ICMEs in this cycle occur less often and are generally weaker and slower, although their field and pressure compressions weaken less than the background solar wind.

Physical profile of elite young motorcyclists.

PubMed

Sánchez-Muñoz, C; Rodríguez, M A; Casimiro-Andújar, A J; Ortega, F B; Mateo-March, M; Zabala, M

2011-10-01

The aim of the study was to describe anthropometric and physical characteristics of elite young road-race motorcyclists (MC). 27 riders (15.6±1.1 years, 54.6±6.9 kg, 166.9±6.7 cm) competing at international elite level participated in this study. Anthropometric variables, hand grip and lumbar isometric strength, and lower-body muscular strength were measured. Comparisons of the MC and a reference group of Spanish physically active adolescents (16.0±0.6 years) showed that the riders were significantly lighter (-12.5 kg), and smaller (-4.7 cm). Riders also had significantly lower values for almost all skinfolds, and for all the measured girths (except forearm) than the reference group. Motorcyclists showed significantly less percent body fat (%BF) and higher muscle mass, and differences were observed for somatotype components compared to the reference group, except for the ectomorphy. Somatotype could be defined as mesomorphic-ectomorph (2.5-4.4-3.7). Mean (±SD) values of all riders were 34.8±5.0 cm for vertical jump height, 402.1±74.5 N for the right hand and 370.7±77.5 N for the left hand strengths, and 120.6±19.3 kg for lumbar isometric strength, respectively. Results demonstrate that MC are small and light, with lower body mass index, skinfolds, girth and breadth dimensions, and %BF than a reference group and other athletes, with high values of hand grip and lumbar isometric strength. © Georg Thieme Verlag KG Stuttgart · New York.

Exposure to urban air pollution and bone health in clinically healthy six-year-old children.

PubMed

Calderón-Garcidueñas, Lilian; Mora-Tiscareño, Antonieta; Francolira, Maricela; Torres-Jardón, Ricardo; Peña-Cruz, Bernardo; Palacios-López, Carolina; Zhu, Hongtu; Kong, Linglong; Mendoza-Mendoza, Nicolás; Montesinoscorrea, Hortencia; Romero, Lina; Valencia-Salazar, Gildardo; Kavanaugh, Michael; Frenk, Silvestre

2013-01-01

Air pollution induces systemic inflammation, as well as respiratory, myocardial and brain inflammation in children. Peak bone mass is influenced by environmental factors. We tested the hypothesis that six-year-olds with lifetime exposures to urban air pollution will have alterations in inflammatory markers and bone mineral density (BMD) as opposed to low-polluted city residents when matched for BMI, breast feeding history, skin phototype, age, sex and socioeconomic status. This pilot study included 20 children from Mexico City (MC) (6.17 years ± 0.63 years) and 15 controls (6.27 years ± 0.76 years). We performed full paediatric examinations, a history of outdoor exposures, seven-day dietary recalls, serum inflammatory markers and dual-energy X-ray absorptiometry (DXA). Children in MC had significantly higher concentrations of IL-6 (p=0.001), marked reductions in total blood neutrophils (p= 0.0002) and an increase in monocytes (p=0.005). MC children also had an insufficient Vitamin D intake and spent less time outdoors than controls (p<0.001) in an environment characterized by decreased UV light, with ozone and fine particulates concentrations above standard values. There were no significant differences between the cohorts in DXA Z scores. The impact of systemic inflammation, vitamin D insufficiency, air pollution, urban violence and poverty may have long-term bone detrimental outcomes in exposed paediatric populations as they grow older, increasing the risk of low bone mass and osteoporosis. The selection of reference populations for DXA must take into account air pollution exposures.

On the Rates of Coronal Mass Ejections: Remote Solar and In Situ Observations

NASA Technical Reports Server (NTRS)

Riley, Pete; Schatzman, C.; Cane, H. V.; Richardson, I. G.; Gopalswamy, N.

2006-01-01

We compare the rates of coronal mass ejections (CMEs) as inferred from remote solar observations and interplanetary CMEs (ICMEs) as inferred from in situ observations at both 1 AU and Ulyssses from 1996 through 2004. We also distinguish between those ICMEs that contain a magnetic cloud (MC) and those that do not. While the rates of CMEs and ICMEs track each other well at solar minimum, they diverge significantly in early 1998, during the ascending phase of the solar cycle, with the remote solar observations yielding approximately 20 times more events than are seen at 1 AU. This divergence persists through 2004. A similar divergence occurs between MCs and non-MC ICMEs. We argue that these divergences are due to the birth of midlatitude active regions, which are the sites of a distinct population of CMEs, only partially intercepted by Earth, and we present a simple geometric argument showing that the CME and ICME rates are consistent with one another. We also acknowledge contributions from (1) an increased rate of high-latitude CMEs and (2) focusing effects from the global solar field. While our analysis, coupled with numerical modeling results, generally supports the interpretation that whether one observes a MC within an ICME is sensitive to the trajectory of the spacecraft through the ICME (i.e., an observational selection effect), one result directly contradicts it. Specifically, we find no systematic offset between the latitudinal origin of ICMEs that contain MCs at 1 AU in the ecliptic plane and that of those that do not.

Terminal velocity of liquids and granular materials dispersed by a high explosive

NASA Astrophysics Data System (ADS)

Loiseau, J.; Pontalier, Q.; Milne, A. M.; Goroshin, S.; Frost, D. L.

2018-04-01

The explosive dispersal of a layer of solid particles or a layer of liquid surrounding a spherical high-explosive charge generates a turbulent, multiphase flow. Shock compression of the material layer during the initial acceleration may partially consolidate the material, leading to the formation of jet-like structures when the layer fragments and sheds particles upon release. Similarly, release of a shock-compressed liquid shell causes the nucleation of cavitation sites, leading to the radial breakup of the shell and the formation of jets upon expansion. In the current study, a wide variety of granular materials and liquids were explosively dispersed. The maximum terminal jet tip or shell velocity was measured using high-speed videography. Charges were constructed using thin-walled glass bulbs of various diameters and contained a central C-4 charge surrounded by the material to be dispersed. This permitted variation of the ratio of material mass to charge mass (M/C) from 4 to 300. Results indicated that material velocity broadly correlates with predictions of the Gurney model. For liquids, the terminal velocity was accurately predicted by the Gurney model. For granular materials, Gurney over-predicted the terminal velocity by 25-60%, depending on the M/C ratio, with larger M/C values exhibiting larger deficits. These deficits are explained by energy dissipation during the collapse of voids in the granular material bed. Velocity deficits were insensitive to the degree of jetting and granular material properties. Empirical corrections to the Gurney model are presented with improved agreement with the dry powder experimental velocities.

How Einstein Discovered "E[subscript 0] = mc[squared]"

ERIC Educational Resources Information Center

Hecht, Eugene

2012-01-01

This paper traces Einstein's discovery of "the equivalence of mass [m] and energy ["E[subscript 0]"]." He came to that splendid insight in 1905 while employed by the Bern Patent Office, at which time he was not an especially ardent reader of physics journals. How then did the young savant, working outside of academia in semi-isolation, realize…

Superlattices and Semiconductor/Semiconductor Interfaces.

DTIC Science & Technology

1984-01-17

the electron effective ’J. N. Schulman and T. C. Mc"il AppI. Phys. Lett 34. 66311979). masse in the snuff band-gap alloys, suggesting reducedp- 3.P...et al. " have made DLTS measurements on n-type, , lead to the loss of electrically active indium through the for- indium doped CdTe films grown on BaF

Biomass burning and urban air pollution over the Central Mexican Plateau

Treesearch

J. D. Crounse; P. F. DeCarlo; D. R. Blake; L. K. Emmons; T. L. Campos; E. C. Apel; A. D. Clarke; A. J. Weinheimer; D. C. McCabe; R. J. Yokelson; J. L. Jimenez; P. O. Wennberg

2009-01-01

Observations during the 2006 dry season of highly elevated concentrations of cyanides in the atmosphere above Mexico City (MC) and the surrounding plains demonstrate that biomass burning (BB) significantly impacted air quality in the region. We find that during the period of our measurements, fires contribute more than half of the organic aerosol mass and submicron...

Composition, mosquito larvicidal, biting deterrent and antifungal activity of essential oils of different plant parts of Cupressus arizonica var. glabra (Carolina Sapphire)

USDA-ARS?s Scientific Manuscript database

Essential oils obtained from the hydrodistillation of female cones (FC), male cones (MC), needles-twigs (NT) and wood barks (WB) of ‘Carolina Sapphire’ [Cupressus arizonica var glabra (Sudw.) Little] were analyzed simultaneously by gas chromatography (GC) and gas chromatography–mass spectrometry (GC...

Batrachochytrium dendrobatidis detected in amphibians from National Forests in eastern Texas, USA

Treesearch

Daniel Saenz; Brendan T. Kavanagh; Matthew A. Kwiatkowski

2010-01-01

The amphibian disease chytridiomycosis, caused by the pathogenic fungus Batrachochytrium dendrobatidis (Bd, Longcore et al. 1999), is well known as a major threat to amphibians resulting in mass die-offs and population declines throughout the world (Berger et al. 1998; Blaustein and Keisecker 2002; Daszak et al. 2003; McCallum 2005; Rachowicz et al. 2006)....

Finite Element Analysis of Fluid-Structure Interaction in a Blast-Resistant Window System (PREPRINT)

DTIC Science & Technology

2008-03-01

membrane effects that only become significant at large out-of-plane deflection levels ( Ugural 1981). Similarly, the mass of each panel, and therefore the...Forum, 465, 143-150. Ugural A.C. (1981). Stresses in Plates and Shells, McGraw-Hill, New York. 30 TABLE CAPTIONS Table 1. Properties of air (at

1994 C. H. McCloy Research Lecture: Does Physical Activity Play a Role in Preventing Osteoporosis?

ERIC Educational Resources Information Center

Drinkwater, Barbara L.

1994-01-01

Review considers problems encountered in relating women's physical activity to increases in bone mass, noting the implications of recommending exercise to help prevent osteoporosis based on that information. Research indicates that for the full benefit of exercise on skeletal health, there must be adequate gonadal hormone levels. (SM)

Effect of polyethyleneglycol (PEG) chain length on the bio-nano-interactions between PEGylated lipid nanoparticles and biological fluids: from nanostructure to uptake in cancer cells

NASA Astrophysics Data System (ADS)

Pozzi, Daniela; Colapicchioni, Valentina; Caracciolo, Giulio; Piovesana, Susy; Capriotti, Anna Laura; Palchetti, Sara; de Grossi, Stefania; Riccioli, Anna; Amenitsch, Heinz; Laganà, Aldo

2014-02-01

When nanoparticles (NPs) enter a physiological environment, medium components compete for binding to the NP surface leading to formation of a rich protein shell known as the ``protein corona''. Unfortunately, opsonins are also adsorbed. These proteins are immediately recognized by the phagocyte system with rapid clearance of the NPs from the bloodstream. Polyethyleneglycol (PEG) coating of NPs (PEGylation) is the most efficient anti-opsonization strategy. Linear chains of PEG, grafted onto the NP surface, are able to create steric hindrance, resulting in a significant inhibition of protein adsorption and less recognition by macrophages. However, excessive PEGylation can lead to a strong inhibition of cellular uptake and less efficient binding with protein targets, reducing the potential of the delivery system. To reach a compromise in this regard we employed a multi-component (MC) lipid system with uncommon properties of cell uptake and endosomal escape and increasing length of PEG chains. Nano liquid chromatography coupled with tandem mass spectrometry (nanoLC-MS/MS) analysis allowed us to accurately determine the corona composition showing that apolipoproteins are the most abundant class in the corona and that increasing the PEG length reduced the protein adsorption and the liposomal surface affinity for apolipoproteins. Due to the abundance of apolipoproteins, we exploited the ``protein corona effect'' to deliver cationic liposome-human plasma complexes to human prostate cancer PC3 cells that express a high level of scavenger receptor class B type 1 in order to evaluate the cellular uptake efficiency of the systems used. Combining laser scanning confocal microscopy with flow cytometry analysis in PC3 cells we demonstrated that MC-PEG2k is the best compromise between an anti-opsonization strategy and active targeting and could be a promising candidate to treat prostate cancer in vivo.When nanoparticles (NPs) enter a physiological environment, medium components compete for binding to the NP surface leading to formation of a rich protein shell known as the ``protein corona''. Unfortunately, opsonins are also adsorbed. These proteins are immediately recognized by the phagocyte system with rapid clearance of the NPs from the bloodstream. Polyethyleneglycol (PEG) coating of NPs (PEGylation) is the most efficient anti-opsonization strategy. Linear chains of PEG, grafted onto the NP surface, are able to create steric hindrance, resulting in a significant inhibition of protein adsorption and less recognition by macrophages. However, excessive PEGylation can lead to a strong inhibition of cellular uptake and less efficient binding with protein targets, reducing the potential of the delivery system. To reach a compromise in this regard we employed a multi-component (MC) lipid system with uncommon properties of cell uptake and endosomal escape and increasing length of PEG chains. Nano liquid chromatography coupled with tandem mass spectrometry (nanoLC-MS/MS) analysis allowed us to accurately determine the corona composition showing that apolipoproteins are the most abundant class in the corona and that increasing the PEG length reduced the protein adsorption and the liposomal surface affinity for apolipoproteins. Due to the abundance of apolipoproteins, we exploited the ``protein corona effect'' to deliver cationic liposome-human plasma complexes to human prostate cancer PC3 cells that express a high level of scavenger receptor class B type 1 in order to evaluate the cellular uptake efficiency of the systems used. Combining laser scanning confocal microscopy with flow cytometry analysis in PC3 cells we demonstrated that MC-PEG2k is the best compromise between an anti-opsonization strategy and active targeting and could be a promising candidate to treat prostate cancer in vivo. Electronic supplementary information (ESI) available: Table S1. The slope of the lines fitting the temporal evolution of size and zeta-potential of MC, MC-PEG1k, MC-PEG2k and MC-PEG5k liposomes. Table S2. The full list of the most abundant corona proteins associated with MC, MC-PEG1k, MC-PEG2k and MC-PEG5k liposomes as identified by NanoLC-MS/MS. See DOI: 10.1039/c3nr05559k

A new time of flight mass spectrometer for absolute dissociative electron attachment cross-section measurements in gas phase

NASA Astrophysics Data System (ADS)

Chakraborty, Dipayan; Nag, Pamir; Nandi, Dhananjay

2018-02-01

A new time of flight mass spectrometer (TOFMS) has been developed to study the absolute dissociative electron attachment (DEA) cross section using a relative flow technique of a wide variety of molecules in gas phase, ranging from simple diatomic to complex biomolecules. Unlike the Wiley-McLaren type TOFMS, here the total ion collection condition has been achieved without compromising the mass resolution by introducing a field free drift region after the lensing arrangement. The field free interaction region is provided for low energy electron molecule collision studies. The spectrometer can be used to study a wide range of masses (H- ion to few hundreds atomic mass unit). The mass resolution capability of the spectrometer has been checked experimentally by measuring the mass spectra of fragment anions arising from DEA to methanol. Overall performance of the spectrometer has been tested by measuring the absolute DEA cross section of the ground state SO2 molecule, and the results are satisfactory.

Strong Field Quenching of the Quasiparticle Effective Mass in Heavy Fermion Compound YbCo2Zn20

NASA Astrophysics Data System (ADS)

Masahiro Ohya,; Masaki Matsushita,; Shingo Yoshiuchi,; Tetsuya Takeuchi,; Fuminori Honda,; Rikio Settai,; Toshiki Tanaka,; Yasunori Kubo,; Yoshichika Ōnuki,

2010-08-01

We found a metamagnetic like anomaly at Hm≃ 5 kOe in a heavy fermion compound YbCo2Zn20 below the characteristic temperature Tχ_{max}=0.32 K where the ac-susceptibility shows a broad peak, suggesting that an electronic state with a very low Kondo temperature is realized. Interestingly, the metamagnetic like behavior was observed as two peaks at 4.0 and 7.5 kOe at 95 mK in the magnetic field dependence of the electronic specific heat C/T. The extremely large values of the electronic specific heat coefficient γ≃ 8000 mJ/(K2\\cdotmol) and A=160 μΩ\\cdotcm/K2 in the electrical resistivity ρ=ρ0+AT2 at H=0 kOe are most likely due to the very low Kondo temperature. The \\sqrt{A} value was, however, found to be strongly reduced from \\sqrt{A}=12.6 (μΩ\\cdotcm/K2)1/2 at 0 kOe to 0.145 (μΩ\\cdotcm/K2)1/2 at 150 kOe. Therefore, we considered that the corresponding cyclotron effective mass mc*, which was determined from the temperature dependence of the de Haas-van Alphen (dHvA) amplitude, is also reduced with increasing magnetic field and is in fact not large, ranging from 2 to 9m0 at 117 kOe. From the field dependence of \\sqrt{A} and mc*, we estimated the cyclotron effective mass at 0 kOe to be 100--500m0, revealing the largest cyclotron mass as far as we know.

ACTH is a novel regulator of bone mass.

PubMed

Isales, Carlos M; Zaidi, Mone; Blair, Harry C

2010-03-01

Adrenocorticotropin (ACTH) is one of several peptide hormones derived from a larger molecule, proopiomelanocortin (POMC). ACTH is a classic endocrine hormone, processed and secreted from the pituitary to stimulate cortisol production from the fasciculata cells in the adrenal gland. However, ACTH is also produced by other cells, including macrophages, at many sites in the body. ACTH binds to a specific member of the melanocortin receptor family, the MC2R. MC2R is expressed in osteoblastic cells in vivo, as shown by in situ hybridization. MC2R expression is strongest at sites of active bone deposition, and thus ACTH response probably varies with osteoblastic activity or stage of osteoblast differentiation. In vitro ACTH stimulates proliferation of osteoblasts in a dose-dependent manner. ACTH at 10 nM increases collagen I mRNA in the osteoblastic cell line SaOs2, although at lower concentrations ACTH may oppose osteoblast differentiation. ACTH is thus, at high concentrations, anabolic for the osteoblast, and it is highly likely that the hormone has concentration-dependent effects on bone metabolism in vivo.

VLT-MAD Observations of Trumpler 14

NASA Astrophysics Data System (ADS)

Rochau, B.; Brandner, W.; Stolte, A.; Henning, T.; da Rio, N.; Gennaro, M.; Hormuth, F.; Marchetti, E.; Amico, P.

We present H and KS observations of the young massive cluster Trumpler 14 obtained with the MCAO system VLT-MAD which provides homogeneous Strehl ratios over a large field of view. We derived maximum Strehl ratios of 9.8% and 12.6% with mean Strehl ratios of 6.0% and 5.9% with in H and K_S, respectively, revealing significant improvement of the spatial PSF stability compared to SCAO systems. We detected 2-3 times more sources than comparable seeing-limited observations, and comparison of the colour-magnitude diagram with isochrones reveals a very young cluster that originated in a starburst-like event 1 ± 0.5 Myr ago. We also tentatively detect hints for an older population of 3 Myr. The mass function between 0.25 Msun and 3.2 Msun appears as a broken power law with a change of the power law slope at m_c ˜ 0.53+0.12-0.10 Msun. Shallow power law slopes are found to be Gamma_{PD,PMS1} = ˜ 0.48 ± 0.11 above m_c and Gamma_{PD,PMS2} = 0.68 ± 0.30 below m_c.

Decay constants $$f_B$$ and $$f_{B_s}$$ and quark masses $$m_b$$ and $$m_c$$ from HISQ simulations

DOE Office of Scientific and Technical Information (OSTI.GOV)

Komijani, J.; et al.

2016-11-22

We present a progress report on our calculation of the decay constantsmore » $$f_B$$ and $$f_{B_s}$$ from lattice-QCD simulations with highly-improved staggered quarks. Simulations are carried out with several heavy valence-quark masses on $(2+1+1)$-flavor ensembles that include charm sea quarks. We include data at six lattice spacings and several light sea-quark masses, including an approximately physical-mass ensemble at all but the smallest lattice spacing, 0.03 fm. This range of parameters provides excellent control of the continuum extrapolation to zero lattice spacing and of heavy-quark discretization errors. Finally, using the heavy-quark effective theory expansion we present a method of extracting from the same correlation functions the charm- and bottom-quark masses as well as some low-energy constants appearing in the heavy-quark expansion.« less

An Astrometric Study of the Low-Mass Binary Star Ross 614

NASA Astrophysics Data System (ADS)

Gatewood, George; Coban, Louis; Han, Inwoo

2003-03-01

Long accepted as the quintessential low-mass star, the secondary of the nearby diminutive astrometric binary Ross 614 has attracted considerable astrophysical interest. Unfortunately, the orbital period of 16.6 yr exceeds the duration of the mission-limited studies of most space-borne or instrumental-proving observational programs. As with most such binaries, the only full-orbit studies are based on photographic materials. The last extended study of this system was based upon the plate collections of the McCormick and Sproul Observatories. The work reported here combines data from the Multichannel Astrometric Photometer, the Hipparcos Intermediate Astrometric Data, the previously unmeasured photographic plates of the Allegheny Observatory, published observations of the visual binary, and recently published radial velocities of the system. Together, these data span more than three orbits of the low-mass binary system. Limiting our analysis to the most recent observations of the binary, and five older observations that are in fair agreement with them, we find masses of 0.2228+/-0.0055 and 0.1107+/-0.0028 Msolar for the primary and secondary, respectively, with the largest source of error being the visual separations of the system. We find a parallax of 244.07+/-0.73 mas, a period of 16.595+/-0.0077 yr, and an increased estimate of the semimajor axis of 1101.2+/-8.2 mas. The latter led to a significant increase in the computed masses. All other aspects of the orbital elements and astrometry are in excellent agreement with those found in the independent study of the McCormick and Sproul plates. The importance of long-term astrometric coverage is pointed out by the fact that the orbital motion of the system only resulted in an acceleration during the compilation of the Hipparcos Catalogue. No orbital parameters or mass estimates can be discerned from these high-precision but short-term data.

Honeywell optical investigations on FLASH program

NASA Astrophysics Data System (ADS)

O'Rourke, Ken; Peterson, Eric; Yount, Larry

1995-05-01

The increasing performance and reduction of life cycle cost requirements placed on commercial and military transport aircraft are resulting in more complex, highly integrated aircraft control and management systems. The use of fiber optic data transmission media can make significant contributions in achieving these performance and cost goals. The Honeywell portion of Task 2A on the Fly-by-Light Advanced System Hardware (FLASH) program is evaluating a Primary Flight Control System (PFCS) using pilot and copilot inputs from Active Hand Controllers (AHC) which are optically linked to the primary flight Control Computers (PFCC). Customer involvement is an important element of the Task 2A activity. Establishing customer requirements and perspectives on productization of systems developed under FLASH are key to future product success. The Honeywell elements of the PFCS demonstrator provide a command path that is optically interfaced from crew inputs to commands of distributed, smart actuation subsystems commands. Optical communication architectures are implemented using several protocols including the new AS-1773A 20 Mbps data bus standard. The interconnecting fiber optic cable plant is provided by our Task 1A teammate McDonnell Douglas Aerospace (West). Fiber optic cable plant fabrication uses processed, tools and materials reflecting necessary advances in manufacturing required to make fly-by-light avionics systems marketable.

Responding to health care reform by addressing the institute of medicine report on the future of nursing.

PubMed

Ellerbe, Suellyn; Regen, Debra

2012-01-01

The current health care environment has heightened the importance of achieving positive patient outcomes and excellent customer satisfaction. To remain competitive, health care organizations must adapt quickly to changing regulatory requirements, quality improvement initiatives, and customer expectations. To ensure nursing practice at the Saint Clare's Health System in Northwest New Jersey is at the forefront of leading change, the nursing staff has embraced the Institute of Medicine report The Future of Nursing: Leading Change. The empowered nursing team has applied Benner's Novice to Expert model and McCauley's Careful Nursing Theory as the foundation for nursing practice. The ability to apply evidence-based nursing research and cultivate professional development at the bedside has resulted in retention of expert nurses at the bedside. Engaging the nursing team has resulted in increased patient satisfaction and improved clinical outcomes. Advanced practice nurses play an important role to mentor the nursing staff and promote an interdisciplinary, collaborative relationship between all health care disciplines and community support programs. Nurses are recognized for their accomplishments and encouraged to obtain specialty certification, advanced degrees, and earn state and national recognition through professional organizations. The professional nurses at the Saint Clare's Health System are prepared to work in whatever environment the new normal creates.

JS-MS: a cross-platform, modular javascript viewer for mass spectrometry signals.

PubMed

Rosen, Jebediah; Handy, Kyle; Gillan, André; Smith, Rob

2017-11-06

Despite the ubiquity of mass spectrometry (MS), data processing tools can be surprisingly limited. To date, there is no stand-alone, cross-platform 3-D visualizer for MS data. Available visualization toolkits require large libraries with multiple dependencies and are not well suited for custom MS data processing modules, such as MS storage systems or data processing algorithms. We present JS-MS, a 3-D, modular JavaScript client application for viewing MS data. JS-MS provides several advantages over existing MS viewers, such as a dependency-free, browser-based, one click, cross-platform install and better navigation interfaces. The client includes a modular Java backend with a novel streaming.mzML parser to demonstrate the API-based serving of MS data to the viewer. JS-MS enables custom MS data processing and evaluation by providing fast, 3-D visualization using improved navigation without dependencies. JS-MS is publicly available with a GPLv2 license at github.com/optimusmoose/jsms.

Dynamics of large-scale solar wind streams obtained by the double superposed epoch analysis

NASA Astrophysics Data System (ADS)

Yermolaev, Yu. I.; Lodkina, I. G.; Nikolaeva, N. S.; Yermolaev, M. Yu.

2015-09-01

Using the OMNI data for period 1976-2000, we investigate the temporal profiles of 20 plasma and field parameters in the disturbed large-scale types of solar wind (SW): corotating interaction regions (CIR), interplanetary coronal mass ejections (ICME) (both magnetic cloud (MC) and Ejecta), and Sheath as well as the interplanetary shock (IS). To take into account the different durations of SW types, we use the double superposed epoch analysis (DSEA) method: rescaling the duration of the interval for all types in such a manner that, respectively, beginning and end for all intervals of selected type coincide. As the analyzed SW types can interact with each other and change parameters as a result of such interaction, we investigate separately eights sequences of SW types: (1) CIR, (2) IS/CIR, (3) Ejecta, (4) Sheath/Ejecta, (5) IS/Sheath/Ejecta, (6) MC, (7) Sheath/MC, and (8) IS/Sheath/MC. The main conclusion is that the behavior of parameters in Sheath and in CIR are very similar both qualitatively and quantitatively. Both the high-speed stream (HSS) and the fast ICME play a role of pistons which push the plasma located ahead them. The increase of speed in HSS and ICME leads at first to formation of compression regions (CIR and Sheath, respectively) and then to IS. The occurrence of compression regions and IS increases the probability of growth of magnetospheric activity.

Adsorption of Ten Microcystin Congeners to Common Laboratory-Ware Is Solvent and Surface Dependent

PubMed Central

Altaner, Stefan; Puddick, Jonathan; Wood, Susanna A.; Dietrich, Daniel R.

2017-01-01

Cyanobacteria can produce heptapetides called microcystins (MC) which are harmful to humans due to their ability to inhibit cellular protein phosphatases. Quantitation of these toxins can be hampered by their adsorption to common laboratory-ware during sample processing and analysis. Because of their structural diversity (>100 congeners) and different physico-chemical properties, they vary in their adsorption to surfaces. In this study, the adsorption of ten different MC congeners (encompassing non-arginated to doubly-arginated congeners) to common laboratory-ware was assessed using different solvent combinations. Sample handling steps were mimicked with glass and polypropylene pipettes and vials with increasing methanol concentrations at two pH levels, before analysis by liquid chromatography-tandem mass spectrometry. We demonstrated that MC adsorb to polypropylene surfaces irrespective of pH. After eight successive pipet actions using polypropylene tips ca. 20% of the MC were lost to the surface material, which increased to 25%–40% when solutions were acidified. The observed loss was alleviated by changing the methanol (MeOH) concentration in the final solvent. The required MeOH concentration varied depending on which congener was present. Microcystins only adsorbed to glass pipettes (loss up to 30% after eight pipet actions) when in acidified aqueous solutions. The latter appeared largely dependent on the presence of ionizable groups, such as arginine residues. PMID:28383495

Relationship between metabolic control and self-monitoring of blood glucose in insulin-treated patients with diabetes mellitus.

PubMed

Soto González, Alfonso; Quintela Fernández, Niurka; Pumar López, Alfonso; Darias Garzón, Ricardo; Rivas Fernández, Margarita; Barberá Comes, Gloria

2015-05-01

To assess the relationship between metabolic control (MC) and frequency of self-monitoring of blood glucose (SMBG) in insulin-treated patients with type 1 (T1DM) and type 2 (T2DM) diabetes mellitus, and to analyze the factors associated to MC. A multicenter, cross-sectional, observational study was conducted in which endocrinologists enrolled diabetic patients treated with insulin who used a glucometer. The cut-off value for MC was HbA1c ≤ 7%. Grade of acceptance of the glucometer was assessed using a visual analogue scale (VAS). A total of 341 patients (53.5% males) with a mean age (SD) 52.8 (16.3) years, mean HbA1c of 7.69% (1.25) and 128 (37.5%) with T1DM and 211 (61.9%) with T2DM were evaluable. SMBG was done by 86.1% at least once weekly. No relationship was seen between MC and SMBG (P=.678) in the overall sample or in the T1DM (P=.940) or T2DM (P=.343) subgroups. In the logistic regression model, hyperglycemic episodes (Exp-b [risk] 1.794, P=0.022), falsely elevated HbA1c values (Exp-b 3.182, P=.005), and VAS (Exp-b 1.269, P=.008) were associated to poor MC in the total sample. Hyperglycemic episodes (Exp-b 2.538, P=.004), falsely elevated HbA1c values (Exp-b 3.125, P=.012), and VAS (Exp-b 1.316, P=.026) were associated to poor MC in the T2DM subgroup, while body mass index (Exp-b 1.143, P=.046) was associated to poor MC in the T1DM subgroup. In this retrospective, non-controlled study on patients with DM treated with insulin who used a glucometer, no relationship was seen between the degree of metabolic control and frequency of use of the glucometer. Copyright © 2014 SEEN. Published by Elsevier España, S.L.U. All rights reserved.

Optimization of extraction methods for quantification of microcystin-LR and microcystin-RR in fish, vegetable, and soil matrices using UPLC-MS/MS.

PubMed

Manubolu, Manjunath; Lee, Jiyoung; Riedl, Kenneth M; Kua, Zi Xun; Collart, Lindsay P; Ludsin, Stuart A

2018-06-01

Human-driven environmental change has increased the occurrence of harmful cyanobacteria blooms in aquatic ecosystems. Concomitantly, exposure to microcystin (MC), a cyanobacterial toxin that can accumulate in animals, edible plants, and agricultural soils, has become a growing public health concern. For accurate estimation of health risks and timely monitoring, availability of reliable detection methods is imperative. Nonetheless, quantitative analysis of MCs in many types of biological and environmental samples has proven challenging because matrix interferences can hinder sample preparation and extraction procedures, leading to poor MC recovery. Herein, controlled experiments were conducted to enhance the use of ultra-performance liquid-chromatography tandem-mass spectrometry (UPLC-MS/MS) to recover MC-LR and MC-RR at a range of concentrations in seafood (fish), vegetables (lettuce), and environmental (soil) matrices. Although these experiments offer insight into detailed technical aspects of the MC homogenization and extraction process (i.e., sonication duration and centrifugation speed during homogenization; elution solvent to use during the final extraction), they centered on identifying the best (1) solvent system to use during homogenization (2-3 tested per matrix) and (2) single-phase extraction (SPE) column type (3 tested) to use for the final extraction. The best procedure consisted of the following, regardless of sample type: centrifugation speed = 4200 × g; elution volume = 8 mL; elution solvent = 80% methanol; and SPE column type = hydrophilic-lipophilic balance (HLB), with carbon also being satisfactory for fish. For sonication, 2 min, 5 min, and 10 min were optimal for fish, lettuce, and soil matrices, respectively. Using the recommended HLB column, the solvent systems that led to the highest recovery of MCs were methanol:water:butanol for fish, methanol:water for lettuce, and EDTA-Na 4 P 2 O 7 for soils. Given that the recommended procedures resulted in average MC-LR and MC-RR recoveries that ranged 93 to 98%, their adoption for the preparation of samples with complex matrices before UPLC-MS/MS analysis is encouraged. Copyright © 2018 Elsevier B.V. All rights reserved.

The Atmospheric Chemistry of Methyl Chavicol (Estragole)

NASA Astrophysics Data System (ADS)

Bloss, W. J.; Alam, M. S.; Rickard, A. R.; Hamilton, J. F.; Pereira, K. F.; Camredon, M.; Munoz, A.; Vazquez, M.; Alacreu, P.; Rodenas, M.; Vera, T.

2012-12-01

The oxidation of volatile organic compounds (VOCs) leads to formation of ozone and secondary organic aerosols (SOA), with consequences for health, air quality, crop yields, atmospheric chemistry and radiative transfer. It is estimated that ca. 90 % of VOC emissions to the atmosphere originate from biogenic sources (BVOC); such emissions may increase under future climates. Recent field observations have identified Methyl Chavicol ("MC" hereafter, also known as Estragole; 1-allyl-4-methoxybenzene, C10H12O) as a major BVOC above pine forests in the USA [Bouvier-Brown et al., 2009], and within an oil palm plantation in Malaysian Borneo, where it was found that MC could represent the highest single floral contribution of reactive carbon to the atmosphere [Misztal et al., 2010]. Palm oil cultivation, and hence emissions of MC, may be expected to increase with societal food and biofuel demand. We present the results of a series of simulation chamber experiments to assess the atmospheric fate of MC. Experiments were performed in the EUPHORE (European Photoreactor) facility in Valencia, Spain (200 m3 outdoor smog chamber), investigating the degradation of MC by reaction with OH, O3 and NO3. An extensive range of measurement instrumentation was used to monitor precursor and product formation, including stable species (FTIR, PTR-MS, GC-FID and GC-MS), radical intermediates (LIF), inorganic components (NOx, O3, HONO (LOPAP and aerosol production (SMPS) and composition (PILS and filters; analysed offline by LC-MS and FTICR-MS). Experiments were conducted at a range of NOx:VOC ratios, and in the presence and absence of radical (OH) scavenger compounds. This chamber dataset is used to determine the rate constants for reaction of MC with OH, O3 and NO3, the ozonolysis radical yields, and identify the primary degradation products for each initiation route, alongside the aerosol mass yields. Aerosol composition measurements are analysed to identify markers for MC contributions to SOA formation in the ambient atmosphere. The results are compared with the (limited) previous smog chamber results, and discussed in the context of the recent field data on MC production and emissions. References Bouvier-Brown et al., Atmos. Chem. Phys. 9, 2061, 2009 Misztal et al., Atmos. Chem. Phys. 10, 4343, 2010.

Pyrolysis-Gas Chromatography/Mass Spectrometry of Thermoplastic Polymers

DTIC Science & Technology

1988-04-01

e e- _.. d . %, % ." i WnU xu.U U W" V m Ifw V E IrWW W2’ V ~-.- , . . , S 3.3.5 Polyamide (Nylon 6, 6 T). The thermal degradation of aliphatic...POLYMERS * J.A. Hiltz - M.C. Bissonnette April 1988 Approved by L.J. Leggat Di7 5 tr/ecr;z v ;ion DISTRIBUTION APPROVED BY D /TO TECHNICAL MEMORANDUM 88...detection par spectrom6trie de masse et ionisation de flaime. Les r~sultats indiquent qu’un plastique inconnu peut Atre identifi6 d’apr& s ses produits

Metabolic activation of 3-hydroxyanisole by isolated rat hepatocytes.

PubMed

Moridani, Majid Y; Cheon, Sophia S; Khan, Sumsullah; O'Brien, Peter J

2003-01-06

A tyrosinase-directed therapeutic approach for malignant melanoma therapy uses the depigmenting phenolic agents such as 4-hydroxyanisole (4-HA) to form cytotoxic o-quinones. However, renal and hepatic toxicity was reported as side effects in a recent 4-HA clinical trial. In search of novel therapeutics, the cytotoxicity of the isomers 4-HA, 3-HA and 2-HA were investigated. In the following, the order of the HAs induced hepatotoxicity in mice, as measured by increased in vivo plasma transaminase activity, or in isolated rat hepatocytes, as measured by trypan blue exclusion, was 3-HA > 2-HA > 4-HA. Hepatocyte GSH depletion preceded HA induced cytotoxicity and a 4-MC-SG conjugate was identified by LC/MS/MS mass spectrometry analysis when 3-HA was incubated with NADPH/microsomes/GSH. 3-HA induced hepatocyte GSH depletion or GSH depletion when 3-HA was incubated with NADPH/microsomes was prevented by CYP 2E1 inhibitors. Dicumarol (an NAD(P)H: quinone oxidoreductase inhibitor) potentiated 3-HA- or 4-methoxycatechol (4-MC) induced toxicity whereas sorbitol (an NADH generating nutrient) greatly prevented cytotoxicity indicating a quinone-mediated cytotoxic mechanism. Ethylendiamine (an o-quinone trap) largely prevented 3-HA and 4-MC-induced cytotoxicity indicating that o-quinone was involved in cytotoxicity. Dithiothreitol (DTT) greatly reduced 3-HA and 4-MC induced toxicity. The ferric chelator deferoxamine slightly decreased 3-HA and 4-MC induced cytotoxicity whereas the antioxidants pyrogallol or TEMPOL greatly prevented the toxicity suggesting that oxidative stress contributed to 3-HA induced cytotoxicity. In summary, ring hydroxylation but not O-demethylation/epoxidation seems to be the bioactivation pathway for 3-HA in rat liver. The cytotoxic mechanism for 3-HA and its metabolite 4-MC likely consists cellular protein alkylation and oxidative stress. These results suggest that 3-HA is not suitable for treatment of melanoma. Copyright 2002 Elsevier Science B.V.

Determination of 238u/235u, 236u/238u and uranium concentration in urine using sf-icp-ms and mc-icp-ms: an interlaboratory comparison.

PubMed

Parrish, Randall R; Thirlwall, Matthew F; Pickford, Chris; Horstwood, Matthew; Gerdes, Axel; Anderson, James; Coggon, David

2006-02-01

Accidental exposure to depleted or enriched uranium may occur in a variety of circumstances. There is a need to quantify such exposure, with the possibility that the testing may post-date exposure by months or years. Therefore, it is important to develop a very sensitive test to measure precisely the isotopic composition of uranium in urine at low levels of concentration. The results of an interlaboratory comparison using sector field (SF)-inductively coupled plasma-mass spectrometry (ICP-MS) and multiple collector (MC)-ICP-MS for the measurement of uranium concentration and U/U and U/U isotopic ratios of human urine samples are presented. Three urine samples were verified to contain uranium at 1-5 ng L and shown to have natural uranium isotopic composition. Portions of these urine batches were doped with depleted uranium (DU) containing small quantities of U, and the solutions were split into 100 mL and 400 mL aliquots that were subsequently measured blind by three laboratories. All methods investigated were able to measure accurately U/U with precisions of approximately 0.5% to approximately 4%, but only selected MC-ICP-MS methods were capable of consistently analyzing U/U to reasonable precision at the approximately 20 fg L level of U abundance. Isotope dilution using a U tracer demonstrates the ability to measure concentrations to better than +/-4% with the MC-ICP-MS method, though sample heterogeneity in urine samples was shown to be problematic in some cases. MC-ICP-MS outperformed SF-ICP-MS methods, as was expected. The MC-ICP-MS methodology described is capable of measuring to approximately 1% precision the U/U of any sample of human urine over the entire range of uranium abundance down to <1 ng L, and detecting very small amounts of DU contained therein.

Isolation and Puification of Uranium Isotopes for Measurement by Mass-Spectrometry (233, 234, 235, 236, 238U) and Alpha Spectrometry (232U)

DOE Office of Scientific and Technical Information (OSTI.GOV)

Marinelli, R; Hamilton, T; Brown, T

2006-05-30

This report describes a standardized methodology used by researchers from the Center for Accelerator Mass Spectrometry (CAMS) (Energy and Environment Directorate) and the Environmental Radiochemistry Group (Chemistry and Materials Science Directorate) at the Lawrence Livermore National Laboratory (LLNL) for the full isotopic analysis of uranium from solution. The methodology has largely been developed for use in characterizing the uranium composition of selected nuclear materials but may also be applicable to environmental studies and assessments of public, military or occupational exposures to uranium using in-vitro bioassay monitoring techniques. Uranium isotope concentrations and isotopic ratios are measured using a combination of Multimore » Collector Inductively Coupled Plasma Mass Spectrometry (MC ICP-MS), Accelerator Mass Spectrometry (AMS) and Alpha Spectrometry.« less

WISE 2005-2006: 60-days of Head-Down Bed Rest Increases the Incidence of Menstrual Cycle Disruption

NASA Astrophysics Data System (ADS)

Wade, Charles

Objective: It has been suggested that acute bed rest of short duration (11 days) disrupts the menstrual cycle of healthy subjects. Furthermore, use of countermeasures such as heavy exercise or dietary manipulations may adversely effect the menstrual cycle. We hypothesized that bed rest of 60 days and the use of countermeasures would increase the incidence of disruption of the menstrual cycle (MC). Methods: Twenty-four healthy subjects with a mean age of 32±0.8 yr, body mass of 59±0.8 kg and MC lengths of 25-32 days were enrolled. Three months prior to the study subjects did not use hormonal birth control methods. Subjects were assigned to one of three groups (n=8 per group): control, exercise countermeasures, and dietary countermeasures. MC lengthening was defined as an increase in duration of 10 or more days. Analysis was performed accounting for the effects of bedrest as well as treatment group. Results: Effects of countermeasures were not significant in the present analysis. After the conclusion of the study, subjects were classified as either normal (N; n=16) or oligomenorrhea (O; n=8) as determined by MC length during the pre-bed rest (PB) and bed rest (BR) periods. During the control period prior to bed rest one subject (4%) had an increase MC length. During the control period the average MC length was 31±0.8 days with a leutinizing hormone (LH) surge 12±0.8 days prior to menses. The duration of menses was 4±0.4 days. During BR there was an increase to 33% (p¡0.05) in the number of subjects having MC lengthening. In these subjects the mean length was increased from 31±0.9 to 62±8.2 days (p¡0.05). There was no change in the period from the LH surge prior to the next menses, 11±0.8 days, or duration of menses, 4±0.2 days. Plasma LH, follicle stimulating hormone (FSH), prolacin (PRL), progesterone (PRG), estradiol (E2), dehydroepiandrosterone sulfate (DHEA-S), aldosterone (Aldo), testosterone (T) and cortisol (C) were measured during PB, BR, early post bed rest (day 0-day 60;EPBR) and late post bed rest (day 60-day 367;LPBR). Plasma PRG was significantly higher (p¡0.02) in the N group before BR and continued throughout the BR period. A significant difference in E2 was observed in the N group between PB and BR, BR and EPBR, and EPBR and LPBR (p¡0.01). E2 was significantly different between N and O during BR (p¡0.02). No differences were observed in the other plasma measurements. Daily urine samples demonstrated no changes in C or Aldo over the course of the study. At 6 and 12 months following completion of the study all subjects reported normal MC. Conclusion: The lengthening of menstrual cycle during bed rest is a result of a delay in ovulation due to the absence of a LH surge (ovulation) associated with lower PRG and E2 levels. In females, changes in menstrual cycles may be a contributing factor to the adverse responses to bed rest such as loss of bone mass, reductions in blood volume and decreased work performance.

Biomass burning and urban air pollution over the central Mexican Plateau [Discussions

Treesearch

J. D. Crounse; P. F. DeCarlo; D. R. Blake; L. K. Emmons; T. L. Campos; E. C. Apel; A. D. Clarke; A. J. Weinheimer; D. C. McCabe; R. J. Yokelson; J. L. Jimenez; P. O. Wennberg

2009-01-01

Observations during the 2006 dry season of highly elevated concentrations of cyanides in the atmosphere above Mexico City (MC) and the surrounding plains, demonstrate that biomass burning (BB) significantly impacted air quality in the region. We find that during the period of our measurements, fires contribute more than half of the organic aerosol mass and submicron...

Proceedings of the Annual Meeting of the Association for Education in Journalism and Mass Communication (80th, Chicago, Illinois, July 30-August 2, 1997): Science Communication.

ERIC Educational Resources Information Center

Association for Education in Journalism and Mass Communication.

The Science Communication section of the Proceedings contains the following seven papers: "Getting an Advance Look: Controversies over Embargoes in Science Journalism" (Vincent Kiernan); "Perceptions of Newspaper Bias in a Local Environmental Controversy" (Katherine A. McComas; Clifford W. Scherer; Cynthia Heffelfinger);…

3D-atom probe characterization of nano-precipitates in a PM processed tool steels

NASA Astrophysics Data System (ADS)

Niederkofler, M.; Leisch, M.

2004-07-01

The microstructure of a powder metallurgical processed high speed steel (nom. composition (wt.%): 1.6 C, 4.8 Cr, 2.0 Mo, 5.0 V, 105 W, 8.0 Co and balance Fe) has been examined using 3D-atom probe technique. By the depth profiling of the time to flight mass spectrometer and position sensitive recording, cylindrical volumes of 10-15 nm in diameter and up to 40 nm in depth have been probed and characterized. The depth profiling measurements of the samples show generally a very homogeneous structure which was expected by the powder metallurgical processing of the material. Different morphologies of the precipitates were recorded. Besides the needle shaped precipitates with an extend up to 20 nm and thickness of few atomic layers, platelets and spherical particles are observed as well. The species which can be assigned to the precipitates appear to some extend as MC molecules in the mass histogram, while the leading constituents in this MC are Mo, V and Cr. Beside distinct particles agglomerations like one-dimensional atomic chains of the alloy components are also observed in the 3D reconstructions of the tool steel matrix.

LLE Review Quarterly Report January - March 2012. Volume 130

DOE Office of Scientific and Technical Information (OSTI.GOV)

Shvydky, Alex

2012-03-01

This volume of the LLE Review, covering January–March 2012, features “OMEGA Polar-Drive Target Designs,” by P. B. Radha, J. A. Marozas, F. J. Marshall, A. Shvydky, T. J. B. Collins, V. N. Goncharov, R. L. McCrory, P. W. McKenty, D. D. Meyerhofer, T. C. Sangster, and S. Skupsky. This article (p. 57) describes low-adiabat, cryogenic-deuterium–tritium, and warm-plastic-shell polar-drive (PD)–implosion designs for the OMEGA laser. The designs are at two different on-target laser intensities, each at a different in-flight aspect ratio (IFAR). The first design permits one to study implosion energetics and target performance closer to ignition-relevant intensities (7 X 10more » 14 W/cm 2 at the quarter-critical surface), where nonlocal heat conduction and laser–plasma interactions can play an important role, but at lower values of IFAR (~22). The second design permits one to study implosion energetics and target performance at a lower intensity (3 X 10 14 W/cm 2) but at higher IFAR (~32), where the shell instability can play an important role. The higher IFAR designs are accessible on the existing OMEGA Laser System only at lower intensities. Implosions at ignition-relevant intensities can be obtained only by reducing target radius, although only at smaller values of IFAR. Polar-drive geometry requires repointing the laser beams to improve shell symmetry. The higher-intensity designs optimize target performance by repointing beams to a lesser extent and compensate for the reduced equatorial drive by increasing beam energies for the repointed beams and using custom beam profiles that improve equatorial illumination at the expense of irradiation at higher latitudes. These designs will be studied when new phase plates for the OMEGA Laser System, corresponding to the smaller target radii and custom beam profiles, are obtained. Implosion results from the combined set of high-intensity and high-IFAR implosions should yield valuable data to validate models of laser-energy deposition, heat conduction, nonuniformity growth, and fuel assembly in PD geometry.« less

Degradation mechanisms of Microcystin-LR during UV-B photolysis and UV/H2O2 processes: Byproducts and pathways.

PubMed

Moon, Bo-Ram; Kim, Tae-Kyoung; Kim, Moon-Kyung; Choi, Jaewon; Zoh, Kyung-Duk

2017-10-01

The removal and degradation pathways of microcystin-LR (MC-LR, [M+H] +  = 995.6) in UV-B photolysis and UV-B/H 2 O 2 processes were examined using liquid chromatography-tandem mass spectrometry. The UV/H 2 O 2 process was more efficient than UV-B photolysis for MC-LR removal. Eight by-products were newly identified in the UV-B photolysis ([M+H] +  = 414.3, 417.3, 709.6, 428.9, 608.6, 847.5, 807.4, and 823.6), and eleven by-products were identified in the UV-B/H 2 O 2 process ([M+H] +  = 707.4, 414.7, 429.3, 445.3, 608.6, 1052.0, 313.4, 823.6, 357.3, 245.2, and 805.7). Most of the MC-LR by-products had lower [M+H] + values than the MC-LR itself during both processes, except for the [M+H] + value of 1052.0 during UV-B photolysis. Based on identified by-products and peak area patterns, we proposed potential degradation pathways during the two processes. Bond cleavage and intramolecular electron rearrangement by electron pair in the nitrogen atom were the major reactions during UV-B photolysis and UV-B/H 2 O 2 processes, and hydroxylation by OH radical and the adduct formation reaction between the produced by-products were identified as additional pathways during the UV-B/H 2 O 2 process. Meanwhile, the degradation by-products identified from MC-LR during UV-B/H 2 O 2 process can be further degraded by increasing H 2 O 2 dose. Copyright © 2017 Elsevier Ltd. All rights reserved.

RM-493, a melanocortin-4 receptor (MC4R) agonist, increases resting energy expenditure in obese individuals.

PubMed

Chen, Kong Y; Muniyappa, Ranganath; Abel, Brent S; Mullins, Katherine P; Staker, Pamela; Brychta, Robert J; Zhao, Xiongce; Ring, Michael; Psota, Tricia L; Cone, Roger D; Panaro, Brandon L; Gottesdiener, Keith M; Van der Ploeg, Lex H T; Reitman, Marc L; Skarulis, Monica C

2015-04-01

Activation of the melanocortin-4 receptor (MC4R) with the synthetic agonist RM-493 decreases body weight and increases energy expenditure (EE) in nonhuman primates. The effects of MC4R agonists on EE in humans have not been examined to date. In a randomized, double-blind, placebo-controlled, crossover study, we examined the effects of the MC4R agonist RM-493 on resting energy expenditure (REE) in obese subjects in an inpatient setting. Twelve healthy adults (6 men and 6 women) with body mass index of 35.7 ± 2.9 kg/m(2) (mean ± SD) received RM-493 (1 mg/24 h) or placebo by continuous subcutaneous infusion over 72 hours, followed immediately by crossover to the alternate treatment. All subjects received a weight-maintenance diet (50% carbohydrate, 30% fat, and 20% protein) and performed 30 minutes of standardized exercise daily. Continuous EE was measured on the third treatment day in a room calorimeter, and REE in the fasting state was defined as the mean of 2 30-minute resting periods. RM-493 increased REE vs placebo by 6.4% (95% confidence interval, 0.68-13.02%), on average by 111 kcal/24 h (95% confidence interval, 15-207 kcal, P = .03). Total daily EE trended higher, whereas the thermic effect of a test meal and exercise EE did not differ significantly. The 23-hour nonexercise respiratory quotient was lower during RM-493 treatment (0.833 ± 0.021 vs 0.848 ± 0.022, P = .02). No adverse effect on heart rate or blood pressure was observed. Short-term administration of the MC4R agonist RM-493 increases REE and shifts substrate oxidation to fat in obese individuals.

RIP1-HAT1-SIRT Complex Identification and Targeting in Treatment and Prevention of Cancer.

PubMed

Carafa, Vincenzo; Nebbioso, Angela; Cuomo, Francesca; Rotili, Dante; Cobellis, Gilda; Bontempo, Paola; Baldi, Alfonso; Spugnini, Enrico P; Citro, Gennaro; Chambery, Angela; Russo, Rosita; Ruvo, Menotti; Ciana, Paolo; Maravigna, Luca; Shaik, Jani; Radaelli, Enrico; De Antonellis, Pasquale; Tarantino, Domenico; Pirolli, Adele; Ragno, Rino; Zollo, Massimo; Stunnenberg, Hendrik G; Mai, Antonello; Altucci, Lucia

2018-03-13

Purpose: Alteration in cell death is a hallmark of cancer. A functional role regulating survival, apoptosis, and necroptosis has been attributed to RIP1/3 complexes. Experimental Design: We have investigated the role of RIP1 and the effects of MC2494 in cell death induction, using different methods as flow cytometry, transcriptome analysis, immunoprecipitation, enzymatic assays, transfections, mutagenesis, and in vivo studies with different mice models. Results: Here, we show that RIP1 is highly expressed in cancer, and we define a novel RIP1/3-SIRT1/2-HAT1/4 complex. Mass spectrometry identified five acetylations in the kinase and death domain of RIP1. The novel characterized pan-SIRT inhibitor, MC2494, increases RIP1 acetylation at two additional sites in the death domain. Mutagenesis of the acetylated lysine decreases RIP1-dependent cell death, suggesting a role for acetylation of the RIP1 complex in cell death modulation. Accordingly, MC2494 displays tumor-selective potential in vitro , in leukemic blasts ex vivo, and in vivo in both xenograft and allograft cancer models. Mechanistically, MC2494 induces bona fide tumor-restricted acetylated RIP1/caspase-8-mediated apoptosis. Excitingly, MC2494 displays tumor-preventive activity by blocking 7,12-dimethylbenz(α)anthracene-induced mammary gland hyperproliferation in vivo Conclusions: These preventive features might prove useful in patients who may benefit from a recurrence-preventive approach with low toxicity during follow-up phases and in cases of established cancer predisposition. Thus, targeting the newly identified RIP1 complex may represent an attractive novel paradigm in cancer treatment and prevention. Clin Cancer Res; 1-15. ©2018 AACR. ©2018 American Association for Cancer Research.

Apportionment of NMHC tailpipe vs non-tailpipe emissions in the Fort McHenry and Tuscarora mountain tunnels

NASA Astrophysics Data System (ADS)

Gertler, Alan W.; Fujita, Eric M.; Pierson, William R.; Wittorff, David N.

Measurements of on-road emissions of non-methane hydrocarbons (NMHCs) were made in the Fort McHenry Tunnel (Baltimore) and Tuscarora Mountain Tunnel (Pennsylvania) during the summer of 1992. Measurements were made during 11 one-hour periods in the Fort McHenry Tunnel and during 11 one-hour periods in the Tuscarora Mountain Tunnel. The observed light-duty fleets were quite new, with a median model year of approximately 1989. Speciated NMHC values were obtained from analyses of canister and Tenax samples, and light-duty speciated emission factors were calculated for the two tunnels. Fuel samples were collected in the area around the tunnels for use in constructing headspace and liquid fuel profiles for the chemical mass balance (CMB) receptor model. Profiles of tailpipe emissions were obtained from the literature. The CMB was used to apportion tailpipe from non-tailpipe emissions. Non-tailpipe sources were found to constitute approximately 15% of the light-duty NMHC emissions. The Federal automotive emission-rate models, MOBILE4.1 and MOBILE5, underpredicted non-tailpipe emissions, assigning approximately 9% and 6.5%, respectively, to non-tailpipe sources. In terms of total absolute emissions, MOBILE5 predictions were approximately a factor of 2 greater than MOBILE4.1 predictions. Both MOBILE4.1 and MOBILE5 underestimated the NMHC emissions in the Fort McHenry Tunnel and overpredicted the NMHC emissions in the Tuscarora Mountain Tunnel. In all cases, the MOBILE models underestimated the absolute value of the non-tailpipe emissions. The ability of the MOBILE models to account for observed emissions when conditions are more variable than those studies in the Fort McHenry and Tuscarora Mountain tunnels is still an open question.

Exposure of Lycopersicon Esculentum to Microcystin-LR: Effects in the Leaf Proteome and Toxin Translocation from Water to Leaves and Fruits

PubMed Central

Gutiérrez-Praena, Daniel; Campos, Alexandre; Azevedo, Joana; Neves, Joana; Freitas, Marisa; Guzmán-Guillén, Remédios; Cameán, Ana María; Renaut, Jenny; Vasconcelos, Vitor

2014-01-01

Natural toxins such as those produced by freshwater cyanobacteria have been regarded as an emergent environmental threat. However, the impact of these water contaminants in agriculture is not yet fully understood. The aim of this work was to investigate microcystin-LR (MC-LR) toxicity in Lycopersicon esculentum and the toxin accumulation in this horticultural crop. Adult plants (2 month-old) grown in a greenhouse environment were exposed for 2 weeks to either pure MC-LR (100 μg/L) or Microcystis aeruginosa crude extracts containing 100 μg/L MC-LR. Chlorophyll fluorescence was measured, leaf proteome investigated with two-dimensional gel electrophoresis and Matrix Assisted Laser Desorption Ionization Time-of-Flight (MALDI-TOF)/TOF, and toxin bioaccumulation assessed by liquid chromatography-mass spectrometry (LC-MS)/MS. Variations in several protein markers (ATP synthase subunits, Cytochrome b6-f complex iron-sulfur, oxygen-evolving enhancer proteins) highlight the decrease of the capacity of plants to synthesize ATP and to perform photosynthesis, whereas variations in other proteins (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit and ribose-5-phosphate isomerase) suggest an increase of carbon fixation and decrease of carbohydrate metabolism reactions in plants exposed to pure MC-LR and cyanobacterial extracts, respectively. MC-LR was found in roots (1635.21 μg/kg fw), green tomatoes (5.15–5.41 μg/kg fw), mature tomatoes (10.52–10.83 μg/kg fw), and leaves (12,298.18 μg/kg fw). The results raise concerns relative to food safety and point to the necessity of monitoring the bioaccumulation of water toxins in agricultural systems affected by cyanotoxin contamination. PMID:24921194

Exposure of Lycopersicon esculentum to microcystin-LR: effects in the leaf proteome and toxin translocation from water to leaves and fruits.

PubMed

Gutiérrez-Praena, Daniel; Campos, Alexandre; Azevedo, Joana; Neves, Joana; Freitas, Marisa; Guzmán-Guillén, Remédios; Cameán, Ana María; Renaut, Jenny; Vasconcelos, Vitor

2014-06-11

Natural toxins such as those produced by freshwater cyanobacteria have been regarded as an emergent environmental threat. However, the impact of these water contaminants in agriculture is not yet fully understood. The aim of this work was to investigate microcystin-LR (MC-LR) toxicity in Lycopersicon esculentum and the toxin accumulation in this horticultural crop. Adult plants (2 month-old) grown in a greenhouse environment were exposed for 2 weeks to either pure MC-LR (100 μg/L) or Microcystis aeruginosa crude extracts containing 100 μg/L MC-LR. Chlorophyll fluorescence was measured, leaf proteome investigated with two-dimensional gel electrophoresis and Matrix Assisted Laser Desorption Ionization Time-of-Flight (MALDI-TOF)/TOF, and toxin bioaccumulation assessed by liquid chromatography-mass spectrometry (LC-MS)/MS. Variations in several protein markers (ATP synthase subunits, Cytochrome b6-f complex iron-sulfur, oxygen-evolving enhancer proteins) highlight the decrease of the capacity of plants to synthesize ATP and to perform photosynthesis, whereas variations in other proteins (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit and ribose-5-phosphate isomerase) suggest an increase of carbon fixation and decrease of carbohydrate metabolism reactions in plants exposed to pure MC-LR and cyanobacterial extracts, respectively. MC-LR was found in roots (1635.21 μg/kg fw), green tomatoes (5.15-5.41 μg/kg fw), mature tomatoes (10.52-10.83 μg/kg fw), and leaves (12,298.18 μg/kg fw). The results raise concerns relative to food safety and point to the necessity of monitoring the bioaccumulation of water toxins in agricultural systems affected by cyanotoxin contamination.

Investigating Plasma Motion of Magnetic Clouds at 1 AU through a Velocity-modified Cylindrical Force-free Flux Rope Model

NASA Astrophysics Data System (ADS)

Wang, Y.; Shen, C.; Liu, R.; Zhou, Z.

2014-12-01

Magnetic clouds (MCs) are the interplanetary counterparts of coronal mass ejections (CMEs). Due to the very low value of Can't connect to bucket.int.confex.com:4201 (Connection refused) LWP::Protocol::http::Socket: connect: Connection refused at /usr/local/lib/perl5/site_perl/5.8.8/LWP/Protocol/http.pm line 51. in MCs, they are believed to be in a nearly force-free state and therefore are able to be modeled by a cylindrical force-free flux rope. However, the force-free state only describes the magnetic field topology but not the plasma motion of a MC. For a MC propagating in interplanetary space, the global plasma motion has three possible components: linear propagating motion of a MC away from the Sun, expanding motion and circular motion with respect to the axis of the MC. By assuming the quasi-steady evolution and self-similar expansion, we introduced the three-component motion into the cylindrical force-free flux rope model, and developed a velocity-modified model. Then we applied the model to 73 MCs observed by Wind spacecraft to investigate the properties of the plasma motion of MCs. It is found that (1) some MCs did not propagate along the Sun-Earth line, suggesting the direct evidence of the CME's deflected propagation and/or rotation in interplanetary space, (2) the expansion speed is correlated with the radial propagation speed and 62%/17% of MCs underwent a under/over-expansion at 1 AU, and (3) the circular motion does exists though it is only on the order of 10 km s-1. These findings advance our understanding of the MC's properties at 1 AU as well as the dynamic evolution of CMEs from the Sun to interplanetary space.

FF12MC: A revised AMBER forcefield and new protein simulation protocol

PubMed Central

2016-01-01

ABSTRACT Specialized to simulate proteins in molecular dynamics (MD) simulations with explicit solvation, FF12MC is a combination of a new protein simulation protocol employing uniformly reduced atomic masses by tenfold and a revised AMBER forcefield FF99 with (i) shortened C—H bonds, (ii) removal of torsions involving a nonperipheral sp3 atom, and (iii) reduced 1–4 interaction scaling factors of torsions ϕ and ψ. This article reports that in multiple, distinct, independent, unrestricted, unbiased, isobaric–isothermal, and classical MD simulations FF12MC can (i) simulate the experimentally observed flipping between left‐ and right‐handed configurations for C14–C38 of BPTI in solution, (ii) autonomously fold chignolin, CLN025, and Trp‐cage with folding times that agree with the experimental values, (iii) simulate subsequent unfolding and refolding of these miniproteins, and (iv) achieve a robust Z score of 1.33 for refining protein models TMR01, TMR04, and TMR07. By comparison, the latest general‐purpose AMBER forcefield FF14SB locks the C14–C38 bond to the right‐handed configuration in solution under the same protein simulation conditions. Statistical survival analysis shows that FF12MC folds chignolin and CLN025 in isobaric–isothermal MD simulations 2–4 times faster than FF14SB under the same protein simulation conditions. These results suggest that FF12MC may be used for protein simulations to study kinetics and thermodynamics of miniprotein folding as well as protein structure and dynamics. Proteins 2016; 84:1490–1516. © 2016 The Authors Proteins: Structure, Function, and Bioinformatics Published by Wiley Periodicals, Inc. PMID:27348292

The power of virtual integration: an interview with Dell Computer's Michael Dell. Interview by Joan Magretta.

PubMed

Dell, M

1998-01-01

Michael Dell started his computer company in 1984 with a simple business insight. He could bypass the dealer channel through which personal computers were then being sold and sell directly to customers, building products to order. Dell's direct model eliminated the dealer's markup and the risks associated with carrying large inventories of finished goods. In this interview, Michael Dell provides a detailed description of how his company is pushing that business model one step further, toward what he calls virtual integration. Dell is using technology and information to blur the traditional boundaries in the value chain between suppliers, manufacturers, and customers. The individual pieces of Dell's strategy--customer focus, supplier partnerships, mass customization, just-in-time manufacturing--may be all be familiar. But Michael Dell's business insight into how to combine them is highly innovative. Direct relationships with customers create valuable information, which in turn allows the company to coordinate its entire value chain back through manufacturing to product design. Dell describes how his company has come to achieve this tight coordination without the "drag effect" of ownership. Dell reaps the advantages of being vertically integrated without incurring the costs, all the while achieving the focus, agility, and speed of a virtual organization. As envisioned by Michael Dell, virtual integration may well become a new organizational model for the information age.

Toward Customized Care Comment on "(Re) Making the Procrustean Bed? Standardization and Customization as Competing Logics in Healthcare".

PubMed

Minvielle, Etienne

2017-07-15

Patients want their personal needs to be taken into account. Accordingly, the management of care has long involved some degree of personalization. In recent times, patients' wishes have become more pressing in a moving context. As the population ages, the number of patients requiring sophisticated combinations of longterm care is rising. Moreover, we are witnessing previously unvoiced demands, preferences and expectations (eg, demand for information about treatment, for care complying with religious practices, or for choice of appointment dates). In view of the escalating costs and the concerns about quality of care, the time has now come to rethink healthcare delivery. Part of this reorganization can be related to customization: what is needed is a customized business model that is effective and sustainable. Such business model exists in different service sectors, the customization being defined as the development of tailored services to meet consumers' diverse and changing needs at near mass production prices. Therefore, its application to the healthcare sector needs to be seriously considered. © 2018 The Author(s); Published by Kerman University of Medical Sciences. This is an open-access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

The relationship between instrumental leaf grade and Shirley Analyzer trash content in cotton lint

USDA-ARS?s Scientific Manuscript database

With the increasing acceptance of high volume instrument (HVITM) instrumental leaf grade index in both domestic and international trading, there is a continued interest in the relationship between instrumental leaf grade and equivalent trash gravimetric content (% percent by mass) from cotton custom...

In-situ Sr isotopic measurement of scheelite using fs-LA-MC-ICPMS

NASA Astrophysics Data System (ADS)

Li, Chao; Zhou, Limin; Zhao, Zheng; Zhang, Zhiyuan; Zhao, Hong; Li, Xinwei; Qu, Wenjun

2018-07-01

Scheelite is one of the main ore minerals in tungsten deposits, and Sr isotopic compositions of scheelite can be used to examine the petrogenesis of igneous rocks and fluid metasomatism in mineralization processes. Both thermal ionization mass spectrometer (TIMS) and femsecond laser ablation multi-collector inductively coupled plasma mass spectrometer (fs-LA-MC-ICP-MS) have been applied to analyze Sr isotopic compositions in scheelite. Here we describe a LA-MC-ICP-MS technique which can obtain in-situ, accurate, high precision 87Sr/86Sr ratios from 20 to 50 μm scheelite in line mode without requiring time-consuming mineral separation and pre-chemical procedures. We found that Ca dimers and Ca argides do not detectably affect the obtained 87Sr/86Sr ratios, and the adopted protocol overcomes interferences from Kr+, Rb+, Er2+ and Yb2+. The results of three MPI-DING reference glasses (KL2-G, ML3B-G and StHs6/80-G) are consistent with the recommended values. Here we show that the values of 87Sr/86Sr are relatively homogeneous for two scheelites from quartz veins, and are comparable to the values determined by a traditional solution method. Hence, these two scheelite samples have the potential to be reference materials for Sr isotopic determination by LA-MC-ICP-MS. To illustrate the utility of the technique, Sr isotopes of scheelites from three different types of tungsten deposits of South China are documented. The 87Sr/86Sr of scheelite from granite-related veinlet-disseminated and porphyry tungsten deposits varies systematically, showing a positive correlation between Sr content and 87Sr/86Sr ratios. These micrometer scale inhomogeneities could be explained by mixing of two components, reflecting intense fluid metasomatism during mineralization processes. High 87Sr/86Sr ratios were obtained for the scheelite samples from a quartz vein type tungsten deposit, indicating that the late stage ore-forming fluid was mainly derived from the surrounding strata. These examples show that in-situ Sr isotopic measurement of scheelite is a powerful tool to decipher the degree of fluid-rock interaction in ore-forming processes.

Using Statistical Multivariable Models to Understand the Relationship Between Interplanetary Coronal Mass Ejecta and Magnetic Flux Ropes

NASA Technical Reports Server (NTRS)

Riley, P.; Richardson, I. G.

2012-01-01

In-situ measurements of interplanetary coronal mass ejections (ICMEs) display a wide range of properties. A distinct subset, "magnetic clouds" (MCs), are readily identifiable by a smooth rotation in an enhanced magnetic field, together with an unusually low solar wind proton temperature. In this study, we analyze Ulysses spacecraft measurements to systematically investigate five possible explanations for why some ICMEs are observed to be MCs and others are not: i) An observational selection effect; that is, all ICMEs do in fact contain MCs, but the trajectory of the spacecraft through the ICME determines whether the MC is actually encountered; ii) interactions of an erupting flux rope (PR) with itself or between neighboring FRs, which produce complex structures in which the coherent magnetic structure has been destroyed; iii) an evolutionary process, such as relaxation to a low plasma-beta state that leads to the formation of an MC; iv) the existence of two (or more) intrinsic initiation mechanisms, some of which produce MCs and some that do not; or v) MCs are just an easily identifiable limit in an otherwise corntinuous spectrum of structures. We apply quantitative statistical models to assess these ideas. In particular, we use the Akaike information criterion (AIC) to rank the candidate models and a Gaussian mixture model (GMM) to uncover any intrinsic clustering of the data. Using a logistic regression, we find that plasma-beta, CME width, and the ratio O(sup 7) / O(sup 6) are the most significant predictor variables for the presence of an MC. Moreover, the propensity for an event to be identified as an MC decreases with heliocentric distance. These results tend to refute ideas ii) and iii). GMM clustering analysis further identifies three distinct groups of ICMEs; two of which match (at the 86% level) with events independently identified as MCs, and a third that matches with non-MCs (68 % overlap), Thus, idea v) is not supported. Choosing between ideas i) and iv) is more challenging, since they may effectively be indistinguishable from one another by a single in-situ spacecraft. We offer some suggestions on how future studies may address this.

MAGNETIC FIELD-LINE LENGTHS IN INTERPLANETARY CORONAL MASS EJECTIONS INFERRED FROM ENERGETIC ELECTRON EVENTS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Kahler, S. W.; Haggerty, D. K.; Richardson, I. G., E-mail: AFRL.RVB.PA@hanscom.af.mil

About one quarter of the observed interplanetary coronal mass ejections (ICMEs) are characterized by enhanced magnetic fields that smoothly rotate in direction over timescales of about 10-50 hr. These ICMEs have the appearance of magnetic flux ropes and are known as 'magnetic clouds' (MCs). The total lengths of MC field lines can be determined using solar energetic particles of known speeds when the solar release times and the 1 AU onset times of the particles are known. A recent examination of about 30 near-relativistic (NR) electron events in and near 8 MCs showed no obvious indication that the field-line lengthsmore » were longest near the MC boundaries and shortest at the MC axes or outside the MCs, contrary to the expectations for a flux rope. Here we use the impulsive beamed NR electron events observed with the Electron Proton and Alpha Monitor instrument on the Advanced Composition Explorer spacecraft and type III radio bursts observed on the Wind spacecraft to determine the field-line lengths inside ICMEs included in the catalog of Richardson and Cane. In particular, we extend this technique to ICMEs that are not MCs and compare the field-line lengths inside MCs and non-MC ICMEs with those in the ambient solar wind outside the ICMEs. No significant differences of field-line lengths are found among MCs, ICMEs, and the ambient solar wind. The estimated number of ICME field-line turns is generally smaller than those deduced for flux-rope model fits to MCs. We also find cases in which the electron injections occur in solar active regions (ARs) distant from the source ARs of the ICMEs, supporting CME models that require extensive coronal magnetic reconnection with surrounding fields. The field-line lengths are found to be statistically longer for the NR electron events classified as ramps and interpreted as shock injections somewhat delayed from the type III bursts. The path lengths of the remaining spike and pulse electron events are compared with model calculations of solar wind field-line lengths resulting from turbulence and found to be in good agreement.« less

Magnetic Field-Line Lengths in Interplanetary Coronal Mass Ejections Inferred from Energetic Electron Events

NASA Technical Reports Server (NTRS)

Kahler, S. W.; Haggerty, D. K.; Richardson, I. G.

2011-01-01

About one quarter of the observed interplanetary coronal mass ejections (ICMEs) are characterized by enhanced magnetic fields that smoothly rotate in direction over timescales of about 10-50 hr. These ICMEs have the appearance of magnetic flux ropes and are known as "magnetic clouds" (MCs). The total lengths of MC field lines can be determined using solar energetic particles of known speeds when the solar release times and the I AU onset times of the particles are known. A recent examination of about 30 near-relativistic (NR) electron events in and near 8 MCs showed no obvious indication that the field-line lengths were longest near the MC boundaries and shortest at the MC axes or outside the MCs, contrary to the expectations for a flux rope. Here we use the impulsive beamed NR electron events observed with the Electron Proton and Alpha Monitor instrument on the Advanced Composition Explorer spacecraft and type III radio bursts observed on the Wind spacecraft to determine the field-line lengths inside ICMEs included in the catalog of Richardson & Cane. In particular, we extend this technique to ICMEs that are not MCs and compare the field-line lengths inside MCs and non-MC ICMEs with those in the ambient solar wind outside the ICMEs. No significant differences of field-line lengths are found among MCs, ICMEs, and the ambient solar wind. The estimated number of ICME field-line turns is generally smaller than those deduced for flux-rope model fits to MCs. We also find cases in which the electron injections occur in solar active regions CARs) distant from the source ARs of the ICMEs, supporting CME models that require extensive coronal magnetic reconnection with surrounding fields. The field-line lengths are found to be statistically longer for the NR electron events classified as ramps and interpreted as shock injections somewhat delayed from the type III bursts. The path lengths of the remaining spike and pulse electron events are compared with model calculations of solar wind field-line lengths resulting from turbulence and found to be in good agreement.

The Dissemination of Mass in the United States: Results and Implications of Recent BIPM Calibrations of US National Prototype Kilograms

PubMed Central

Kubarych, Zeina J; Abbott, Patrick J

2014-01-01

The National Institute of Standards and Technology (NIST) is responsible for the dissemination of the unit of mass within the United States of America through the national prototype kilogram K20 and its check standard K4. These platinum-iridium artifacts have been in use since 1889 and are periodically sent to the International Bureau of Weights and Measures (BIPM) for recalibration. The following is a brief description of the roles of the national prototype kilograms in the dissemination of mass in the United States of America, and the implications for NIST mass calibration customers of the most recent recalibrations of K20 and K4. PMID:26601023

A Combined Kinetic and Volatility Basis Set Approach to Model Secondary Organic Aerosol from Toluene and Diesel Exhaust/Meat Cooking Mixtures

NASA Astrophysics Data System (ADS)

Parikh, H. M.; Carlton, A. G.; Zhang, H.; Kamens, R.; Vizuete, W.

2011-12-01

Secondary organic aerosol (SOA) is simulated for 6 outdoor smog chamber experiments using a SOA model based on a kinetic chemical mechanism in conjunction with a volatility basis set (VBS) approach. The experiments include toluene, a non-SOA-forming hydrocarbon mixture, diesel exhaust or meat cooking emissions and NOx, and are performed under varying conditions of relative humidity. SOA formation from toluene is modeled using a condensed kinetic aromatic mechanism that includes partitioning of lumped semi-volatile products in particle organic-phase and incorporates particle aqueous-phase chemistry to describe uptake of glyoxal and methylglyoxal. Modeling using the kinetic mechanism alone, along with primary organic aerosol (POA) from diesel exhaust (DE) /meat cooking (MC) fails to simulate the rapid SOA formation at the beginning hours of the experiments. Inclusion of a VBS approach with the kinetic mechanism to characterize the emissions and chemistry of complex mixture of intermediate volatility organic compounds (IVOCs) from DE/MC, substantially improves SOA predictions when compared with observed data. The VBS model includes photochemical aging of IVOCs and evaporation of POA after dilution. The relative contribution of SOA mass from DE/MC is as high as 95% in the morning, but substantially decreases after mid-afternoon. For high humidity experiments, aqueous-phase SOA fraction dominates the total SOA mass at the end of the day (approximately 50%). In summary, the combined kinetic and VBS approach provides a new and improved framework to semi-explicitly model SOA from VOC precursors in conjunction with a VBS approach that can be used on complex emission mixtures comprised with hundreds of individual chemical species.

Two New Long-period Giant Planets from the McDonald Observatory Planet Search and Two Stars with Long-period Radial Velocity Signals Related to Stellar Activity Cycles

NASA Astrophysics Data System (ADS)

Endl, Michael; Brugamyer, Erik J.; Cochran, William D.; MacQueen, Phillip J.; Robertson, Paul; Meschiari, Stefano; Ramirez, Ivan; Shetrone, Matthew; Gullikson, Kevin; Johnson, Marshall C.; Wittenmyer, Robert; Horner, Jonathan; Ciardi, David R.; Horch, Elliott; Simon, Attila E.; Howell, Steve B.; Everett, Mark; Caldwell, Caroline; Castanheira, Barbara G.

2016-02-01

We report the detection of two new long-period giant planets orbiting the stars HD 95872 and HD 162004 (ψ1 Dra B) by the McDonald Observatory planet search. The planet HD 95872b has a minimum mass of 4.6 {M}{{Jup}} and an orbital semimajor axis of 5.2 AU. The giant planet ψ1 Dra Bb has a minimum mass of 1.5 {M}{{Jup}} and an orbital semimajor axis of 4.4 AU. Both of these planets qualify as Jupiter analogs. These results are based on over one and a half decades of precise radial velocity (RV) measurements collected by our program using the McDonald Observatory Tull Coude spectrograph at the 2.7 m Harlan J. Smith Telescope. In the case of ψ1 Dra B we also detect a long-term nonlinear trend in our data that indicates the presence of an additional giant planet, similar to the Jupiter-Saturn pair. The primary of the binary star system, ψ1 Dra A, exhibits a very large amplitude RV variation due to another stellar companion. We detect this additional member using speckle imaging. We also report two cases—HD 10086 and HD 102870 (β Virginis)—of significant RV variation consistent with the presence of a planet, but that are probably caused by stellar activity, rather than reflexive Keplerian motion. These two cases stress the importance of monitoring the magnetic activity level of a target star, as long-term activity cycles can mimic the presence of a Jupiter-analog planet.

First Detection of the Hatchett-McCray Effect in the High-Mass X-ray Binary

NASA Technical Reports Server (NTRS)

Sonneborn, G.; Iping, R. C.; Kaper, L.; Hammerschiag-Hensberge, G.; Hutchings, J. B.

2004-01-01

The orbital modulation of stellar wind UV resonance line profiles as a result of ionization of the wind by the X-ray source has been observed in the high-mass X-ray binary 4U1700-37/HD 153919 for the first time. Far-UV observations (905-1180 Angstrom, resolution 0.05 Angstroms) were made at the four quadrature points of the binary orbit with the Far Ultraviolet Spectroscopic Explorer (FUSE) in 2003 April and August. The O6.5 laf primary eclipses the X-ray source (neutron star or black hole) with a 3.41-day period. Orbital modulation of the UV resonance lines, resulting from X-ray photoionization of the dense stellar wind, the so-called Hatchett-McCray (HM) effect, was predicted for 4U1700-37/HD153919 (Hatchett 8 McCray 1977, ApJ, 211, 522) but was not seen in N V 1240, Si IV 1400, or C IV 1550 in IUE and HST spectra. The FUSE spectra show that the P V 1118-1128 and S IV 1063-1073 P-Cygni lines appear to vary as expected for the HM effect, weakest at phase 0.5 (X-ray source conjunction) and strongest at phase 0.0 (X-ray source eclipse). The phase modulation of the O VI 1032-1037 lines, however, is opposite to P V and S IV, implying that O VI may be a byproduct of the wind's ionization by the X-ray source. Such variations were not observed in N V, Si IV, and C IV because of their high optical depth. Due to their lower cosmic abundance, the P V and S IV wind lines are unsaturated, making them excellent tracers of the ionization conditions in the O star's wind.

In Situ Carbon Isotope Analysis by Laser Ablation MC-ICP-MS.

PubMed

Chen, Wei; Lu, Jue; Jiang, Shao-Yong; Zhao, Kui-Dong; Duan, Deng-Fei

2017-12-19

Carbon isotopes have been widely used in tracing a wide variety of geological and environmental processes. The carbon isotope composition of bulk rocks and minerals was conventionally analyzed by isotope ratio mass spectrometry (IRMS), and, more recently, secondary ionization mass spectrometry (SIMS) has been widely used to determine carbon isotope composition of carbon-bearing solid materials with good spatial resolution. Here, we present a new method that couples a RESOlution S155 193 nm laser ablation system with a Nu Plasma II MC-ICP-MS, with the aim of measuring carbon isotopes in situ in carbonate minerals (i.e., calcite and aragonite). Under routine operating conditions for δ 13 C analysis, instrumental bias generally drifts by 0.8‰-2.0‰ in a typical analytical session of 2-3 h. Using a magmatic calcite as the standard, the carbon isotopic composition was determined for a suite of calcite samples with δ 13 C values in the range of -6.94‰ to 1.48‰. The obtained δ 13 C data are comparable to IRMS values. The combined standard uncertainty for magmatic calcite is <0.3‰ (1s). No significant matrix effects have been identified in calcite with the amplitude of chemical composition variation (i.e., MnO, SrO, MgO, or FeO) up to 2.5 wt %. Two modern corals were investigated using magmatic calcite as the calibration standard, and the average δ 13 C values for both corals are similar to the bulk IRMS values. Moreover, coral exhibits significant heterogeneity in carbon isotope compositions, with differences up to 4.85‰ within an individual coral. This study indicates that LA-MC-ICP-MS can serve as an appropriate method to analyze carbon isotopes of carbonate minerals in situ.

A new measurement of the half-life of (166m)Ho.

PubMed

Nedjadi, Y; Bailat, C; Caffari, Y; Froidevaux, P; Wastiel, C; Kivel, N; Guenther-Leopold, I; Triscone, G; Jaquenod, F; Bochud, F

2012-09-01

The work presented here is a new and precise measurement of the half-life of (166m)Ho by determining the activity concentration, using an ionisation chamber calibrated for this nuclide, and measuring the number of (166m)Ho atoms using multi-collector inductively coupled plasma mass spectrometry (MC-ICP-MS). Since the isotope (166)Er interferes with the mass spectrometric measurement, Er has to be eliminated from the (166m)Ho radioactive solution. The elimination was achieved using ion-exchange chromatography with the cation exchange resin Dowex AG 50W-X8 and 2-Hydroxybutanoic acid as the mobile phase. After a first transit through the chromatographic column, the purified (166m)Ho eluate was spiked with natural Er to get a resulting Er isotopic composition close to that of natural Er at better than 99.5%, and then it underwent two further separations to eliminate the Er. The activity concentration of this Er-free radioactive (166m)Ho solution was measured in our reference ionisation chamber calibrated for this nuclide by means of the 4πβ(PC)-γ and 4πβ(PS)-4πγ coincidence techniques and integral counting with a well-type NaI(Tl) detector and Monte Carlo efficiencies. An aliquot of this standardized solution was sent to the Paul Scherrer Institute (PSI) for mass concentration determination using an isotope dilution MC-ICP-MS approach. The mass concentration of (166m)Ho in this solution was determined with 0.25% relative standard uncertainty. This value was corroborated by two other independent measurements. The new half-life of (166m)Ho, 1132.6(39) years (k=1), is compatible with the value determined in 1965, but is 5.6% shorter and about 43 times more precise. Copyright © 2012 Elsevier Ltd. All rights reserved.

MC-TESTER: a universal tool for comparisons of Monte Carlo predictions for particle decays in high energy physics

NASA Astrophysics Data System (ADS)

Golonka, P.; Pierzchała, T.; Waş, Z.

2004-02-01

Theoretical predictions in high energy physics are routinely provided in the form of Monte Carlo generators. Comparisons of predictions from different programs and/or different initialization set-ups are often necessary. MC-TESTER can be used for such tests of decays of intermediate states (particles or resonances) in a semi-automated way. Our test consists of two steps. Different Monte Carlo programs are run; events with decays of a chosen particle are searched, decay trees are analyzed and appropriate information is stored. Then, at the analysis step, a list of all found decay modes is defined and branching ratios are calculated for both runs. Histograms of all scalar Lorentz-invariant masses constructed from the decay products are plotted and compared for each decay mode found in both runs. For each plot a measure of the difference of the distributions is calculated and its maximal value over all histograms for each decay channel is printed in a summary table. As an example of MC-TESTER application, we include a test with the τ lepton decay Monte Carlo generators, TAUOLA and PYTHIA. The HEPEVT (or LUJETS) common block is used as exclusive source of information on the generated events. Program summaryTitle of the program:MC-TESTER, version 1.1 Catalogue identifier: ADSM Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADSM Program obtainable from: CPC Program Library, Queen's University of Belfast, N. Ireland Computer: PC, two Intel Xeon 2.0 GHz processors, 512MB RAM Operating system: Linux Red Hat 6.1, 7.2, and also 8.0 Programming language used:C++, FORTRAN77: gcc 2.96 or 2.95.2 (also 3.2) compiler suite with g++ and g77 Size of the package: 7.3 MB directory including example programs (2 MB compressed distribution archive), without ROOT libraries (additional 43 MB). No. of bytes in distributed program, including test data, etc.: 2 024 425 Distribution format: tar gzip file Additional disk space required: Depends on the analyzed particle: 40 MB in the case of τ lepton decays (30 decay channels, 594 histograms, 82-pages booklet). Keywords: particle physics, decay simulation, Monte Carlo methods, invariant mass distributions, programs comparison Nature of the physical problem: The decays of individual particles are well defined modules of a typical Monte Carlo program chain in high energy physics. A fast, semi-automatic way of comparing results from different programs is often desirable, for the development of new programs, to check correctness of the installations or for discussion of uncertainties. Method of solution: A typical HEP Monte Carlo program stores the generated events in the event records such as HEPEVT or PYJETS. MC-TESTER scans, event by event, the contents of the record and searches for the decays of the particle under study. The list of the found decay modes is successively incremented and histograms of all invariant masses which can be calculated from the momenta of the particle decay products are defined and filled. The outputs from the two runs of distinct programs can be later compared. A booklet of comparisons is created: for every decay channel, all histograms present in the two outputs are plotted and parameter quantifying shape difference is calculated. Its maximum over every decay channel is printed in the summary table. Restrictions on the complexity of the problem: For a list of limitations see Section 6. Typical running time: Varies substantially with the analyzed decay particle. On a PC/Linux with 2.0 GHz processors MC-TESTER increases the run time of the τ-lepton Monte Carlo program TAUOLA by 4.0 seconds for every 100 000 analyzed events (generation itself takes 26 seconds). The analysis step takes 13 seconds; ? processing takes additionally 10 seconds. Generation step runs may be executed simultaneously on multi-processor machines. Accessibility: web page: http://cern.ch/Piotr.Golonka/MC/MC-TESTER e-mails: Piotr.Golonka@CERN.CH, T.Pierzchala@friend.phys.us.edu.pl, Zbigniew.Was@CERN.CH.

The FTO gene polymorphism (rs9939609) is associated with metabolic syndrome in morbidly obese subjects from southern Italy.

PubMed

Liguori, Rosario; Labruna, Giuseppe; Alfieri, Andreina; Martone, Domenico; Farinaro, Eduardo; Contaldo, Franco; Sacchetti, Lucia; Pasanisi, Fabrizio; Buono, Pasqualina

2014-08-01

Gene variants in MC4R, SIRT1 and FTO are associated with severe obesity and metabolic impairment in Caucasians. We investigated whether common variants in these genes are associated with metabolic syndrome (MetS) in a large group of morbidly obese young adults from southern Italy. One thousand morbidly obese subjects (62% women, mean body mass index 46.5 kg/m(2), mean age 32.6 years) whose families had lived in southern Italy for at least 2 generations were recruited. Single-nucleotide polymorphisms (SNPs) rs12970134, rs477181, rs502933 (MC4R locus), rs3818292, rs7069102, rs730821, rs2273773, rs12413112 (SIRT1 locus) and rs1421085, rs9939609, 9930506, 1121980 (FTO locus) were genotyped by Taqman assay; blood parameters were assayed by routine methods; the Fat Mass, Fat Free Mass, Respiratory Quotient, Basal Metabolic Rate (BMR) and waist circumference were also determined. Binomial logistic regression showed that the TA heterozygous genotype of SNP rs9939609 in the FTO gene was associated with the presence of MetS in our population [OR (95% CI): 2.53 (1.16-5.55)]. Furthermore, the FTO rs9939609 genotype accounted for 21.3% of the MetS phenotype together with total cholesterol, BMR and age. Our results extend the knowledge on genotype susceptibility for MetS in relation to a specific geographical area of residence. Copyright © 2014 Elsevier Ltd. All rights reserved.

Using artificial neural networks to constrain the halo baryon fraction during reionization

NASA Astrophysics Data System (ADS)

Sullivan, David; Iliev, Ilian T.; Dixon, Keri L.

2018-01-01

Radiative feedback from stars and galaxies has been proposed as a potential solution to many of the tensions with simplistic galaxy formation models based on Λcold dark matter, such as the faint end of the ultraviolet (UV) luminosity function. The total energy budget of radiation could exceed that of galactic winds and supernovae combined, which has driven the development of sophisticated algorithms that evolve both the radiation field and the hydrodynamical response of gas simultaneously, in a cosmological context. We probe self-feedback on galactic scales using the adaptive mesh refinement, radiative transfer, hydrodynamics, and N-body code RAMSES-RT. Unlike previous studies which assume a homogeneous UV background, we self-consistently evolve both the radiation field and gas to constrain the halo baryon fraction during cosmic reionization. We demonstrate that the characteristic halo mass with mean baryon fraction half the cosmic mean, Mc(z), shows very little variation as a function of mass-weighted ionization fraction. Furthermore, we find that the inclusion of metal cooling and the ability to resolve scales small enough for self-shielding to become efficient leads to a significant drop in Mc when compared to recent studies. Finally, we develop an artificial neural network that is capable of predicting the baryon fraction of haloes based on recent tidal interactions, gas temperature, and mass-weighted ionization fraction. Such a model can be applied to any reionization history, and trivially incorporated into semi-analytical models of galaxy formation.

High precision isotope ratio measurements of mercury isotopes in cinnabar ores using multi-collector inductively coupled plasma mass spectrometry.

PubMed

Hintelmann, Holger; Lu, ShengYong

2003-06-01

Variations in Hg isotope ratios in cinnabar ores obtained from different countries were detected by high precision isotope ratio measurements using multi-collector inductively coupled mass spectrometry (MC-ICP-MS). Values of delta198/202Hg varied from 0.0-1.3 percent per thousand relative to a NIST SRM 1641d Hg solution. The typical external uncertainty of the delta values was 0.06 to 0.26 percent per thousand. Hg was introduced into the plasma as elemental Hg after reduction by sodium borohydride. A significant fractionation of lead isotopes was observed during the simultaneous generation of lead hydride, preventing normalization of the Hg isotope ratios using the measured 208/206Pb ratio. Hg ratios were instead corrected employing the simultaneously measured 205/203T1 ratio. Using a 10 ng ml(-1) Hg solution and 10 min of sampling, introducing 60 ng of Hg, the internal precision of the isotope ratio measurements was as low as 14 ppm. Absolute Hg ratios deviated from the representative IUPAC values by approximately 0.2% per u. This observation is explained by the inadequacy of the exponential law to correct for mass bias in MC-ICP-MS measurements. In the absence of a precisely characterized Hg isotope ratio standard, we were not able to determine unambiguously the absolute Hg ratios of the ore samples, highlighting the urgent need for certified standard materials.

Atmospheric 21Ne abundance determined by the Helix-MC Plus mass spectrometer

NASA Astrophysics Data System (ADS)

Honda, M.; Zhang, X.; Phillips, D.; Hamilton, D.; Deerberg, M.; Schwieters, J. B.

2014-12-01

Analyses of noble gas isotopes by multi-collector, high resolution mass spectrometry have the potential to revolutionise applications in the cosmo-geo-sciences. The Helix-MC Plus noble gas mass spectrometer installed at the Australian National University (ANU) is equipped with unique high mass resolution collectors [mass resolution (MR): ~1,800 and mass resolving power (MRP): ~8,000], including fixed axial (Ax), adjustable high mass (H2) and adjustable low mass (L2) detectors. The high mass resolution of the L2, Ax and H2 collectors permits complete separation of 20Ne (measured on L2 detector) from doubly charged interfering 40Ar (required MR of 1,777), 1H19F (MR = 1450), 1H218O (MR = 894) and partial separation of the 21Ne peak (on Ax detector) from interfering 20Ne1H (MR = 3,271), and 22Ne (on H2 detector) from interfering doubly charged CO2 (MR = 6,231). Because of the high MRP of ~8,000, 21Ne can be measured, essentially without interference from 20Ne1H, by setting the magnet position on a 20Ne1H interference-free position. This capability provides an important opportunity to re-evaluate the 21Ne abundance in the atmosphere. Our analyses demonstrate that 20Ne1H contributes ~4% to atmospheric 21Ne measurements, with the corresponding production ratio of 20Ne1H to 20Ne being ~1E-4. We calculate a new atmospheric 21Ne/20Ne ratio of 0.00287 relative to an atmospheric 22Ne/20Ne ratio of 0.102; this new value is distinctly lower than the current IUPAC recommended 21Ne/20Ne value of 0.00298. There are several significant implications ensuing from the newly determined atmospheric 21Ne abundance. For example, in the area of Earth sciences the most critical issue relates to cosmogenic 21Ne surface exposure ages, which involve the calculation of 21Ne concentrations from excess 21Ne, relative to the atmospheric 21Ne/20Ne ratio. For young samples, where cosmogenic 21Ne contents are small and the 21Ne/20Ne ratio is close to the atmospheric value, the revised value could increase cosmogenic 21Ne ages by ~30%.

A renewable commitment

DOE Office of Scientific and Technical Information (OSTI.GOV)

McArthur, D.; Salaff, S.

1997-06-01

New initiatives favoring green power and wind energy are under way in Alberta, Quebec and Ontario. The Canadian government made a major commitment to green power in April when Anne McLellan, the federal minister of natural resources (NRCan), announced in Ottawa that the Canadian government has selected the City of Calgary Electric System (CCES) to acquire and distribute green power to certain federal buildings in Alberta. This will be the first federal procurement of its kind in Canada and the first supply of green power. NRCan will acquire up to 10 GWh per year of electricity generated by renewable sourcesmore » for NRCan buildings, while up to 3.1 GWh per year will go to Environment Canada buildings in Alberta. The announcement was made jointly by McLellan and Sergio Marchi, federal environment minister. CCES is a municipally owned distribution utility which supplies power to about 295,000 customer accounts in Calgary, whose population exceeds 750,000. While no details of the actual types of green power supply were available in late April, sources indicated that windpower was among the supply options under consideration. The Alberta Power Pool began on January 1, 1996, as a competitive wholesale pool providing the lowest cost power from competing suppliers. The pool is the most progressive and deregulated system in Canada, and now with an apparent mechanism to deliver green power, the pool could be a model for green power procurement in Canada.« less

Will Australians pay for health care advice from a community pharmacist? A video vignette study.

PubMed

Sriram, Deepa; McManus, Alexandra; Emmerton, Lynne; Jiwa, Moyez

2015-01-01

Large proportion of Australians have access to pharmacists' health advice at no cost. The impact of a proposed co-payment levy for general practitioner (GP) consultation by Australian government is unclear. This raises an interesting question about consumers' perceived value of health-related consultations. This survey of representative sample of Western Australians explores the hypothesis that Australians are willing to pay for advanced model of pharmacy consultation. Two videos illustrating current-services and quality-enhanced-service (QES) incorporating systematic assessment of symptoms and referral to GP if necessary, were used. Participants viewed videos online and completed a willingness-to-pay (WTP) questionnaire about their perception and WTP for each service. Logistic regression and McNemar tests were used to identify WTP groups. Of the 175 respondents, one in nine (19/175, 11%) were willing to pay and (35/175) 20% might consider paying for advice at pharmacies as per current-practice. Almost one in four (49/175, 28%) were willing to pay and (47/175) 27% would consider paying for QES (McNemar Test P < 0.001). The majority of West Australians may be willing to pay for consultation at pharmacies that offers more private, time-intensive experience with documented GP referral where required. Further research is warranted to test WTP with actual customers to confirm these results. Copyright © 2015 Elsevier Inc. All rights reserved.

KSC-2013-1046

NASA Image and Video Library

2013-01-09

CAPE CANAVERAL, Fla. -- At a news conference NASA officials and industry partners discuss progress of the agency's Commercial Crew Program CCP. Participating in the briefing, from the left are, Mike Curie, NASA Public Affairs, Ed Mango, NASA Commercial Crew Program manager, Phil McAlister, NASA Commercial Spaceflight Development director, Rob Meyerson, Blue Origin president and program manager, John Mulholland, The Boeing Company Commercial Programs Space Exploration vice president and program manager, Mark Sirangelo, Sierra Nevada Corp. vice president and SNC Space Systems chairman and Garrett Reisman, Space Exploration Technologies SpaceX Commercial Crew project manager. Through CCP, NASA is facilitating the development of U.S. commercial crew space transportation capabilities to achieve safe, reliable and cost-effective access to and from low-Earth orbit for potential future government and commercial customers. For more information, visit http://www.nasa.gov/commercialcrew Photo credit: NASA/Kim Shiflett

ICME-driven sheath regions deplete the outer radiation belt electrons

NASA Astrophysics Data System (ADS)

Hietala, H.; Kilpua, E. K.; Turner, D. L.

2013-12-01

It is an outstanding question in space weather and solar wind-magnetosphere interaction studies, why some storms result in an increase of the outer radiation belt electron fluxes, while others deplete them or produce no change. One approach to this problem is to look at differences in the storm drivers. Traditionally drivers have been classified to Stream Interaction Regions (SIRs) and Interplanetary Coronal Mass Ejections (ICMEs). However, an 'ICME event' is a complex structure: The core is a magnetic cloud (MC; a clear flux rope structure). If the mass ejection is fast enough, it can drive a shock in front of it. This leads to the formation of a sheath region between the interplanetary shock and the leading edge of the MC. While both the sheath and the MC feature elevated solar wind speed, their other properties are very different. For instance, the sheath region has typically a much higher dynamic pressure than the magnetic cloud. Moreover, the sheath region has a high power in magnetic field and dynamic pressure Ultra Low Frequency (ULF) range fluctuations, while the MC is characterised by an extremely smooth magnetic field. Magnetic clouds have been recognised as important drivers magnetospheric activity since they can comprise long periods of very large southward Interplanetary Magnetic Field (IMF). Nevertheless, previous studies have shown that sheath regions can also act as storm drivers. In this study, we analyse the effects of ICME-driven sheath regions on the relativistic electron fluxes observed by GOES satellites on the geostationary orbit. We perform a superposed epoch analysis of 31 sheath regions from solar cycle 23. Our results show that the sheaths cause an approximately one order of magnitude decrease in the 24h-averaged electron fluxes. Typically the fluxes also stay below the pre-event level for more than two days. Further analysis reveals that the decrease does not depend on, e.g., whether the sheath interval contains predominantly northward or southward IMF. The main controlling factors of the loss seem to be the dynamic pressure jump at the shock and the level of solar wind dynamic pressure ULF fluctuations within the sheath. We also discuss the superposed epoch time series of the Dst index and the stand-off distance of the magnetopause during these intervals. Based on our results we suggest that the separation of the effects from different parts of the ICME (sheath, MC) will be crucial for understanding how radiation belt electrons react to the CME impact.

Proceedings of the Annual Meeting of the Association for Education in Journalism and Mass Communication (79th, Anaheim, CA, August 10-13, 1996). Qualitative Studies Division.

ERIC Educational Resources Information Center

Association for Education in Journalism and Mass Communication.

The Qualitative Studies section of the proceedings contains the following 13 papers: "Writing as Theater: The Marketing of the Digital Word" (Sally McMillan); "Rethinking Ideology: Polysemy, Pleasure and Hegemony in Television Culture" (Luis Rivera-Perez); "Low Power FM: A Small History" (Gregory J. Adamo); "The…

Staff - Janet R. Schaefer | Alaska Division of Geological & Geophysical

Science.gov Websites

. http://doi.org/10.14509/25602 Wallace, K.L., Schaefer, J.R., and Coombs, M.L., 2013, Character, mass ., Coombs, M.L., Diefenbach, A.K., Lopez, Taryn, McNutt, S.R., Neal, C.A., Payne, A.L., Power, J.A , J.E., Schilling, S.P., Schaefer, J.R., and Trusdell, F.A., 2007, Crisis GIS: Preparing for and