Sample records for mesoporous silica catalytic

  1. Mesoporous silica nanoparticles for biomedical and catalytical applications

    SciTech Connect

    Sun, Xiaoxing


    Mesoporous silica materials, discovered in 1992 by the Mobile Oil Corporation, have received considerable attention in the chemical industry due to their superior textual properties such as high surface area, large pore volume, tunable pore diameter, and narrow pore size distribution. Among those materials, MCM-41, referred to Mobile Composition of Matter NO. 41, contains honeycomb liked porous structure that is the most common mesoporous molecular sieve studied. Applications of MCM-41 type mesoporous silica material in biomedical field as well as catalytical field have been developed and discussed in this thesis. The unique features of mesoporous silica nanoparticles were utilized for the design of delivery system for multiple biomolecules as described in chapter 2. We loaded luciferin into the hexagonal channels of MSN and capped the pore ends with gold nanoparticles to prevent premature release. Luciferase was adsorbed onto the outer surface of the MSN. Both the MSN and the gold nanoparticles were protected by poly-ethylene glycol to minimize nonspecific interaction of luciferase and keep it from denaturating. Controlled release of luciferin was triggered within the cells and the enzymatic reaction was detected by a luminometer. Further developments by varying enzyme/substrate pairs may provide opportunities to control cell behavior and manipulate intracellular reactions. MSN was also served as a noble metal catalyst support due to its large surface area and its stability with active metals. We prepared MSN with pore diameter of 10 nm (LP10-MSN) which can facilitate mass transfer. And we successfully synthesized an organo silane, 2,2'-Bipyridine-amide-triethoxylsilane (Bpy-amide-TES). Then we were able to functionalize LP10-MSN with bipyridinyl group by both post-grafting method and co-condensation method. Future research of this material would be platinum complexation. This Pt (II) complex catalyst has been reported for a C-H bond activation reaction as an

  2. A bio-catalytically driven Janus mesoporous silica cluster motor with magnetic guidance.


    Ma, Xing; Sanchez, Samuel


    A bio-catalytic Janus motor based on the mesoporous silica cluster (JMSC) is fabricated. Chemically conjugated catalase triggers the decomposition of H2O2 to produce driving force by bubble propulsion, while a metallic (Ni) coating layer allows for magnetic guidance of the motor. The JMSC motor can act as a delivery vehicle with cargo loading inside its mesopores. PMID:25407318

  3. Monodisperse metal nanoparticle catalysts on silica mesoporous supports: synthesis, characterizations, and catalytic reactions

    SciTech Connect

    Somorjai, G.A.


    The design of high performance catalyst achieving near 100% product selectivity at maximum activity is one of the most important goals in the modern catalytic science research. To this end, the preparation of model catalysts whose catalytic performances can be predicted in a systematic and rational manner is of significant importance, which thereby allows understanding of the molecular ingredients affecting the catalytic performances. We have designed novel 3-dimensional (3D) high surface area model catalysts by the integration of colloidal metal nanoparticles and mesoporous silica supports. Monodisperse colloidal metal NPs with controllable size and shape were synthesized using dendrimers, polymers, or surfactants as the surface stabilizers. The size of Pt, and Rh nanoparticles can be varied from sub 1 nm to 15 nm, while the shape of Pt can be controlled to cube, cuboctahedron, and octahedron. The 3D model catalysts were generated by the incorporation of metal nanoparticles into the pores of mesoporous silica supports via two methods: capillary inclusion (CI) and nanoparticle encapsulation (NE). The former method relies on the sonication-induced inclusion of metal nanoparticles into the pores of mesoporous silica, whereas the latter is performed by the encapsulation of metal nanoparticles during the hydrothermal synthesis of mesoporous silica. The 3D model catalysts were comprehensively characterized by a variety of physical and chemical methods. These catalysts were found to show structure sensitivity in hydrocarbon conversion reactions. The Pt NPs supported on mesoporous SBA-15 silica (Pt/SBA-15) displayed significant particle size sensitivity in ethane hydrogenolysis over the size range of 1-7 nm. The Pt/SBA-15 catalysts also exhibited particle size dependent product selectivity in cyclohexene hydrogenation, crotonaldehyde hydrogenation, and pyrrole hydrogenation. The Rh loaded SBA-15 silica catalyst showed structure sensitivity in CO oxidation reaction. In

  4. Gold Incorporated Mesoporous Silica Thin Film Model Surface as a Robust SERS and Catalytically Active Substrate.


    Sunil Sekhar, Anandakumari Chandrasekharan; Vinod, Chathakudath Prabhakaran


    Ultra-small gold nanoparticles incorporated in mesoporous silica thin films with accessible pore channels perpendicular to the substrate are prepared by a modified sol-gel method. The simple and easy spin coating technique is applied here to make homogeneous thin films. The surface characterization using FESEM shows crack-free films with a perpendicular pore arrangement. The applicability of these thin films as catalysts as well as a robust SERS active substrate for model catalysis study is tested. Compared to bare silica film our gold incorporated silica, GSM-23F gave an enhancement factor of 10³ for RhB with a laser source 633 nm. The reduction reaction of p-nitrophenol with sodium borohydride from our thin films shows a decrease in peak intensity corresponding to -NO₂ group as time proceeds, confirming the catalytic activity. Such model surfaces can potentially bridge the material gap between a real catalytic system and surface science studies. PMID:27213321

  5. Synthesis of mesoporous silica hollow nanospheres with multiple gold cores and catalytic activity.


    Chen, Junchen; Xue, Zhaoteng; Feng, Shanshan; Tu, Bo; Zhao, Dongyuan


    The core-shell Au@resorcinol-formaldehyde (RF) nanospheres with multiple cores have been successfully synthesized by a modified Stöber method. After coating mesoporous silica and the calcination, the Au@meso-SiO2 hollow nanospheres with multiple gold cores can be obtained, which have a high surface area (∼537 m(2)/g) and uniform pore size (∼2.5 nm). The Au@meso-SiO2 hollow nanospheres can be used as a catalyst for the reduction of 4-nitrophenol by NaBH4 into 4-aminophenol, and exhibit excellent catalytic performance. PMID:24935190

  6. Multifunctional mesoporous silica catalyst


    Lin, Victor Shang-Yi; Tsai, Chih-Hsiang; Chen, Hung-Ting; Pruski, Marek; Kobayashi, Takeshi


    The present invention provides bifunctional silica mesoporous materials, including mesoporous silica nanoparticles ("MSN"), having pores modified with diarylammonium triflate and perfluoroaryl moieties, that are useful for the acid-catalyzed esterification of organic acids with organic alcohols.

  7. Facile Fabrication of Well-Dispersed Pt Nanoparticles in Mesoporous Silica with Large Open Spaces and Their Catalytic Applications.


    Liu, Xianchun; Chen, Dashu; Chen, Lin; Jin, Renxi; Xing, Shuangxi; Xing, Hongzhu; Xing, Yan; Su, Zhongmin


    In this paper, a facile strategy is reported for the preparation of well-dispersed Pt nanoparticles in ordered mesoporous silica (Pt@OMS) by using a hybrid mesoporous phenolic resin-silica nanocomposite as the parent material. The phenolic resin polymer is proposed herein to be the key in preventing the aggregation of Pt nanoparticles during their formation process and making contributions both to enhance the surface area and enlarge the pore size of the support. The Pt@OMS proves to be a highly active and stable catalyst for both gas-phase oxidation of CO and liquid-phase hydrogenation of 4-nitrophenol. This work might open new avenues for the preparation of noble metal nanoparticles in mesoporous silica with unique structures for catalytic applications. PMID:27245766

  8. Synthesis of mesoporous iron-incorporated silica-pillared clay and catalytic performance for phenol hydroxylation

    NASA Astrophysics Data System (ADS)

    Yang, Shengjun; Liang, Guozheng; Gu, Aijuan; Mao, Huihui


    Fe-incorporated silica-pillared clays (Fe-SPCs) with ordered interlayer mesoporous structure have been synthesized through a new two-step procedure including the modification of the silica nano-pillars with potassium ferricyanide (K3Fe(CN)6) and successive calcination. X-ray diffraction, nitrogen adsorption-desorption, Fourier transform infrared spectra, X-ray fluorescence analyses, diffuse reflectance UV-vis spectra and X-ray absorption near-edge structure spectra were used to characterize the structures and the synthesizing mechanism of Fe-SPCs. Results show that all iron species were tetrahedrally coordinated with the interlayer silica nano-pillars, and the cationic surfactant molecule plays an important role in the intercalation of tetraethoxysilane and the introduction of iron into the intragallery silica framework. Moreover, the structural parameters of Fe-SPC can be adjusted by controlling the concentration of K3Fe(CN)6, as the concentration of K3Fe(CN)6 increases from 1 M to 2 M, the gallery height of Fe-SPC increases from 2.51 to 2.66 nm, while the Brunauer-Emmett-Teller (BET) surface area, pore volume and Barrett-Joyner-Halenda (BJH) pore size decrease from 856 to 794 m2/g, 0.75 to 0.69 cm3/g, and 2.2 to 2.0 nm, respectively. The Fe-SPCs show good catalytic activity in phenol hydroxylation using H2O2 as oxidant (phenol:H2O2 = 1:1, water), specifically, the phenol conversion is 46.2%, and the selectivity of dihydroxybenzenes is 70.6% at 343 K.

  9. Catalytic performance of subtilisin immobilized without covalently attachment on surface-functionalized mesoporous silica materials

    NASA Astrophysics Data System (ADS)

    Murai, K.; Nonoyama, T.; Ando, F.; Kato, K.


    Mesoporous silica (MPS) materials were synthesized using cetyltrimethylammonium bromide or amphiphilic pluronic polymer P123 (EO20PO70EO20) as structure-directing agent. MPS samples were characterized by FE-SEM and N2 adsorption-desorption isotherms, respectively. Subtilisin from Bacillus licheiformis (4.1 × 7.8 × 3.7 nm) was easily immobilized by a direct one-step immobilization process onto MPS with different organo-functinalized surfaces. However, enzyme immobilized on MPS modified with 3-mercaptopropyl group strongly reduced its enantioselectivity. Denaturation temperature of immobilized subtilisin shifted to a high temperature compared to free-enzyme. These biocatalysts on MPS particles retained about 30% of original activity even after 5 cycles of recycle use.

  10. Effects of surface activation on the structural and catalytic properties of ruthenium nanoparticles supported on mesoporous silica.


    Ma, Xianfeng; Lin, Rui; Beuerle, Christopher; Jackson, James E; Obare, Sherine O; Ofoli, Robert Y


    Using colloid-based methods to prepare supported catalytic metallic nanoparticles (NPs) often faces the challenge of removing the stabilizer used during synthesis and activating the catalyst without modifying the particles or the support. We explored three surface activation protocols (thermal oxidation at 150 °C, thermal reduction at 350 °C, and argon-protected calcination at 650 °C) to activate ruthenium NPs supported on mesoporous silica (MSU-F), and assessed their effects on the structural and catalytic properties of the catalysts, and their activity by the aqueous phase hydrogenation of pyruvic acid. The NPs were synthesized by polyol reduction using poly-N-vinyl-2-pyrrolidone (PVP) as a stabilizer, and supported on MSU-F by sonication-assisted deposition. The NPs maintained their original morphology on the support during activation. Ar-protected calcination was the most efficient of the three for completely removing PVP from particle surfaces, and provided the highest degree of particle crystallinity and a metal dispersion comparable to commercial Ru/SiO2. Its catalytic performance was significantly higher than the other two protocols, although all three thermally activated catalysts achieved higher activity than the commercial catalyst at the same Ru loading. Post-reaction analysis also showed that the supported catalyst activated at 650 °C retained its morphology during the reaction, which is an important requirement for recyclability. PMID:24394435

  11. Effects of surface activation on the structural and catalytic properties of ruthenium nanoparticles supported on mesoporous silica

    NASA Astrophysics Data System (ADS)

    Ma, Xianfeng; Lin, Rui; Beuerle, Christopher; Jackson, James E.; Obare, Sherine O.; Ofoli, Robert Y.


    Using colloid-based methods to prepare supported catalytic metallic nanoparticles (NPs) often faces the challenge of removing the stabilizer used during synthesis and activating the catalyst without modifying the particles or the support. We explored three surface activation protocols (thermal oxidation at 150 ° C, thermal reduction at 350 ° C, and argon-protected calcination at 650 ° C) to activate ruthenium NPs supported on mesoporous silica (MSU-F), and assessed their effects on the structural and catalytic properties of the catalysts, and their activity by the aqueous phase hydrogenation of pyruvic acid. The NPs were synthesized by polyol reduction using poly-N-vinyl-2-pyrrolidone (PVP) as a stabilizer, and supported on MSU-F by sonication-assisted deposition. The NPs maintained their original morphology on the support during activation. Ar-protected calcination was the most efficient of the three for completely removing PVP from particle surfaces, and provided the highest degree of particle crystallinity and a metal dispersion comparable to commercial Ru/SiO2. Its catalytic performance was significantly higher than the other two protocols, although all three thermally activated catalysts achieved higher activity than the commercial catalyst at the same Ru loading. Post-reaction analysis also showed that the supported catalyst activated at 650 ° C retained its morphology during the reaction, which is an important requirement for recyclability.

  12. Distributions of noble metal Pd and Pt in mesoporous silica

    NASA Astrophysics Data System (ADS)

    Arbiol, J.; Cabot, A.; Morante, J. R.; Chen, Fanglin; Liu, Meilin


    Mesoporous silica nanostructures have been synthesized and loaded with Pd and Pt catalytic noble metals. It is found that Pd forms small nanoclusters (3-5 nm) on the surface of the mesoporous structure whereas Pt impregnation results in the inclusion of Pt nanostructures within the silica hexagonal pores (from nanoclusters to nanowires). It is observed that these materials have high catalytic properties for CO-CH4 combustion, even in a thick film form. In particular, results indicate that the Pt and Pd dispersed in mesoporous silica are catalytically active as a selective filter for gas sensors.

  13. Carbon Nanotube Synthesis Using Mesoporous Silica Templates

    SciTech Connect

    Zheng, Feng; Liang, Liang; Gao, Yufei; Sukamto, Johanes H.; Aardahl, Chris L.


    Well-aligned carbon nanotubes (CNTs) were grown on mesoporous silica films by chemical vapor deposition (CVD). Ethylene was used as the carbon source and CVD was performed at 1023 K and atmospheric pressure. The films were doped with Fe during gelation, and three different structure directing agents were used for mesoporous silica synthesis: polyoxyethylene (10) cetyl ether (C16EO10), Pluronic tri-block copolymer (P123), and cetyltriethylammonium chloride (CTAC). A high degree of CNT alignment on C16EO10-mesoporous silica films was produced at Fe:Si molar ratio of 1.80. Similar alignment of CNTs was achieved on the other two types of films but on CTAC-mesoporous silica films, CNTs only grew parallel to the substrate surface from the cracks in the films because of the in-plane arrangement of the mesopores in such films. Considerable progress has been made in producing multi-walled carbon nanotubes (CNTs) by catalytic CVD techniques. If CNTs are to be integrated into certain useful devices, it is critical to be able to grow highly aligned arrays of CNTs with narrow size distribution and at specific locations on a substrate. Long-range alignment normal to the substrate results from steric crowding if the initial catalyst sites are sufficiently dense. Alignment may be improved with better control of the density of catalytic sites by means of a template of appropriate pore structure. The confinement of CNTs by the pores during the initial growth may also help align CNTs.

  14. Characterization of 12-molybdophosphoric acid supported on mesoporous silica MCM-41 and its catalytic performance in the synthesis of hydroquinone diacetate

    NASA Astrophysics Data System (ADS)

    Ahmed, Awad I.; Samra, S. E.; El-Hakam, S. A.; Khder, A. S.; El-Shenawy, H. Z.; El-Yazeed, W. S. Abo


    12-molybdophosphoric acid (PMA) was supported on mesoporous molecular sieves MCM-41 by impregnation of 12-molybdophosphoric acid followed by calcination. The nanochannels of MCM-41 provide a large surface area for the solid state dispersion of 12-molybdophosphoric acid. The samples have been characterized by N2 adsorption-desorption at -196 °C, transmission electron microscopy (TEM), powder X-ray diffraction (PXRD), and FT-IR measurements. The acidity and catalytic activity have been, respectively, examined by nonaqueous titration of n-butylamine in acetonitrile and synthesis of hydroquinone diacetate. The results showed that ordered hexagonal pore structure was observed in the synthesized MCM-41. Also the results indicate that PMA are highly dispersed on mesoporous silica MCM-41 spherical nanoparticles while PMA retains its Keggin structure. On the other hand, with increasing the introduced PMA amount, the specific surface area decreases, and the mesoporous ordering of the samples become poor. Both the surface acidity and the catalytic activity sharply increase with the modification of MCM-41 by PMA but decrease by increasing the calcination temperature. The sample with 55 wt% PMA/MCM-41 calcined at 350 °C shows the highest acidity and catalytic activity.

  15. Highly selective BTX from catalytic fast pyrolysis of lignin over supported mesoporous silica.


    Elfadly, A M; Zeid, I F; Yehia, F Z; Rabie, A M; Aboualala, M M; Park, Sang-Eon


    The post synthesis of Al(3+) or Zr(4+) substituted MCM-48 framework with controlled acidity is challenging because the functional groups exhibiting acidity often jeopardize the framework integrity. Herein, we report the post-synthesis of two hierarchically porous MCM-48 composed of either aluminum (Al(3+)) or zirconium (Zr(4+)) clusters with high throughput. All prepared catalysts have been characterized by HR-TEM, XRD, IR, N2-adsorption, NH3-TPD, TGA and MAS NMR. They exhibit BET surface areas of 597 and 1112m(2)g(-1) for 8.4% Al/MCM-48 and 2.9% Zr/MCM-48, respectively. XRD analysis reveals that the hierarchical porosity of parental MCM-48 is reserved even after incorporation of Al(3+)or Zr(4+). Zr/MCM-48 catalysts are demonstrate a superior performance versus that of Al/MCM-48 and MCM-48 because of the mild (ZrO2) or nil (SiO2) Lewis acidity contributed from Zr-μ2-O group as well as smaller pore sizes suitable for the restriction of unwanted side reactions. The reaction conditions which were affecting the catalytic pyrolysis and final products were gas flow rate, pyrolysis temperature, and catalyst to lignin ratio. A total of 49% of BTX product were obtained over 2.9% Zr/MCM-48 at 600°C. The Lewis acid character was the governing factor which helps in pyrolysis and directly affects the BTX formation. PMID:27196367

  16. Mesoporous Silica: A Suitable Adsorbent for Amines

    PubMed Central


    Mesoporous silica with KIT-6 structure was investigated as a preconcentrating material in chromatographic systems for ammonia and trimethylamine. Its adsorption capacity was compared to that of existing commercial materials, showing its increased adsorption power. In addition, KIT-6 mesoporous silica efficiently adsorbs both gases, while none of the employed commercial adsorbents did. This means that KIT-6 Mesoporous silica may be a good choice for integrated chromatography/gas sensing micro-devices. PMID:20628459

  17. Cellular membrane trafficking of mesoporous silica nanoparticles

    SciTech Connect

    Fang, I-Ju


    This dissertation mainly focuses on the investigation of the cellular membrane trafficking of mesoporous silica nanoparticles. We are interested in the study of endocytosis and exocytosis behaviors of mesoporous silica nanoparticles with desired surface functionality. The relationship between mesoporous silica nanoparticles and membrane trafficking of cells, either cancerous cells or normal cells was examined. Since mesoporous silica nanoparticles were applied in many drug delivery cases, the endocytotic efficiency of mesoporous silica nanoparticles needs to be investigated in more details in order to design the cellular drug delivery system in the controlled way. It is well known that cells can engulf some molecules outside of the cells through a receptor-ligand associated endocytosis. We are interested to determine if those biomolecules binding to cell surface receptors can be utilized on mesoporous silica nanoparticle materials to improve the uptake efficiency or govern the mechanism of endocytosis of mesoporous silica nanoparticles. Arginine-glycine-aspartate (RGD) is a small peptide recognized by cell integrin receptors and it was reported that avidin internalization was highly promoted by tumor lectin. Both RGD and avidin were linked to the surface of mesoporous silica nanoparticle materials to investigate the effect of receptor-associated biomolecule on cellular endocytosis efficiency. The effect of ligand types, ligand conformation and ligand density were discussed in Chapter 2 and 3. Furthermore, the exocytosis of mesoporous silica nanoparticles is very attractive for biological applications. The cellular protein sequestration study of mesoporous silica nanoparticles was examined for further information of the intracellular pathway of endocytosed mesoporous silica nanoparticle materials. The surface functionality of mesoporous silica nanoparticle materials demonstrated selectivity among the materials and cancer and normal cell lines. We aimed to determine

  18. Design and functionalization of photocatalytic systems within mesoporous silica.


    Qian, Xufang; Fuku, Kojirou; Kuwahara, Yasutaka; Kamegawa, Takashi; Mori, Kohsuke; Yamashita, Hiromi


    In the past decades, various photocatalysts such as TiO2, transition-metal-oxide moieties within cavities and frameworks, or metal complexes have attracted considerable attention in light-excited catalytic processes. Owing to high surface areas, transparency to UV and visible light as well as easily modified surfaces, mesoporous silica-based materials have been widely used as excellent hosts for designing efficient photocatalytic systems under the background of environmental remediation and solar-energy utilization. This Minireview mainly focuses on the surface-chemistry engineering of TiO2/mesoporous silica photocatalytic systems and fabrication of binary oxides and nanocatalysts in mesoporous single-site-photocatalyst frameworks. Recently, metallic nanostructures with localized surface plasmon resonance (LSPR) have been widely studied in catalytic applications harvesting light irradiation. Accordingly, silver and gold nanostructures confined in mesoporous silica and their corresponding catalytic activity enhanced by the LSPR effect will be introduced. In addition, the integration of metal complexes within mesoporous silica materials for the construction of functional inorganic-organic supramolecular photocatalysts will be briefly described. PMID:24828540

  19. Utilization of a By-product Produced from Oxidative Desulfurization Process over Cs-Mesoporous Silica Catalysts

    SciTech Connect

    Kim, Hyeonjoo; Jeong, Kwang Eun; Jeong, Soon-Yong; Park, Young-Kwon; Kim, Do Heui; Jeon, Jong Ki


    We investigated the use of Cs-mesoporous silica catalysts to upgrade a by-product of oxidative desulfurization (ODS). Cs-mesoporous silica catalysts were chaeacterized through N2 adsorption, XRD, CO2-temperature-programmed desorption, and XRF. Cs-mesoporous silica prepared by the direct incorporation method showed higher catalytic performance than a Cs/MCM-41 catalyst by impregnation method for the catalytic decomposition of sulfone compounds produced from ODS process.

  20. Synthesis of mesoporous silica nanoparticles.


    Wu, Si-Han; Mou, Chung-Yuan; Lin, Hong-Ping


    Good control of the morphology, particle size, uniformity and dispersity of mesoporous silica nanoparticles (MSNs) is of increasing importance to their use in catalyst, adsorption, polymer filler, optical devices, bio-imaging, drug delivery, and biomedical applications. This review discusses different synthesis methodologies to prepare well-dispersed MSNs and hollow silica nanoparticles (HSNs) with tunable dimensions ranging from a few to hundreds of nanometers of different mesostructures. The methods include fast self-assembly, soft and hard templating, a modified Stöber method, dissolving-reconstruction and modified aerogel approaches. In practical applications, the MSNs prepared by these methods demonstrate good potential for use in high-performance catalysis, antireflection coating, transparent polymer-MSNs nanocomposites, drug-release and theranostic systems. PMID:23403864

  1. A bio-catalytically driven Janus mesoporous silica cluster motor with magnetic guidance† †Electronic supplementary information (ESI) available. See DOI: 10.1039/c4cc08285k Click here for additional data file. Click here for additional data file. Click here for additional data file. Click here for additional data file. Click here for additional data file.

    PubMed Central

    Ma, Xing


    A bio-catalytic Janus motor based on the mesoporous silica cluster (JMSC) is fabricated. Chemically conjugated catalase triggers the decomposition of H2O2 to produce driving force by bubble propulsion, while a metallic (Ni) coating layer allows for magnetic guidance of the motor. The JMSC motor can act as a delivery vehicle with cargo loading inside its mesopores. PMID:25407318

  2. Sample Desorption/Onization From Mesoporous Silica


    Iyer, Srinivas; Dattelbaum, Andrew M.


    Mesoporous silica is shown to be a sample holder for laser desorption/ionization of mass spectrometry. Supported mesoporous silica was prepared by coating an ethanolic silicate solution having a removable surfactant onto a substrate to produce a self-assembled, ordered, nanocomposite silica thin film. The surfactant was chosen to provide a desired pore size between about 1 nanometer diameter and 50 nanometers diameter. Removal of the surfactant resulted in a mesoporous silica thin film on the substrate. Samples having a molecular weight below 1000, such as C.sub.60 and tryptophan, were adsorbed onto and into the mesoporous silica thin film sample holder and analyzed using laser desorption/ionization mass spectrometry.

  3. Non-destructively shattered mesoporous silica for protein drug delivery

    SciTech Connect

    Lei, Chenghong; Chen, Baowei; Li, Xiaolin; Qi, Wen N.; Liu, Jun


    Mesoporous silicas have been extensively used for entrapping small chemical molecules and biomacromolecules. We hypothesize that the loading density of biomacromlecules such as proteins in mesoporous silicas could be limited due to mesopore disorderness and depth because of some pore volume inaccessible. We innovatively shattered mesoporous silicas resulting in reduced particle sizes and improved intramesoporous structures in aqueous solution by a powerful sonication, where the mesoporous structures were still well maintained. The sonication-shattered mesoporous silicas can allow protein loading densities to be increased by more than 170%, demonstrating that significantly more mesoporous room of the silicas could become accessible for biomacromolecule loading after the sonication-shattering.

  4. Bimodal mesoporous silica with bottleneck pores.


    Reber, M J; Brühwiler, D


    Bimodal mesoporous silica consisting of two sets of well-defined mesopores is synthesized by a partial pseudomorphic transformation of an ordered mesoporous starting material (SBA-15 type). The introduction of a second set of smaller mesopores (MCM-41 type) establishes a pore system with bottlenecks that restricts the access to the core of the bimodal mesoporous silica particles. The particle size and shape of the starting material are retained, but micropores present in the starting material disappear during the transformation, leading to a true bimodal mesoporous product. A varying degree of transformation allows the adjustment of the pore volume contribution of the two mesopore domains. Information on the accessibility of the mesopores is obtained by the adsorption of fluorescence-labeled poly(amidoamine) dendrimers and imaging by confocal laser scanning microscopy. This information is correlated with nitrogen sorption data to provide insights regarding the spatial distribution of the two mesopore domains. The bimodal mesoporous materials are excellent model systems for the investigation of cavitation effects in nitrogen desorption isotherms. PMID:26399172

  5. Preparation of periodic mesoporous silica-included divacant Keggin units for the catalytic oxidation of styrene to synthesize styrene oxide

    NASA Astrophysics Data System (ADS)

    Yu, Xiaodan; Xu, Leilei; Yang, Xia; Guo, Yingna; Li, Kexin; Hu, Jianglei; Li, Wei; Ma, Fengyan; Guo, Yihang


    Periodic mesoporous composite catalysts, [( n-C 4H 9) 4N] 4[γ-SiW 10O 34(H 2O) 2]/SBA-15 (TBA-1*/SBA-15, where TBA-1* = [( n-C 4H 9) 4N] 4[γ-SiW 10O 34(H 2O) 2]), with TBA-1* loadings of 4.3-14.8% were prepared by simultaneous hydrolysis and co-condensation of the tetraethoxysilane (TEOS) in the presence of divacant Keggin-type polyoxometalate and triblock copolymer surfactant (P123) followed by hydrothermal treatment process. Structure integrity of the Keggin unit in as-prepared composites was studied by Fourier transform infrared spectroscopy (FT-IR), Raman scattering spectra, and 29Si magic-angle spinning (MAS) NMR. Periodic mesoporous structure of the composites was evaluated by low-angle X-ray powder diffraction (LXRD) patterns, nitrogen porosimetry, and transmission electron microscope (TEM) measurements. As-prepared TBA-1*/SBA-15 was used as an heterogeneous oxidation catalyst for the styrene epoxidation reaction to synthesize styrene oxide in the presence of dilute H 2O 2 (30%), and influences of solvent, molar ratio of styrene to H 2O 2, TBA-1* loading on the styrene conversion, styrene oxide yield and selectivity were considered.

  6. Modified Mesoporous Silica for Efficient Siloxane Capture.


    Jafari, Tahereh; Jiang, Ting; Zhong, Wei; Khakpash, Nasser; Deljoo, Bahareh; Aindow, Mark; Singh, Prabhakar; Suib, Steven L


    In this study, octamethylcyclotetrasiloxane (D4) was removed by using a novel modified solid adsorbent of mesoporous silica. The adsorbent was synthesized using inverse micelles with some modifications in the synthesis process (temperature of gelation) and in the post treatment conditions (calcination temperature and heating rate) with a concomitant improvement of D4 uptake. This is the first report on regulating the textural properties of the mesoporous silica material UCT-14 to develop an active silica adsorbent. These adjustments resulted in an increase of the silica surface area from 391 to 798 m(2)·g(-1), which leads to a high capacity (686 mg·g(-1)) of D4-capture for the silica synthesized at 80 °C, calcined at 450 °C with the heating rate of 100 °C·min(-1) (Si-Syn80). This adsorbent showed comparable adsorption performance with the widely used commercial silica gel under dry and humid condition. Recyclability tests on the commercial silica gel and mesoporous silica synthesized at 120 °C and calcined at 450 °C with a heating rate of 100 °C·min(-1) (called Si-Syn120 or Si-450 or Si-100 °C·min(-1)) indicated that the Si-Syn120 (capacity drop 10%) is more efficient than silica gel (capacity drop 15%) after three cycles. Although, the presence of moisture (25%) in the nitrogen gas stream led to capacity reduction in both Si-Syn120 and commercial silica gel, the modified UCT-14 shows slightly better resistance to humid condition. PMID:26890152

  7. Drug release from ordered mesoporous silicas.


    Doadrio, Antonio L; Salinas, Antonio J; Sánchez-Montero, José M; Vallet-Regí, M


    The state-of-the-art in the investigation of drugs release from Silica-based ordered Mesoporous Materials (SMMs) is reviewed. First, the SMM systems used like host matrixes are described. Then, the model drugs studied until now, including their pharmacological action, structure and the mesoporous matrix employed for each drug, are comprehensively listed. Next, the factors influencing the release of drugs from SMMs and the strategies used to control the drug delivery, specially the chemical functionalization of the silica surface, are discussed. In addition, how all these factors were gathered in a kinetic equation that describes the drug release from the mesoporous matrixes is explained. The new application of molecular modeling and docking in the investigation of the drug delivery mechanisms from SMMs is also presented. Finally, the new approaches under investigation in this field are mentioned including the design of smart stimuli-responsive materials and other recent proposals for a future investigation. PMID:26549760

  8. Self-Assembly and Compartmentalization of Nanozymes in Mesoporous Silica-Based Nanoreactors.


    Huang, Yanyan; Lin, Youhui; Ran, Xiang; Ren, Jinsong; Qu, Xiaogang


    Herein, to mimic complex natural system, polyelectrolyte multilayer (PEM)-coated mesoporous silica nanoreactors were used to compartmentalize two different artificial enzymes. PEMs coated on the surface of mesoporous silica could serve as a permeable membrane to control the flow of molecules. When assembling hemin on the surface of mesoporous silica, the hemin-based mesoporous silica system possessed remarkable peroxidase-like activity, especially at physiological pH, and could be recycled more easily than traditional graphene-hemin nanocompounds. The hope is that these new findings may pave the way for exploring novel nanoreactors to achieve compartmentalization of nanozymes and applying artificial cascade catalytic systems to mimic cell organelles or important biochemical transformations. PMID:26934043

  9. Synthesis of manganese incorporated hierarchical mesoporous silica nanosphere with fibrous morphology by facile one-pot approach for efficient catalytic ozonation.


    Afzal, Shahzad; Quan, Xie; Chen, Shuo; Wang, Jing; Muhammad, Dost


    Manganese incorporated fibrous silica nanosphere (MnOx-0.013/KCC-1) was synthesized by one step hydrothermal method for the first time and its catalytic activity for ozonation of oxalic acid was studied. For comparison, manganese loaded MCM-41 (MnOx-0.013/MCM-41) was prepared by impregnation method. Various characterizations showed that the morphological, structural and textural properties of MnOx-0.013/KCC-1 were well preserved. Ozonation and catalytic ozonation by MnOx-0.013/KCC-1 and MnOx-0.013/MCM-41 led to 4, 85 and 60% reduction in TOC respectively. Furthermore, 0.05 and 1.2mgL(-1) leaching of Mn was detected from MnOx-0.013/KCC-1 and MnOx-0.013/MCM-41, which are approximately 2.0 and 42.0% of the total Mn present in MnOx-0.013/KCC-1 and MnOx-0.013/MCM-41 respectively. The high catalytic activity was attributed to the generation of hydroxyl radical. Surface hydroxyl groups investigated by using phosphates and ATR-FTIR were believed to be the active sites. Our proposed method of synthesis can be generalized for the synthesis of other metal oxides incorporated fibrous silica for environmental catalysis and other catalytic reactions. PMID:27434734

  10. Mesoporous CLEAs-silica composite microparticles with high activity and enhanced stability

    PubMed Central

    Cui, Jiandong; Jia, Shiru; Liang, Longhao; Zhao, Yamin; Feng, Yuxiao


    A novel enzyme immobilization approach was used to generate mesoporous enzymes-silica composite microparticles by co-entrapping gelatinized starch and cross-linked phenylalanine ammonia lyase (PAL) aggregates (CLEAs) containing gelatinized starch into biomemitic silica and subsequently removing the starch by α-amylase treatment. During the preparation process, the gelatinzed starch served as a pore-forming agent to create pores in CLEAs and biomimetic silica. The resulting mesoporous CLEAs-silica composite microparticles exhibited higher activity and stability than native PAL, conventional CLEAs, and PAL encapsulated in biomimetic silica. Furthermore, the mesoporous CLEAs-silica composite microparticles displayed good reusability due to its suitable size and mechanical properties, and had excellent stability for storage. The superior catalytic performances were attributed to the combinational unique structure from the intra-cross-linking among enzyme aggregates and hard mesoporous silica shell, which not only decreased the enzyme-support negative interaction and mass-transfer limitations, but also improved the mechanical properties and monodispersity. This approach will be highly beneficial for preparing various bioactive mesoporous composites with excellent catalytic performance. PMID:26374188

  11. Mesoporous silica nanoparticles for active corrosion protection.


    Borisova, Dimitriya; Möhwald, Helmuth; Shchukin, Dmitry G


    This work presents the synthesis of monodisperse, mesoporous silica nanoparticles and their application as nanocontainers loaded with corrosion inhibitor (1H-benzotriazole (BTA)) and embedded in hybrid SiOx/ZrOx sol-gel coating for the corrosion protection of aluminum alloy. The developed porous system of mechanically stable silica nanoparticles exhibits high surface area (∼1000 m2·g(-1)), narrow pore size distribution (d∼3 nm), and large pore volume (∼1 mL·g(-1)). As a result, a sufficiently high uptake and storage of the corrosion inhibitor in the mesoporous nanocontainers was achieved. The successful embedding and homogeneous distribution of the BTA-loaded monodisperse silica nanocontainers in the passive anticorrosive SiOx/ZrOx film improve the wet corrosion resistance of the aluminum alloy AA2024 in 0.1 M sodium chloride solution. The enhanced corrosion protection of this newly developed active system in comparison to the passive sol-gel coating was observed during a simulated corrosion process by the scanning vibrating electrode technique (SVET). These results, as well as the controlled pH-dependent release of BTA from the mesoporous silica nanocontainers without additional polyelectrolyte shell, suggest an inhibitor release triggered by the corrosion process leading to a self-healing effect. PMID:21344888

  12. A highly ordered cubic mesoporous silica/graphene nanocomposite.


    Lee, Chang-Wook; Roh, Kwang Chul; Kim, Kwang-Bum


    A highly ordered cubic mesoporous silica (KIT-6)/graphene nanocomposite and 2D KIT-6 nanoflakes were synthesized using a novel synthesis methodology. The non-ionic triblock copolymer, P123, played a dual role as a structure-directing agent in the formation of the cubic mesoporous structure and as a cross-linking agent between mesoporous silica and graphene. The prepared (KIT-6)/graphene nanocomposite could act as a template for the preparation of mesoporous material/graphene nanocomposites. PMID:24057016

  13. Dendrimer Templated Synthesis of One Nanometer Rh and Pt Particles Supported on Mesoporous Silica: Catalytic Activity for Ethylene and Pyrrole Hydrogenation.

    SciTech Connect

    Huang, Wenyu; Kuhn, John N.; Tsung, Chia-Kuang; Zhang, Yawen; Habas, Susan E.; Yang, Peidong; Somorjai, Gabor A.


    Monodisperse rhodium (Rh) and platinum (Pt) nanoparticles as small as {approx}1 nm were synthesized within a fourth generation polyaminoamide (PAMAM) dendrimer, a hyperbranched polymer, in aqueous solution and immobilized by depositing onto a high-surface-area SBA-15 mesoporous support. X-ray photoelectron spectroscopy indicated that the as-synthesized Rh and Pt nanoparticles were mostly oxidized. Catalytic activity of the SBA-15 supported Rh and Pt nanoparticles was studied with ethylene hydrogenation at 273 and 293 K in 10 torr of ethylene and 100 torr of H{sub 2} after reduction (76 torr of H{sub 2} mixed with 690 torr of He) at different temperatures. Catalysts were active without removing the dendrimer capping but reached their highest activity after hydrogen reduction at a moderate temperature (423 K). When treated at a higher temperature (473, 573, and 673 K) in hydrogen, catalytic activity decreased. By using the same treatment that led to maximum ethylene hydrogenation activity, catalytic activity was also evaluated for pyrrole hydrogenation.

  14. Synthesis of periodic mesoporous silica thin films

    SciTech Connect

    Anderson, M.T.; Martin, J.E.; Odinek, J.G.; Newcomer, P.


    We have synthesized periodic mesoporous silica thin films from homogeneous solutions. To synthesize the films, a thin layer of a pH 7 micellar coating solution that contains TMOS (tetramethoxysilane) is dip or spin-coated onto Si wafers, borosilicate glass, or quartz substrates. NH3 gas is diffused into the solution and causes rapid hydrolysis and condensation of the TMOS and the formation of periodic mesoporous thin films within 10 seconds. Combination of homogenous solutions and rapid product formation maximizes the concentration of the desired product and provides a controlled, predictable microstructure. The films have been made continuous and crack-free by optimizing initial silica concentration and film thickness. The films are being evaluated as high surface area, size-selective coatings for surface acoustic wave (SAW) sensors.

  15. Electrical Relaxation in ULTEM® and ULTEM® Containing Mesoporous Silica

    NASA Astrophysics Data System (ADS)

    Turo, Andrew; Edmondson, Charles E.; Lomax, Joseph F.; Bendler, John T.; Fontanella, John J.; Wintersgill, Mary C.


    Mesoporous silica has been added to Ultem® 1000 polyetherimide using solution casting. The mesoporous silica that was added was either uncoated or coated with polystyrene. Audio frequency dielectric relaxation studies were then carried out over the temperature range 5.5 to 550 K. Several interesting results were obtained. First, the uncoated mesoporous silica caused essentially no change in the relaxation spectrum of pure Ultem®. The polystyrene coated mesoporous silica caused rather large changes. The most striking example is the introduction of a new relaxation. This relaxation occurs at about 150 K and 1000 Hz as showing in fig. 1 via the open circles.

  16. Morphological Control of Multifunctional Mesoporous Silica Nanomaterials for Catalysis Applications

    SciTech Connect

    Seong Huh


    I found an efficient method to control the morphology of the organically monofunctionalized mesoporous silica materials by introducing different types of organoalkoxysilanes in a base-catalyzed co-condensation reaction. The monofunctionalized materials exhibit different particle morphologies relative to the pure MCM-41 material. The concentration dependence of the morphology is a critical factor to determine the final particle shape. A proposed mechanism of the shape evolution is also offered. After understanding the role of organoalkoxysilanes in producing various well-shaped nanomaterials, I also obtained a series of bifunctional mesoporous silica materials with certain particle morphology. A series of bifunctional mesoporous silica nanospheres (MSNs) whose physicochemical properties was investigated via solid state NMR techniques and Cu{sup 2+} adsorption capacity tests, The ratio of two different organic groups inside of mesopores of these MSNs could be fine-tuned. These MSNs serve as a useful model system to study substrate selectivity in catalytic reactions and sorption phenomena. For example, the Cu{sup 2+} adsorption capacity of these materials was dictated by the chemical nature of the mesopores generated by the different organic functional groups. An investigation of the substrate selectivity of the bifunctionalized MSNs in a competitive nitroaldol reaction using an equimolar amount of two competing 4-nitrobenzaldehyde derivatives was performed. Shape-controlled bifunctional MSNs were employed as the catalysts. The properties of the MSNs were investigated using various spectroscopic methods and electron microscopy. The more hydrophobic the surface organic groups are, the higher the ratio of hydrophobic final product. This is the first example to demonstrate the selection of substrate using physicochemical nature of the mesopore surface other than the conventional shape selection in zeolite systems. I also created a cooperative dual catalyst system that is

  17. Morphological control of multifunctionalized mesoporous silica nanomaterials for catalysis applications

    NASA Astrophysics Data System (ADS)

    Huh, Seong

    I found an efficient method to control the morphology of the organically monofunctionalized mesoporous silica materials by introducing different types of organoalkoxysilanes in a base-catalyzed co-condensation reaction. The monofunctionalized materials exhibit different particle morphologies relative to the pure MCM-41 material. The concentration dependence of the morphology is a critical factor to determine the final particle shape. A proposed mechanism of the shape evolution is also offered. After understanding the role of organoalkoxysilanes in producing various well-shaped nanomaterials, I also obtained a series of bifunctional mesoporous silica materials with certain particle morphology. A series of bifunctional mesoporous silica nanospheres (MSNs) whose physicochemical properties was investigated via solid state NMR techniques and Cu 2+ adsorption capacity tests. The ratio of two different organic groups inside of mesopores of these MSNs could be fine-tuned. These MSNs serve as a useful model system to study substrate selectivity in catalytic reactions and sorption phenomena. For example, the Cu2+ adsorption capacity of these materials was dictated by the chemical nature of the mesopores generated by the different organic functional groups. An investigation of the substrate selectivity of the bifunctionalized MSNs in a competitive nitroaldol reaction using an equimolar amount of two competing 4-nitrobenzaldehyde derivatives was performed. Shape-controlled bifunctional MSNs were employed as the catalysts. The properties of the MSNs were investigated using various spectroscopic methods and electron microscopy. The more hydrophobic the surface organic groups are, the higher the ratio of hydrophobic final product. This is the first example to demonstrate the selection of substrate using physicochemical nature of the mesopore surface other than the conventional shape selection in zeolite systems. I also created a cooperative dual catalyst system that is capable of

  18. Catalytic Mesoporous Janus Nanomotors for Active Cargo Delivery

    PubMed Central


    We report on the synergy between catalytic propulsion and mesoporous silica nanoparticles (MSNPs) for the design of Janus nanomotors as active cargo delivery systems with sizes <100 nm (40, 65, and 90 nm). The Janus asymmetry of the nanomotors is given by electron beam (e-beam) deposition of a very thin platinum (2 nm) layer on MSNPs. The chemically powered Janus nanomotors present active diffusion at low H2O2 fuel concentration (i.e., <3 wt %). Their apparent diffusion coefficient is enhanced up to 100% compared to their Brownian motion. Due to their mesoporous architecture and small dimensions, they can load cargo molecules in large quantity and serve as active nanocarriers for directed cargo delivery on a chip. PMID:25844893

  19. Catalytic mesoporous Janus nanomotors for active cargo delivery.


    Ma, Xing; Hahn, Kersten; Sanchez, Samuel


    We report on the synergy between catalytic propulsion and mesoporous silica nanoparticles (MSNPs) for the design of Janus nanomotors as active cargo delivery systems with sizes <100 nm (40, 65, and 90 nm). The Janus asymmetry of the nanomotors is given by electron beam (e-beam) deposition of a very thin platinum (2 nm) layer on MSNPs. The chemically powered Janus nanomotors present active diffusion at low H2O2 fuel concentration (i.e., <3 wt %). Their apparent diffusion coefficient is enhanced up to 100% compared to their Brownian motion. Due to their mesoporous architecture and small dimensions, they can load cargo molecules in large quantity and serve as active nanocarriers for directed cargo delivery on a chip. PMID:25844893

  20. Transport properties of fast proton conducting mesoporous silica xerogels

    NASA Astrophysics Data System (ADS)

    Colomer, M. T.; Rubio, F.; Jurado, J. R.

    Mesoporous acid-free silica xerogels exhibiting a proton conductivity of 2.0 × 10 -2 S cm -1 at 80 °C and 81% RH is reported for the first time. The proton conductivity values, lower cost and higher hydrophilicity of mesoporous silica xerogels make them potential substitutes for Nafion membranes in proton exchange membranes fuel cells (PEMFCs).

  1. Biodegradation-tunable mesoporous silica nanorods for controlled drug delivery.


    Park, Sung Bum; Joo, Young-Ho; Kim, Hyunryung; Ryu, WonHyoung; Park, Yong-il


    Mesoporous silica in the forms of micro- or nanoparticles showed great potentials in the field of controlled drug delivery. However, for precision control of drug release from mesoporous silica-based delivery systems, it is critical to control the rate of biodegradation. Thus, in this study, we demonstrate a simple and robust method to fabricate "biodegradation-tunable" mesoporous silica nanorods based on capillary wetting of anodic aluminum oxide (AAO) template with an aqueous alkoxide precursor solution. The porosity and nanostructure of silica nanorods were conveniently controlled by adjusting the water/alkoxide molar ratio of precursor solutions, heat-treatment temperature, and Na addition. The porosity and biodegradation kinetics of the fabricated mesoporous nanorods were analyzed using N2 adsorption/desorption isotherm, TGA, DTA, and XRD. Finally, the performance of the mesoporous silica nanorods as drug delivery carrier was demonstrated with initial burst and subsequent "zero-order" release of anti-cancer drug, doxorubicin. PMID:25746247

  2. Fluorescence properties of dye doped mesoporous silica

    NASA Astrophysics Data System (ADS)

    Carbonaro, Carlo M.; Corpino, Riccardo; Ricci, Pier Carlo; Chiriu, Daniele; Cannas, Carla


    In this paper we present a review of the main results we obtained studying the emission properties of organic-inorganic hybrids obtained combining mesoporous silica and Xantene dyes, in particular the standard referenc Rhodamine 6G. The purpose of the review is to show the possibility to efficiently "dope" the transparent inorganic porous matrix to obtain promising systems for photonic and biomedical applications. The strategies to solve the concentration effect and the leaching phenomenon are discussed within the framework of the single exciton theory.

  3. Mesoporous silica-titania composed materials.


    Messina, Paula V; Morini, Marcela A; Sierra, María B; Schulz, Pablo C


    Titania mesosized particles were obtained by TiCl4 hydrolysis in Aerosol OT/water/n-hexane microemulsion. These particles were incorporated in surfactant templated silica mesoporous materials of MCM-41 and MCM-50 structures. Results depended on the surfactant: hexadecyltrimethylammonium bromide templated materials retained the honeycomb structure with small modifications in their characteristics. The dodecyltrimethylammonium bromide templated material changed from honeycomb to lamellar structure when the titania particles were included, with dramatic changes in the structure characteristics. The didodecyldimethylammonium bromide templated lamellar structure was retained after TIO2 inclusion, with a slight increase in the specific area, pore diameter and pore walls thickness. PMID:16600274

  4. Fluorescence properties of dye doped mesoporous silica

    SciTech Connect

    Carbonaro, Carlo M. Corpino, Riccardo Ricci, Pier Carlo Chiriu, Daniele; Cannas, Carla


    In this paper we present a review of the main results we obtained studying the emission properties of organic-inorganic hybrids obtained combining mesoporous silica and Xantene dyes, in particular the standard reference Rhodamine 6G. The purpose of the review is to show the possibility to efficiently 'dope' the transparent inorganic porous matrix to obtain promising systems for photonic and biomedical applications. The strategies to solve the concentration effect and the leaching phenomenon are discussed within the framework of the single exciton theory.

  5. Enzyme-controlled sensing-actuating nanomachine based on Janus Au-mesoporous silica nanoparticles.


    Villalonga, Reynaldo; Díez, Paula; Sánchez, Alfredo; Aznar, Elena; Martínez-Máñez, Ramón; Pingarrón, José M


    Novel Janus nanoparticles with Au and mesoporous silica faces on opposite sides were prepared using a Pickering emulsion template with paraffin wax as the oil phase. These anisotropic colloids were employed as integrated sensing-actuating nanomachines for enzyme-controlled stimuli-responsive cargo delivery. As a proof of concept, we demonstrated the successful use of the Janus colloids for controlled delivery of tris(2,2'-bipyridyl) ruthenium(II) chloride from the mesoporous silica face, which was grafted with pH-sensitive gatelike scaffoldings. The release was mediated by the on-demand catalytic decomposition of urea by urease, which was covalently immobilized on the Au face. PMID:23649789

  6. Gated Silica Mesoporous Materials in Sensing Applications.


    Sancenón, Félix; Pascual, Lluís; Oroval, Mar; Aznar, Elena; Martínez-Máñez, Ramón


    Silica mesoporous supports (SMSs) have a large specific surface area and volume and are particularly exciting vehicles for delivery applications. Such container-like structures can be loaded with numerous different chemical substances, such as drugs and reporters. Gated systems also contain addressable functions at openings of voids, and cargo delivery can be controlled on-command using chemical, biochemical or physical stimuli. Many of these gated SMSs have been applied for drug delivery. However, fewer examples of their use in sensing protocols have been reported. The approach of applying SMSs in sensing uses another concept-that of loading pores with a reporter and designing a capping mechanism that is selectively opened in the presence of a target analyte, which results in the delivery of the reporter. According to this concept, we provide herein a complete compilation of published examples of probes based on the use of capped SMSs for sensing. Examples for the detection of anions, cations, small molecules and biomolecules are provided. The diverse range of gated silica mesoporous materials presented here highlights their usefulness in recognition protocols. PMID:26491626

  7. Gated Silica Mesoporous Materials in Sensing Applications

    PubMed Central

    Sancenón, Félix; Pascual, Lluís; Oroval, Mar; Aznar, Elena; Martínez-Máñez, Ramón


    Silica mesoporous supports (SMSs) have a large specific surface area and volume and are particularly exciting vehicles for delivery applications. Such container-like structures can be loaded with numerous different chemical substances, such as drugs and reporters. Gated systems also contain addressable functions at openings of voids, and cargo delivery can be controlled on-command using chemical, biochemical or physical stimuli. Many of these gated SMSs have been applied for drug delivery. However, fewer examples of their use in sensing protocols have been reported. The approach of applying SMSs in sensing uses another concept—that of loading pores with a reporter and designing a capping mechanism that is selectively opened in the presence of a target analyte, which results in the delivery of the reporter. According to this concept, we provide herein a complete compilation of published examples of probes based on the use of capped SMSs for sensing. Examples for the detection of anions, cations, small molecules and biomolecules are provided. The diverse range of gated silica mesoporous materials presented here highlights their usefulness in recognition protocols. PMID:26491626

  8. Magnetic Fluorescent Delivery Vehicle using Uniform Mesoporous Silica Spheres Embedded with Monodisperse Magnetic and Semiconductor Nanocrystals

    SciTech Connect

    Kim, Jaeyun; Lee, Ji Eun; Lee, Jinwoo; Yu, Jung Ho; Kim, Byoung Chan; An, Kwangjin; Hwang, Yosun; Shin, Chae-Ho; Park, Je-Geun; Kim, Jungbae; Hyeon, Taeghwan


    Uniform sized colloidal nanocrystals have attracted much attention, because of their unique magnetic and optical properties, as compared with those of their bulk counterparts. Especially magnetic nanocrystals and quantum dots have been intensively pursued for biomedical applications such as contrast enhancement agents in magnetic resonance imaging, magnetic carriers for drug delivery system, biological labeling and diagnostics. Due to their large pore sizes and high surface areas, mesoporous materials and its composites with nanocrystals have attracted considerable attention. In order to use the nanocrystals as functional delivery carriers and catalytic supports, nanocrystals coated with porous silica shells are desirable. Herein, we report a synthetic procedure for the fabrication of monodisperse nanocrystals embedded in uniform pore-sized mesoporous silica spheres. As a representative example, we synthesized monodisperse magnetite (Fe3O4) nanocrystals embedded in mesoporous silica spheres and both magnetite nanocrystals and CdSe/ZnS quantum dots embedded in mesoporous silica spheres. Furthermore, these mesoporous silica spheres were applied to the uptake and controlled release of drugs.

  9. Incorporation of antimicrobial compounds in mesoporous silica film monolith.


    Izquierdo-Barba, Isabel; Vallet-Regí, María; Kupferschmidt, Natalia; Terasaki, Osamu; Schmidtchen, Artur; Malmsten, Martin


    Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieved without greatly affecting the structure of the mesoporous silica. The modified mesoporous silica released LL-37 and chlorhexidine slowly, reaching maximum release after about 200 h. The release rate could also be controlled through incorporation of SH groups in the pore walls, adding to pore hydrophobicity and reducing the release rate by about 50% compared to the unmodified mesoporous silica. Mesoporous silica containing either LL-37 or chlorhexidine displayed potent bactericidal properties against both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli. While chlorhexidine-loaded mesoporous silica displayed an accompanying high toxicity, as judged from hemolysis, LDH release, and MTT assay, the corresponding material containing LL-37 showed very low toxicity by all these assays, comparable to that observed for mesoporous silica in the absence of antibacterial drug, as well as to the negative controls in the respective assays. Mesoporous silica containing LL-37 therefore holds potential as an implantable material or a surface coating for such materials, as it combines potent bactericidal action with low toxicity, important features for controlling implant-related infections, e.g., for multi-resistant pathogens or for cases where access to the infection site of systemically administered antibiotics is limited due to collagen capsule formation or other factors. PMID:19628277

  10. Crystallization of hollow mesoporous silica nanoparticles.


    Drisko, Glenna L; Carretero-Genevrier, Adrian; Perrot, Alexandre; Gich, Martí; Gàzquez, Jaume; Rodriguez-Carvajal, Juan; Favre, Luc; Grosso, David; Boissière, Cédric; Sanchez, Clément


    Complex 3D macrostructured nanoparticles are transformed from amorphous silica into pure polycrystalline α-quartz using catalytic quantities of alkaline earth metals as devitrifying agent. Walls as thin as 10 nm could be crystallized without losing the architecture of the particles. The roles of cation size and the mol% of the incorporated devitrifying agent in crystallization behavior are studied, with Mg(2+), Ca(2+), Sr(2+) and Ba(2+) all producing pure α-quartz under certain conditions. PMID:25503642

  11. Mesoporous Silica-Supported Amidozirconium-Catalyzed Carbonyl Hydroboration


    Eedugurala, Naresh; Wang, Zhuoran; Chaudhary, Umesh; Nelson, Nicholas; Kandel, Kapil; Kobayashi, Takeshi; Slowing, Igor I.; Pruski, Marek; Sadow, Aaron D.


    The hydroboration of aldehydes and ketones using a silica-supported zirconium catalyst is reported. Reaction of Zr(NMe2)4 and mesoporous silica nanoparticles (MSN) provides the catalytic material Zr(NMe2)n@MSN. Exhaustive characterization of Zr(NMe2)n@MSN with solid-state (SS)NMR and infrared spectroscopy, as well as through reactivity studies, suggests its surface structure is primarily ≡SiOZr(NMe2)3. The presence of these nitrogen-containing zirconium sites is supported by 15N NMR spectroscopy, including natural abundance 15N NMR measurements using dynamic nuclear polarization (DNP) SSNMR. The Zr(NMe2)n@MSN material reacts with pinacolborane (HBpin) to provide Me2NBpin and the material ZrH/Bpin@MSN that is composed of interacting surface-bonded zirconium hydride and surface-bonded borane ≡SiOBpinmore » moieties in an approximately 1:1 ratio, as well as zirconium sites coordinated by dimethylamine. The ZrH/Bpin@MSN is characterized by 1H/2H and 11B SSNMR and infrared spectroscopy and through its reactivity with D2. The zirconium hydride material or the zirconium amide precursor Zr(NMe2)n@MSN catalyzes the selective hydroboration of aldehydes and ketones with HBpin in the presence of functional groups that are often reduced under hydroboration conditions or are sensitive to metal hydrides, including olefins, alkynes, nitro groups, halides, and ethers. Remarkably, this catalytic material may be recycled without loss of activity at least eight times, and air-exposed materials are catalytically active. These supported zirconium centers are robust catalytic sites for carbonyl reduction and that surface-supported, catalytically reactive zirconium hydride may be generated from zirconium-amide or zirconium alkoxide sites.« less

  12. Functionalized bimodal mesoporous silicas as carriers for controlled aspirin delivery

    NASA Astrophysics Data System (ADS)

    Gao, Lin; Sun, Jihong; Li, Yuzhen


    The bimodal mesoporous silica modified with 3-aminopropyltriethoxysilane was performed as the aspirin carrier. The samples' structure, drug loading and release profiles were characterized with X-ray diffraction, scanning electron microscopy, N 2 adsorption and desorption, Fourier transform infrared spectroscopy, TG analysis, elemental analysis and UV-spectrophotometer. For further exploring the effects of the bimodal mesopores on the drug delivery behavior, the unimodal mesoporous material MCM-41 was also modified as the aspirin carrier. Meantime, Korsmeyer-Peppas equation ft= ktn was employed to analyze the dissolution data in details. It is indicated that the bimodal mesopores are beneficial for unrestricted drug molecules diffusing and therefore lead to a higher loading and faster releasing than that of MCM-41. The results show that the aspirin delivery properties are influenced considerably by the mesoporous matrix, whereas the large pore of bimodal mesoporous silica is the key point for the improved controlled-release properties.

  13. Incorporation of anti-inflammatory agent into mesoporous silica.


    Braz, Wilson Rodrigues; Rocha, Natállia Lamec; de Faria, Emerson H; Silva, Márcio L A E; Ciuffi, Katia J; Tavares, Denise C; Furtado, Ricardo Andrade; Rocha, Lucas A; Nassar, Eduardo J


    The unique properties of macroporous, mesoporous, and microporous systems, including their ability to accommodate molecules of different sizes inside their pores and to act as drug delivery systems, have been the object of extensive studies. In this work, mesoporous silica with hexagonal structure was obtained by template synthesis via the sol-gel process. The resulting material was used as support to accommodate the anti-inflammatory agent indomethacin. The alkaline route was used to prepare the mesoporous silica; cetyltrimethylammonium bromide was employed as porogenic agent. The silica particles were functionalized with 3-aminopropyltriethoxysilane alkoxide (APTES) by the sol-gel post-synthesis method. Indomethacin was incorporated into the silica functionalized with APTES and into non-functionalized silica. The resulting systems were characterized by x-ray diffraction (XRD), specific area, infrared spectroscopy, and thermal analyses (TGA). XRD attested to formation of mesoporous silica with hexagonal structure. This structure remained after silica functionalization with APTES and incorporation of indomethacin. Typical infrared spectroscopy vibrations and organic material decomposition during TGA confirmed silica functionalization and drug incorporation. The specific surface area and pore volume of the functionalized material incorporated with indomethacin decreased as compared with the specific surface area and pore volume of the non-functionalized silica containing no drug, suggesting both the functionalizing agent and the drug were present in the silica. Cytotoxicity tests conducted on normal fibroblasts (GM0479A) cells attested that the silica matrix containing indomethacin was less toxic than the free drug. PMID:27533108

  14. Grafting Sulfated Zirconia on Mesoporous Silica

    SciTech Connect

    Wang, Yong; Lee, Kwan Young; Choi, Saemin; Liu, Jun; Wang, Li Q.; Peden, Charles HF


    Sulfated zirconia has received considerable attention as a potential solid acid catalyst in recent years. In this paper, the preparation and properties of acid catalysts obtained by grafting ziconia with atomic precision on MCM-41 mesoporous silica were studied. TEM and potential titration characterizations revealed that ZrO2/MCM-41 with monolayer coverage can be obtained using this grafting technique. Sulfated ZrO2/MCM-41 exhibits improved thermal stability than that of bulk sulfated zirconia, as evidenced by temperature programmed characterizations and XRD analysis. Temperature programmed reaction of isopropanol was used to evaluate the acidity of sulfated ZrO2/MCM-41. It was found that the acid strength of sulfated ZrO2/MCM-41 with monolayer coverage is weaker than bulk sulfated zirconia but stronger than SiO2-Al2O3, a common strong acid catalyst.

  15. Silica-based mesoporous nanoparticles for controlled drug delivery.


    Kwon, Sooyeon; Singh, Rajendra K; Perez, Roman A; Abou Neel, Ensanya A; Kim, Hae-Won; Chrzanowski, Wojciech


    Drug molecules with lack of specificity and solubility lead patients to take high doses of the drug to achieve sufficient therapeutic effects. This is a leading cause of adverse drug reactions, particularly for drugs with narrow therapeutic window or cytotoxic chemotherapeutics. To address these problems, there are various functional biocompatible drug carriers available in the market, which can deliver therapeutic agents to the target site in a controlled manner. Among the carriers developed thus far, mesoporous materials emerged as a promising candidate that can deliver a variety of drug molecules in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles are widely used as a delivery reagent because silica possesses favourable chemical properties, thermal stability and biocompatibility. Currently, sol-gel-derived mesoporous silica nanoparticles in soft conditions are of main interest due to simplicity in production and modification and the capacity to maintain function of bioactive agents. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release. The properties of mesopores, including pore size and porosity as well as the surface properties, can be altered depending on additives used to fabricate mesoporous silica nanoparticles. Active surface enables functionalisation to modify surface properties and link therapeutic molecules. The tuneable mesopore structure and modifiable surface of mesoporous silica nanoparticle allow incorporation of various classes of drug molecules and controlled delivery to the target sites. This review aims to present the state of knowledge of currently available drug delivery system and identify properties of an ideal drug carrier for specific application, focusing on mesoporous silica nanoparticles. PMID:24020012

  16. Silica-based mesoporous nanoparticles for controlled drug delivery

    PubMed Central

    Kwon, Sooyeon; Singh, Rajendra K; Perez, Roman A; Abou Neel, Ensanya A


    Drug molecules with lack of specificity and solubility lead patients to take high doses of the drug to achieve sufficient therapeutic effects. This is a leading cause of adverse drug reactions, particularly for drugs with narrow therapeutic window or cytotoxic chemotherapeutics. To address these problems, there are various functional biocompatible drug carriers available in the market, which can deliver therapeutic agents to the target site in a controlled manner. Among the carriers developed thus far, mesoporous materials emerged as a promising candidate that can deliver a variety of drug molecules in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles are widely used as a delivery reagent because silica possesses favourable chemical properties, thermal stability and biocompatibility. Currently, sol-gel-derived mesoporous silica nanoparticles in soft conditions are of main interest due to simplicity in production and modification and the capacity to maintain function of bioactive agents. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release. The properties of mesopores, including pore size and porosity as well as the surface properties, can be altered depending on additives used to fabricate mesoporous silica nanoparticles. Active surface enables functionalisation to modify surface properties and link therapeutic molecules. The tuneable mesopore structure and modifiable surface of mesoporous silica nanoparticle allow incorporation of various classes of drug molecules and controlled delivery to the target sites. This review aims to present the state of knowledge of currently available drug delivery system and identify properties of an ideal drug carrier for specific application, focusing on mesoporous silica nanoparticles. PMID:24020012

  17. A highly ordered cubic mesoporous silica/graphene nanocomposite

    NASA Astrophysics Data System (ADS)

    Lee, Chang-Wook; Roh, Kwang Chul; Kim, Kwang-Bum


    A highly ordered cubic mesoporous silica (KIT-6)/graphene nanocomposite and 2D KIT-6 nanoflakes were synthesized using a novel synthesis methodology. The non-ionic triblock copolymer, P123, played a dual role as a structure-directing agent in the formation of the cubic mesoporous structure and as a cross-linking agent between mesoporous silica and graphene. The prepared (KIT-6)/graphene nanocomposite could act as a template for the preparation of mesoporous material/graphene nanocomposites.A highly ordered cubic mesoporous silica (KIT-6)/graphene nanocomposite and 2D KIT-6 nanoflakes were synthesized using a novel synthesis methodology. The non-ionic triblock copolymer, P123, played a dual role as a structure-directing agent in the formation of the cubic mesoporous structure and as a cross-linking agent between mesoporous silica and graphene. The prepared (KIT-6)/graphene nanocomposite could act as a template for the preparation of mesoporous material/graphene nanocomposites. Electronic supplementary information (ESI) available: S1: TEM images of disordered mesoporous silica/graphene nanocomposite; S2: TEM images of KIT-6/GO nanocomposite; S3: Thermogravimetric analysis of KIT-6/GO and KG-400-700; S4: SEM and TEM images of KIT-6; S5: Low angle XRD, Raman spectra, N2 adsorption isotherms, pore size distribution and photographic images of the prepared samples; S6: TEM image and N2 adsorption isotherms of mesoporous carbon/graphene nanocomposite; S7: XPS C1s spectra of the prepared samples. See DOI: 10.1039/c3nr03108j

  18. Zirconia-silica based mesoporous desulfurization adsorbents

    NASA Astrophysics Data System (ADS)

    Palomino, Jessica M.; Tran, Dat T.; Kareh, Ana R.; Miller, Christopher A.; Gardner, Joshua M. V.; Dong, Hong; Oliver, Scott R. J.


    We report a series of mesoporous silicate sorbent materials templated by long-chain primary alkylamines that display record level of desulfurization of the jet fuel JP-8. Pure silica frameworks and those with a Si:Zr synthesis molar ratio ranging from 44:1 to 11:1 were investigated. The optimum sorbent was identified as dodecylamine-templated silica-zirconia synthesized from a gel with Si:Zr molar ratio of 15:1. With an optimized silver loading of 11 wt.%, a saturation adsorption capacity of 39.4 mgS g-1 and a silver efficiency of 1.21 molS mol Ag-1 were observed for JP-8. This sorbent displayed exceptional regenerability, maintaining 86% of its initial capacity in model fuel after solvent regeneration with diethyl ether. Low-cost, portable and reusable sorbents for the desulfurization of JP-8 jet fuel are needed to make solid oxide fuel cells (SOFCs) a reality for military power needs. SOFCs require ultra-low sulfur content fuel, which traditional desulfurization methods cannot achieve.

  19. Synthesis of a multinanoparticle-embedded core/mesoporous silica shell structure as a durable heterogeneous catalyst.


    Wang, Lijun; Shi, Jianlin; Zhu, Yan; He, Qianjun; Xing, Huaiyong; Zhou, Jian; Chen, Feng; Chen, Yu


    A multi-nanoparticle-embedded amorphous aluminum/magnesium oxides (AAMO) core/mesoporous silica (mSiO(2)) shell structure has been successfully synthesized by calcining the presynthesized catalyst precursor-containing layered double hydroxide (LDH) core/mesoporous silica shell composite. The well-dispersed catalytic nanoparticles were fixed at the interface between AAMO core and mesoporous SiO(2) shell, i.e., at the inner pore mouths of the mesoporous SiO(2) shell, which could effectively prevent nanoparticles from growth and/or aggregation with each other and in the meantime allow efficient access of reactants to the catalytic NPs. The final core/shell composite was found to be an efficient and highly recyclable heterogeneous catalyst. PMID:22375619

  20. Mesoporous silica magnetite nanocomposite synthesized by using a neutral surfactant

    NASA Astrophysics Data System (ADS)

    Souza, K. C.; Salazar-Alvarez, G.; Ardisson, J. D.; Macedo, W. A. A.; Sousa, E. M. B.


    Magnetite nanoparticles coated by mesoporous silica were synthesized by an alternative chemical route using a neutral surfactant and without the application of any functionalization method. The magnetite (Fe3O4) nanoparticles were prepared by precipitation from aqueous media, and then coated with mesoporous silica by using nonionic block copolymer surfactants as the structure-directing agents. The mesoporous SiO2-coated Fe3O4 samples were characterized by x-ray diffraction, Fourier-transform infrared spectroscopy, N2 adsorption-desorption isotherms, transmission electron microscopy, 57Fe Mössbauer spectroscopy, and vibrating sample magnetometry. Our results revealed that the magnetite nanoparticles are completely coated by well-ordered mesoporous silica with free pores and stable (~8 nm thick) pore walls, and that the structural and magnetic properties of the Fe3O4 nanoparticles are preserved in the applied synthesis route.

  1. Bifunctional mesoporous silicas with clearly distinguished localization of grafted groups

    NASA Astrophysics Data System (ADS)

    Roik, N. V.; Belyakova, L. A.


    Bifunctional mesoporous silicas with clearly distinguished localization of grafted groups on the surface of particles and inside their pores were obtained by means of sol-gel synthesis with postsynthetic vapor-phase treatment in vacuum. It was found that the synthesized materials have the hexagonally ordered porous structure typical of MCM-41 type silica.

  2. Enzyme catalytic membrane based on a hybrid mesoporous membrane.


    Fu, Wensheng; Yamaguchi, Akira; Kaneda, Hideaki; Teramae, Norio


    Immobilization of glucose oxidase (GOD) within a hybrid mesoporous membrane with 12 nm pore diameter was successfully achieved, resulting in catalytically high efficiency during flow of a glucose solution across the membrane. PMID:18253526

  3. Formation of monodisperse mesoporous silica microparticles via spray-drying.


    Waldron, Kathryn; Wu, Winston Duo; Wu, Zhangxiong; Liu, Wenjie; Selomulya, Cordelia; Zhao, Dongyuan; Chen, Xiao Dong


    In this work, a protocol to synthesize monodisperse mesoporous silica microparticles via a unique microfluidic jet spray-drying route is reported for the first time. The microparticles demonstrated highly ordered hexagonal mesostructures with surface areas ranging from ~900 up to 1500 m(2)/g and pore volumes from ~0.6 to 0.8 cm(3)/g. The particle size could be easily controlled from ~50 to 100 μm from the same diameter nozzle via changing the initial solute content, or changing the drying temperature. The ratio of the surfactant (CTAB) and silica (TEOS), and the amount of water in the precursor were found to affect the degree of ordering of mesopores by promoting either the self-assembly of the surfactant-silica micelles or the condensation of the silica as two competing processes in evaporation induced self-assembly. The drying rate and the curvature of particles also affected the self-assembly of the mesostructure. The particle mesostructure is not influenced by the inlet drying temperature in the range of 92-160 °C, with even a relatively low temperature of 92 °C producing highly ordered mesoporous microparticles. The spray-drying derived mesoporous silica microparticles, while of larger sizes and more rapidly synthesized, showed a comparable performance with the conventional mesoporous silica MCM-41 in controlled release of a dye, Rhodamine B, indicating that these spray dried microparticles could be used for the immobilisation and controlled release of small molecules. PMID:24461839

  4. Preparation, characterization, and catalytic performance of Ta-HMS mesoporous molecular sieve

    NASA Astrophysics Data System (ADS)

    Li, Xuefeng; Zhang, Like; Gao, Huanxin; Chen, Qingling


    Various Ta-HMS (hexagonal mesoporous silica) samples with different Ta content were hydrothermally prepared and characterized by XRD, N2-adsorption, ICP-AES, FTIR, and UV-Vis spectroscopy. The catalytic performance of the samples was also evaluated in the epoxidation of cyclohexene with cumene hydroperoxide as oxidant. The regularity of mesoporous structure decreases while more extraframe Ta ions are formed with increasing the Ta content. Ta-HMS with Ta/Si ratio of 0.015 shows the highest conversion and selectivity in the studied epoxidation reaction. The catalyst can be used for three times without significant activity loss.

  5. Magnetic mesoporous silica nanoparticles: fabrication and their laccase immobilization performance.


    Wang, Feng; Guo, Chen; Yang, Liang-rong; Liu, Chun-Zhao


    Newly large-pore magnetic mesoporous silica nanoparticles (MMSNPs) with wormhole framework structures were synthesized for the first time by using tetraethyl orthosilicate as the silica source and amine-terminated Jeffamine surfactants as template. Iminodiacerate was attached on these MMSNPs through a silane-coupling agent and chelated with Cu(2+). The Cu(2+)-chelated MMSNPs (MMSNPs-CPTS-IDA-Cu(2+)) showed higher adsorption capacity of 98.1 mg g(-1)-particles and activity recovery of 92.5% for laccase via metal affinity adsorption in comparison with MMSNPs via physical adsorption. The Michaelis constant (K(m)) and catalytic constant (k(cat)) of laccase immobilized on the MMSNPs-CPTS-IDA-Cu(2+) were 3.28 mM and 155.4 min(-1), respectively. Storage stability and temperature endurance of the immobilized laccase on MMSNPs-CPTS-IDA-Cu(2+) increased significantly, and the immobilized laccase retained 86.6% of its initial activity after 10 successive batch reactions operated with magnetic separation. PMID:20655206

  6. Ti containing mesoporous silica submicrometer-sphere, with tunable particle size for styrene oxidation

    NASA Astrophysics Data System (ADS)

    Wang, Jingjing; Lu, Jinming; Yang, Jianhua; Chen, Rui; Zhang, Yan; Yin, Dehong; Wang, Jinqu


    Ti-containing mesoporous silica materials with size-tunable mesopores and isolated tetrahedrally coordinated Ti species have widely applications in bulk molecular catalysis. Herein, mesoporous titanium silica submicrometer-spheres (Ti-MSSs) with tunable outer particle diameter were synthesized based on developed Stober method using nonionic surfactant P123 as particle dispersing agent at room temperature. P123 molecular assembled structures will interact with silica species through interface hydrogen bond leading to the formation of tunable sized particles. The particle size was controlled ranging from 400 to 80 nm by adjusting the P123 concentration. The influence of Ti-MSSs particle size on the oxidation of styrene with aqueous H2O2 as oxidant was investigated in detail. Ti-MSSs showed better catalytical performance compared to mesoporous titanium silica large particles. Moreover, the catalyst activity increased with decrease in particle size of Ti-MSSs. Nano-sized Ti-MSSs of about 80 nm demonstrated the optimized performance for styrene oxidation with styrene conversion 44.7%, benzaldehyde selectivity 82.2% and styrene oxide 17.7% while the reaction time was 6 h.

  7. Functionalized bimodal mesoporous silicas as carriers for controlled aspirin delivery

    SciTech Connect

    Gao Lin; Sun Jihong; Li Yuzhen


    The bimodal mesoporous silica modified with 3-aminopropyltriethoxysilane was performed as the aspirin carrier. The samples' structure, drug loading and release profiles were characterized with X-ray diffraction, scanning electron microscopy, N{sub 2} adsorption and desorption, Fourier transform infrared spectroscopy, TG analysis, elemental analysis and UV-spectrophotometer. For further exploring the effects of the bimodal mesopores on the drug delivery behavior, the unimodal mesoporous material MCM-41 was also modified as the aspirin carrier. Meantime, Korsmeyer-Peppas equation f{sub t}=kt{sup n} was employed to analyze the dissolution data in details. It is indicated that the bimodal mesopores are beneficial for unrestricted drug molecules diffusing and therefore lead to a higher loading and faster releasing than that of MCM-41. The results show that the aspirin delivery properties are influenced considerably by the mesoporous matrix, whereas the large pore of bimodal mesoporous silica is the key point for the improved controlled-release properties. - Graphical abstract: Loading (A) and release profiles (B) of aspirin in N-BMMs and N-MCM-41 indicated that BMMs have more drug loading capacity and faster release rate than that MCM-41. Highlights: > Bimodal mesoporous silicas (BMMs) and MCM-41 modified with amino group via post-treatment procedure. > Loading and release profiles of aspirin in modified BMMs and MCM-41. > Modified BMMs have more drug loading capacity and faster release rate than that modified MCM-41.

  8. Mesoporous silica nanoparticles in target drug delivery system: A review

    PubMed Central

    Bharti, Charu; Nagaich, Upendra; Pal, Ashok Kumar; Gulati, Neha


    Due to lack of specification and solubility of drug molecules, patients have to take high doses of the drug to achieve the desired therapeutic effects for the treatment of diseases. To solve these problems, there are various drug carriers present in the pharmaceuticals, which can used to deliver therapeutic agents to the target site in the body. Mesoporous silica materials become known as a promising candidate that can overcome above problems and produce effects in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles (MSNs) are widely used as a delivery reagent because silica possesses favorable chemical properties, thermal stability, and biocompatibility. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release of the target site. The properties of mesoporous, including pore size, high drug loading, and porosity as well as the surface properties, can be altered depending on additives used to prepare MSNs. Active surface enables functionalization to changed surface properties and link therapeutic molecules. They are used as widely in the field of diagnosis, target drug delivery, bio-sensing, cellular uptake, etc., in the bio-medical field. This review aims to present the state of knowledge of silica containing mesoporous nanoparticles and specific application in various biomedical fields. PMID:26258053

  9. Functionalized mesoporous silica materials for molsidomine adsorption: Thermodynamic study

    SciTech Connect

    Alyoshina, Nonna A.; Parfenyuk, Elena V.


    A series of unmodified and organically modified mesoporous silica materials was prepared. The unmodified mesoporous silica was synthesized via sol–gel synthesis in the presence of D-glucose as pore-forming agent. The functionalized by phenyl, aminopropyl and mercaptopropyl groups silica materials were prepared via grafting. The fabricated adsorbent materials were characterized by Fourier transform infrared spectroscopy (FTIR) analysis, N{sub 2} adsorption/desorption and elemental analysis methods. Then their adsorption properties for mesoionic dug molsidomine were investigated at 290–313 K and physiological pH value. Thermodynamic parameters of molsidomine adsorption on the synthesized materials have been calculated. The obtained results showed that the adsorption process of molsidomine on the phenyl modified silica is the most quantitatively and energetically favorable. The unmodified and mercaptopropyl modified silica materials exhibit significantly higher adsorption capacities and energies for molsidomine than the aminopropyl modified sample. The effects are discussed from the viewpoint of nature of specific interactions responsible for the adsorption. - Graphical abstract: Comparative analysis of the thermodynamic characteristics of molsidomine adsorption showed that the adsorption process on mesoporous silica materials is controlled by chemical nature of surface functional groups. Molsidomine adsorption on the phenyl modified silica is the most quantitatively and energetically favorable. Taking into account ambiguous nature of mesoionic compounds, it was found that molsidomine is rather aromatic than dipolar. Display Omitted - Highlights: • Unmodified and organically modified mesoporous silica materials were prepared. • Molsidomine adsorption on the silica materials was studied. • Phenyl modified silica shows the highest adsorption capacity and favorable energy. • Molsidomine exhibits the lowest affinity to aminopropyl modified silica.

  10. Mesoporous Silica-Supported Amidozirconium-Catalyzed Carbonyl Hydroboration

    SciTech Connect

    Eedugurala, Naresh; Wang, Zhuoran; Chaudhary, Umesh; Nelson, Nicholas; Kandel, Kapil; Kobayashi, Takeshi; Slowing, Igor I.; Pruski, Marek; Sadow, Aaron D.


    The hydroboration of aldehydes and ketones using a silica-supported zirconium catalyst is reported. Reaction of Zr(NMe2)4 and mesoporous silica nanoparticles (MSN) provides the catalytic material Zr(NMe2)n@MSN. Exhaustive characterization of Zr(NMe2)n@MSN with solid-state (SS)NMR and infrared spectroscopy, as well as through reactivity studies, suggests its surface structure is primarily ≡SiOZr(NMe2)3. The presence of these nitrogen-containing zirconium sites is supported by 15N NMR spectroscopy, including natural abundance 15N NMR measurements using dynamic nuclear polarization (DNP) SSNMR. The Zr(NMe2)n@MSN material reacts with pinacolborane (HBpin) to provide Me2NBpin and the material ZrH/Bpin@MSN that is composed of interacting surface-bonded zirconium hydride and surface-bonded borane ≡SiOBpin moieties in an approximately 1:1 ratio, as well as zirconium sites coordinated by dimethylamine. The ZrH/Bpin@MSN is characterized by 1H/2H and 11B SSNMR and infrared spectroscopy and through its reactivity with D2. The zirconium hydride material or the zirconium amide precursor Zr(NMe2)n@MSN catalyzes the selective hydroboration of aldehydes and ketones with HBpin in the presence of functional groups that are often reduced under hydroboration conditions or are sensitive to metal hydrides, including olefins, alkynes, nitro groups, halides, and ethers. Remarkably, this catalytic material may be recycled without loss of activity at least eight times, and air-exposed materials are catalytically active. These supported zirconium centers are robust catalytic sites for carbonyl reduction and that surface-supported, catalytically reactive zirconium hydride may be generated from zirconium-amide or zirconium alkoxide sites.

  11. Preparing mesoporous carbon and silica with rosin-silica composite gel.


    Liu, Haidi; Du, Shangfeng; Chen, Yunfa


    Mesoporous carbon and mesoporous silica were prepared respectively with a same rosin-silica nanocomposite gel which was synthesized by cogelating tetra-ethyl-oxy-silane (silica source) and rosin (carbon source). Carbonizing the gel in nitrogen and then etching away silica with alkaline solution, mesoporous carbon with specific surface area larger than 800 m2/g was obtained. If calcining the gel at high temperature in air for given time, porous silica with surface area higher than 700 m2/g was done. BET measurement was employed to investigate the pore distribution and surface area of the samples. Most of the pores in both the porous carbon and porous silica were mesoscale, which makes the materials potential in enzyme supports for bio-catalyzed reaction or adsorbents for contaminants with large molecular size. PMID:19441395

  12. In-situ immobilization of enzymes in mesoporous silicas

    NASA Astrophysics Data System (ADS)

    Santalla, Esther; Serra, Elías; Mayoral, Alvaro; Losada, José; Blanco, Rosa M.; Díaz, Isabel


    Lipase from Candida antarctica B, horseradish peroxidase and laccase have been entrapped in silica cages rising mesoporous structures. Lipase and laccase yielded the highest structured mesoporous material whereas horseradish peroxidase may have altered the symmetry giving as a result mesocelullar foam (MCF) type of cages. The possible effect in the final structure of the material of the nature, size and surface structure of the proteins as well as the presence of various additives in the enzyme extracts is currently under investigations.

  13. Thermally Stable Nanocatalyst for High Temperature Reactions: Pt-Mesoporous Silica Core-Shell Nanoparticles

    SciTech Connect

    Joo, Sang Hoon; Park, J.Y.; Tsung, C.-K.; Yamada, Y.; Yang, P.; Somorjai, G.A.


    Recent advances in colloidal synthesis enabled the precise control of size, shape and composition of catalytic metal nanoparticles, allowing their use as model catalysts for systematic investigations of the atomic-scale properties affecting catalytic activity and selectivity. The organic capping agents stabilizing colloidal nanoparticles, however, often limit their application in high-temperature catalytic reactions. Here we report the design of a high-temperature stable model catalytic system that consists of Pt metal core coated with a mesoporous silica shell (Pt{at}mSiO{sub 2}). While inorganic silica shells encaged the Pt cores up to 750 C in air, the mesopores directly accessible to Pt cores made the Pt{at}mSiO{sub 2} nanoparticles as catalytically active as bare Pt metal for ethylene hydrogenation and CO oxidation. The high thermal stability of Pt{at}mSiO{sub 2} nanoparticles permitted high-temperature CO oxidation studies, including ignition behavior, which was not possible for bare Pt nanoparticles because of their deformation or aggregation. The results suggest that the Pt{at}mSiO{sub 2} nanoparticles are excellent nanocatalytic systems for high-temperature catalytic reactions or surface chemical processes, and the design concept employed in the Pt{at}mSiO{sub 2} core-shell catalyst can be extended to other metal-metal oxide compositions.

  14. Mesoporous-silica films, fibers, and powders by evaporation


    Bruinsma, Paul J.; Baskaran, Suresh; Bontha, Jagannadha R.; Liu, Jun


    This invention pertains to surfactant-templated nanometer-scale porosity of a silica precursor solution and forming a mesoporous material by first forming the silica precursor solution into a preform having a high surface area to volume ratio, then rapid drying or evaporating a solvent from the silica precursor solution. The mesoporous material may be in any geometric form, but is preferably in the form of a film, fiber, powder or combinations thereof. The rapid drying or evaporation of solvent from the solution is accomplished by layer thinning, for example spin casting, liquid drawing, and liquid spraying respectively. Production of a film is by layer thinning, wherein a layer of the silica precursor solution is formed on a surface followed by removal of an amount of the silica precursor solution and leaving a geometrically thinner layer of the silica precursor solution from which the solvent quickly escapes via evaporation. Layer thinning may be by any method including but not limited to squeegeeing and/or spin casting. In powder formation by spray drying, the same conditions of fast drying exists as in spin-casting (as well as in fiber spinning) because of the high surface-area to volume ratio of the product. When a powder is produced by liquid spraying, the particles or micro-bubbles within the powder are hollow spheres with walls composed of mesoporous silica. Mesoporous fiber formation starts with a similar silica precursor solution but with an added pre-polymer making a pituitous mixture that is drawn into a thin strand from which solvent is evaporated leaving the mesoporous fiber(s).

  15. Mesoporous-silica films, fibers, and powders by evaporation


    Bruinsma, Paul J.; Baskaran, Suresh; Bontha, Jagannadha R.; Liu, Jun


    This invention pertains to surfactant-templated nanometer-scale porosity of a silica precursor solution and forming a mesoporous material by first forming the silica precursor solution into a preform having a high surface area to volume ratio, then rapid drying or evaporating a solvent from the silica precursor solution. The mesoporous material may be in any geometric form, but is preferably in the form of a film, fiber, powder or combinations thereof. The rapid drying or evaporation of solvent from the solution is accomplished by layer thinning, for example spin casting, liquid drawing, and liquid spraying respectively. Production of a film is by layer thinning, wherein a layer of the silica precursor solution is formed on a surface followed by removal of an amount of the silica precursor solution and leaving a geometrically thinner layer of the silica precursor solution from which the solvent quickly escapes via evaporation. Layer thinning may be by any method including but not limited to squeegeeing and/or spin casting. In powder formation by spray drying, the same conditions of fast drying exists as in spin-casting (as well as in fiber spinning) because of the high surface-area to volume ratio of the product. When a powder is produced by liquid spraying, the particles or micro-bubbles within the powder are hollow spheres with walls composed of mesoporous silica. Mesoporous fiber formation starts with a similar silica precursor solution but with an added pre-polymer making a pituitous mixture that is drawn into a thin strand from which solvent is evaporated leaving the mesoporous fiber(s).

  16. Mesoporous-silica films, fibers, and powders by evaporation


    Bruinsma, P.J.; Baskaran, S.; Bontha, J.R.; Liu, J.


    This invention pertains to surfactant-templated nanometer-scale porosity of a silica precursor solution and forming a mesoporous material by first forming the silica precursor solution into a preform having a high surface area to volume ratio, then rapid drying or evaporating a solvent from the silica precursor solution. The mesoporous material may be in any geometric form, but is preferably in the form of a film, fiber, powder or combinations thereof. The rapid drying or evaporation of solvent from the solution is accomplished by layer thinning, for example spin casting, liquid drawing, and liquid spraying respectively. Production of a film is by layer thinning, wherein a layer of the silica precursor solution is formed on a surface followed by removal of an amount of the silica precursor solution and leaving a geometrically thinner layer of the silica precursor solution from which the solvent quickly escapes via evaporation. Layer thinning may be by any method including but not limited to squeegeeing and/or spin casting. In powder formation by spray drying, the same conditions of fast drying exists as in spin-casting (as well as in fiber spinning) because of the high surface-area to volume ratio of the product. When a powder is produced by liquid spraying, the particles or micro-bubbles within the powder are hollow spheres with walls composed of mesoporous silica. Mesoporous fiber formation starts with a similar silica precursor solution but with an added pre-polymer making a pituitous mixture that is drawn into a thin strand from which solvent is evaporated leaving the mesoporous fiber(s). 24 figs.

  17. Sulfonated mesoporous silica-carbon composites and their use as solid acid catalysts

    NASA Astrophysics Data System (ADS)

    Valle-Vigón, Patricia; Sevilla, Marta; Fuertes, Antonio B.


    The synthesis of highly functionalized porous silica-carbon composites made up of sulfonic groups attached to a carbon layer coating the pores of three types of mesostructured silica (i.e. SBA-15, KIT-6 and mesocellular silica) is presented. The synthesis procedure involves the following steps: (a) removal of the surfactant, (b) impregnation of the silica pores with a carbon precursor, (c) carbonization and (d) sulfonation. The resulting silica-carbon composites contain ˜30 wt % of carbonaceous matter with a high density of acidic groups attached to the deposited carbon (i.e.sbnd SO3H, sbnd COOH and sbnd OH). The structural characteristics of the parent silica are retained in the composite materials, which exhibit a high surface area, a large pore volume and a well-ordered porosity made up uniform mesopores. The high density of the sulfonic groups in combination with the mesoporous structure of the composites ensures that a large number of active sites are easily accessible to reactants. These sulfonated silica-carbon composites behave as eco-friendly, active, selective, water tolerant and recyclable solid acids. In this study we demonstrate the usefulness of these composites as solid acid catalysts for the esterification of maleic anhydride, succinic acid and oleic acid with ethanol. These composites exhibit a superior intrinsic catalytic activity to other commercial solid acids such as Amberlyst-15.

  18. Antibacterial performance of nanocrystallined titania confined in mesoporous silica nanotubes.


    Cendrowski, Krzysztof; Peruzynska, Magdalena; Markowska-Szczupak, Agata; Chen, Xuecheng; Wajda, Anna; Lapczuk, Joanna; Kurzawski, Mateusz; Kalenczuk, Ryszard J; Drozdzik, Marek; Mijowska, Ewa


    In this paper, we study synthesis and characteristics of mesoporous silica nanotubes modified by titanium dioxide, as well as their antimicrobial properties and influence on mitochondrial activity of mouse fibroblast L929. Nanocrystalized titania is confined in mesopores of silica nanotubes and its light activated antibacterial response is revealed. The analysis of the antibacterial effect on Escherichia coli. (ATCC 25922) shows strong enhancement during irradiation with the artificial visible and ultraviolet light in respect to the commercial catalyst and control sample free from the nanomaterials. In darkness, the mesoporous silica/titania nanostructures exhibited antibacterial activity dependent on the stirring speed of the suspension containing nanomaterials. Obtained micrograph proved internalization of the sample into the microorganism trough the cell membrane. The analysis of the mitochondrial activity and amount of lactate dehydrogenase released from mouse fibroblast cells L929 in the presence of the sample were determined with LDH and WST1 assays, respectively. The synthesized silica/titania antibacterial agent also exhibits pronounced photoinduced inactivation of the bacterial growth under the artificial visible and UV light irritation in respect to the commercial catalyst. Additionally, mesoporous silica/titania nanotubes were characterized in details by means of high resolution transmission electron microscopy (HR-TEM), XRD and BET Isotherm. PMID:24676537

  19. Enhanced retention of aqueous transition metals in mesoporous silica

    NASA Astrophysics Data System (ADS)

    Nelson, J.; Bargar, J.; Brown, G. E.; Maher, K.


    Mesoporosity (2-50 nm diameter pores) is abundant within grain coatings and primary silicate minerals in natural environments. Mesopores often contribute significantly to total specific surface area and act as gateways for the transport of subsurface solutes, including nutrients and contaminants, between mineral surfaces and ambient fluids. However, the physiochemical mechanisms of sorption and transport within mesopores cannot be assumed to be the same as for macropores (>50 nm), because of confinement-induced changes in water properties, the structure of electrical double layers, solvation shells and dehydration rates of aquo ions, and the charge and reactive site densities of mineral surfaces. Despite the ubiquity of confined spaces in natural and industrial porous media, few studies have examined the molecular-scale mechanisms and geochemical reactions controlling meso-confinement phenomena in environmentally relevant materials. We conducted batch Zn sorption experiments using synthetic, controlled pore-size (i.e., 7.5-300 nm), metal-oxide beads as model geologic substrates. Comparison of Zn adsorbed onto macroporous and mesoporous silica beads indicates Zn adsorption capacity is increased in mesopores when normalized to surface area. In the presence of a background electrolyte (i.e., NaCl), Zn sorption capacity to macroporous silica is reduced; however, no significant difference in Zn sorption capacity on mesoporous silica was observed between the presence and absence of a background electrolyte. The effect of competing cations is indirect evidence that mesopores promote inner-sphere complexation and reduce outer-sphere complexation. EXAFS characterization of adsorbed zinc to macroporous silica matches that reported for low Zn coverages on silica (Roberts et al., JCIS, 2003), whereas a different spectrum is observed for the mesoporous case. Shell-by-shell fitting indicates that Zn is dominantly in octahedral coordination in macropores, as opposed to

  20. Highly Loaded Mesoporous Silica/Nanoparticle Composites and Patterned Mesoporous Silica Films

    NASA Astrophysics Data System (ADS)

    Kothari, Rohit; Hendricks, Nicholas R.; Wang, Xinyu; Watkins, James J.


    Novel approaches for the preparation of highly filled mesoporous silica/nanoparticle (MS/NP) composites and for the fabrication of patterned MS films are described. The incorporation of iron platinum NPs within the walls of MS is achieved at high NP loadings by doping amphiphilic poly(ethylene oxide-b-propylene oxide-b-ethylene oxide) (Pluronic®) copolymer templates via selective hydrogen bonding between the pre-synthesized NPs and the hydrophilic portion of the block copolymer. The MS is then synthesized by means of phase selective condensation of tetraethylorthosilicate (TEOS) within the NP loaded block copolymer templates dilated with supercritical carbon dioxide (scCO2) followed by calcination. For patterned films, microphase separated block copolymer/small molecule additive blends are patterned using UV-assisted nanoimprint lithography. Infusion and condensation of a TEOS within template films using ScCO2 as a processing medium followed by calcination yields the patterned MS films. Scanning electron microscopy is used characterize pattern fidelity and transmission electron microscopy analysis confirms the presence of the mesopores. Long range order in nanocomposites is confirmed by low angle x-ray diffraction.

  1. Microwave assisted N-alkylation of amine functionalized crystal-like mesoporous phenylene-silica.


    Lourenço, Mirtha A O; Siegel, Renée; Mafra, Luís; Ferreira, Paula


    N-alkylation reaction of amine functionalized phenylene moieties in crystal-like mesoporous silica is successfully achieved with about 87% of conversion in two reaction cycles. A potassium iodide catalyzed method commonly used for the selective N-monoalkylation of aniline is adapted and optimized to the N-monoalkylation reactions of the amine functionalized periodic mesoporous phenylene-silica (NH2-PMO) under microwave irradiation with preservation of the ordered mesostructure and of the crystal-like molecular scale periodicity of the material. This functionalization opens an avenue for the preparation of new materials with different amino-alkyl groups specially designed for a desired application, namely on the adsorption or catalytic fields. PMID:23508286

  2. Synthesis and catalytic applications of combined zeolitic/mesoporous materials

    PubMed Central

    Vernimmen, Jarian; Cool, Pegie


    Summary In the last decade, research concerning nanoporous siliceous materials has been focused on mesoporous materials with intrinsic zeolitic features. These materials are thought to be superior, because they are able to combine (i) the enhanced diffusion and accessibility for larger molecules and viscous fluids typical of mesoporous materials with (ii) the remarkable stability, catalytic activity and selectivity of zeolites. This review gives an overview of the state of the art concerning combined zeolitic/mesoporous materials. Focus is put on the synthesis and the applications of the combined zeolitic/mesoporous materials. The different synthesis approaches and formation mechanisms leading to these materials are comprehensively discussed and compared. Moreover, Ti-containing nanoporous materials as redox catalysts are discussed to illustrate a potential implementation of combined zeolitic/mesoporous materials. PMID:22259762

  3. The synthesis and application of two mesoporous silica nanoparticles as drug delivery system with different shape

    NASA Astrophysics Data System (ADS)

    Wang, Jiayi; Wang, Zhuyuan; Chen, Hui; Zong, Shenfei; Cui, Yiping


    Mesoporous silica nanospheres(MSNSs) have been obtained utilizing the conventional reverse micelles synthesis method while the mesoporous silica nanorods(MSNRs) have been acquired by means of changing certain parameters. Afterwards, the prepared mesoporous silica nanospheres and nanorods were used as drug carriers to load and release the classical cancer therapeutic drug—DOX. According to the absorption spectra, the encapsulation efficiency of the mesoporous silica nanospheres is almost as high as that of the nanospheres. Different from the familiar encapsulation efficiency, the release characteristic curves of the mesoporous silica nanospheres and nanorods possessed certain differences during the release process. Finally incellular fluorescence imaging was achieved to observe the endocytosis of the mesoporous silica materials. Our results show that although both of the two kinds of nanoparticles possess favourable properties for loading and releasing drugs, the mesoporous silica nanospheres perform better in dispersity and controlled release than the nanorods, which probably endow them the potential as incellular drug delivery system.

  4. Facile synthesis of size controllable dendritic mesoporous silica nanoparticles.


    Yu, Ye-Jun; Xing, Jun-Ling; Pang, Jun-Ling; Jiang, Shu-Hua; Lam, Koon-Fung; Yang, Tai-Qun; Xue, Qing-Song; Zhang, Kun; Wu, Peng


    The synthesis of highly uniform mesoporous silica nanospheres (MSNs) with dendritic pore channels, particularly ones with particle sizes below 200 nm, is extremely difficult and remains a grand challenge. By a combined synthetic strategy using imidazolium ionic liquids (ILs) with different alkyl lengths as cosurfactants and Pluronic F127 nonionic surfactants as inhibitors of particle growth, the preparation of dendritic MSNs with controlled diameter between 40 and 300 nm was successfully realized. An investigation of dendritic MSNs using scanning electron microscopy (SEM), transmission electron microscopy (TEM), and nitrogen physisorption revealed that the synthesis of dendritic MSNs at larger size (100-300 nm) strongly depends on the alkyl lengths of cationic imidazolium ILs; while the average size of dendritic MSNs can be controlled within the range of 40-100 nm by varying the amount of Pluronic F127. The Au@MSNs can be used as a catalyst for the reduction of 4-nitrophenol by NaBH4 into 4-aminophenol and exhibit excellent catalytic performance. The present discovery of the extended synthesis conditions offers reproducible, facile, and large-scale synthesis of the monodisperse spherical MSNs with precise size control and, thus, has vast prospects for future applications of ultrafine mesostructured nanoparticle materials in catalysis and biomedicine. PMID:25454255

  5. Multifunctional mesoporous silica nanocomposite nanoparticles for theranostic applications.


    Lee, Ji Eun; Lee, Nohyun; Kim, Taeho; Kim, Jaeyun; Hyeon, Taeghwan


    Clever combinations of different types of functional nanostructured materials will enable the development of multifunctional nanomedical platforms for multimodal imaging or simultaneous diagnosis and therapy. Mesoporous silica nanoparticles (MSNs) possess unique structural features such as their large surface areas, tunable nanometer-scale pore sizes, and well-defined surface properties. Therefore, they are ideal platforms for constructing multifunctional materials that incorporate a variety of functional nanostructured materials. In this Account, we discuss recent progress by our group and other researchers in the design and fabrication of multifunctional nanocomposite nanoparticles based on mesoporous silica nanostructures for applications to simultaneous diagnosis and therapy. Versatile mesoporous silica-based nanocomposite nanoparticles were fabricated using various methods. Here, we highlight two synthetic approaches: the encapsulation of functional nanoparticles within a mesoporous silica shell and the assembly of nanoparticles on the surface of silica nanostructures. Various nanoparticles were encapsulated in MSNs using surfactants as both phase transfer agents and pore-generating templates. Using MSNs as a scaffold, functional components such as magnetic nanoparticles and fluorescent dyes have been integrated within these systems to generate multifunctional nanocomposite systems that maintain their individual functional characteristics. For example, uniform mesoporous dye-doped silica nanoparticles immobilized with multiple magnetite nanocrystals on their surfaces have been fabricated for their use as a vehicle capable of simultaneous magnetic resonance (MR) and fluorescence imaging and drug delivery. The resulting nanoparticle-incorporated MSNs were then tested in mice with tumors. These in vivo experiments revealed that these multifunctional nanocomposite nanoparticles were delivered to the tumor sites via passive targeting. These nanocomposite

  6. Plutonium complexation by phosphonate-functionalized mesoporous silica

    SciTech Connect

    Parsons-Moss, T; Schwaiger, L K; Hubaud, A; Hu, Y J; Tuysuz, H; Yang, P; Balasubramanian, K; Nitsche, H


    MCM-41-type mesoporous silica functionalized with the CMPO-based 'Ac-Phos' silane has been reported in the literature (1) to show good capacity as an acftinide sorbent material, with potential applications in environmental sequestration, aqueous waste separation and/or vitrification, and chemical sensing of actinides in solution. The study explores the complexation of Pu(IV and VI) and other selected actinides and lanthanides by SBA-15 type mesoporous silica functionalized with Ac-Phos. The Pu binding kinetics and binding capacity were determined for both the Ac-Phos functionalized and unmodified SBA-15. They analyzed the binding geometry and redox behavior of Pu(VI) by X-ray absorption spectroscopy (XAS). They discuss the synthesis and characterization of the functionalized mesoporous material, batch sorption experiments, and the detailed analyses of the actinide complexes that are formed. Structural measurements are paired with high-level quantum mechanical modeling to elucidate the binding mechanisms.

  7. Adsorption of mycotoxins in beverages onto functionalized mesoporous silicas

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Mycotoxins, natural toxins produced by fungi, are a global concern as contaminates of agricultural commodities. Exposure to these toxins can be reduced by the use of binding materials. Templated mesoporous silicas are promising materials with favorable adsorptive properties for dyes, ions, and toxin...

  8. Mesoporous silica material TUD-1 as a drug delivery system.


    Heikkilä, T; Salonen, J; Tuura, J; Hamdy, M S; Mul, G; Kumar, N; Salmi, T; Murzin, D Yu; Laitinen, L; Kaukonen, A M; Hirvonen, J; Lehto, V-P


    For the first time the feasibility of siliceous mesoporous material TUD-1 (Technische Universiteit Delft) for drug delivery was studied. Model drug, ibuprofen, was adsorbed into TUD-1 mesopores via a soaking procedure. Characterizations with nitrogen adsorption, XRD, TG, HPLC and DSC demonstrated the successful inclusion of ibuprofen into TUD-1 host. The amount of ibuprofen adsorbed into the nanoreservoir of TUD-1 material was higher than reported for other mesoporous silica drug carriers (drug/carrier 49.5 wt.%). Drug release studies in vitro (HBSS buffer pH 5.5) demonstrated a fast and unrestricted liberation of ibuprofen, with 96% released at 210 min of the dissolution assay. The drug dissolution profile of TUD-1 material with the random, foam-like three-dimensional mesopore network and high accessibility to the dissolution medium was found to be much faster (kinetic constant k = 10.7) and more diffusion based (release constant n = 0.64) compared to a mesoporous MCM-41 material with smaller, unidirectional mesopore channels (k = 4.7, n = 0.71). Also, the mesoporous carriers were found to significantly increase the dissolution rate of ibuprofen, when compared to the pure crystalline form of the drug (k = 0.6, n = 0.96). TUD-1 was constituted as a potential drug delivery device with fast release property, with prospective applications in the formulation of poorly soluble drug compounds. PMID:17046183

  9. Functionalized mesoporous silica nanoparticles for oral delivery of budesonide

    SciTech Connect

    Yoncheva, K.; Popova, M.; Szegedi, A.; Mihaly, J.; Tzankov, B.; Lambov, N.; Konstantinov, S.; Tzankova, V.; Pessina, F.; Valoti, M.


    Non-functionalized and amino-functionalized mesoporous silica nanoparticle were loaded with anti-inflammatory drug budesonide and additionally post-coated with bioadhesive polymer (carbopol). TEM images showed spherical shape of the nanoparticles and slightly higher polydispersity after coating with carbopol. Nitrogen physisorption and thermogravimetic analysis revealed that more efficient loading and incorporation into the pores of nanoparticles was achieved with the amino-functionalized silica carrier. Infrared spectra indicated that the post-coating of these nanoparticles with carbopol led to the formation of bond between amino groups of the functionalized carrier and carboxyl groups of carbopol. The combination of amino-functionalization of the carrier with the post-coating of the nanoparticles sustained budesonide release. Further, an in vitro model of inflammatory bowel disease showed that the cytoprotective effect of budesonide loaded in the post-coated silica nanoparticles on damaged HT-29 cells was more pronounced compared to the cytoprotection obtained with pure budesonide. -- Graphical abstract: Silica mesoporous MCM-41 particles were amino-functionalized, loaded with budesonide and post-coated with bioadhesive polymer (carbopol) in order to achieve prolonged residence of anti-inflammatory drug in GIT. Highlights: • Higher drug loading in amino-functionalized mesoporous silica. • Amino-functionalization and post-coating of the nanoparticles sustained drug release. • Achievement of higher cytoprotective effect with drug loaded into the nanoparticles.

  10. Rapid synthesis of ordered hexagonal mesoporous silica and their incorporation with Ag nanoparticles by solution plasma

    SciTech Connect

    Pootawang, Panuphong; Saito, Nagahiro; Takai, Osamu; Lee, Sang Yul


    Graphical abstract: Overall reactions of mesoporous silica and AgNPs-incorporated mesoporous silica syntheses by solution plasma process (SPP). Highlights: ► SPP for rapid synthesis of mesoporous silica. ► SPP for rapid synthesis of mesoporous silica and AgNPs incorporation. ► Higher surface area and larger pore diameter of mesoporous silica synthesized by SPP. -- Abstract: Rapid synthesis of silica with ordered hexagonal mesopore arrangement was obtained using solution plasma process (SPP) by discharging the mixture of P123 triblock copolymer/TEOS in acid solution. SPP, moreover, was utilized for Ag nanoparticles (AgNPs) incorporation in silica framework as one-batch process using silver nitrate (AgNO{sub 3}) solution as precursor. The turbid silicate gel was clearly observed after discharge for 1 min and the white precipitate formed at 3 min. The mesopore with hexagonal arrangement and AgNPs were observed in mesoporous silica. Two regions of X-ray diffraction patterns (2θ < 2° and 2θ = 35–90°) corresponded to the mesoporous silica and Ag nanocrystal characteristics. Comparing with mesoporous silica prepared by a conventional sol–gel route, surface area and pore diameter of mesoporous silica prepared by solution plasma were observed to be larger. In addition, the increase in Ag loading resulted in the decrease in surface area with insignificant variation in the pore diameter of mesoporous silica. SPP could be successfully utilized not only to enhance gelation time but also to increase surface area and pore diameter of mesoporous silica.

  11. Thin-Layer Polymer Wrapped Enzymes Encapsulated in Hierarchically Mesoporous Silica with High Activity and Enhanced Stability

    NASA Astrophysics Data System (ADS)

    Zhang, Fang; Wang, Meitao; Liang, Chao; Jiang, Huangyong; Shen, Jian; Li, Hexing


    A novel soft-hard cooperative approach was developed to synthesize bioactive mesoporous composite by pre-wrapping Penicillin G amidase with poly(acrylaimde) nanogel skin and subsequently incorporating such Penicillin G amidase nanocapsules into hierarchically mesoporous silica. The as-received bioactive mesoporous composite exhibited comparable activity and extraordinarily high stability in comparison with native Penicillin G amidase and could be used repetitively in the water-medium hydrolysis of penicillin G potassium salt. Furthermore, this strategy could be extended to the synthesis of multifunctional bioactive mesoporous composite by simultaneously introducing glucose oxidase nanocapsules and horseradish peroxidase nanocapsules into hierarchically mesoporous silica, which demonstrated a synergic effect in one-pot tandem oxidation reaction. Improvements in the catalytic performances were attributed to the combinational unique structure from soft polymer skin and hard inorganic mesoporous silica shell, which cooperatively helped enzyme molecules to retain their appropriate geometry and simultaneously decreased the enzyme-support negative interaction and mass transfer limitation under heterogeneous conditions.

  12. Thin-layer polymer wrapped enzymes encapsulated in hierarchically mesoporous silica with high activity and enhanced stability.


    Zhang, Fang; Wang, Meitao; Liang, Chao; Jiang, Huangyong; Shen, Jian; Li, Hexing


    A novel soft-hard cooperative approach was developed to synthesize bioactive mesoporous composite by pre-wrapping Penicillin G amidase with poly(acrylaimde) nanogel skin and subsequently incorporating such Penicillin G amidase nanocapsules into hierarchically mesoporous silica. The as-received bioactive mesoporous composite exhibited comparable activity and extraordinarily high stability in comparison with native Penicillin G amidase and could be used repetitively in the water-medium hydrolysis of penicillin G potassium salt. Furthermore, this strategy could be extended to the synthesis of multifunctional bioactive mesoporous composite by simultaneously introducing glucose oxidase nanocapsules and horseradish peroxidase nanocapsules into hierarchically mesoporous silica, which demonstrated a synergic effect in one-pot tandem oxidation reaction. Improvements in the catalytic performances were attributed to the combinational unique structure from soft polymer skin and hard inorganic mesoporous silica shell, which cooperatively helped enzyme molecules to retain their appropriate geometry and simultaneously decreased the enzyme-support negative interaction and mass transfer limitation under heterogeneous conditions. PMID:24651701

  13. Thin-Layer Polymer Wrapped Enzymes Encapsulated in Hierarchically Mesoporous Silica with High Activity and Enhanced Stability

    PubMed Central

    Zhang, Fang; Wang, Meitao; Liang, Chao; Jiang, Huangyong; Shen, Jian; Li, Hexing


    A novel soft-hard cooperative approach was developed to synthesize bioactive mesoporous composite by pre-wrapping Penicillin G amidase with poly(acrylaimde) nanogel skin and subsequently incorporating such Penicillin G amidase nanocapsules into hierarchically mesoporous silica. The as-received bioactive mesoporous composite exhibited comparable activity and extraordinarily high stability in comparison with native Penicillin G amidase and could be used repetitively in the water-medium hydrolysis of penicillin G potassium salt. Furthermore, this strategy could be extended to the synthesis of multifunctional bioactive mesoporous composite by simultaneously introducing glucose oxidase nanocapsules and horseradish peroxidase nanocapsules into hierarchically mesoporous silica, which demonstrated a synergic effect in one-pot tandem oxidation reaction. Improvements in the catalytic performances were attributed to the combinational unique structure from soft polymer skin and hard inorganic mesoporous silica shell, which cooperatively helped enzyme molecules to retain their appropriate geometry and simultaneously decreased the enzyme-support negative interaction and mass transfer limitation under heterogeneous conditions. PMID:24651701

  14. Solution Plasma Process for Template Removal in Mesoporous Silica Synthesis

    NASA Astrophysics Data System (ADS)

    Pootawang, Panuphong; Saito, Nagahiro; Takai, Osamu


    The plasma discharge in aqueous solution was scientifically studied and applied to template removal in mesoporous silica synthesis. Highly dispersed spherical mesoporous silica particles were synthesized by the ternary surfactant system containing the Pluronic P123 copolymer (EO20PO69EO20), sodium dodecylbenzene sulfonate, and 1,1,2,2,3,3,4,4,4-nonafluoro-1-butane sulfonate, via the sol-gel method in acid solutions. The solution plasma process (SPP), instead of conventional thermal calcinations, was used to remove the template. The mechanism of the removal of the organic template occurred via oxidation by the hydroxyl radicals generated during discharge. The transformation of a mesopore structure from a disordered wormlike structure to a hexagonally arranged structure was observed by X-ray diffraction analysis and was confirmed by transmission electron microscopy. The results of the thermal analysis and functional group identification of mesoporous silica after SPP showed evidence of organic template removal. The surface area calculated using the Brunauer-Emmett-Teller (BET) theory and the mean pore diameter results could be used to evaluate the plasma efficiency, demonstrating that this method does not affect the pore size in the case of discharge in a solution of pH 3 compared with the results of thermal calcination. Hence, SPP was proved to be highly efficient for organic template removal, exhibiting short consumption time and less contamination.

  15. Synthesis and Characterization of Bionanoparticle-Silica Composites and Mesoporous Silica with Large Pores

    SciTech Connect

    Niu, Z.; Yang, L.; Kabisatpathy, S.; He, J.; Lee, A.; Ron, J.; Sikha, G.; Popov, B.N.; Emrick, T.; Russell, T. P.; Wang. Q.


    A sol-gel process has been developed to incorporate bionanoparticles, such as turnip yellow mosaic virus, cowpea mosaic virus, tobacco mosaic virus, and ferritin into silica, while maintaining the integrity and morphology of the particles. The structures of the resulting materials were characterized by transmission electron microscopy, small angle X-ray scattering, and N{sub 2} adsorption-desorption analysis. The results show that the shape and surface morphology of the bionanoparticles are largely preserved after being embedded into silica. After removal of the bionanoparticles by calcination, mesoporous silica with monodisperse pores, having the shape and surface morphology of the bionanoparticles replicated inside the silica, was produced,. This study is expected to lead to both functional composite materials and mesoporous silica with structurally well-defined large pores.

  16. Mesoporous Silica Nanoparticles and Films for Cargo Delivery

    NASA Astrophysics Data System (ADS)

    Guardado Alvarez, Tania Maria

    Mesoporous silica materials are well known materials that can range from films to nanoparticles. Mesoporous silica nanoparticles (MSNs) and mesoporous silica films have been of increasing interest among the scientific community for its use in cargo delivery. Silica provides ease of functionalization, a robust support and biocompatibility. Several methods have been used in order to give the mesoporous silica nanomaterials different qualities that render them a useful material with different characteristics. Among these methods is surface modification by taking advantage of the OH groups on the surface. When a molecule attached to the surface can act as a molecular machine it transforms the nanomaterial to act as delivery system that can be activated upon command. The work covered in this thesis focuses on the development and synthesis of different mesoporous silica materials for the purpose of trapping and releasing cargo molecules. Chapter 2 focuses in the photoactivation of "snap-top" stoppers over the pore openings of mesoporous silica nanoparticles that releases intact cargo molecules from the pores. The on-command release can be stimulated by either one UV photon or two coherent near-IR photons. Two-photon activation is particularly desirable for use in biological systems because it enables good tissue penetration and precise spatial control. Chapter 3 focuses on the design and synthesis of a nano-container consisting of mesoporous silica nanoparticles with the pore openings covered by "snap-top" caps that are opened by near-IR light. A photo transducer molecule that is a reducing agent in an excited electronic state is covalently attached to the system. Near IR two-photon excitation causes intermolecular electron transfer that reduces a disulfide bond holding the cap in place, thus allowing the cargo molecules to escape. The operation of the "snap-top" release mechanism by both one- and two photon is described. This system presents a proof of concept of a near

  17. Titanium-containing mesoporous molecular sieves for catalytic oxidation of aromatic compounds

    NASA Astrophysics Data System (ADS)

    Tanev, Peter T.; Chibwe, Malama; Pinnavaia, Thomas J.


    TITANIUM silicalite is an effective molecular-sieve catalyst for the selective oxidation of alkanes, the hydroxylation of phenol and the epoxidation of alkenes in the presence of H2O2 (refs 1-3). The range of organic compounds that can be oxidized is greatly limited, however, by the relatively small pore size (about 0.6 nm) of the host framework4. Large-pore (mesoporous) silica-based molecular sieves have been prepared recently by Kresge et all5-7 and Kuroda et al 8.; the former used a templating approach in which the formation of an inorganic mesoporous structure is assisted by self-organization of surfactants, and the latter involved topochemical rearrangement of a layered silica precursor. Here we describe the use of the templating approach to synthesize mesoporous silica-based molecular sieves partly substituted with titanium-large-pore analogues of titanium silicalite. We find that these materials show selective catalytic activity towards the oxidation of 2,6-ditert-butyl phenol to the corresponding quinone and the conversion of benzene to phenol.

  18. Surfactant-free synthesis of mesoporous and hollow silica nanoparticles with an inorganic template.


    Baù, Luca; Bártová, Barbora; Arduini, Maria; Mancin, Fabrizio


    A surfactant-free synthesis of mesoporous and hollow silica nanoparticles is reported in which boron acts as the templating agent. Using such a simple and mild procedure as a treatment with water, the boron-rich phase is selectively removed, affording mesoporous pure silica nanoparticles with wormhole-like pores or, depending on the synthetic conditions, silica nanoshells. PMID:20024287

  19. Highly ordered mesoporous silica nanoparticles and their application to DNA separation

    NASA Astrophysics Data System (ADS)

    Lee, Hye Sun; Chang, Jeong Ho


    This work describes the innovative development of high throughput human DNA purification process using the molecular self-assembled mesoporous silica nanoparticles. The mesoporous silica nanoparticles were prepared by sol-gel method and the formation of molecular self-assembled monolayers with functional groups was chemically demonstrated. The surface modification of functional groups was performed with aminofunctionallized organic silanes on mesoporous silica nanoparticles and the results of DNA separation was represented with electrophoresis images.

  20. Catalytic conversion of cellulose over mesoporous Y zeolite.


    Park, Young-Kwon; Jun, Bo Ram; Park, Sung Hoon; Jeon, Jong-Ki; Lee, See Hoon; Kim, Seong-Soo; Jeong, Kwang-Eun


    Mesoporous Y zeolite (Meso-Y) was applied, for the first time, to the catalytic pyrolysis of cellulose which is a major constituent of lignocellulosic biomass, to produce high-quality bio-oil. A representative mesoporous catalyst Al-MCM-41 was also used to compare its catalytic activity with that of Meso-Y. Pyrolysis-gas chromatography/mass spectrometry was used for the experiments. Meso-Y, with higher acidity, led to larger yields of aromatics and furans with high value-added than Al-MCM-41, resulting in the production of bio-oil with higher quality. The effect of temperature on the catalytic pyrolysis was not significant within the range of 400-500 degrees C. When the Meso-Y to cellulose ratio was increased from 1/1 via 2/1 to 3/1, the deoxygenation efficiency increased, leading to increased yield of aromatics. PMID:24757989

  1. Chemoradiotherapeutic wrinkled mesoporous silica nanoparticles for use in cancer therapy

    SciTech Connect

    Munaweera, Imalka; Balkus, Kenneth J. Jr. E-mail:; Koneru, Bhuvaneswari; Shi, Yi; Di Pasqua, Anthony J. E-mail:


    Over the last decade, the development and application of nanotechnology in cancer detection, diagnosis, and therapy have been widely reported. Engineering of vehicles for the simultaneous delivery of chemo- and radiotherapeutics increases the effectiveness of the therapy and reduces the dosage of each individual drug required to produce an observable therapeutic response. We here developed a novel chemoradiotherapeutic 1,2-dioleoyl-sn-glycero-3-phosphocholine lipid coated/uncoated platinum drug loaded, holmium-containing, wrinkled mesoporous silica nanoparticle. The materials were characterized with TEM, FTIR, {sup 1}H NMR, energy dispersive x-ray, inductively coupled plasma-mass spectrometry, and zeta potential measurements. In vitro platinum drug release from both lipid coated and uncoated chemoradiotherapeutic wrinkled mesoporous silica are reported. Various kinetic models were used to analyze the release kinetics. The radioactivity of the chemoradiotherapeutic nanocarriers was measured after neutron-activation.

  2. Chemoradiotherapeutic wrinkled mesoporous silica nanoparticles for use in cancer therapy

    NASA Astrophysics Data System (ADS)

    Munaweera, Imalka; Koneru, Bhuvaneswari; Shi, Yi; Di Pasqua, Anthony J.; Balkus, Kenneth J., Jr.


    Over the last decade, the development and application of nanotechnology in cancer detection, diagnosis, and therapy have been widely reported. Engineering of vehicles for the simultaneous delivery of chemo- and radiotherapeutics increases the effectiveness of the therapy and reduces the dosage of each individual drug required to produce an observable therapeutic response. We here developed a novel chemoradiotherapeutic 1,2-dioleoyl-sn-glycero-3-phosphocholine lipid coated/uncoated platinum drug loaded, holmium-containing, wrinkled mesoporous silica nanoparticle. The materials were characterized with TEM, FTIR, 1H NMR, energy dispersive x-ray, inductively coupled plasma-mass spectrometry, and zeta potential measurements. In vitro platinum drug release from both lipid coated and uncoated chemoradiotherapeutic wrinkled mesoporous silica are reported. Various kinetic models were used to analyze the release kinetics. The radioactivity of the chemoradiotherapeutic nanocarriers was measured after neutron-activation.

  3. Mesoporous silica nanoparticles for bioadsorption, enzyme immobilisation, and delivery carriers

    NASA Astrophysics Data System (ADS)

    Popat, Amirali; Hartono, Sandy Budi; Stahr, Frances; Liu, Jian; Qiao, Shi Zhang; Qing (Max) Lu, Gao


    Mesoporous silica nanoparticles (MSNs) provide a non-invasive and biocompatible delivery platform for a broad range of applications in therapeutics, pharmaceuticals and diagnosis. The creation of smart, stimuli-responsive systems that respond to subtle changes in the local cellular environment are likely to yield long term solutions to many of the current drug/gene/DNA/RNA delivery problems. In addition, MSNs have proven to be promising supports for enzyme immobilisation, enabling the enzymes to retain their activity, affording them greater potential for wide applications in biocatalysis and energy. This review provides a comprehensive summary of the advances made in the last decade and a future outlook on possible applications of MSNs as nanocontainers for storage and delivery of biomolecules. We discuss some of the important factors affecting the adsorption and release of biomolecules in MSNs and review of the cytotoxicity aspects of such nanomaterials. The review also highlights some promising work on enzyme immobilisation using mesoporous silica nanoparticles.

  4. Fluorescent Functionalized Mesoporous Silica for Radioactive Material Extraction

    SciTech Connect

    Li, Juan; Zhu, Kake; Shang, Jianying; Wang, Donghai; Nie, Zimin; Guo, Ruisong; Liu, Chongxuan; Wang, Zheming; Li, Xiaolin; Liu, Jun


    Mesoporous silica with covalently bound salicylic acid molecules incorporated in the structure was synthesized with a one-pot, co-condensation reaction at room temperature. The as-synthesized material has a large surface area, uniform particle size, and an ordered pore structure as determined by characterization with transmission electron microscopy, thermal gravimetric analysis, and infrared spectra, etc. Using the strong fluorescence and metal coordination capability of salicylic acid, functionalized mesoporous silica (FMS) was developed to track and extract radionuclide contaminants, such as uranyl [U(VI)] ions encountered in subsurface environments. Adsorption measurements showed a strong affinity of the FMS toward U(VI) with a Kd value of 105 mL/g, which is four orders of magnitude higher than the adsorption of U(VI) onto most of the sediments in natural environments. The new materials have a potential for synergistic environmental monitoring and remediation of the radionuclide U(VI) from contaminated subsurface environments.

  5. Contamination-resistant silica antireflective coating with closed ordered mesopores.


    Sun, Jinghua; Zhang, Qinghua; Ding, Ruimin; Lv, Haibing; Yan, Hongwei; Yuan, Xiaodong; Xu, Yao


    Porous silica optical antireflective (AR) coatings prepared by traditional sol-gel method have been extensively used for high power laser systems, but a serious drawback is that contamination existing in the high vacuum is easily absorbed by the disordered open pore structure, resulting in a fast decrease in transmittance. To improve the stability of transmittance in vacuum, a contamination-resistant silica AR coating with ordered mesopores completely closed by hydrophobic-oleophobic groups was successfully developed on a fused quartz substrate. The ordered mesopores in the coating were controlled under the direction of surfactant F127 via an evaporation-induced-self-assembling process and then were closed by post-grafting long chain fluoroalkylsilane. The grazing incidence small angle X-ray scattering (GISAXS) and the X-ray reflectivity (XRR) results indicated that the mesopores in the coating constructed a Fmmm orthorhombic symmetry structure with a (010) plane parallel to the substrate. Cage-like mesopores were confirmed by nitrogen adsorption-desorption analysis. The obtained coatings showed low surface roughness, excellent abrase-resistance and high transmittance of 100% on quartz substrate. Especially, the decrease of transmittance tested with polydimethylsiloxane pollution in vacuum within one-month was as small as 0.02%. The laser induced damage threshold was up to 59.8 J cm(-2) at a 12 ns laser pulse of 1053 nm wavelength. This work provides an alternative way to fabricate AR coatings with high stability. PMID:25000419

  6. Thermal-stable carbon nanotube-supported metal nanocatalysts by mesoporous silica coating.


    Sun, Zhenyu; Zhang, Hongye; Zhao, Yanfei; Huang, Changliang; Tao, Ranting; Liu, Zhimin; Wu, Zhenduo


    A universal strategy was developed for the preparation of high-temperature-stable carbon nanotube (CNT) -supported metal nanocatalysts by encapsulation with a mesoporous silica coating. Specifically, we first showed the design of one novel catalyst, Pt(@)CNT/SiO(2), with a controllable mesoporous silica coating in the range 11-39 nm containing pores ≈3 nm in diameter. The hollow porous silica shell offers a physical barrier to separate Pt nanoparticles from contact with each other, and at the same time the access of reactant species to Pt was not much affected. As a result, the catalyst showed high thermal stability against metal particle agglomeration or sintering even after being subjected to harsh treatments up to 500 °C. In addition, degradation in catalytic activity was minimized for the hydrogenation of nitrobenzene over the catalyst treated at 300 °C for 2 h. The scheme was also extended to coat porous silica onto the surfaces of CuRu(@)CNT and the resultant catalyst thereby can be reusable at least four times without loss of activity for the hydrogenolysis of glycerol. These results suggest that the as-prepared nanostructured CNT-supported catalysts may find promising applications, especially in those processes requiring rigorous conditions. PMID:21480615

  7. Continuous synthesis process of hexagonal nanoplates of P6m ordered mesoporous silica.


    Jammaer, Jasper; van Erp, Titus S; Aerts, Alexander; Kirschhock, Christine E A; Martens, Johan A


    Hexagonally ordered mesoporous silica coined COK-12 was synthesized in a continuous process by combining streams of sodium silicate and citric acid/sodium citrate buffered solution of (ethylene oxide)(20)-(propylene oxide)(70)-(ethylene oxide)(20) triblock copolymer (Pluronic P123) from separate reservoirs. COK-12 precipitated spontaneously upon combining both streams at nearly neutral pH and ambient temperature. Stable intermediates of the COK-12 formation process could be prepared by limiting sodium silicate addition. Investigation of these intermediates using small-angle X-ray scattering revealed COK-12 formed via an assembly process departing from spherical uncharged core-shell P123-silica micelles. The sterical stabilization of these micelles decreased upon accumulation of silicate oligomers in their shell. Aggregation of the spherical micelles led to cylindrical micelles, which aligned and adopted the final hexagonal organization. This unprecedentedly fast formation of P6m ordered mesoporous silica was caused by two factors in the synthesis medium: the neutral pH favoring uncharged silicate oligomers and the high salt concentration promoting hydrophobic interactions with surfactant micelles leading to silica accumulation in the PEO shell. The easy continuous synthesis process is convenient for large-scale production. The platelet particle morphology with short and identical internal channels will be advantageous for many applications such as pore replication, nanotube or fiber growth, catalytic functionalization, drug delivery, film and sensor development, and in nano dyes as well as for investigation of pore diffusion phenomena. PMID:21790195

  8. Adsorption behavior of natural anthocyanin dye on mesoporous silica

    NASA Astrophysics Data System (ADS)

    Kohno, Yoshiumi; Haga, Eriko; Yoda, Keiko; Shibata, Masashi; Fukuhara, Choji; Tomita, Yasumasa; Maeda, Yasuhisa; Kobayashi, Kenkichiro


    Because of its non-toxicity, naturally occurring anthocyanin is potentially suitable as a colorant for foods and cosmetics. To the wider use of the anthocyanin, the immobilization on the inorganic host for an easy handling as well as the improvement of the stability is required. This study is focused on the adsorption of significant amount of the natural anthocyanin dye onto mesoporous silica, and on the stability enhancement of the anthocyanin by the complexation. The anthocyanin has successfully been adsorbed on the HMS type mesoporous silica containing small amount of aluminum. The amount of the adsorbed anthocyanin has been increased by modifying the pore wall with n-propyl group to make the silica surface hydrophobic. The light fastness of the adsorbed anthocyanin has been improved by making the composite with the HMS samples containing aluminum, although the degree of the improvement is not so large. It has been proposed that incorporation of the anthocyanin molecule deep inside the mesopore is required for the further enhancement of the stability.

  9. Controlling stability of gold nanoparticles in mesoporous silica

    NASA Astrophysics Data System (ADS)

    Bore, Mangesh Tukaram

    Metal particles deposited on oxide supports are used extensively as heterogeneous catalysts. By using a suitable combination of active metal phases and supports, the catalysts are designed for high activity, selectivity and mechanical strength. However, catalysts undergo deactivation, with poisoning, fouling, sintering and volatilization being some of the common reasons for loss of catalyst activity. For supported metal catalysts, sintering of metal particles is a major cause of catalyst deactivation. The rate and extent of sintering of supported metals depends upon temperature, atmosphere, support, promoter and metal. It is known that gold nanoparticles show high reactivity for CO oxidation at low temperature, but only when the Au particles are very small (<5 nm). Gold nanoparticles supported on silica show rapid sintering at 200°C--400°C. Porosity of support could play an important role in controlling the sintering of metal particles. But the role of pore size, pore curvature and structure is difficult to study with conventional supported metal catalysts. Surfactant templated mesoporous silica is a promising support material since it provides well defined pores of uniform size and structure. Hence, these silica supports provide ideal model systems for control of nanoparticle sintering. Limitations of mesoporous silica are its low hydrothermal stability at elevated temperatures and its inert nature. The pores of mesoporous silica reportedly collapse at temperatures above 500°C and gold nanoparticles supported on reducible oxides such as TiO2, CO3O4 and Fe2O 3 are more active compared to pure silica for CO oxidation. In this work highly dispersed gold nanoparticles (<2 nm) were prepared within the pores of silica with pore sizes ranging from 2.2 nm to 6.5 nm and differing pore architecture (2D-hexagonal, 3D-hexagonal, cubic and pores coiled-up in spherical geometry). In the 2D-hexagonal pore structure, the pores are one dimensional and terminate on the particle

  10. Functionalized mesoporous silica nanoparticles for oral delivery of budesonide

    NASA Astrophysics Data System (ADS)

    Yoncheva, K.; Popova, M.; Szegedi, A.; Mihaly, J.; Tzankov, B.; Lambov, N.; Konstantinov, S.; Tzankova, V.; Pessina, F.; Valoti, M.


    Non-functionalized and amino-functionalized mesoporous silica nanoparticle were loaded with anti-inflammatory drug budesonide and additionally post-coated with bioadhesive polymer (carbopol). TEM images showed spherical shape of the nanoparticles and slightly higher polydispersity after coating with carbopol. Nitrogen physisorption and thermogravimetic analysis revealed that more efficient loading and incorporation into the pores of nanoparticles was achieved with the amino-functionalized silica carrier. Infrared spectra indicated that the post-coating of these nanoparticles with carbopol led to the formation of bond between amino groups of the functionalized carrier and carboxyl groups of carbopol. The combination of amino-functionalization of the carrier with the post-coating of the nanoparticles sustained budesonide release. Further, an in vitro model of inflammatory bowel disease showed that the cytoprotective effect of budesonide loaded in the post-coated silica nanoparticles on damaged HT-29 cells was more pronounced compared to the cytoprotection obtained with pure budesonide.

  11. A High Temperature Capacitive Humidity Sensor Based on Mesoporous Silica

    PubMed Central

    Wagner, Thorsten; Krotzky, Sören; Weiß, Alexander; Sauerwald, Tilman; Kohl, Claus-Dieter; Roggenbuck, Jan; Tiemann, Michael


    Capacitive sensors are the most commonly used devices for the detection of humidity because they are inexpensive and the detection mechanism is very specific for humidity. However, especially for industrial processes, there is a lack of dielectrics that are stable at high temperature (>200 °C) and under harsh conditions. We present a capacitive sensor based on mesoporous silica as the dielectric in a simple sensor design based on pressed silica pellets. Investigation of the structural stability of the porous silica under simulated operating conditions as well as the influence of the pellet production will be shown. Impedance measurements demonstrate the utility of the sensor at both low (90 °C) and high (up to 210 °C) operating temperatures. PMID:22163790

  12. Peroxidase-like activity of mesoporous silica encapsulated Pt nanoparticle and its application in colorimetric immunoassay.


    Wang, Zhifei; Yang, Xia; Yang, Jingjing; Jiang, Yanyun; He, Nongyue


    Nanomaterial-based artificial enzymes have received great attention in recent year due to their potential application in immunoassay techniques. However, such potential is usually limited by poor dispersion stability or low catalytic activity induced by the capping agent essentially required in the synthesis. In an attempt to address these challenges, here, we studied the novel Pt nanoparticles (NPs) based peroxidase-like mimic by encapsulating Pt NP in mesoporous silica (Pt@mSiO2 NPs). Compared with other nanomaterial-based artificial enzymes, the obtained Pt@mSiO2 NPs not only exhibit high peroxidase-like activity but also have good dispersion stability in buffer saline solution when grafted with spacer PEG. Results show that when the thickness of silica shell is about 9 nm the resulting Pt@mSiO2 NPs exhibit the catalytic activity similar to that of Pt NPs, which is approximately 26 times higher than that of Fe3O4 NPs (in terms of Kcat for H2O2). Due to the protection of silica shell, the subsequent surface modification with antibody has little effect on their catalytic activity. The analytical performance of this system in detecting hCG shows that after 5 min incubation the limit of detection can reach 10 ng mL(-1) and dynamic linear working range is 5-200 ng mL(-1). Our findings pave the way for design and development of novel artificial enzyme labeling. PMID:25682428

  13. Controlled epitaxial growth of mesoporous silica/gold nanorod nanolollipops and nanodumb-bells

    SciTech Connect

    Huang, Ching-Mao; Chung, Ming-Fang; Lo, Leu-Wei; Souris, Jeffrey S.


    In this work, we describe the controlled synthesis of novel heterogeneous nanostructures comprised of mesoporous silica-coated gold nanorods (MSGNRs) in the form of core–shell nanolollipops and nanodumb-bells, using a seed-mediated sol–gel method. Although MSGNR core–shell (θ-MSGNR) structures have been reported previously by us and others, we herein discuss the first ever fabrication of MSGNR nanolollipops (φ-MSGNR) and nanodumb-bells (β-MSGNR), achieved by simply controlling the aging time of gold nanorods (GNRs), the residual cetyltrimethylammonium bromide (CTAB) coating of GNRs, and the addition of dimethyl formamide during incubation, centrifugation, and sonication, respectively. Transmission electron microscopy revealed two bare GNR isoforms, with aspect ratios of approximately 4 and 6, while scanning electron microscopy was used to further elucidate the morphology of φ-MSGNR and β-MSGNR heterostructures. In agreement with the smaller dielectric constants afforded by incomplete silica encasement, spectroscopic studies of φ-MSGNR and β-MSGNR, surface plasmon resonance (SPR) bands revealed 20-40 nm blue shifts relative to the SPR of θ-MSGNR. On the basis of the attributes and applications of more conventional θ-MSGNRs, φ-MSGNRs and β-MSGNRs are anticipated to provide most of the utility of θ-MSGNRs, but with the additional functionalities that accompany their incorporation of both bare gold and mesoporous silica encased tips; with significant/unique implications for biomedical and catalytic applications.

  14. Controlled epitaxial growth of mesoporous silica/gold nanorod nanolollipops and nanodumb-bells

    NASA Astrophysics Data System (ADS)

    Huang, Ching-Mao; Chung, Ming-Fang; Souris, Jeffrey S.; Lo, Leu-Wei


    In this work, we describe the controlled synthesis of novel heterogeneous nanostructures comprised of mesoporous silica-coated gold nanorods (MSGNRs) in the form of core-shell nanolollipops and nanodumb-bells, using a seed-mediated sol-gel method. Although MSGNR core-shell (θ-MSGNR) structures have been reported previously by us and others, we herein discuss the first ever fabrication of MSGNR nanolollipops (φ-MSGNR) and nanodumb-bells (β-MSGNR), achieved by simply controlling the aging time of gold nanorods (GNRs), the residual cetyltrimethylammonium bromide (CTAB) coating of GNRs, and the addition of dimethyl formamide during incubation, centrifugation, and sonication, respectively. Transmission electron microscopy revealed two bare GNR isoforms, with aspect ratios of approximately 4 and 6, while scanning electron microscopy was used to further elucidate the morphology of φ-MSGNR and β-MSGNR heterostructures. In agreement with the smaller dielectric constants afforded by incomplete silica encasement, spectroscopic studies of φ-MSGNR and β-MSGNR, surface plasmon resonance (SPR) bands revealed 20-40 nm blue shifts relative to the SPR of θ-MSGNR. On the basis of the attributes and applications of more conventional θ-MSGNRs, φ-MSGNRs and β-MSGNRs are anticipated to provide most of the utility of θ-MSGNRs, but with the additional functionalities that accompany their incorporation of both bare gold and mesoporous silica encased tips; with significant/unique implications for biomedical and catalytic applications.

  15. Synthesis of palladium nanoparticles supported on mesoporous N-doped carbon and their catalytic ability for biofuel upgrade.


    Xu, Xuan; Li, Yi; Gong, Yutong; Zhang, Pengfei; Li, Haoran; Wang, Yong


    We report a catalyst made of Pd nanoparticles (NPs) supported on mesoporous N-doped carbon, Pd@CN(0132), which was shown to be highly active in promoting biomass refining. The use of a task-specific ionic liquid (3-methyl-1-butylpyridine dicyanamide) as a precursor and silica NPs as a hard template afforded a high-nitrogen-content (12 wt %) mesoporous carbon material that showed high activity in stabilizing Pd NPs. The resulting Pd@CN(0.132) catalyst showed very high catalytic activity in hydrodeoxygenation of vanillin (a typical model compound of lignin) at low H(2) pressure under mild conditions in aqueous media. Excellent catalytic results (100% conversion of vanillin and 100% selectivity for 2-methoxy-4-methylphenol) were achieved, and no loss of catalytic activity was observed after six recycles. PMID:23030399

  16. Mesoporous Silica Nanomaterials for Applications in Catalysis, Sensing, Drug Delivery and Gene Transfection

    SciTech Connect

    Daniela Rodica Radu


    The central theme of this dissertation is represented by the versatility of mesoporous silica nanomaterials in various applications such as catalysis and bio-applications, with main focus on biological applications of Mesoporous Silica Nanospheres (MSN). The metamorphosis that we impose to these materials from catalysis to sensing and to drug and gene delivery is detailed in this dissertation. First, we developed a synthetic method that can fine tune the amount of chemically accessible organic functional groups on the pores surface of MSN by exploiting electrostatic and size matching between the cationic alkylammonium head group of the cetyltrimethylammonium bromide (CTAB) surfactant and various anionic organoalkoxysilane precursors at the micelle-water interface in a base-catalyzed condensation reaction of silicate. Aiming nature imitation, we demonstrated the catalytic abilities of the MSNs, We utilized an ethylenediamine functional group for chelating Cu{sup 2+} as a catalytic functional group anchored inside the mesopores. Thus, a polyalkynylene-based conducting polymer (molecular wire) was synthesized within the Cu-functionalized MSNs silica catalyst. For sensing applications, we have synthesized a poly(lactic acid) coated mesoporous silica nanosphere (PLA-MSN) material that serves as a fluorescence sensor system for detection of amino-containing neurotransmitters in neutral aqueous buffer. We exploited the mesoporosity of MSNs for encapsulating pharmaceutical drugs. We examined bio-friendly capping molecules such as polyamidoamine dendrimers of generations G2 to G4, to prevent the drug leaching. Next, the drug delivery system employed MSNs loaded with Doxorubicin, an anticancer drug. The results demonstrated that these nano-Trojan horses have ability to deliver Doxorubicin to cancer cells and induce their death. Finally, to demonstrate the potential of MSN as an universal cellular transmembrane nanovehicle, we anchored positively charged dendrimers on the

  17. In Situ Loading of Drugs into Mesoporous Silica SBA-15.


    Wan, Mi Mi; Li, Yan Yan; Yang, Tian; Zhang, Tao; Sun, Xiao Dan; Zhu, Jian Hua


    In a new strategy for loading drugs into mesoporous silica, a hydrophilic (heparin) or hydrophobic drug (ibuprofen) is encapsulated directly in a one-pot synthesis by evaporation-induced self-assembly. In situ drug loading significantly cuts down the preparation time and dramatically increases the loaded amount and released fraction of the drug, and appropriate drug additives favor a mesoporous structure of the vessels. Drug loading was verified by FTIR spectroscopy and release tests, which revealed much longer release with a larger amount of heparin or ibuprofen compared to postloaded SBA-15. Besides, the in vitro anticoagulation properties of the released heparin and the biocompatibility of the vessels were carefully assessed, including activated partial thromboplastin time, thrombin time, hemolysis, platelet adhesion experiments, and the morphologies of red blood cells. A concept of new drug-release agents with soft core and hard shell is proposed and offers guidance for the design of novel drug-delivery systems. PMID:26999658

  18. Silver nanoparticles incorporated onto ordered mesoporous silica from Tollen's reagent

    NASA Astrophysics Data System (ADS)

    Zienkiewicz-Strzałka, M.; Pasieczna-Patkowska, S.; Kozak, M.; Pikus, S.


    Noble metal nanostructures supported on mesoporous silica are bridge between traditional silica adsorbents and modern catalysts. In this work the Ag/SBA-15 mesoporous materials were synthesized and characterized. Various forms of nanosilver supported on ordered mesoporous template have been successfully obtained via proposed procedures. In all synthesized materials, Tollen's reagent (diammine silver complex [Ag(NH3)2]+) was used as a silver source. Silver nanoparticles were prepared by reduction of ammoniacal silver complex by formaldehyde in the solution of stabilizer. After reduction, Ag nanoparticles could be deposited on SBA-15, or added during traditional synthesis of SBA-15 giving silver or silver chloride nanoparticles in the combination with porous silica. Silver nanostructures as nanoparticles or nanowires were also embedded onto the SBA-15 by incipient wetness impregnation of silver ions. Absorbed silver ions were next reduced under hydrogen at high temperature. There are many advantages of utilized ammoniacal silver complex as a silver source. Proposed method is capable to synthesis of various metal nanostructures with controlled composition and morphology. The silver ammonia complex is composed of two ions surrounding and protecting the central silver ion, so it is possible to obtain very small nanoparticles using simple approach without any functionalization of external and internal surface of SBA-15. This approach allows obtaining greatly small silver nanoparticles on SBA-15 (4 nm) or nanowires depending on the metal loading amount. Moreover, the colloidal silver solution prepared from Tollen's reagent, in the presence of triblock copolymer, remains stable for a long time. Reduction of Tollen's reagent to silver colloidal solution seems to be efficient, fast and interesting approach for the preparation of supported silver nanostructures Obtained samples were characterized by powder X-ray diffraction, small angle X-ray scattering (SAXS), UV

  19. Sponge mesoporous silica formation using disordered phospholipid bilayers as template.


    Galarneau, Anne; Sartori, Federica; Cangiotti, Michela; Mineva, Tzonka; Di Renzo, Francesco; Ottaviani, M Francesca


    Lecithin/dodecylamine/lactose mixtures in ethanol/aqueous media led to the formation of sponge mesoporous silica (SMS) materials by means of tetraethoxysilane (TEOS) as silica source. SMS materials show a "sponge-mesoporous" porosity with a pore diameter of about 5-6 nm, in accordance to the length of a lecithin bilayer. SMS synthesis was developed to create a new class of powerful biocatalysts able to efficiently encapsulate enzymes by adding a porosity control to the classical sol-gel synthesis and by using phospholipids and lactose as protecting agents for the enzymes. In the present study, the formation of SMS was investigated by using electron paramagnetic resonance (EPR) probes inserted inside phospholipid bilayers. The influence of progressive addition of each component (ethanol, dodecylamine, lactose, TEOS) on phospholipid bilayers was first examined; then, the time evolution of EPR spectra during SMS synthesis was studied. Parameters informative of mobility, structure, order, and polarity around the probes were extracted by computer analysis of the EPR line shape. The results were discussed on the basis of solids characterization by X-ray diffraction, nitrogen isotherm, transmission electron microscopy, and scanning electron microscopy. The results, together with the well-known ability of ethanol to promote membrane hemifusion, suggested that the templating structure is a bicontinuous phospholipid bilayer phase, shaped as a gyroid, resulting of multiple membrane hemifusions induced by the high alcohol content used in SMS synthesis. SMS synthesis was compared to hexagonal mesoporous silica (HMS) synthesis accomplished by adding TEOS to a dodecylamine/EtOH/water mixture. EPR evidenced the difference between HMS and SMS synthesis; the latter uses an already organized but slowly growing mesophase of phospholipids, never observed before, whereas the former shows a progressive elongation of micelles into wormlike structures. SMS-type materials represent a new

  20. Synthesis of white light emitting mesoporous carbon-silica nanocomposite

    NASA Astrophysics Data System (ADS)

    Sato, Koji; Ishikawa, Yukari; Matsumura, Akihiro; Ishii, Yosuke; Kawasaki, Shinji


    White light emitting mesoporous carbon-silica (MPCS) was synthesized by serially adding triblock copolymer (Pluronic, F127), ethanol (EtOH), tetraethoxysilane (TEOS), hydrochloric acid aqueous (HCl) and phenol-formaldehyde resin (resol) followed by the heat treatments of carbonization and oxidation. The PL intensity of MPCS showed a tendency to be strong with increasing of HCl concentration in >= 0.2 M. The pore size of MPCS that emits white light was 8 ~ 9 nm and the specific surface area was 320 ~ 418 m2 / g.

  1. Monodisperse Mesoporous Carbon Nanoparticles from Polymer/Silica Self-Aggregates and Their Electrocatalytic Activities.


    Huang, Xiaoxi; Zhou, Li-Jing; Voiry, Damien; Chhowalla, Manish; Zou, Xiaoxin; Asefa, Tewodros


    In our quest to make various chemical processes sustainable, the development of facile synthetic routes and inexpensive catalysts can play a central role. Herein we report the synthesis of monodisperse, polyaniline (PANI)-derived mesoporous carbon nanoparticles (PAMCs) that can serve as efficient metal-free electrocatalysts for the hydrogen peroxide reduction reaction (HPRR) as well as the oxygen reduction reaction (ORR) in fuel cells. The materials are synthesized by polymerization of aniline with the aid of (NH4)2S2O8 as oxidant and colloidal silica nanoparticles as templates, then carbonization of the resulting PANI/silica composite material at different high temperatures, and finally removal of the silica templates from the carbonized products. The PAMC materials that are synthesized under optimized synthetic conditions possess monodisperse mesoporous carbon nanoparticles with an average size of 128 ± 12 nm and an average pore size of ca. 12 nm. Compared with Co3O4, a commonly used electrocatalyst for HPRR, these materials show much better catalytic activity for this reaction. In addition, unlike Co3O4, the PAMCs remain relatively stable during the reaction, under both basic and acidic conditions. The nanoparticles also show good electrocatalytic activity toward ORR. Based on the experimental results, PAMCs' excellent electrocatalytic activity is attributed partly to their heteroatom dopants and/or intrinsic defect sites created by vacancies in their structures and partly to their high porosity and surface area. The reported synthetic method is equally applicable to other polymeric precursors (e.g., polypyrrole (PPY)), which also produces monodisperse, mesoporous carbon nanoparticles in the same way. The resulting materials are potentially useful not only for electrocatalysis of HPRR and ORR in fuel cells but also for other applications where high surface area, small sized, nanostructured carbon materials are generally useful for (e.g., adsorption

  2. Catalytic upgrading of xylan over mesoporous Y catalyst.


    Kim, Seong-Soo; Jun, Bo Ram; Park, Sung Hoon; Jeon, Jong-Ki; Suh, Dong Jin; Kim, Tae-Wan; Park, Young-Kwon


    In-situ catalytic cracking of xylan, a model compound of hemicellulose, was carried out using pyrolysis-gas chromatography/mass spectrometry over mesoporous Y for the first time. Experiments were conducted at three different temperatures, 400 degrees C, 450 degrees C, and 500 degrees C, to investigate the effect of reaction temperature. Three different biomass-to-catalyst ratios, 1:1, 1:2, and 1:3, were tested at 500 degrees C to examine the effect of catalyst dose. In addition, the catalytic activity of mesoporous Y was compared with that of Al-MCM-41. The catalysts used were characterized by N2 adsorption-desorption, temperature programmed desorption of NH3, and X-ray diffraction. The main pyrolysis products of xylan were acids, hydrocarbons, phenolics, oxygenates, aromatics, and polycyclic aromatic hydrocarbons. Mesoporous Y, which has acid sites with larger quantity and stronger acidity than those of Al-MCM-41, was shown to enhance the quality of bio-oil to a larger extent, producing a larger quantity of high-value-added products, such as aromatics and furans. PMID:24734712

  3. The Role of Non-Bonded Interactions in the Conformational Dynamics of Organophosphorous Hydrolase Adsorbed onto Functionalized Mesoporous Silica Surfaces

    SciTech Connect

    Gomes, Diego Enry B.; Lins, Roberto D.; Pascutti, Pedro G.; Lei, Chenghong; Soares, Thereza A.


    The enzyme organophosphorous hydrolase (OPH) catalyzes the hydrolysis of a wide variety of organophosphorous compounds with high catalytic efficiency and broad substrate specificity. The immobilization of OPH in functionalized mesoporous silica surfaces increases significantly its catalytic specific activity compared to the enzyme in solution with important applications for the detection and decontamination of insecticides and chemical warfare agents. Experimental measurements of immobilization efficiency as function of the charge and coverage percentage of different functional groups have been interpreted as electrostatic forces being the predominant interactions underlying the adsorption of OPH onto functionalized mesoporous silica surfaces. Explicit solvent molecular dynamics simulations have been performed for OPH in bulk solution and adsorbed onto two distinct interaction potential models of the mesoporous silica functional groups in order to investigate the relative contributions of non-bonded interactions to the conformational dynamics and adsorption of the protein. Our results support the conclusion that while electrostatic interactions are responsible for the specific binding of OPH to the FMS surface, van der Waals forces are detrimental for enhanced interfacial adhesion. Key-words: molecular dynamics simulations; bacterial phosphotriesterase; conformational changes; confined environments; coarse-grain and atomistic models; silanol molecular model.

  4. Thrombin-Responsive Gated Silica Mesoporous Nanoparticles As Coagulation Regulators.


    Bhat, Ravishankar; Ribes, Àngela; Mas, Núria; Aznar, Elena; Sancenón, Félix; Marcos, M Dolores; Murguía, Jose R; Venkataraman, Abbaraju; Martínez-Máñez, Ramón


    The possibility of achieving sophisticated actions in complex biological environments using gated nanoparticles is an exciting prospect with much potential. We herein describe new gated mesoporous silica nanoparticles (MSN) loaded with an anticoagulant drug and capped with a peptide containing a thrombin-specific cleavage site. When the coagulation cascade was triggered, active thrombin degraded the capping peptidic sequence and induced the release of anticoagulant drugs to delay the clotting process. The thrombin-dependent response was assessed and a significant increase in coagulation time in plasma from 2.6 min to 5 min was found. This work broadens the application of gated silica nanoparticles and demonstrates their ability to act as controllers in a complex scenario such as hemostasis. PMID:26794474

  5. Mesoporous silica nanoparticles deliver DNA and chemicals into plants

    NASA Astrophysics Data System (ADS)

    Torney, François; Trewyn, Brian G.; Lin, Victor S.-Y.; Wang, Kan


    Surface-functionalized silica nanoparticles can deliver DNA and drugs into animal cells and tissues. However, their use in plants is limited by the cell wall present in plant cells. Here we show a honeycomb mesoporous silica nanoparticle (MSN) system with 3-nm pores that can transport DNA and chemicals into isolated plant cells and intact leaves. We loaded the MSN with the gene and its chemical inducer and capped the ends with gold nanoparticles to keep the molecules from leaching out. Uncapping the gold nanoparticles released the chemicals and triggered gene expression in the plants under controlled-release conditions. Further developments such as pore enlargement and multifunctionalization of these MSNs may offer new possibilities in target-specific delivery of proteins, nucleotides and chemicals in plant biotechnology.

  6. White light emitting Mesoporous Carbon-Silica Nanocomposite

    NASA Astrophysics Data System (ADS)

    Matsumura, Akihiro; Ishii, Yosuke; Sato, Koji; Ishikawa, Yukari; Kawasaki, Shinji


    Visible photoluminescence (PL) from oxidized mesoporous carbon-silica nanocomposite (MPCS) prepared by the triconstituent co-assembly method is reported. White PL from MPCS was observed by naked eye at room temperature. Oxidation effects on carbon-silica bonding states and transmittance were investigated. PL intensity decreased with decreasing of carbon dangling bond density by oxidation at above 500 °C. The transmittance of MPCS at excitation and emission wavelengths increased with increasing of oxidation temperature. It is concluded that PL intensity is determined by the balance between PL related carbon density and transmittance. We proposed an additional wet oxidation that can increase PL intensity by the increase of transmittance under suppressing carbon desorption.

  7. Post-treatment and characterization of novel luminescent hybrid bimodal mesoporous silicas

    NASA Astrophysics Data System (ADS)

    Li, Yuzhen; Sun, Jihong; Wu, Xia; Lin, Li; Gao, Lin


    A novel luminescent hybrid bimodal mesoporous silicas (LHBMS) were synthesized via grafting 1,8-Naphthalic anhydride into the pore channels of bimodal mesoporous silicas (BMMs) for the first time. The resulting samples were characterized by powder X-ray diffraction (XRD), N 2 adsorption/desorption measurement, Fourier transform infrared spectroscopy (FT-IR), Transmission electron microscopy (TEM), UV-vis absorption spectroscopy, and Photoluminescence spectroscopy (PL). The results show that 1,8-Naphthalic anhydride organic groups have been successfully introduced into the mesopores of the BMMs and the hybrid silicas are of bimodal mesoporous structure with the ordered small mesopores of around 3 nm and the large mesopores of uniform intra-nanoparticle. The excellent photoluminescent performance of LHBMS has a blue shift compared to that of 2-[3-(triethoxysilyl) propyl-1 H-Benz [de]isoquinoline-1, 3(2 H)-dione, suggesting the existence of the quantum confinement effectiveness.

  8. Facile preparation of mesoporous carbon-silica-coated graphene for the selective enrichment of endogenous peptides.


    Zhang, Quanqing; Zhang, Qinghe; Xiong, Zhichao; Wan, Hao; Chen, Xiaoting; Li, Hongmei; Zou, Hanfa


    A sandwich-like composite composed of ordered mesoporous carbon-silica shell-coated graphene (denoted as graphene@mSiO2-C) was prepared by an in-situ carbonation strategy. A mesoporous silica shell was synthesized by a sol-gel method, and cetyltrimethyl ammonium bromide inside the mesopores were in-situ carbonized as a carbon source to obtain a carbon-silica shell. The resulting mesoporous carbon-silica material with a sandwich structure possesses a high surface area (600 m(2) g(-1)), large pore volume (0.587 cm(3) g(-1)), highly ordered mesoporous pore (3 nm), and high carbon content (30%). This material shows not only high hydrophobicity of graphene and mesoporous carbon but also a hydrophilic silica framework that ensures excellent dispersibility in aqueous solution. The material can capture many more peptides from bovine serum albumin tryptic digests than mesoporous silica shell-coated graphene, demonstrating great enrichment efficiency for peptides. Furthermore, the prepared composite was applied to the enrichment of low-abundance endogenous peptides in human serum. Based on Matrix-Assisted Laser Desorption/ Ionization Time of Flight Mass Spectrometry identification, the graphene@mSiO2-C could efficiently size-exclude proteins and enriches the low-abundant peptides on the graphene and mesoporous carbon. And based on the LC-MS/MS results, 892 endogenous peptides were obtained by graphene@mSiO2-C, hinting at its great potential in peptides analysis. PMID:26695263

  9. Mesoporous silica as carrier of antioxidant for food packaging materials

    NASA Astrophysics Data System (ADS)

    Buonocore, Giovanna Giuliana; Gargiulo, Nicola; Verdolotti, Letizia; Liguori, Barbara; Lavorgna, Marino; Caputo, Domenico


    Mesoporous silicas have been long recognized as very promising materials for the preparation of drug delivery systems. In this work SBA-15 mesoporous silica has been functionalized with amino-silane to be used as carrier of antioxidant compound in the preparation of active food packaging materials exhibiting tailored release properties. Active films have been prepared by loading the antioxidant tocopherol, the purely siliceous SBA-15 and the aminofunctionalized SBA-15 loaded with tocopherol into LDPE matrix trough a two-step process (mixing+extrusion). The aim of the present work is the study of the effect of the pore size and of the chemical functionality of the internal walls of the mesophase on the migration of tocopherol from active LDPE polymer films. Moreover, it has been proved that the addition of the active compound do not worsen the properties of the film such as optical characteristic and water vapor permeability, thus leading to the development of a material which could be favorably used mainly, but not exclusively, in the sector of food packaging.

  10. Colloidal mesoporous silica nanoparticles enhance the biological activity of resveratrol.


    Summerlin, Natalie; Qu, Zhi; Pujara, Naisarg; Sheng, Yong; Jambhrunkar, Siddharth; McGuckin, Michael; Popat, Amirali


    The naturally occurring polyphenol resveratrol (RES) has attracted increasing attention in recent years due to its antioxidant, anti-inflammatory, and anticancer activity. However, resveratrol's promising potential as a nutraceutical is hindered by its poor aqueous solubility, which limits its biological activity. Here we show that encapsulating resveratrol in colloidal mesoporous silica nanoparticles (MCM-48-RES) enhances its saturated solubility by ∼95% and increases its in vitro release kinetics compared to pure resveratrol. MCM-48-RES showed high loading capacity (20% w/w) and excellent encapsulation efficiency (100%). When tested against HT-29 and LS147T colon cancer cell lines, MCM-48-RES-mediated in vitro cell death was higher than that of pure resveratrol, mediated via the PARP and cIAP1 pathways. Finally, MCM-48-RES treatment also inhibited lipopolysaccharide-induced NF-κB activation in RAW264.7 cells, demonstrating improved anti-inflammatory activity. More broadly, our observations demonstrate the potential of colloidal mesoporous silica nanoparticles as next generation delivery carriers for hydrophobic nutraceuticals. PMID:27060664

  11. Gold nanoparticles supported on mesoporous silica: origin of high activity and role of Au NPs in selective oxidation of cyclohexane.


    Wu, Pingping; Bai, Peng; Yan, Zifeng; Zhao, George X S


    Homogeneous immobilization of gold nanoparticles (Au NPs) on mesoporous silica has been achieved by using a one-pot synthesis method in the presence of organosilane mercapto-propyl-trimethoxysilane (MPTMS). The resultant Au NPs exhibited an excellent catalytic activity in the solvent-free selective oxidation of cyclohexane using molecular oxygen. By establishing the structure-performance relationship, the origin of the high activity of mesoporous supported Au catalyst was identified to be due to the presence of low-coordinated Au (0) sites with high dispersion. Au NPs were confirmed to play a critical role in the catalytic oxidation of cyclohexane by promoting the activation of O2 molecules and accelerating the formation of surface-active oxygen species. PMID:26729288

  12. Gold nanoparticles supported on mesoporous silica: origin of high activity and role of Au NPs in selective oxidation of cyclohexane

    PubMed Central

    Wu, Pingping; Bai, Peng; Yan, Zifeng; Zhao, George X. S.


    Homogeneous immobilization of gold nanoparticles (Au NPs) on mesoporous silica has been achieved by using a one-pot synthesis method in the presence of organosilane mercapto-propyl-trimethoxysilane (MPTMS). The resultant Au NPs exhibited an excellent catalytic activity in the solvent-free selective oxidation of cyclohexane using molecular oxygen. By establishing the structure-performance relationship, the origin of the high activity of mesoporous supported Au catalyst was identified to be due to the presence of low-coordinated Au (0) sites with high dispersion. Au NPs were confirmed to play a critical role in the catalytic oxidation of cyclohexane by promoting the activation of O2 molecules and accelerating the formation of surface-active oxygen species. PMID:26729288

  13. Colorimetric detection of hydrogen peroxide and glucose using the magnetic mesoporous silica nanoparticles.


    Wang, Yonghong; Zhou, Bo; Wu, Shun; Wang, Kemin; He, Xiaoxiao


    In this work, we synthesized a type of magnetic mesoporous silica nanoparticle (denoted as Fe3O4@MSN) with Fe3O4 as the core and mesoporous silica the shell. The superparamagnetic Fe3O4-core provides high peroxidase-mimic activity and makes the artificial enzymatic system easily recyclable. Furthermore, Fe3O4 nanoparticles are encapsulated in MSN shells to hinder the aggregation and keep them stable even under harsh conditions. Meanwhile, small active molecules are allowed to diffuse in and out of the MSN shells. Based on these functional units, the Fe3O4@MSN as robust nanoreactors can catalyze a self-organized cascade reaction, which includes oxidation of glucose by oxygen to yield gluconic acid and H2O2, and the latter further oxidizes 3,3,5,5-tetramethylbenzidine (TMB) to produce a color change. The Fe3O4@MSN, whose catalytic efficiency was not strongly dependent on pH and temperature, was successfully used for the detection of glucose and showed excellent sensitivity with a detection limit of 0.4×10(-5) mol/L. Nevertheless, the assay is also highly selective toward the glucose detection. PMID:25618726

  14. Complete magnesiothermic reduction reaction of vertically aligned mesoporous silica channels to form pure silicon nanoparticles

    PubMed Central

    Kim, Kyoung Hwan; Lee, Dong Jin; Cho, Kyeong Min; Kim, Seon Joon; Park, Jung-Ki; Jung, Hee-Tae


    Owing to its simplicity and low temperature conditions, magnesiothermic reduction of silica is one of the most powerful methods for producing silicon nanostructures. However, incomplete reduction takes place in this process leaving unconverted silica under the silicon layer. This phenomenon limits the use of this method for the rational design of silicon structures. In this effort, a technique that enables complete magnesiothermic reduction of silica to form silicon has been developed. The procedure involves magnesium promoted reduction of vertically oriented mesoporous silica channels on reduced graphene oxides (rGO) sheets. The mesopores play a significant role in effectively enabling magnesium gas to interact with silica through a large number of reaction sites. Utilizing this approach, highly uniform, ca. 10 nm sized silicon nanoparticles are generated without contamination by unreacted silica. The new method for complete magnesiothermic reduction of mesoporous silica approach provides a foundation for the rational design of silicon structures. PMID:25757800

  15. Complete magnesiothermic reduction reaction of vertically aligned mesoporous silica channels to form pure silicon nanoparticles

    NASA Astrophysics Data System (ADS)

    Kim, Kyoung Hwan; Lee, Dong Jin; Cho, Kyeong Min; Kim, Seon Joon; Park, Jung-Ki; Jung, Hee-Tae


    Owing to its simplicity and low temperature conditions, magnesiothermic reduction of silica is one of the most powerful methods for producing silicon nanostructures. However, incomplete reduction takes place in this process leaving unconverted silica under the silicon layer. This phenomenon limits the use of this method for the rational design of silicon structures. In this effort, a technique that enables complete magnesiothermic reduction of silica to form silicon has been developed. The procedure involves magnesium promoted reduction of vertically oriented mesoporous silica channels on reduced graphene oxides (rGO) sheets. The mesopores play a significant role in effectively enabling magnesium gas to interact with silica through a large number of reaction sites. Utilizing this approach, highly uniform, ca. 10 nm sized silicon nanoparticles are generated without contamination by unreacted silica. The new method for complete magnesiothermic reduction of mesoporous silica approach provides a foundation for the rational design of silicon structures.

  16. Influence of spatial configurations on electromagnetic interference shielding of ordered mesoporous carbon/ordered mesoporous silica/silica composites

    PubMed Central

    Wang, Jiacheng; Zhou, Hu; Zhuang, Jiandong; Liu, Qian


    Ordered mesoporous carbons (OMCs), obtained by nanocasting using ordered mesoporous silicas (OMSs) as hard templates, exhibit unique arrangements of ordered regular nanopore/nanowire mesostructures. Here, we used nanocasting combined with hot-pressing to prepare 10 wt% OMC/OMS/SiO2 ternary composites possessing various carbon mesostructure configurations of different dimensionalities (1D isolated CS41 carbon nanowires, 2D hexagonal CMK-3 carbon, and 3D cubic CMK-1 carbon). The electric/dielectric properties and electromagnetic interference (EMI) shielding efficiency (SE) of the composites were influenced by spatial configurations of carbon networks. The complex permittivity and the EMI SE of the composites in the X-band frequency range decreased for the carbon mesostructures in the following order: CMK-3-filled > CMK-1-filled > CS41-filled. Our study provides technical directions for designing and preparing high-performance EMI shielding materials. Our OMC-based silica composites can be used for EMI shielding, especially in high-temperature or corrosive environments, owing to the high stability of the OMC/OMS fillers and the SiO2 matrix. Related shielding mechanisms are also discussed. PMID:24248277

  17. Influence of spatial configurations on electromagnetic interference shielding of ordered mesoporous carbon/ordered mesoporous silica/silica composites.


    Wang, Jiacheng; Zhou, Hu; Zhuang, Jiandong; Liu, Qian


    Ordered mesoporous carbons (OMCs), obtained by nanocasting using ordered mesoporous silicas (OMSs) as hard templates, exhibit unique arrangements of ordered regular nanopore/nanowire mesostructures. Here, we used nanocasting combined with hot-pressing to prepare 10 wt% OMC/OMS/SiO2 ternary composites possessing various carbon mesostructure configurations of different dimensionalities (1D isolated CS41 carbon nanowires, 2D hexagonal CMK-3 carbon, and 3D cubic CMK-1 carbon). The electric/dielectric properties and electromagnetic interference (EMI) shielding efficiency (SE) of the composites were influenced by spatial configurations of carbon networks. The complex permittivity and the EMI SE of the composites in the X-band frequency range decreased for the carbon mesostructures in the following order: CMK-3-filled > CMK-1-filled > CS41-filled. Our study provides technical directions for designing and preparing high-performance EMI shielding materials. Our OMC-based silica composites can be used for EMI shielding, especially in high-temperature or corrosive environments, owing to the high stability of the OMC/OMS fillers and the SiO2 matrix. Related shielding mechanisms are also discussed. PMID:24248277

  18. Influence of spatial configurations on electromagnetic interference shielding of ordered mesoporous carbon/ordered mesoporous silica/silica composites

    NASA Astrophysics Data System (ADS)

    Wang, Jiacheng; Zhou, Hu; Zhuang, Jiandong; Liu, Qian


    Ordered mesoporous carbons (OMCs), obtained by nanocasting using ordered mesoporous silicas (OMSs) as hard templates, exhibit unique arrangements of ordered regular nanopore/nanowire mesostructures. Here, we used nanocasting combined with hot-pressing to prepare 10 wt% OMC/OMS/SiO2 ternary composites possessing various carbon mesostructure configurations of different dimensionalities (1D isolated CS41 carbon nanowires, 2D hexagonal CMK-3 carbon, and 3D cubic CMK-1 carbon). The electric/dielectric properties and electromagnetic interference (EMI) shielding efficiency (SE) of the composites were influenced by spatial configurations of carbon networks. The complex permittivity and the EMI SE of the composites in the X-band frequency range decreased for the carbon mesostructures in the following order: CMK-3-filled > CMK-1-filled > CS41-filled. Our study provides technical directions for designing and preparing high-performance EMI shielding materials. Our OMC-based silica composites can be used for EMI shielding, especially in high-temperature or corrosive environments, owing to the high stability of the OMC/OMS fillers and the SiO2 matrix. Related shielding mechanisms are also discussed.

  19. Silica-based mesoporous nanobiomaterials as promoter of bone regeneration process.


    Shadjou, Nasrin; Hasanzadeh, Mohammad


    Silica-based mesostructured nanomaterials have emerged as a full family of biomaterials with tremendous potential to address the requirements for the bone regeneration process. This review focuses on more recent advances in bone regeneration process based on silica-based mesoporous biomaterials during 2012 to January 2015. In this review, we describe application of silica-based mesoporous mesostructured nanomaterials (possessing pore sizes in the range 2-50 nm) for the bone regeneration process. We summarize the preparation methods, the effect of mesopore templates and composition on the mesopore-structure characteristics, and different forms of these materials, including particles, fibers, spheres, scaffolds, and composites. The effect of structural and textural properties of mesoporous materials on the development of new biomaterials for treatment of different bone pathologies such as infection, osteoporosis, cancer, and so forth is discussed. In addition, silica-based mesoporous bioactive glass, as a potential drug/growth factor carrier, is reviewed, which includes the composition-structure-drug delivery relationship and the functional effect on the antibacteria and tissue-stimulation properties. Also, application of different mesoporous materials on construction of 3D macroporous scaffolds for bone tissue engineering was disused. Finally, this review discusses the possibility of covalently grafting different osteoinductive agents to the silica-based mesoporous scaffold surface that act as attracting signals for bone cells to promote the bone regeneration process. PMID:26011776

  20. Synthesis of hydrothermally stable, hierarchically mesoporous aluminosilicate Al-SBA-1 and their catalytic properties.


    Li, Na; Wang, Jin-Gui; Xu, Jian-Xiong; Liu, Jin-Yu; Zhou, Hui-Jing; Sun, Ping-Chuan; Chen, Tie-Hong


    Hydrothermally stable mesoporous aluminosilicates Al-SBA-1 with hierarchical pore structure have been successfully synthesized under alkaline condition at 120 °C by employing organic mesomorphous complexes of polyelectrolyte (poly(acrylic acid) (PAA)) and cationic surfactant (hexadecyl pyridinium chloride (CPC)) as template. The Si/Al ratio could be as high as 5 and the incorporation of Al into the silica framework did not disturb the well-ordered cubic Pm ̅3n mesostructure. Meanwhile, the incorporation of Al could greatly increase the specific surface area and pore volume of the samples. The Al-SBA-1 materials exhibited a high hydrothermal stability and remained stable even after being treated in boiling water for 10 days. The catalytic activity of the Al-SBA-1 materials was investigated by employing the Friedel-Crafts alkylation of toluene with benzyl alcohol as a model reaction and they exhibited excellent catalytic property due to the incorporated acid sites and the hierarchically mesoporous structure. PMID:22327221

  1. Reaction mechanisms in irradiated, precipitated, and mesoporous silica.


    Dondi, D; Buttafava, A; Zeffiro, A; Bracco, S; Sozzani, P; Faucitano, A


    A matrix EPR spectroscopy study of the low temperature γ radiolysis of precipitated (Zeosil) and mesoporous high surface silica has afforded evidence of the formation of trapped H-atoms, H-atom centers, siloxy radicals ≡Si-O(•), anomalous silyl peroxy radicals ≡Si-OO(•) with reduced g tensor anisotropy, siloxy radical-cations (≡Si-O-Si≡)(+•), E' centers, and two species from Ge impurity. Coordination of peroxyl radicals with diamagnetic ≡Si(+) centers is proposed and tested by DFT computations in order to justify the observed g tensor. Coordination of H-atoms to ≡Si(+) centers is also proposed for the structure of the H-atom centers as an alternative model not requiring the intervention of Ge, Sn, or CO impurities. The DFT method has been employed to assess the electronic structure of siloxy radical-cations and its similarity with that of the carbon radical-cation analogues; the results have prompted a revision of the structures proposed in the literature for ST1 and ST2 centers. The comparison between the two types of silica has afforded evidence of different radiolysis mechanisms leading to a greater yield of trapped H-atoms and H-atom centers in zeosil silica, which is reckoned with the 4-fold greater concentration of silanol groups. Parallel radiolysis experiments carried out by using both types of silica with polybutadiene oligomers as adsorbate have afforded evidence of free valence and energy migration phenomena leading to irreversible linking of polybutadiene chains onto silica. Reaction mechanisms are proposed based on the detection of SiO2-bonded free radicals whose structure has been defined by EPR. PMID:23521082

  2. Impregnation of Fenofibrate on mesoporous silica using supercritical carbon dioxide.


    Bouledjouidja, Abir; Masmoudi, Yasmine; Van Speybroeck, Michiel; Schueller, Laurent; Badens, Elisabeth


    Low oral bioavailability can be circumvented by the formulation of the poorly water soluble drug in ordered mesoporous silica (OMS-L-7). Fenofibrate is an orally administered, poorly water-soluble active pharmaceutical ingredient (API), used clinically to lower lipid levels. Fenofibrate was loaded into silica using two methods: incipient wetness and supercritical impregnation. This study investigates the impact of loading and the impact of varying supercritical carbon dioxide (scCO2) processing conditions. The objective is to enhance Fenofibrate loading into silica while reducing degree of the drug crystallinity, so as to increase the drug's dissolution rate and its bioavailability. The comparison of both impregnation processes was made in terms of impregnation yields and duration as well as physical characterization of the drug. While incipient wetness method led to a Fenofibrate loading up to 300 mgdrug/gsilica in 48 h of impregnation, the supercritical impregnation method yielded loading up to 485 mgdrug/gsilica in 120 min of impregnation duration, at 16 MPa and 308 K, with a low degree of crystallinity (about 1%) comparable to the crystallinity observed via the solvent method. In addition to the enhancement of impregnation efficiency, the supercritical route provides a solvent-free alternative for impregnation. PMID:26732521

  3. High-performance PdRu bimetallic catalyst supported on mesoporous silica nanoparticles for phenol hydrogenation

    NASA Astrophysics Data System (ADS)

    Huang, Chao; Yang, Xu; Yang, Hui; Huang, Peiyan; Song, Huiyu; Liao, Shijun


    A high-performance PdRu bimetallic catalyst supported on mesoporous silica nanoparticles (MSN), PdRu/MSN, was prepared by a facile impregnation-hydrogen reduction method. It was found that PdRu/MSN showed 5 times higher activity than that of Pd/MSN towards the liquid-phase hydrogenation of phenol. The catalysts were characterized comprehensively by multiple techniques, X-ray diffraction (XRD), transmission electron microscopy (TEM), X-ray photoelectron spectroscopy (XPS), and hydrogen temperature program reduction (TPR). It was revealed that adding Ru could effectively improve the Pd dispersion and promote the electronic interaction between the Pd and Ru, both of which contribute to enhancing the catalytic activity.

  4. Synthesis of mesoporous silica materials from municipal solid waste incinerator bottom ash.


    Liu, Zhen-Shu; Li, Wen-Kai; Huang, Chun-Yi


    Incinerator bottom ash contains a large amount of silica and can hence be used as a silica source for the synthesis of mesoporous silica materials. In this study, the conditions for alkaline fusion to extract silica from incinerator bottom ash were investigated, and the resulting supernatant solution was used as the silica source for synthesizing mesoporous silica materials. The physical and chemical characteristics of the mesoporous silica materials were analyzed using BET, XRD, FTIR, SEM, and solid-state NMR. The results indicated that the BET surface area and pore size distribution of the synthesized silica materials were 992 m2/g and 2-3.8 nm, respectively. The XRD patterns showed that the synthesized materials exhibited a hexagonal pore structure with a smaller order. The NMR spectra of the synthesized materials exhibited three peaks, corresponding to Q(2) [Si(OSi)2(OH)2], Q(3) [Si(OSi)3(OH)], and Q(4) [Si(OSi)4]. The FTIR spectra confirmed the existence of a surface hydroxyl group and the occurrence of symmetric Si-O stretching. Thus, mesoporous silica was successfully synthesized from incinerator bottom ash. Finally, the effectiveness of the synthesized silica in removing heavy metals (Pb2+, Cu2+, Cd2+, and Cr2+) from aqueous solutions was also determined. The results showed that the silica materials synthesized from incinerator bottom ash have potential for use as an adsorbent for the removal of heavy metals from aqueous solutions. PMID:24656468

  5. One-step synthesis of degradable T1-FeOOH functionalized hollow mesoporous silica nanocomposites from mesoporous silica spheres

    NASA Astrophysics Data System (ADS)

    Peng, Yung-Kang; Tseng, Yu-Jui; Liu, Chien-Liang; Chou, Shang-Wei; Chen, Yu-Wei; Tsang, S. C. Edman; Chou, Pi-Tai


    The combination of a hollow mesoporous structure and a magnetic resonance (MR) contrast agent has shown its potential in simultaneous drug delivery and cell tracking applications. However, the preparation of this kind of nanocomposite is complicated and usually takes several days, which is unsuitable for scaled-up production. To overcome these hurdles, we report herein a facile method to synthesize iron oxide hydroxide functionalized hollow mesoporous silica spheres (FeOOH/HMSS) in a one-step manner. By carefully controlling the reaction kinetics of K2FeO4 in water, the gram-scale production of FeOOH/HMSS can be readily achieved at 60 °C for as short as 30 min. Most importantly, this synthetic process is also cost-effective and eco-friendly in both the precursor (K2FeO4 and H2O) and the product (FeOOH). The mechanism for the formation of a hollow structure was carefully investigated, which involves the synergetic effect of the surfactant CTAB and the side product KOH. Having outstanding biocompatibility, these degradable nanocolloids also demonstrate their feasibility in in vitro/vivo MR imaging and in vitro drug delivery.The combination of a hollow mesoporous structure and a magnetic resonance (MR) contrast agent has shown its potential in simultaneous drug delivery and cell tracking applications. However, the preparation of this kind of nanocomposite is complicated and usually takes several days, which is unsuitable for scaled-up production. To overcome these hurdles, we report herein a facile method to synthesize iron oxide hydroxide functionalized hollow mesoporous silica spheres (FeOOH/HMSS) in a one-step manner. By carefully controlling the reaction kinetics of K2FeO4 in water, the gram-scale production of FeOOH/HMSS can be readily achieved at 60 °C for as short as 30 min. Most importantly, this synthetic process is also cost-effective and eco-friendly in both the precursor (K2FeO4 and H2O) and the product (FeOOH). The mechanism for the formation of a

  6. Mesoporous-Silica-Functionalized Nanoparticles for Drug Delivery.


    Giret, Simon; Wong Chi Man, Michel; Carcel, Carole


    The ever-growing interest for finding efficient and reliable methods for treatment of diseases has set a precedent for the design and synthesis of new functional hybrid materials, namely porous nanoparticles, for controlled drug delivery. Mesoporous silica nanoparticles (MSNPs) represent one of the most promising nanocarriers for drug delivery as they possess interesting chemical and physical properties, thermal and mechanical stabilities, and are biocompatibile. In particular, their easily functionalizable surface allows a large number of property modifications further improving their efficiency in this field. This Concept article deals with the advances on the novel methods of functionalizing MSNPs, inside or outside the pores, as well as within the walls, to produce efficient and smart drug carriers for therapy. PMID:26250991

  7. Improved gene transfer with histidine-functionalized mesoporous silica nanoparticles.


    Brevet, David; Hocine, Ouahiba; Delalande, Anthony; Raehm, Laurence; Charnay, Clarence; Midoux, Patrick; Durand, Jean-Olivier; Pichon, Chantal


    Mesoporous silica nanoparticles (MSN) were functionalized with aminopropyltriethoxysilane (MSN-NH2) then L-histidine (MSN-His) for pDNA delivery in cells and in vivo. The complexation of pDNA with MSN-NH2 and MSN-His was first studied with gel shift assay. pDNA complexed with MSN-His was better protected from DNase degradation than with MSN-NH2. An improvement of the transfection efficiency in cells was observed with MSN-His/pDNA compared to MSN-NH2/pDNA, which could be explained by a better internalization of MSN-His. The improvement of the transfection efficiency with MSN-His was also observed for gene transfer in Achilles tendons in vivo. PMID:24853464

  8. Silicalites and Mesoporous Silica Nanoparticles for photodynamic therapy.


    Hocine, Ouahiba; Gary-Bobo, Magali; Brevet, David; Maynadier, Marie; Fontanel, Simon; Raehm, Laurence; Richeter, Sébastien; Loock, Bernard; Couleaud, Pierre; Frochot, Céline; Charnay, Clarence; Derrien, Gaëlle; Smaïhi, Monique; Sahmoune, Amar; Morère, Alain; Maillard, Philippe; Garcia, Marcel; Durand, Jean-Olivier


    The synthesis of silicalites and Mesoporous Silica Nanoparticles (MSN), which covalently incorporate original water-soluble photosensitizers for PDT applications is described. PDT was performed on MDA-MB-231 breast cancer cells. All the nanoparticles showed significant cell death after irradiation, which was not correlated with (1)O(2) quantum yield of the nanoparticles. Other parameters are involved and in particular the surface and shape of the nanoparticles which influence the pathway of endocytosis. Functionalization with mannose was necessary to obtain the best results with PDT due to an active endocytosis of mannose-functionalized nanoparticles. The quantity of mannose on the surface should be carefully adjusted as a too high amount of mannose impairs the phototoxicity of the nanoparticles. Fluorescein was also encapsulated in MCM-41 type MSN in order to localize the nanoparticles in the organelles of the cells by confocal microscopy. The MSN were localized in lysosomes after active endocytosis by mannose receptors. PMID:20934496

  9. Mesoporous silica nanoparticles in tissue engineering--a perspective.


    Rosenholm, Jessica Maria; Zhang, Jixi; Linden, Mika; Sahlgren, Cecilia


    In this review, we summarize the latest developments and give a perspective on future applications of mesoporous silica nanoparticles (MSNs) in regenerative medicine. MSNs constitute a flexible platform for controlled delivery of drugs and imaging agents in tissue engineering and stem cell therapy. We highlight the recent advances in applying MSNs for controlled drug delivery and stem cell tracking. We touch upon novel functions of MSNs in real time imaging of drug release and biological function, and as tools to control the chemical and mechanical environment of stem cells. We discuss the need for novel model systems for studying biofunctionality and biocompatibility of MSNs, and how the interdisciplinary activities within the field will advance biotechnology research. PMID:26784861

  10. Porous thin films of functionalized mesoporous silica nanoparticles.


    Kobler, Johannes; Bein, Thomas


    The synthesis of extremely small mesoporous silica nanoparticles via a specific co-condensation process with phenyl groups is demonstrated. The suspensions are ideally suited for the production of nanoscale thin films by spin-coating. Thanks to the small particle size and the resulting low surface roughness, the films show excellent optical qualities and exhibit good diffusion properties and a highly accessible pore system. The availability of such homogeneous porous thin films made it possible to use ellipsometric porosimetry (EP) as a convenient method to determine the effective porosity of the films on their original support without destroying it. It was possible to record sorption isotherms of the thin films with ellipsometry and to correlate the data with nitrogen sorption data of dried powders of the same material. The thin films showed very low refractive indices of around 1.2. PMID:19206399

  11. Breakable mesoporous silica nanoparticles for targeted drug delivery.


    Maggini, Laura; Cabrera, Ingrid; Ruiz-Carretero, Amparo; Prasetyanto, Eko A; Robinet, Eric; De Cola, Luisa


    "Pop goes the particle". Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery. PMID:26974603

  12. Hollow mesoporous silica nanoparticles for intracellular delivery of fluorescent dye

    PubMed Central


    In this study, hollow mesoporous silica nanoparticles (HMSNs) were synthesized using the sol-gel/emulsion approach and its potential application in drug delivery was assessed. The HMSNs were characterized, by transmission electron microscopy (TEM), Scanning Electron Microscopy (SEM), nitrogen adsorption/desorption and Brunauer-Emmett-Teller (BET), to have a mesoporous layer on its surface, with an average pore diameter of about 2 nm and a surface area of 880 m2/g. Fluorescein isothiocyanate (FITC) loaded into these HMSNs was used as a model platform to assess its efficacy as a drug delivery tool. Its release kinetic study revealed a sequential release of FITC from the HMSNs for over a period of one week when soaked in inorganic solution, while a burst release kinetic of the dye was observed just within a few hours of soaking in organic solution. These FITC-loaded HMSNs was also found capable to be internalized by live human cervical cancer cells (HeLa), wherein it was quickly released into the cytoplasm within a short period of time after intracellular uptake. We envision that these HMSNs, with large pores and high efficacy to adsorb chemicals such as the fluorescent dye FITC, could serve as a delivery vehicle for controlled release of chemicals administered into live cells, opening potential to a diverse range of applications including drug storage and release as well as metabolic manipulation of cells. PMID:21208421

  13. Ionic liquid decorated mesoporous silica nanoparticles: a new high-performance hybrid electrolyte for lithium batteries.


    Li, Yang; Wong, Ka-Wai; Ng, Ka-Ming


    We report a novel hybrid electrolyte based on mesoporous silica nanoparticles decorated with an ionic liquid, which exhibits a superior lithium ion transference number of >0.8, and an excellent electrochemical window of >5 V with attractive ionic conductivity. The insights obtained pave a new way for the preparation of high-performance electrolytes with mesoporous structures. PMID:26926805

  14. Ultrasound assisted morphological control of mesoporous silica with improved lysozyme adsorption.


    Sun, Shumin; Wang, Shen; Wang, Peiyuan; Wu, Qiong; Fang, Shaoming


    The morphological control of mesoporous silica without any additives has attracted much attention. Discrete rod-like and string-of-beads like mesoporous SBA-15 can be achieved under ultrasound irradiation without changing the composition of synthesis system. The smaller particles of SBA-15 showed improved lysozyme immobilization capacity and higher adsorption rate over conventional rope-like SBA-15. PMID:25150609

  15. Breakable mesoporous silica nanoparticles for targeted drug delivery

    NASA Astrophysics Data System (ADS)

    Maggini, Laura; Cabrera, Ingrid; Ruiz-Carretero, Amparo; Prasetyanto, Eko A.; Robinet, Eric; de Cola, Luisa


    ``Pop goes the particle''. Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery.``Pop goes the particle''. Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery. Electronic supplementary information (ESI) available: Full experimental procedures, additional SEM and TEM images of particles, complete UV-Vis and PL-monitored characterization of the breakdown of

  16. Structure and Luminescence Properties of Eu3+-Doped Cubic Mesoporous Silica Thin Films

    PubMed Central


    Eu3+ ions-doped cubic mesoporous silica thin films with a thickness of about 205 nm were prepared on silicon and glass substrates using triblock copolymer as a structure-directing agent using sol–gel spin-coating and calcination processes. X-ray diffraction and transmission electron microscopy analysis show that the mesoporous silica thin films have a highly ordered body-centered cubic mesoporous structure. High Eu3+ ion loading and high temperature calcination do not destroy the ordered cubic mesoporous structure of the mesoporous silica thin films. Photoluminescence spectra show two characteristic emission peaks corresponding to the transitions of5D0-7F1 and 5D0-7F2 of Eu3+ ions located in low symmetry sites in mesoporous silica thin films. With the Eu/Si molar ratio increasing to 3.41%, the luminescence intensity of the Eu3+ ions-doped mesoporous silica thin films increases linearly with increasing Eu3+ concentration. PMID:20672132

  17. A cationic surfactant assisted selective etching strategy to hollow mesoporous silica spheres.


    Fang, Xiaoliang; Chen, Cheng; Liu, Zhaohui; Liu, Pengxin; Zheng, Nanfeng


    Hollow mesoporous silica spheres have recently attracted increasing attention. However, effective synthesis of uniform hollow mesoporous spheres with controllable well-defined pore structures for fundamental research and practical applications has remained a significant challenge. In this work, a straightforward and effective "cationic surfactant assisted selective etching" synthetic strategy was developed for the preparation of high-quality hollow mesoporous silica spheres with either wormhole-like or oriented mesoporous shell. The as-prepared hollow mesoporous silica spheres have large surface area, high pore volume, and controllable structure parameters. Our experiments demonstrated that cationic surfactant plays critical roles in forming the hollow mesoporous structure. A formation mechanism involving the etching of solid SiO(2) accelerated by cationic surfactant followed by the redeposition of dissolved silica species directed by cationic surfactant is proposed. Furthermore, the strategy can be extended as a general strategy to transform silica-coated composite materials into yolk-shell structures with either wormhole-like or oriented mesoporous shell. PMID:21305093

  18. Carboxylic acid-grafted mesoporous material and its high catalytic activity in one-pot three-component coupling reaction

    SciTech Connect

    Gomes, Ruth; Bhaumik, Asim; Dutta, Saikat


    A new carboxylic acid functionalized mesoporous organic polymer has been synthesized via in situ radical polymerization of divinylbenzene and acrylic acid using a mesoporous silica as a seed during the polymerization process under solvothermal conditions. The mesoporous material MPDVAA-1 has been thoroughly characterized employing powder XRD, solid state {sup 13}C cross polarization magic angle spinning-nuclear magnetic resonance, FT-IR spectroscopy, N{sub 2} sorption, HR-TEM, and NH{sub 3} temperature programmed desorption-thermal conductivity detector (TPD-TCD) analysis to understand its porosity, chemical environment, bonding, and surface properties. The mesoporous polymer was used as a catalyst for a three comp onent Biginelli condensation between various aldehydes, β-keto esters, and urea/thioureas to give 3,4-dihydropyrimidine-2(1H)-ones. The reactions were carried out under conventional heating as well as solvent-free microwave irradiation of solid components, and in both the cases, the mesoporous polymer MPDVAA-1 proved to be a powerful, robust, and reusable catalyst with high catalytic efficiency.

  19. Carboxylic acid-grafted mesoporous material and its high catalytic activity in one-pot three-component coupling reaction

    NASA Astrophysics Data System (ADS)

    Gomes, Ruth; Dutta, Saikat; Bhaumik, Asim


    A new carboxylic acid functionalized mesoporous organic polymer has been synthesized via in situ radical polymerization of divinylbenzene and acrylic acid using a mesoporous silica as a seed during the polymerization process under solvothermal conditions. The mesoporous material MPDVAA-1 has been thoroughly characterized employing powder XRD, solid state 13C cross polarization magic angle spinning-nuclear magnetic resonance, FT-IR spectroscopy, N2 sorption, HR-TEM, and NH3 temperature programmed desorption-thermal conductivity detector (TPD-TCD) analysis to understand its porosity, chemical environment, bonding, and surface properties. The mesoporous polymer was used as a catalyst for a three comp onent Biginelli condensation between various aldehydes, β-keto esters, and urea/thioureas to give 3,4-dihydropyrimidine-2(1H)-ones. The reactions were carried out under conventional heating as well as solvent-free microwave irradiation of solid components, and in both the cases, the mesoporous polymer MPDVAA-1 proved to be a powerful, robust, and reusable catalyst with high catalytic efficiency.

  20. Membrane interactions of mesoporous silica nanoparticles as carriers of antimicrobial peptides.


    Braun, Katharina; Pochert, Alexander; Lindén, Mika; Davoudi, Mina; Schmidtchen, Artur; Nordström, Randi; Malmsten, Martin


    Membrane interactions are critical for the successful use of mesoporous silica nanoparticles as delivery systems for antimicrobial peptides (AMPs). In order to elucidate these, we here investigate effects of nanoparticle charge and porosity on AMP loading and release, as well as consequences of this for membrane interactions and antimicrobial effects. Anionic mesoporous silica particles were found to incorporate considerable amounts of the cationic AMP [LL-37, 37 aa] (LL-37), whereas loading is much lower for non-porous or positively charged silica nanoparticles. Due to preferential pore localization, anionic mesoporous particles, but not the other particles, protect LL-37 from degradation by infection-related proteases. For anionic mesoporous nanoparticles, membrane disruption is mediated almost exclusively by peptide release. In contrast, non-porous silica particles build up a resilient LL-37 surface coating due to their higher negative surface charge, and display largely particle-mediated membrane interactions and antimicrobial effects. For positively charged mesoporous silica nanoparticles, LL-37 incorporation promotes the membrane binding and disruption displayed by the particles in the absence of peptide, but also causes toxicity against human erythrocytes. Thus, the use of mesoporous silica nanoparticles as AMP delivery systems requires consideration of membrane interactions and selectivity of both free peptide and the peptide-loaded nanoparticles, the latter critically dependent on nanoparticle properties. PMID:27174622

  1. High performance of phosphonate-functionalized mesoporous silica for U(VI) sorption from aqueous solution.


    Yuan, Li-Yong; Liu, Ya-Lan; Shi, Wei-Qun; Lv, Yu-Long; Lan, Jian-Hui; Zhao, Yu-Liang; Chai, Zhi-Fang


    The renaissance of nuclear energy promotes increasing basic research on the separation and enrichment of nuclear fuel associated radionuclides. Herein, we report the first study for developing mesoporous silica functionalized with phosphonate (NP10) as a sorbent for U(VI) sorption from aqueous solution. The mesoporous silica was synthesized by co-condensation of diethylphosphatoethyltriethoxysilane (DPTS) and tetraethoxysilane (TEOS), using cationic surfactant cetyltrimethylammonium bromide (CTAB) as the template. The synthesized silica nanoparticles were observed to possess a mesoporous structure with a uniform pore diameter of 2.7 nm, and to have good stability and high efficiency for U(VI) sorption from aqueous solution. A maximum sorption capacity of 303 mg g(-1) and fast equilibrium time of 30 min were achieved under near neutral conditions at room temperature. The adsorbed U(VI) can be easily desorbed by using 0.1 mol L(-1) HNO(3), and the reclaimed mesoporous silica can be reused with no decrease of sorption capacity. In addition, the preconcentration of U(VI) from a 100 mL aqueous solution using the functionalized mesoporous silica was also studied. The preconcentration factor was found to be as high as 100, suggesting the vast opportunities of this kind of mesoporous silica for the solid-phase extraction and enrichment of U(VI). PMID:21681327

  2. Synthesis, characterization and catalytic activity of carbon-silica hybrid catalyst from rice straw

    NASA Astrophysics Data System (ADS)

    Janaun, J.; Safie, N. N.; Siambun, N. J.


    The hybrid-carbon catalyst has been studied because of its promising potential to have high porosity and surface area to be used in biodiesel production. Silica has been used as the support to produce hybrid carbon catalyst due to its mesoporous structure and high surface area properties. The chemical synthesis of silica-carbon hybrid is expensive and involves more complicated preparation steps. The presence of natural silica in rice plants especially rice husk has received much attention in research because of the potential as a source for solid acid catalyst synthesis. But study on rice straw, which is available abundantly as agricultural waste is limited. In this study, rice straw undergone pyrolysis and functionalized using fuming sulphuric acid to anchor -SO3H groups. The presence of silica and the physiochemical properties of the catalyst produced were studied before and after sulphonation. The catalytic activity of hybrid carbon silica acid catalyst, (H-CSAC) in esterification of oleic acid with methanol was also studied. The results showed the presence of silica-carbon which had amorphous structure and highly porous. The carbon surface consisted of higher silica composition, had lower S element detected as compared to the surface that had high carbon content but lower silica composition. This was likely due to the fact that Si element which was bonded to oxygen was highly stable and unlikely to break the bond and react with -SO3H ions. H-CSAC conversions were 23.04 %, 35.52 % and 34.2 7% at 333.15 K, 343.15 K and 353.15 K, respectively. From this research, rice straw can be used as carbon precursor to produce hybrid carbon-silica catalyst and has shown catalytic activity in biodiesel production. Rate equation obtained is also presented.

  3. A novel enzyme-mimic nanosensor based on quantum dot-Au nanoparticle@silica mesoporous microsphere for the detection of glucose.


    Li, Yang; Ma, Qiang; Liu, Ziping; Wang, Xinyan; Su, Xingguang


    QD-Au NP@silica mesoporous microspheres have been fabricated as a novel enzyme-mimic nanosensor. CdTe quantum dots (QDs) were loaded into the core, and Au nanoparticles (NPs) were encapsulated in the outer mesoporous shell. QDs and Au NPs were separated in the different space of the nanosensor, which prevent the potential energy or electron transfer process between QDs and Au NPs. As biomimetic catalyst, Au NPs in the mesoporous silica shell can catalytically oxidize glucose as glucose oxidase (GOx)-mimicking. The resultant hydrogen peroxide can quench the photoluminescence (PL) signal of QDs in the microsphere core. Therefore the nanosensor based on the decrease of the PL intensity of QDs was established for the glucose detection. The linear range for glucose was in the range of 5-200 μM with a detection limit (3σ) of 1.32 μM. PMID:25086895

  4. Mechanical Stability of Templated Mesoporous Silica Thin Films

    SciTech Connect

    Williford, Rick E.; Li, Xiaohong S.; Addleman, Raymond S.; Fryxell, Glen E.; Baskaran, Suresh; Birnbaum, Jerome C.; Coyle, Christopher A.; Zemanian, Thomas S.; Wang, Chong M.; Courtney, Andrea R.


    Mesoporous silica thin films about 1 micron thick were prepared by spin casting using several organic templates that provide a range of pore structures from disordered (sponge-like) to more ordered (honeycomb-like) 2D hexagonal arrays. Nanoindentation measurements indicate that the elastic modulus (E), and thus the density, of the pore wall material are substantially lower than for fused silica. The corresponding lower dielectric constant for pore walls was used to calculate film porosities (P) with recent correlations from the literature. Curve fits to the standard modulus vs. porosity correlation, E/Eporewall=(1-P)n, for the films gave lower n=2.2 for the honeycomb-like film with higher E, but higher n=2.5 for the sponge-like film with lower E, in contrast to theoretical expectations (n=2 for sponge-like and n=3 for honeycomb-like). Although the dielectric constant depends primarily on first-order structural information (P), the elastic modulus of these structurally imperfect films required second-order (pore wall thickness/diameter ratio) and third-order (pore connectivity) parameters to resolve the data. The power law exponent n can vary continuously, depending on the details of the mesostructure, and should not be assumed a' priori unless justified by detailed structural information

  5. Preparation of Mesoporous Silica Templated Metal Nanowire Films on Foamed Nickel Substrates

    SciTech Connect

    Campbell, Roger; Kenik, Edward A; Bakker, Martin; Havrilla, George; Montoya, Velma; Shamsuzzoha, Mohammed


    A method has been developed for the formation of high surface area nanowire films on planar and three-dimensional metal electrodes. These nanowire films are formed via electrodeposition into a mesoporous silica film. The mesoporous silica films are formed by a sol-gel process using Pluronic tri-block copolymers to template mesopore formation on both planar and three-dimensional metal electrodes. Surface area increases of up to 120-fold have been observed in electrodes containing a templated film when compared to the same types of electrodes without the templated film.

  6. N-doped mesoporous carbons supported palladium catalysts prepared from chitosan/silica/palladium gel beads.


    Zeng, Minfeng; Wang, Yudong; Liu, Qi; Yuan, Xia; Feng, Ruokun; Yang, Zhen; Qi, Chenze


    In this study, a heterogeneous catalyst including palladium nanoparticles supported on nitrogen-doped mesoporous carbon (Pd@N-C) is synthesized from palladium salts as palladium precursor, colloidal silica as template, and chitosan as carbon source. N2 sorption isotherm results show that the prepared Pd@N-C had a high BET surface area (640m(2)g(-1)) with large porosity. The prepared Pd@N-C is high nitrogen-rich as characterized with element analysis. X-ray photoelectron spectroscopy (XPS), high-resolution transmission electron microscopy (HR-TEM), and Raman spectroscopy characterization of the catalyst shows that the palladium species with different chemical states are well dispersed on the nitrogen-containing mesoporous carbon. The Pd@N-C is high active and shows excellent stability as applied in Heck coupling reactions. This work supplies a successful method to prepare Pd heterogeneous catalysts with high performance from bulk biopolymer/Pd to high porous nitrogen-doped carbon supported palladium catalytic materials. PMID:27155234

  7. Post-treatment and characterization of novel luminescent hybrid bimodal mesoporous silicas

    SciTech Connect

    Li Yuzhen; Sun Jihong; Wu Xia; Lin Li; Gao Lin


    A novel luminescent hybrid bimodal mesoporous silicas (LHBMS) were synthesized via grafting 1,8-Naphthalic anhydride into the pore channels of bimodal mesoporous silicas (BMMs) for the first time. The resulting samples were characterized by powder X-ray diffraction (XRD), N{sub 2} adsorption/desorption measurement, Fourier transform infrared spectroscopy (FT-IR), Transmission electron microscopy (TEM), UV-vis absorption spectroscopy, and Photoluminescence spectroscopy (PL). The results show that 1,8-Naphthalic anhydride organic groups have been successfully introduced into the mesopores of the BMMs and the hybrid silicas are of bimodal mesoporous structure with the ordered small mesopores of around 3 nm and the large mesopores of uniform intra-nanoparticle. The excellent photoluminescent performance of LHBMS has a blue shift compared to that of 2-[3-(triethoxysilyl) propyl-1 H-Benz [de]isoquinoline-1, 3(2 H)-dione, suggesting the existence of the quantum confinement effectiveness. - Graphical abstract: A novel luminescent hybrid bimodal mesoporous silicas was synthesized via modification and then grafting with 1, 8-Naphthalic anhydride, which would be strong potential application in the photoluminescent fields.

  8. A reconstruction strategy to synthesize mesoporous SAPO molecular sieve single crystals with high MTO catalytic activity.


    Wang, Chan; Yang, Miao; Li, Mingrun; Xu, Shutao; Yang, Yue; Tian, Peng; Liu, Zhongmin


    Mesoporous SAPO-34 single crystals with tunable porosity and Si content have been fast synthesized within 4 hours by a reconstruction strategy, which show excellent hydrothermal stability and MTO catalytic activity. This new strategy is further proven to be applicable to prepare other mesoporous SAPO molecular sieve single crystals. PMID:27101359

  9. Surface functionalized mesoporous silica nanoparticles for intracellular drug delivery

    NASA Astrophysics Data System (ADS)

    Vivero-Escoto, Juan Luis

    Mesoporous silica nanoparticles (MSNs) are a highly promising platform for intracellular controlled release of drugs and biomolecules. Despite that the application of MSNs in the field of intracellular drug delivery is still at its infancy very exciting breakthroughs have been achieved in the last years. A general review of the most recent progress in this area of research is presented, including a description of the latest findings on the pathways of entry into live mammalian cells together with the intracellular trafficking, a summary on the contribution of MSNs to the development of site-specific drug delivery systems, a report on the biocompatibility of this material in vitro andin vivo, and a discussion on the most recent breakthroughs in the synthesis and application of stimuli-responsive mesoporous silica-based delivery vehicles. A gold nanoparticles (AuNPs)-capped MSNs-based intracellular photoinduced drug delivery system (PR-AuNPs-MSNs) for the controlled release of anticancer drug inside of human fibroblast and liver cells was synthesized and characterized. We found that the mesoporous channels of MSNs could be efficiently capped by the photoresponsive AuNPs without leaking the toxic drug, paclitaxel, inside of human cells. Furthermore, we demonstrated that the cargo-release property of this PR-AuNPs-MSNs system could be easily photo-controlled under mild and biocompatible conditions in vitro. In collaboration with Renato Mortera (a visiting student from Italy), a MSNs based intracellular delivery system for controlled release of cell membrane impermeable cysteine was developed. A large amount of cysteine molecules were covalently attached to the silica surface of MSNs through cleavable disulfide linkers. These cysteine-containing nanoparticles were efficiently endocytosed by human cervical cancer cells HeLa. These materials exhibit 450 times higher cell growth inhibition capability than that of the conventional N-acetylcysteine prodrug. The ability to

  10. Synthesis and microwave absorbing properties of FeNi alloy incorporated ordered mesoporous carbon-silica nanocomposite

    NASA Astrophysics Data System (ADS)

    Li, Guoxian; Guo, Yunxia; Sun, Xin; Wang, Tao; Zhou, Jianhua; He, Jianping


    Ordered mesoporous carbon-silica/FeNi nanocomposite were prepared by a sol-gel method and following sintering process. The electromagnetic parameters were measured in the 0.5-18 GHz range. Compared with ordered mesoporous carbon-silica composite, the permittivity of ordered mesoporous carbon-silica/FeNi nanocomposite decreases, while the permeability almost remains unchanged. The optimal reflection loss of ordered mesoporous carbon-silica/FeNi nanocomposite can reach -45.6 dB at 11.1 GHz for a layer thickness of 3.0 mm. The enhanced microwave absorption of the mesoporous carbon-silica/FeNi nanocomposite is due to better balance between the complex permittivity and permeability, geometrical effect, as well as multiple reflections by the ordered mesoporous structure.

  11. Curcumin loaded mesoporous silica: an effective drug delivery system for cancer treatment.


    Kotcherlakota, Rajesh; Barui, Ayan Kumar; Prashar, Sanjiv; Fajardo, Mariano; Briones, David; Rodríguez-Diéguez, Antonio; Patra, Chitta Ranjan; Gómez-Ruiz, Santiago


    In the present study, we report the delivery of anti-cancer drug curcumin to cancer cells using mesoporous silica materials. A series of mesoporous silica material based drug delivery systems (S2, S4 and S6) were first designed and developed through the amine functionalization of KIT-6, MSU-2 and MCM-41 followed by the loading of curcumin. The curcumin loaded materials were characterized with several physico-chemical techniques and thoroughly screened on cancer cells to evaluate their in vitro drug delivery efficacy. All the curcumin loaded silica materials exhibited higher cellular uptake and inhibition of cancer cell viability compared to pristine curcumin. The effective internalization of curcumin in cancer cells through the mesoporous silica materials initiated the generation of intracellular reactive oxygen species and the down regulation of poly ADP ribose polymerase (PARP) enzyme levels compared to free curcumin leading to the activation of apoptosis. This study shows that the anti-cancer activity of curcumin can be potentiated by loading onto mesoporous silica materials. Therefore, we strongly believe that mesoporous silica based curcumin loaded drug delivery systems may have future potential applications for the treatment of cancers. PMID:26674254

  12. A reversible light-operated nanovalve on mesoporous silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Tarn, Derrick; Ferris, Daniel P.; Barnes, Jonathan C.; Ambrogio, Michael W.; Stoddart, J. Fraser; Zink, Jeffrey I.


    Two azobenzene α-cyclodextrin based nanovalves are designed, synthesized and assembled on mesoporous silica nanoparticles. Under aqueous conditions, the cyclodextrin cap is tightly bound to the azobenzene moiety and capable of holding back loaded cargo molecules. Upon irradiation with a near-UV light laser, trans to cis-photoisomerization of azobenzene initiates a dethreading process, which causes the cyclodextrin cap to unbind followed by the release of cargo. The addition of a bulky stopper to the end of the stalk allows this design to be reversible; complete dethreading of cyclodextrin as a result of unbinding with azobenzene is prevented as a consequence of steric interference. As a result, thermal relaxation of cis- to trans-azobenzene allows for the rebinding of cyclodextrin and resealing of the nanopores, a process which entraps the remaining cargo. Two stalks were designed with different lengths and tested with alizarin red S and propidium iodide. No cargo release was observed prior to light irradiation, and the system was capable of multiuse. On/off control was also demonstrated by monitoring the release of cargo when the light stimulus was applied and removed, respectively.Two azobenzene α-cyclodextrin based nanovalves are designed, synthesized and assembled on mesoporous silica nanoparticles. Under aqueous conditions, the cyclodextrin cap is tightly bound to the azobenzene moiety and capable of holding back loaded cargo molecules. Upon irradiation with a near-UV light laser, trans to cis-photoisomerization of azobenzene initiates a dethreading process, which causes the cyclodextrin cap to unbind followed by the release of cargo. The addition of a bulky stopper to the end of the stalk allows this design to be reversible; complete dethreading of cyclodextrin as a result of unbinding with azobenzene is prevented as a consequence of steric interference. As a result, thermal relaxation of cis- to trans-azobenzene allows for the rebinding of cyclodextrin and

  13. Well-Dispersed ZIF-Derived Co,N-Co-doped Carbon Nanoframes through Mesoporous-Silica-Protected Calcination as Efficient Oxygen Reduction Electrocatalysts.


    Shang, Lu; Yu, Huijun; Huang, Xing; Bian, Tong; Shi, Run; Zhao, Yufei; Waterhouse, Geoffrey I N; Wu, Li-Zhu; Tung, Chen-Ho; Zhang, Tierui


    A well-dispersed Co,N co-doped carbon nanoframework (Co,N-CNF) with hierarchically porous structure is successfully synthesized from zeolitic imidazolate framework (ZIF) precursors via a mesoporous-silica-protected calcination strategy. By preventing the irreversible fusion and aggregation during the high-temperature pyrolysis step with this protection strategy, the Co,N-CNF exhibits comparable oxygen reduction reaction (ORR) catalytic activity to that of commercial Pt catalysts with the same loading. PMID:26677131

  14. Bio-templated synthesis of highly ordered macro-mesoporous silica material for sustained drug delivery

    NASA Astrophysics Data System (ADS)

    Qu, Fengyu; Lin, Huiming; Wu, Xiang; Li, Xiaofeng; Qiu, Shilun; Zhu, Guangshan


    The bimodal porous structured silica materials consisting of macropores with the diameter of 5-20 μm and framework-like mesopores with the diameter of 4.7-6.0 nm were prepared using natural Manchurian ash and mango linin as macropored hard templates and P123 as mesopore soft templates, respectively. The macroporous structures of Manchurian ash and mango linin were replicated with the walls containing highly ordered mesoporous silica as well. As-synthesized dual porous silica was characterized by scanning electron microscope (SEM), powder X-ray diffraction (XRD), transmission electron microscope (TEM) and nitrogen adsorption/desorption, fourier transform IR (FTIR) spectroscopy, and thermo-gravimetric analyzer (TGA). Ibuprofen (Ibu) was employed as a model drug and the release profiles showed that the dual porous material had a sustained drug delivery capability. And such highly ordered dual pore silica materials may have potential applications for bimolecular adsorption/separation and tissue repairing.

  15. Label-Free Luminescent Mesoporous Silica Nanoparticles for Imaging and Drug Delivery

    PubMed Central

    Chen, Hongmin; Zhen, Zipeng; Tang, Wei; Todd, Trever; Chuang, Yen-Jun; Wang, Lianchun; Pan, Zhengwei; Xie, Jin


    We report herein a straightforward and label-free approach to prepare luminescent mesoporous silica nanoparticles. We found that calcination at 400 °C can grant mesoporous organosilica nanoparticles with strong fluorescence of great photo- and chemical stability. The luminescence is found to originate from the carbon dots generated from the calcination, rather than the defects in the silica matrix as was believed previously. The calcination does not impact the particles' abilities to load drugs and conjugate to biomolecules. In a proof-of-concept study, we demonstrated that doxorubicin (Dox) can be efficiently encapsulated into these fluorescent mesoporous silica nanoparticles. After coupled to c(RGDyK), the nanoconjugates can efficiently home to tumors through interactions with integrin αvβ3 overexpressed on the tumor vasculature. This calcination-induced luminescence is expected to find wide applications in silica-based drug delivery, nanoparticle coating, and immunofluorescence imaging. PMID:24052805

  16. Mixed surfactants-directed the mesoporous silica materials with various morphologies and structures

    SciTech Connect

    Lin Huiming; Qu Fengyu; Wu Xiang; Xue Ming; Zhu Guangshan; Qiu Shilun


    A new mixed surfactants system using alkyl carboxylic acids and quaternized poly[bis(2-chloroethyl)ether-alt-1,3-bis[3-(dimethylamino)propyl] urea] (PEPU) as the co-template was used to synthesize mesoporous silica materials with various morphologies and structures, including flakes, regular spheres, nanoparticles, and tube-spheres. The cationic polymer connected the anionic surfactant micelle to the anionic polysilicate species to induce the synthesis of the mesoporous silica materials. The structure and property of the surfactant and the cationic polymer determined the formation of mesoporous silica, and also had a signification influence on the morphology and structure of the final materials. To further explore the possible formation mechanism of these mesoporous materials, zeta potential was utilized to evaluate the interaction between the anionic surfactant and the cationic co-template. In addition, the structure, morphology, and porosity of these materials were characterized by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and N{sub 2} adsorption-desorption measurements. - Graphical abstract: A new mixed surfactants system using alkyl carboxylic acids and PEPU as the co-template was used to synthesize mesoporous silica materials with various morphologies and structures. Highlights: {yields}A new mixed surfactants system induced the mesoporous silica materials with various morphologies and structure. > It is a development of the type S{sup -}N{sup +}I{sup -} route of the mesoporous formation. > Zeta potential was utilized to evaluate the interaction between the anionic surfactant and the cationic co-template. > The property and amount of surfactant and polymer determined the formation of the mesoporous materials.

  17. Protective effect of mesoporous silica particles on encapsulated folates.


    Ruiz-Rico, María; Daubenschüz, Hanna; Pérez-Esteve, Édgar; Marcos, María D; Amorós, Pedro; Martínez-Máñez, Ramón; Barat, José M


    Mesoporous silica particles (MSPs) are considered suitable supports to design gated materials for the encapsulation of bioactive molecules. Folates are essential micronutrients which are sensitive to external agents that provoke nutritional deficiencies. Folates encapsulation in MSPs to prevent degradation and to allow their controlled delivery is a promising strategy. Nevertheless, no information exists about the protective effect of MSPs encapsulation to prevent their degradation. In this work, 5-formyltetrahydrofolate (FO) and folic acid (FA) were entrapped in MSPs functionalized with polyamines, which acted as pH-dependent molecular gates. The stability of free and entrapped vitamins after acidic pH, high temperature and light exposure was studied. The results showed the degradation of FO after high temperature and acidic pH, whereas entrapped FO displayed enhanced stability. Free FA was degraded by light, but MSPs stabilized the vitamin. The obtained results point toward the potential use of MSPs as candidates to enhance stability and to improve the bioavailability of functional biomolecules. PMID:27235728

  18. Near Infrared Light-Powered Janus Mesoporous Silica Nanoparticle Motors.


    Xuan, Mingjun; Wu, Zhiguang; Shao, Jingxin; Dai, Luru; Si, Tieyan; He, Qiang


    We describe fuel-free, near-infrared (NIR)-driven Janus mesoporous silica nanoparticle motors (JMSNMs) with diameters of 50, 80, and 120 nm. The Janus structure of the JMSNMs is generated by vacuum sputtering of a 10 nm Au layer on one side of the MSNMs. Upon exposure to an NIR laser, a localized photothermal effect on the Au half-shells results in the formation of thermal gradients across the JMSNMs; thus, the generated self-thermophoresis can actively drive the nanomotors to move at an ultrafast speed, for instance, up to 950 body lengths/s for 50 nm JMSNMs under an NIR laser power of 70.3 W/cm(2). The reversible "on/off" motion of the JMSNMs and their directed movement along the light gradient can be conveniently modulated by a remote NIR laser. Moreover, dynamic light scattering measurements are performed to investigate the coexisting translational and rotational motion of the JMSNMs in the presence of both self-thermophoretic forces and strong Brownian forces. These NIR-powered nanomotors demonstrate a novel strategy for overcoming the necessity of chemical fuels and exhibit a significant improvement in the maneuverability of nanomotors while providing potential cargo transportation in a biofriendly manner. PMID:27152728

  19. Chemical Insight into the Adsorption of Chromium(III) on Iron Oxide/Mesoporous Silica Nanocomposites.


    Egodawatte, Shani; Datt, Ashish; Burns, Eric A; Larsen, Sarah C


    Magnetic iron oxide/mesoporous silica nanocomposites consisting of iron oxide nanoparticles embedded within mesoporous silica (MCM-41) and modified with aminopropyl functional groups were prepared for application to Cr(III) adsorption followed by magnetic recovery of the nanocomposite materials from aqueous solution. The composite materials were extensively characterized using physicochemical techniques, such as powder X-ray diffraction, thermogravimetric and elemental analysis, nitrogen adsorption, and zeta potential measurements. For aqueous Cr(III) at pH 5.4, the iron oxide/mesoporous silica nanocomposite exhibited a superior equilibrium adsorption capacity of 0.71 mmol/g, relative to 0.17 mmol/g for unmodified mesoporous silica. The aminopropyl-functionalized iron oxide/mesoporous silica nanocomposites displayed an equilibrium adsorption capacity of 2.08 mmol/g, the highest adsorption capacity for Cr(III) of all the materials evaluated in this study. Energy-dispersive spectroscopy (EDS) with transmission electron microscopy (TEM) and X-ray photoelectron spectroscopy (XPS) experiments provided insight into the chemical nature of the adsorbed chromium species. PMID:26134074

  20. Avidin-biotin capped mesoporous silica nanoparticles as an ion-responsive release system to determine lead(II).


    Song, Weiling; Li, Jingyu; Li, Qing; Ding, Wenyao; Yang, Xiaoyan


    We have developed DNAzyme-functionalized silica nanoparticles for the rapid, sensitive, and selective detection of lead ion (Pb(2+)). The specific binding between avidin and biotinylated DNAzymes was used to cap the pore of dye-trapped silica nanoparticles. In the presence of Pb(2+), DNAzymes were catalytically cleaved to uncap the pore, releasing the dye cargo with detectable enhancements of fluorescence signal. This method enables rapid (15 min) and sensitive (limit of detection=8.0 nM) detection. Moreover, the Pb(2+)-responsive behavior shows high selectivity with other metal ions. The superior properties of the as-designed DNAzyme-functionalized silica nanoparticles can be attributed to the large loading capacity and highly ordered pore structure of mesoporous silica nanoparticles as well as the catalytical cleaving of DNAzymes with Pb(2+). The recoveries obtained by standard Pb(II) addition to real samples-tap water, commercial mineral water, and lake water-were all from 98 to 101%. Our design serves as a new prototype for metal-ion sensing systems, and it also has promising potential for detection of various targets in stimulus-release systems. PMID:25447495

  1. Synthesis of highly-ordered mesoporous carbon/silica nanocomposites and derivative hierarchically mesoporous carbon from a phenyl-bridged organosiloxane

    NASA Astrophysics Data System (ADS)

    Wu, Zhiwang; Pang, Jiebin; Lu, Yunfeng


    Mesoporous carbon/silica nanocomposites and derivative hierarchically mesoporous carbon have been prepared using 1,4-bis(triethoxysilyl)benzene (BTEB) as a precursor for a carbon/silica network and Pluronic P123 (HO(CH2CH2O)20(CH2CH(CH3)O)70(CH2CH2O)20H) as a template for highly-ordered hexagonal pores. Co-assembly of BTEB and P123 and subsequent carbonization results in a mesoporous carbon/silica nanocomposite with hexagonally oriented pores. Removal of the silica component in the carbon/silica network creates a second porosity in the network and results in hierarchically mesoporous carbon. The mesostructure of these materials was characterized by transmission electron microscopy (TEM), field-emission scanning electron microscopy (FE-SEM), powder X-ray diffraction (PXRD), and N2 sorption.

  2. Direct imaging Au nanoparticle migration inside mesoporous silica channels.


    Liu, Zhengwang; Che, Renchao; Elzatahry, Ahmed A; Zhao, Dongyuan


    Supported metal nanoparticle (NP) catalysts have been widely used in many industry processes and catalytic reactions. Catalyst deactivation is mainly caused by the sintering of supported metal NPs. Hence, understanding the metal NPs' sintering behaviors has great significance in preventing catalyst deactivation. Here we report the metal particle migration inside/between mesochannels by scanning transmission electron microscopy and electron energy loss spectroscopy via an in situ TEM heating technique. A sintering process is proposed that particle migration predominates, driven by the difference of gravitational potential from the height of the uneven internal surface of the mesopores; when the distance of the gold nanoparticles with a size of about 3 and 5 nm becomes short after migration, the coalescence process is completed, which is driven by an "octopus-claw-like" expansion of a conduction electron cloud outside the Au NPs. The supports containing an abundance of micropores help to suppress particle migration and coalescence. Our findings provide the understanding toward the rational design of supported industrial catalysts and other nanocomposites with enhanced activity and stability for applications such as batteries, catalysis, drug delivery, gas sensors, and solar cells. PMID:25264601

  3. Magnetic properties of mesoporous cobalt-silica-alumina ternary mixed oxides

    SciTech Connect

    Pal, Nabanita; Seikh, Md. Motin; Bhaumik, Asim


    Mesoporous cobalt-silica-alumina mixed oxides with variable cobalt content have been synthesized through slow evaporation method by using Pluronic F127 non-ionic surfactant as template. N{sub 2} sorption analysis of the template-free mixed oxide samples revealed that these mesoporous materials have high BET surface areas together with large mesopores. Powder XRD, TEM, EDS, FT IR and EPR spectroscopic analysis have been employed to understand the nature of the mesophases, bonding and composition of the materials. Low temperature magnetic measurements of these mixed oxide materials show the presence of ferromagnetic correlation at elevated temperature though at low temperature paramagnetic to ferrimagnetic transition is observed. Highlights: Black-Right-Pointing-Pointer Mesoporous cobalt-silica-alumina ternary mixed oxides. Black-Right-Pointing-Pointer High surface area and mesoporosity in magnetic materials. Black-Right-Pointing-Pointer Ferromagnetic correlation at elevated temperature. Black-Right-Pointing-Pointer Low temperature paramagnetic to ferrimagnetic transition.

  4. Mesoporous silica film from a solution containing a surfactant and methods of making same


    Liu, Jun [West Richland, WA; Domansky, Karel [Cambridge, MA; Li, Xiaohong [Richland, WA; Fryxell, Glen E [Kennewick, WA; Baskaran, Suresh [Kennewick, WA; Kohler, Nathan J [Richland, WA; Thevuthasan, Suntharampillai [Kennewick, WA; Coyle, Christopher A [Richland, WA; Birnbaum, Jerome C [Richland, WA


    The present invention is a mesoporous silica film having a low dielectric constant and method of making having the steps of combining a surfactant in a silica precursor solution, spin-coating a film from this solution mixture, forming a partially hydroxylated mesoporous film, and dehydroxylating the hydroxylated film to obtain the mesoporous film. It is advantageous that the small polyoxyethylene ether surfactants used in spin-coated films as described in the present invention will result in fine pores smaller on average than about 20 nm. The resulting mesoporous film has a dielectric constant less than 3, which is stable in moist air with a specific humidity. The present invention provides a method for superior control of film thickness and thickness uniformity over a coated wafer, and films with low dielectric constant.

  5. Bimetallic Nanocatalysts in Mesoporous Silica for Hydrogen Production from Coal-Derived Fuels

    SciTech Connect

    Kuila, Debasish; Ilias, Shamsuddin


    In steam reforming reactions (SRRs) of alkanes and alcohols to produce H2, noble metals such as platinum (Pt) and palladium (Pd) are extensively used as catalyst. These metals are expensive; so, to reduce noble-metal loading, bi-metallic nanocatalysts containing non-noble metals in MCM-41 (Mobil Composition of Material No. 41, a mesoporous material) as a support material with high-surface area were synthesized using one-pot hydrothermal procedure with a surfactant such as cetyltrimethylammonium bromide (CTAB) as a template. Bi-metallic nanocatalysts of Pd-Ni and Pd-Co with varying metal loadings in MCM-41 were characterized by x-ray diffraction (XRD), N2 adsorption, and Transmission electron microscopy (TEM) techniques. The BET surface area of MCM-41 (~1000 m2/g) containing metal nanoparticles decreases with the increase in metal loading. The FTIR studies confirm strong interaction between Si-O-M (M = Pd, Ni, Co) units and successful inclusion of metal into the mesoporous silica matrix. The catalyst activities were examined in steam reforming of methanol (SRM) reactions to produce hydrogen. Reference tests using catalysts containing individual metals (Pd, Ni and Co) were also performed to investigate the effect of the bimetallic system on the catalytic behavior in the SRM reactions. The bimetallic system remarkably improves the hydrogen selectivity, methanol conversion and stability of the catalyst. The results are consistent with a synergistic behavior for the Pd-Ni-bimetallic system. The performance, durability and thermal stability of the Pd-Ni/MCM-41 and Pd-Co/MCM-41 suggest that these materials may be promising catalysts for hydrogen production from biofuels. A part of this work for synthesis and characterization of Pd-Ni-MCM-41 and its activity for SRM reactions has been published (“Development of Mesoporous Silica Encapsulated Pd-Ni Nanocatalyst for Hydrogen Production” in “Production and Purification of Ultraclean

  6. Reversible control of pore size and surface chemistry of mesoporous silica through dynamic covalent chemistry: philicity mediated catalysis

    NASA Astrophysics Data System (ADS)

    Singh, Dheeraj Kumar; Pavan Kumar, B. V. V. S.; Eswaramoorthy, M.


    Here, we report the synthesis of adaptive hybrid mesoporous silica having the ability to reconfigure its pore properties such as pore size and philicity in response to the external environment. Decyl chains were reversibly appended to the pore walls of silica through imine motifs as dynamic covalent modules to switch the pore size and philicity in response to pH. This switching of pore properties was used to gate the access of reactants to the gold nanoparticles immobilized inside the nanopores, thus enabling us to turn-on/turn-off the catalytic reaction. The use of such dynamic covalent modules to govern pore properties would enable the realization of intelligent hybrids capable of controlling many such chemical processes in response to stimuli.Here, we report the synthesis of adaptive hybrid mesoporous silica having the ability to reconfigure its pore properties such as pore size and philicity in response to the external environment. Decyl chains were reversibly appended to the pore walls of silica through imine motifs as dynamic covalent modules to switch the pore size and philicity in response to pH. This switching of pore properties was used to gate the access of reactants to the gold nanoparticles immobilized inside the nanopores, thus enabling us to turn-on/turn-off the catalytic reaction. The use of such dynamic covalent modules to govern pore properties would enable the realization of intelligent hybrids capable of controlling many such chemical processes in response to stimuli. Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr02959g

  7. Synthesis and Characterization of Mesoporous Silica Functionalized with Calix[4]arene Derivatives

    PubMed Central

    Alahmadi, Sana M.; Mohamad, Sharifah; Maah, Mohd Jamil


    This work reports a new method to covalently attach calix[4]arene derivatives onto MCM-41, using a diisocyanate as a linker. The modified mesoporous silicates were characterized by fourier transform infrared spectroscopy (FTIR), thermal analysis (TGA) and elemental analysis. The FTIR spectra and TGA analysis verified that the calix[4]arene derivates are covalently attached to the mesoporous silica. The preservation of the MCM-41 channel system was checked by X-ray diffraction and nitrogen adsorption analysis. PMID:23202977

  8. Modulation of microporous/mesoporous structures in self-templated cobalt-silica.


    Martens, Dana L; Wang, David K; Motuzas, Julius; Smart, Simon; da Costa, João C Diniz


    Finite control of pore size distributions is a highly desired attribute when producing porous materials. While many methodologies strive to produce such materials through one-pot strategies, oftentimes the pore structure requires post-treatment modification. In this study, modulation of pore size in cobalt-silica systems was investigated by a novel, non-destructive, self-templated method. These systems were produced from two cobalt-containing silica starting materials which differed by extent of condensation. These starting materials, sol (SG') and xerogel (XG'), were mixed with pure silica sol to produce materials containing 5-40 mol% Co. The resultant SG-series materials exhibited typical attributes for cobalt-silica systems: mesoporous characteristics developed at high cobalt concentrations, coinciding with Co3O4 formation; whereas, in the XG-series materials, these mesoporous characteristics were extensively suppressed. Based on an examination of the resultant materials a mechanism describing the pore size formation and modulation of the two systems was proposed. Pore size modulation in the XG-series was caused, in part, by the cobalt source acting as an autogenous template for the condensation of the silica network. These domains could be modified when wetted, allowing for the infiltration and subsequent condensation of silica oligomers into the pre-formed, mesoporous cages, leading to a reduction in the mesoporous content of the final product. PMID:25609189

  9. Modulation of microporous/mesoporous structures in self-templated cobalt-silica

    NASA Astrophysics Data System (ADS)

    Martens, Dana L.; Wang, David K.; Motuzas, Julius; Smart, Simon; da Costa, João C. Diniz


    Finite control of pore size distributions is a highly desired attribute when producing porous materials. While many methodologies strive to produce such materials through one-pot strategies, oftentimes the pore structure requires post-treatment modification. In this study, modulation of pore size in cobalt-silica systems was investigated by a novel, non-destructive, self-templated method. These systems were produced from two cobalt-containing silica starting materials which differed by extent of condensation. These starting materials, sol (SG') and xerogel (XG'), were mixed with pure silica sol to produce materials containing 5-40 mol% Co. The resultant SG-series materials exhibited typical attributes for cobalt-silica systems: mesoporous characteristics developed at high cobalt concentrations, coinciding with Co3O4 formation; whereas, in the XG-series materials, these mesoporous characteristics were extensively suppressed. Based on an examination of the resultant materials a mechanism describing the pore size formation and modulation of the two systems was proposed. Pore size modulation in the XG-series was caused, in part, by the cobalt source acting as an autogenous template for the condensation of the silica network. These domains could be modified when wetted, allowing for the infiltration and subsequent condensation of silica oligomers into the pre-formed, mesoporous cages, leading to a reduction in the mesoporous content of the final product.

  10. Modulation of microporous/mesoporous structures in self-templated cobalt-silica

    PubMed Central

    Martens, Dana L.; Wang, David K.; Motuzas, Julius; Smart, Simon; da Costa, João C. Diniz


    Finite control of pore size distributions is a highly desired attribute when producing porous materials. While many methodologies strive to produce such materials through one-pot strategies, oftentimes the pore structure requires post-treatment modification. In this study, modulation of pore size in cobalt-silica systems was investigated by a novel, non-destructive, self-templated method. These systems were produced from two cobalt-containing silica starting materials which differed by extent of condensation. These starting materials, sol (SG′) and xerogel (XG′), were mixed with pure silica sol to produce materials containing 5–40 mol% Co. The resultant SG-series materials exhibited typical attributes for cobalt-silica systems: mesoporous characteristics developed at high cobalt concentrations, coinciding with Co3O4 formation; whereas, in the XG-series materials, these mesoporous characteristics were extensively suppressed. Based on an examination of the resultant materials a mechanism describing the pore size formation and modulation of the two systems was proposed. Pore size modulation in the XG-series was caused, in part, by the cobalt source acting as an autogenous template for the condensation of the silica network. These domains could be modified when wetted, allowing for the infiltration and subsequent condensation of silica oligomers into the pre-formed, mesoporous cages, leading to a reduction in the mesoporous content of the final product. PMID:25609189

  11. Bone tissue engineering using silica-based mesoporous nanobiomaterials:Recent progress.


    Shadjou, Nasrin; Hasanzadeh, Mohammad


    Bone disorders are of significant concern due to increase in the median age of our population. It is in this context that tissue engineering has been emerging as a valid approach to the current therapies for bone regeneration/substitution. Tissue-engineered bone constructs have the potential to alleviate the demand arising from the shortage of suitable autograft and allograft materials for augmenting bone healing. Silica based mesostructured nanomaterials possessing pore sizes in the range 2-50 nm and surface reactive functionalities have elicited immense interest due to their exciting prospects in bone tissue engineering. In this review we describe application of silica-based mesoporous nanomaterials for bone tissue engineering. We summarize the preparation methods, the effect of mesopore templates and composition on the mesopore-structure characteristics, and different forms of these materials, including particles, fibers, spheres, scaffolds and composites. Also, the effect of structural and textural properties of mesoporous materials on development of new biomaterials for production of bone implants and bone cements was discussed. Also, application of different mesoporous materials on construction of manufacture 3-dimensional scaffolds for bone tissue engineering was discussed. It begins by giving the reader a brief background on tissue engineering, followed by a comprehensive description of all the relevant components of silica-based mesoporous biomaterials on bone tissue engineering, going from materials to scaffolds and from cells to tissue engineering strategies that will lead to "engineered" bone. PMID:26117771

  12. Carbon functionalized mesoporous silica-based gas sensors for indoor volatile organic compounds.


    Liu, Yupu; Chen, Junchen; Li, Wei; Shen, Dengke; Zhao, Yujuan; Pal, Manas; Yu, Haijun; Tu, Bo; Zhao, Dongyuan


    Indoor organic gaseous pollution is a global health problem, which seriously threats the health and life of human all over the world. Hence, it is important to fabricate new sensing materials with high sensitivity and efficiency for indoor volatile organic compounds. In this study, a series of ordered mesoporous silica-based nanocomposites with uniform carbon coatings on the internal surface of silica mesopore channels were synthesized through a simple template-carbonization strategy. The obtained mesoporous silica-carbon nanocomposites not only possess ordered mesostructures, high surface areas (up to ∼759m(2)g(-1)), large and tunable pore sizes (2.6-10.2nm), but also have the improved hydrophobicity and anti-interference capability to environmental humidity. The sensing performances of the mesoporous silica-carbon nanocomposites to volatile organic compounds, such as ethylbenzene, methylbenzene, benzene, methanol, acetone, formaldehyde, dichloromethane and tetrahydrofuran, were systematically investigated. The relationships between the sensing performances and their properties, including mesostructures, surface areas, pore sizes, carbon contents and surface hydrophilic/hydrophobic interactions, have been achieved. The mesoporous silica-carbon nanocomposites with hexagonal mesostructure exhibit outstanding performance at room temperature to benzene and acetone with high responses, short response (2-3s) and recovery (16-19s) time, strong anti-interference to environmental humidity, and long-term stability (less than ∼5% loss of the frequency shifts after 42days). Therefore, the obtained mesoporous silica-carbon nanocomposites have a hopeful prospect in the field of environmental air quality monitoring. PMID:27240244

  13. The intracellular controlled release from bioresponsive mesoporous silica with folate as both targeting and capping agent

    NASA Astrophysics Data System (ADS)

    Guo, Rui; Li, Le-Le; Zhao, Wen-Hua; Chen, Yu-Xi; Wang, Xiao-Zhu; Fang, Chen-Jie; Feng, Wei; Zhang, Tian-Lan; Ma, Xiang; Lu, Meng; Peng, Shi-Qi; Yan, Chun-Hua


    A smart mesoporous silica nanocarrier with intracellular controlled release is fabricated, with folic acid as dual-functional targeting and capping agent. The folate not only improves the efficiency of the nanocarrier internalized by the cancer cells, but also blocks the pores of the mesoporous silica to eliminate premature leakage of the drug. With disulfide bonds as linkers to attach the dual-functional folate within the surface of mesoporous silica, the controlled release can be triggered in the presence of reductant dithiothreitol (DTT) or glutathione (GSH). The cellular internalization via folate-receptor-mediated endocytosis and the intracellular controlled release of highly toxic anticancer drug DOX were demonstrated with an in vitro HeLa cell culture, indicating an efficient cancer-targeted drug delivery.A smart mesoporous silica nanocarrier with intracellular controlled release is fabricated, with folic acid as dual-functional targeting and capping agent. The folate not only improves the efficiency of the nanocarrier internalized by the cancer cells, but also blocks the pores of the mesoporous silica to eliminate premature leakage of the drug. With disulfide bonds as linkers to attach the dual-functional folate within the surface of mesoporous silica, the controlled release can be triggered in the presence of reductant dithiothreitol (DTT) or glutathione (GSH). The cellular internalization via folate-receptor-mediated endocytosis and the intracellular controlled release of highly toxic anticancer drug DOX were demonstrated with an in vitro HeLa cell culture, indicating an efficient cancer-targeted drug delivery. Electronic supplementary information (ESI) available: the details of XRD patterns and HRTEM images of the materials, release profile of F⊂M-F in an acidic solution, intracellular uptake measurement with flow cytometry, intracellular release measurement with confocal fluorescence microscopy, selected distance of folate derivatives. See DOI: 10

  14. Cellulose conjugated FITC-labelled mesoporous silica nanoparticles: intracellular accumulation and stimuli responsive doxorubicin release

    NASA Astrophysics Data System (ADS)

    Hakeem, Abdul; Zahid, Fouzia; Duan, Ruixue; Asif, Muhammad; Zhang, Tianchi; Zhang, Zhenyu; Cheng, Yong; Lou, Xiaoding; Xia, Fan


    Herein, we design novel cellulose conjugated mesoporous silica nanoparticle (CLS-MSP) based nanotherapeutics for stimuli responsive intracellular doxorubicin (DOX) delivery. DOX molecules are entrapped in pores of the fabricated mesoporous silica nanoparticles (MSPs) while cellulose is used as an encapsulating material through esterification on the outlet of the pores of the MSPs to avoid premature DOX release under physiological conditions. In in vitro studies, stimuli responsive DOX release is successfully achieved from DOX loaded cellulose conjugated mesoporous silica nanoparticles (DOX/CLS-MSPs) by pH and cellulase triggers. Intracellular accumulation of DOX/CLS-MSPs in human liver cancer cells (HepG2 cells) is investigated through confocal microscope magnification. Cell viability of HepG2 cells is determined as the percentage of the cells incubated with DOX/CLS-MSPs compared with that of non-incubated cells through an MTT assay.Herein, we design novel cellulose conjugated mesoporous silica nanoparticle (CLS-MSP) based nanotherapeutics for stimuli responsive intracellular doxorubicin (DOX) delivery. DOX molecules are entrapped in pores of the fabricated mesoporous silica nanoparticles (MSPs) while cellulose is used as an encapsulating material through esterification on the outlet of the pores of the MSPs to avoid premature DOX release under physiological conditions. In in vitro studies, stimuli responsive DOX release is successfully achieved from DOX loaded cellulose conjugated mesoporous silica nanoparticles (DOX/CLS-MSPs) by pH and cellulase triggers. Intracellular accumulation of DOX/CLS-MSPs in human liver cancer cells (HepG2 cells) is investigated through confocal microscope magnification. Cell viability of HepG2 cells is determined as the percentage of the cells incubated with DOX/CLS-MSPs compared with that of non-incubated cells through an MTT assay. Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr08753h

  15. Preparation, characterization and oxygen sensing properties of luminescent carbon dots assembled mesoporous silica microspheres.


    Wang, Li; Zhang, Haoran; Zhou, Xiaohua; Liu, Yingliang; Lei, Bingfu


    In this paper, our effort was focused on preparation and oxygen sensing of luminescence carbon dots (CDs) assembled hollow mesoporous silica microspheres (HMSMs) and mesoporous silica microspheres (MSMs). MSMs doped with CDs showed shorter response time and recovery time comparing with HMSMs doped with CDs. This feature can be attributed to ordered channel structure of mesoporous carrier which can promote the gas diffusion effectively. While HMSMs doped with CDs shows a higher oxygen quenching response and the degree of quenching reach 80.35%. The response time was determined to be about 7s and the emission intensities of the samples were effectively reduced as the concentration of oxygen increased. These results indicate that the system we have developed can be used for oxygen detection in wide concentration range and is especially accurate for very low oxygen concentrations. The obtained CDs grafted hollow mesoporous silica microspheres (HMSMs) and mesoporous silica microspheres (MSMs) samples appears to be a promising sensing material for environmental detection application and would also find applications in catalyst, electrode, or related fields. PMID:27309945

  16. Antibacterial Dental Composites with Chlorhexidine and Mesoporous Silica

    PubMed Central

    Zhang, J.F.; Wu, R.; Fan, Y.; Liao, S.; Wang, Y.; Wen, Z.T.; Xu, X.


    One of the leading causes for the failure of dental composite restorations is secondary caries. Effectively inhibiting cariogenic biofilms and reducing secondary caries could extend the service life of composite restorations. Dental composites releasing antibacterial agents such as chlorhexidine (CHX) have shown biofilm-inhibitory efficacy, but they usually have poor physical and mechanical properties. Herein, we present a study of a new method to encapsulate and release CHX from dental composite using mesoporous silica nanoparticles (MSNs). SBA-15 MSNs were synthesized according to a reported procedure. CHX (62.9 wt%) was encapsulated into dried MSN from 0.3 M CHX ethanol solution. The dental composites containing 0% (control), 3%, 5%, and 6.3% CHX or the same amounts of CHX entrapped in MSN (denoted as CHX@MSN) were fabricated with methacrylate monomers and silanized glass fillers (CHX or CHX@MSN + glass filler particle = 70 wt%). The monomer mixture consisted of bisphenol A glycidyl methacrylate (BisGMA), hexanediol dimethacrylate (HDDMA), ethoxylated bisphenol A dimethacrylate (EBPADMA), and urethane dimethacrylates (UEDMA) at a weight ratio of 40:30:20:10. The composites were tested for CHX release and recharge, flexural strength and modulus (at 24 hr and 1 mo), surface roughness, in vitro wear, and antibacterial activity against Streptococcus mutans and Lactobacillus casei (in both planktonic growth and biofilm formation). The results showed that the composites with CHX@MSN largely retained mechanical properties and smooth surfaces and showed controlled release of CHX over a long time. In contrast, the composites with directly mixed CHX showed reduced mechanical properties, rough surfaces, and burst release of CHX in a short time. The composites with CHX either directly mixed or in MSN showed strong inhibition to S. mutans and L. casei. This research has demonstrated the successful application of MSNs as a novel nanotechnology in dental materials to inhibit

  17. Antibacterial dental composites with chlorhexidine and mesoporous silica.


    Zhang, J F; Wu, R; Fan, Y; Liao, S; Wang, Y; Wen, Z T; Xu, X


    One of the leading causes for the failure of dental composite restorations is secondary caries. Effectively inhibiting cariogenic biofilms and reducing secondary caries could extend the service life of composite restorations. Dental composites releasing antibacterial agents such as chlorhexidine (CHX) have shown biofilm-inhibitory efficacy, but they usually have poor physical and mechanical properties. Herein, we present a study of a new method to encapsulate and release CHX from dental composite using mesoporous silica nanoparticles (MSNs). SBA-15 MSNs were synthesized according to a reported procedure. CHX (62.9 wt%) was encapsulated into dried MSN from 0.3 M CHX ethanol solution. The dental composites containing 0% (control), 3%, 5%, and 6.3% CHX or the same amounts of CHX entrapped in MSN (denoted as CHX@MSN) were fabricated with methacrylate monomers and silanized glass fillers (CHX or CHX@MSN + glass filler particle = 70 wt%). The monomer mixture consisted of bisphenol A glycidyl methacrylate (BisGMA), hexanediol dimethacrylate (HDDMA), ethoxylated bisphenol A dimethacrylate (EBPADMA), and urethane dimethacrylates (UEDMA) at a weight ratio of 40:30:20:10. The composites were tested for CHX release and recharge, flexural strength and modulus (at 24 hr and 1 mo), surface roughness, in vitro wear, and antibacterial activity against Streptococcus mutans and Lactobacillus casei (in both planktonic growth and biofilm formation). The results showed that the composites with CHX@MSN largely retained mechanical properties and smooth surfaces and showed controlled release of CHX over a long time. In contrast, the composites with directly mixed CHX showed reduced mechanical properties, rough surfaces, and burst release of CHX in a short time. The composites with CHX either directly mixed or in MSN showed strong inhibition to S. mutans and L. casei. This research has demonstrated the successful application of MSNs as a novel nanotechnology in dental materials to inhibit

  18. Targeted anticancer prodrug with mesoporous silica nanoparticles as vehicles

    NASA Astrophysics Data System (ADS)

    Fan, Jianquan; Fang, Gang; Wang, Xiaodan; Zeng, Fang; Xiang, Yufei; Wu, Shuizhu


    A targeted anticancer prodrug system was fabricated with 180 nm mesoporous silica nanoparticles (MSNs) as carriers. The anticancer drug doxorubicin (DOX) was conjugated to the particles through an acid-sensitive carboxylic hydrazone linker which is cleavable under acidic conditions. Moreover, folic acid (FA) was covalently conjugated to the particle surface as the targeting ligand for folate receptors (FRs) overexpressed in some cancer cells. The in vitro release profiles of DOX from the MSN-based prodrug systems showed a strong dependence on the environmental pH values. The fluorescent dye FITC was incorporated in the MSNs so as to trace the cellular uptake on a fluorescence microscope. Cellular uptakes by HeLa, A549 and L929 cell lines were tested for FA-conjugated MSNs and plain MSNs respectively, and a much more efficient uptake by FR-positive cancer cells (HeLa) can be achieved by conjugation of folic acid onto the particles because of the folate-receptor-mediated endocytosis. The cytotoxicities for the FA-conjugated MSN prodrug, the plain MSN prodrug and free DOX against three cell lines were determined, and the result indicates that the FA-conjugated MSN prodrug exhibits higher cytotoxicity to FR-positive cells, and reduced cytotoxicity to FR-negative cells. Thus, with 180 nm MSNs as the carriers for the prodrug system, good drug loading, selective targeting and sustained release of drug molecules within targeted cancer cells can be realized. This study may provide useful insights for designing and improving the applicability of MSNs in targeted anticancer prodrug systems.

  19. Ionic liquid-templated preparation of mesoporous silica embedded with nanocrystalline sulfated zirconia

    NASA Astrophysics Data System (ADS)

    Ward, Antony J.; Pujari, Ajit A.; Costanzo, Lorenzo; Masters, Anthony F.; Maschmeyer, Thomas


    A series of mesoporous silicas impregnated with nanocrystalline sulphated zirconia was prepared by a sol-gel process using an ionic liquid-templated route. The physicochemical properties of the mesoporous sulphated zirconia materials were studied using characterisation techniques such as inductively coupled optical emission spectroscopy, X-ray diffraction, transmission electron microscopy, energy-dispersive X-ray microanalysis, elemental analysis and X-ray photoelectron spectroscopy. Analysis of the new silicas indicates isomorphous substitution of silicon with zirconium and reveals the presence of extremely small (< 10 nm) polydispersed zirconia nanoparticles in the materials with zirconium loadings from 27.77 to 41.4 wt.%.

  20. Gravimetric chemical sensors based on silica-based mesoporous organic-inorganic hybrids.


    Xu, Jiaqiang; Zheng, Qi; Zhu, Yongheng; Lou, Huihui; Xiang, Qun; Cheng, Zhixuan


    Silica-based mesoporous organic-inorganic hybrid material modified quartz crystal microbalance (QCM) sensors have been examined for their ability to achieve highly sensitive and selective detection. Mesoporous silica SBA-15 serves as an inorganic host with large specific surface area, facilitating gas adsorption, and thus leads to highly sensitive response; while the presence of organic functional groups contributes to the greatly improved specific sensing property. In this work, we summarize our efforts in the rational design and synthesis of novel sensing materials for the detection of hazardous substances, including simulant nerve agent, organic vapor, and heavy metal ion, and develop high-performance QCM-based chemical sensors. PMID:25924299

  1. Synthesis and optical behaviour of mesoporous silica functionalized by organometallic molecules

    NASA Astrophysics Data System (ADS)

    Laskowski, L.; Kassiba, A.; Makowska-Janusik, M.; Errien, N.; Mehdi, A.; Swiatek, J.


    Mesoporous silica SBA-15 functionalized by (1,4,8,11-tetraazacyclotetradecane) cyclam groups chelating nickel ions (Ni-cyclam) were synthesized by two different approaches. Characterizations by transmission electron microscopy TEM and UV-VIS absorption spectroscopy were performed to monitor the structure and optical properties of the material with regard to the used synthesis methods. The assignment of the experimental UV-VIS absorption spectra is carried out by using the support of suitable numerical simulations based on quantum chemistry DFT codes developed on the modelled (Ni-cyclam) system as free molecule and also constrained in the pores of mesoporous silica matrices.

  2. Removal of mercury from aqueous solution using mesoporous silica nanoparticles modified with polyamide receptor.


    He, Chunsheng; Ren, Long; Zhu, Weiping; Xu, Yufang; Qian, Xuhong


    Based on the principle of supramolecular recognition and fluorescent chemical sensors, a novel kind of material for the separation of toxic heavy metal ions was designed and synthesized. Mesoporous silica nanoparticles MCM-41 with high surface areas and large ordered pores were used as the supporting matrix. Poly-amide derivative, was grafted to the mesoporous silica nanoparticles for extracting and separating trace Hg(2+) from aqueous solution, with a short adsorption time (t=3min) and a wide range of pH application (pH 3-11). The separation material could also extract trace mercury from Traditional Chinese Medicine, and has no influence on their effective components. PMID:26232282

  3. Immobilization of Zidovudine Derivatives on the SBA-15 Mesoporous Silica and Evaluation of Their Cytotoxic Activity

    PubMed Central

    Lewandowski, Dawid


    Novel zidovudine derivatives, able to be covalently conjugated to silica surface, have been obtained and grafted to SBA-15 mesoporous silica. Cytotoxic activity of the hybrid organic-inorganic (zidovudine derivatives-silica) systems against HeLa and KB cell lines has been analyzed. Addition of folic acid had a positive influence on the cytotoxicity. Up to 69% of HeLa and 65% of KB tumor cells growth inhibition has been achieved at low silica concentration used (10 μg/mL). PMID:25942021

  4. Immobilization of Zidovudine Derivatives on the SBA-15 Mesoporous Silica and Evaluation of Their Cytotoxic Activity.


    Lewandowski, Dawid; Lewandowska, Marta; Ruszkowski, Piotr; Pińska, Anita; Schroeder, Grzegorz


    Novel zidovudine derivatives, able to be covalently conjugated to silica surface, have been obtained and grafted to SBA-15 mesoporous silica. Cytotoxic activity of the hybrid organic-inorganic (zidovudine derivatives-silica) systems against HeLa and KB cell lines has been analyzed. Addition of folic acid had a positive influence on the cytotoxicity. Up to 69% of HeLa and 65% of KB tumor cells growth inhibition has been achieved at low silica concentration used (10 μg/mL). PMID:25942021

  5. Ordered mesoporous silica prepared by quiescent interfacial growth method - effects of reaction chemistry

    PubMed Central


    Acidic interfacial growth can provide a number of industrially important mesoporous silica morphologies including fibers, spheres, and other rich shapes. Studying the reaction chemistry under quiescent (no mixing) conditions is important for understanding and for the production of the desired shapes. The focus of this work is to understand the effect of a number of previously untested conditions: acid type (HCl, HNO3, and H2SO4), acid content, silica precursor type (TBOS and TEOS), and surfactant type (CTAB, Tween 20, and Tween 80) on the shape and structure of products formed under quiescent two-phase interfacial configuration. Results show that the quiescent growth is typically slow due to the absence of mixing. The whole process of product formation and pore structuring becomes limited by the slow interfacial diffusion of silica source. TBOS-CTAB-HCl was the typical combination to produce fibers with high order in the interfacial region. The use of other acids (HNO3 and H2SO4), a less hydrophobic silica source (TEOS), and/or a neutral surfactant (Tweens) facilitate diffusion and homogenous supply of silica source into the bulk phase and give spheres and gyroids with low mesoporous order. The results suggest two distinct regions for silica growth (interfacial region and bulk region) in which the rate of solvent evaporation and local concentration affect the speed and dimension of growth. A combined mechanism for the interfacial bulk growth of mesoporous silica under quiescent conditions is proposed. PMID:24237719

  6. Development of novel delivery system for warfarin based on mesoporous silica: adsorption characteristics of silica materials for the anticoagulant.


    Dolinina, Ekaterina S; Vorobyeva, Evgeniya V; Parfenyuk, Elena V


    The adsorption of the anticoagulant warfarin onto unmodified (UMS) and modified (phenyl (PhMS), methyl (MMS), mercaptopropyl (MPMS)) mesoporous silica materials was studied at pH 1.6 and 7.4 and in the temperature range of 293-325 K. The silica materials were prepared by sol-gel method for further characterization by FTIR spectroscopy, N2 adsorption/desorption method, transmission electron microscopy and zeta potential measurements. The effects of medium pH, temperature and surface modification of mesoporous silica material on their adsorption characteristics (adsorption capacity, thermodynamic parameters of adsorption) relative to anticoagulant warfarin were investigated. It was found that medium acid-base properties strongly affect the adsorption of warfarin due to the pH-dependent structural diversity of the drug and ionization state of the silica surfaces. The adsorption capacity of the silica materials at pH 1.6 decreases in the order: MMS > MPMS > UMS > PhMS. The influence of various non-covalent interactions on the adsorption capacity of the silica materials and energy of the drug-silica interactions is discussed. These results may be useful for the development of a novel delivery system of warfarin. PMID:26465269

  7. Synthesis of mesoporous silica materials from municipal solid waste incinerator bottom ash

    SciTech Connect

    Liu, Zhen-Shu Li, Wen-Kai; Huang, Chun-Yi


    Highlights: • The optimal alkaline agent for the extraction of silica from bottom ash was Na{sub 2}CO{sub 3}. • The pore sizes for the mesoporous silica synthesized from bottom ash were 2–3.8 nm. • The synthesized materials exhibited a hexagonal pore structure with a smaller order. • The materials have potential for the removal of heavy metals from aqueous solutions. - Abstract: Incinerator bottom ash contains a large amount of silica and can hence be used as a silica source for the synthesis of mesoporous silica materials. In this study, the conditions for alkaline fusion to extract silica from incinerator bottom ash were investigated, and the resulting supernatant solution was used as the silica source for synthesizing mesoporous silica materials. The physical and chemical characteristics of the mesoporous silica materials were analyzed using BET, XRD, FTIR, SEM, and solid-state NMR. The results indicated that the BET surface area and pore size distribution of the synthesized silica materials were 992 m{sup 2}/g and 2–3.8 nm, respectively. The XRD patterns showed that the synthesized materials exhibited a hexagonal pore structure with a smaller order. The NMR spectra of the synthesized materials exhibited three peaks, corresponding to Q{sup 2} [Si(OSi){sub 2}(OH){sub 2}], Q{sup 3} [Si(OSi){sub 3}(OH)], and Q{sup 4} [Si(OSi){sub 4}]. The FTIR spectra confirmed the existence of a surface hydroxyl group and the occurrence of symmetric Si–O stretching. Thus, mesoporous silica was successfully synthesized from incinerator bottom ash. Finally, the effectiveness of the synthesized silica in removing heavy metals (Pb{sup 2+}, Cu{sup 2+}, Cd{sup 2+}, and Cr{sup 2+}) from aqueous solutions was also determined. The results showed that the silica materials synthesized from incinerator bottom ash have potential for use as an adsorbent for the removal of heavy metals from aqueous solutions.

  8. Mesoporous carbon-supported Pd nanoparticles with high specific surface area for cyclohexene hydrogenation: Outstanding catalytic activity of NaOH-treated catalysts

    NASA Astrophysics Data System (ADS)

    Puskás, R.; Varga, T.; Grósz, A.; Sápi, A.; Oszkó, A.; Kukovecz, Á.; Kónya, Z.


    Extremely high specific surface area mesoporous carbon-supported Pd nanoparticle catalysts were prepared with both impregnation and polyol-based sol methods. The silica template used for the synthesis of mesoporous carbon was removed by both NaOH and HF etching. Pd/mesoporous carbon catalysts synthesized with the impregnation method has as high specific surface area as 2250 m2/g. In case of NaOH-etched impregnated samples, the turnover frequency of cyclohexene hydrogenation to cyclohexane at 313 K was obtained ~ 14 molecules • site- 1 • s- 1. The specific surface area of HF-etched samples was higher compared to NaOH-etched samples. However, catalytic activity was ~ 3-6 times higher on NaOH-etched samples compared to HF-etched samples, which can be attributed to the presence of sodium and surface hydroxylgroups of the catalysts etched with NaOH solution.

  9. Effect of polyvinylpyrrolidone on mesoporous silica morphology and esterification of lauric acid with 1-butanol catalyzed by immobilized enzyme

    SciTech Connect

    Zhang, Jinyu; Zhou, Guowei Jiang, Bin; Zhao, Minnan; Zhang, Yan


    Mesoporous silica materials with a range of morphology evolution, i.e., from curved rod-shaped mesoporous silica to straight rod-shaped mesoporous silica, were successfully prepared using polyvinylpyrrolidone (PVP) and triblock copolymer as dual template. The effects of PVP molecular weight and concentration on mesoporous silica structure parameters were studied. Results showed that surface area and pore volume continuously decreased with increased PVP molecular weight. Mesoporous silica prepared with PVP K30 also possessed larger pore diameter, interplanar spacing (d{sub 100}), and cell parameter (a{sub 0}) than that prepared with PVP K15 and PVP K90. In addition, with increased PVP concentration, d{sub 100} and a{sub 0} continuously decreased. The mechanism of morphology evolution caused by the change in PVP concentration was investigated. The conversion rate of lauric acid with 1-butanol catalyzed by immobilized Porcine pancreatic lipase (PPL) was also evaluated. Results showed that PPL immobilized on amino-functionalized straight rod-shaped mesoporous silica maintained 50% of its esterification conversion rate even after five cycles of use with a maximum conversion rate was about 90.15%. - Graphical abstract: Curved rod-shaped mesoporous silica can be obtained at low and the highest PVP concentration, while straight rod-shaped mesoporous silica can be obtained at higher PVP concentration. - Highlights: • Mesoporous silica with morphology evolution from CRMS to SRMS were prepared. • Effects of PVP molecular weight and concentration on silica morphology were studied. • A possible mechanism for the formation of morphology evolution SiO{sub 2} was proposed. • Esterification of lauric acid with 1-butanol catalyzed by immobilized PPL.

  10. Mesoporous silica nanoparticles with organo-bridged silsesquioxane framework as innovative platforms for bioimaging and therapeutic agent delivery.


    Du, Xin; Li, Xiaoyu; Xiong, Lin; Zhang, Xueji; Kleitz, Freddy; Qiao, Shi Zhang


    Mesoporous silica material with organo-bridged silsesquioxane frameworks is a kind of synergistic combination of inorganic silica, mesopores and organics, resulting in some novel or enhanced physicochemical and biocompatible properties compared with conventional mesoporous silica materials with pure Si-O composition. With the rapid development of nanotechnology, monodispersed nanoscale periodic mesoporous organosilica nanoparticles (PMO NPs) and organo-bridged mesoporous silica nanoparticles (MSNs) with various organic groups and structures have recently been synthesized from 100%, or less, bridged organosilica precursors, respectively. Since then, these materials have been employed as carrier platforms to construct bioimaging and/or therapeutic agent delivery nanosystems for nano-biomedical application, and they demonstrate some unique and/or enhanced properties and performances. This review article provides a comprehensive overview of the controlled synthesis of PMO NPs and organo-bridged MSNs, physicochemical and biocompatible properties, and their nano-biomedical application as bioimaging agent and/or therapeutic agent delivery system. PMID:27017579

  11. Mesoporous MgO: Synthesis, physico-chemical, and catalytic properties

    NASA Astrophysics Data System (ADS)

    Maerle, A. A.; Kasyanov, I. A.; Moskovskaya, I. F.; Romanovsky, B. V.


    Mesoporous MgO was obtained via the hydrothermal synthesis using both ionogenic and non-ionogenic surfactants as structure-directing templates. The materials prepared were characterized by SEM, BET-N2, XRD, and TG-DTA techniques. MgO particles are spherical 20-μm aggregates of primary oxide particles well shaped as rectangular parallelepipeds. Magnesium oxide samples have the specific surface area of 290-400 m2/g and pore sizes of 3.3-4.1 nm. Their mesoporous structure remained unchanged after calcination up to 350°C. Catalytic activity of mesoporous MgO was studied in acetone condensation reaction.

  12. SBA-15 Mesoporous Silica Modified with Gallic Acid and Evaluation of Its Cytotoxic Activity

    PubMed Central

    Lewandowski, Dawid


    Gallic acid has been covalently conjugated to SBA-15 mesoporous silica surface through different linkers. Cytotoxic activity of the hybrid organic-inorganic systems against HeLa and KB cell lines has been analyzed. Up to 67% of HeLa or KB tumor cells growth inhibition has been achieved at low silica concentration used (10 μg mL-1). PMID:26151908

  13. Integrated, cascading enzyme-/chemocatalytic cellulose conversion using catalysts based on mesoporous silica nanoparticles.


    Lee, Yi-Chun; Dutta, Saikat; Wu, Kevin C-W


    This article reports a novel approach to deconstructing cellulose into 5-hydroxymethylfurfural (HMF) with a high yield (46.1%) by integrating a sequential enzyme cascade technique in an aqueous system with solid acid catalysis in an organic-solvent system. We executed the rational design and synthesis of mesoporous silica nanoparticles (MSNs) with various pore sizes and surface functionalities, which proved to be useful for the immobilization of various enzymes (i.e., cellulase and isomerase) and nanoparticles (i.e., magnetic Fe3 O4 ) and for functionalization of various acid groups (i.e., H2 PO3 , COOH, and SO3 H). We separately applied the synthesized biocatalysts (i.e., cellulase-Fe3 O4 @MSN and isomerase-Fe3 O4 @MSN) and chemical catalysts (i.e., HSO3 -MSN) in a sequential cellulose-to-glucose, glucose-to-fructose, and fructose-to-HMF conversion, respectively, across both aqueous- and organic-solvent systems after the optimization of reaction conditions (e.g., reaction temperature, water ratio, catalyst amount). The integrated enzymatic and chemocatalytic concept in this study could be an effective and economically friendly process for various catalytic applications. PMID:25257168

  14. Textural and structural properties and surface acidity characterization of mesoporous silica-zirconia molecular sieves

    NASA Astrophysics Data System (ADS)

    Rodríguez-Castellón, E.; Jiménez-López, A.; Maireles-Torres, P.; Jones, D. J.; Rozière, J.; Trombetta, M.; Busca, G.; Lenarda, M.; Storaro, L.


    Homogeneous mesoporous zirconium-containing MCM-41 type silica were prepared by supramolecular templating and their textural and structural properties were studied using powder X-ray diffraction, N 2 porosimetry, atomic force microscopy, EXAFS, XPS, and UV-VIS-NIR diffuse reflectance spectroscopy. Their acid properties were also studied by using IR spectroscopy and by the use of catalytic tests such as the decomposition of isopropanol and the isomerization of 1-butene. The materials prepared show a good degree of crystallinity with a regular ordering of the pores into a hexagonal arrangement and high thermal stability. The specific surface area of the prepared materials decreases as the zirconium content rises. Zirconium atoms are in coordination 7 to 8 and located at the surface of the pores such that a high proportion of the oxygen atoms bonded to zirconium corresponds to surface non-condensed oxygen atoms. Both facts are responsible for the acid properties of the solids that show weak Brønsted and medium strong Lewis acidity.

  15. Monodisperse spherical mesoporous silica particles: fast synthesis procedure and fabrication of photonic-crystal films

    NASA Astrophysics Data System (ADS)

    Trofimova, E. Yu; Kurdyukov, D. A.; Yakovlev, S. A.; Kirilenko, D. A.; Kukushkina, Yu A.; Nashchekin, A. V.; Sitnikova, A. A.; Yagovkina, M. A.; Golubev, V. G.


    A procedure for the synthesis of monodisperse spherical mesoporous silica particles (MSMSPs) via the controlled coagulation of silica/surfactant clusters into spherical aggregates with mean diameters of 250-1500 nm has been developed. The synthesis is fast (taking less than 1 h) because identical clusters are simultaneously formed in the reaction mixture. The results of microscopic, x-ray diffraction, adsorption and optical measurements allowed us to conclude that the clusters are ˜15 nm in size and have hexagonally packed cylindrical pore channels. The channel diameters in MSMSPs obtained with cethyltrimethylammonium bromide and decyltrimethylammonium bromide as structure-directing agents were 3.1 ± 0.15 and 2.3 ± 0.12 nm, respectively. The specific surface area and the pore volume of MSMSP were, depending on synthesis conditions, 480-1095 m2 g-1 and 0.50-0.65 cm3 g-1. The MSMSP were used to grow opal-like photonic-crystal films possessing a hierarchical macro-mesoporous structure, with pores within and between the particles. A selective filling of mesopore channels with glycerol, based on the difference between the capillary pressures in macro- and mesopores, was demonstrated. It is shown that this approach makes it possible to control the photonic bandgap position in mesoporous opal films by varying the degree of mesopore filling with glycerol.

  16. One-pot synthesis of superacid catalytic material SO{sub 4}{sup 2-}/ZrO{sub 2}-SiO{sub 2} with thermostable well-ordered mesoporous structure

    SciTech Connect

    Li Ruifeng; Yu Feng; Li Fuxiang; Zhou Meimei; Xu Bingshe; Xie Kechang


    A superacid mesostructured catalyst was directly synthesized by adding sulfuric acid to mesoporous zirconia-silica synthesis mixtures, and was characterized by HRTEM, XRD, UV-Vis, nitrogen sorption, NH{sub 3}-TPD, and Pyridine-FTIR. The XRD patterns and electron diffraction micrographs of the calcined samples showed the ordered mesoporous structure and tetragonal crystalline in frameworks. The ammonia TPD, pyridine in situ FTIR, and paraffin isomerization illustrated a new acidic property of the samples. The synthesis of the mesoporous materials, which have stable crystalline frameworks, high surface area, and strong acidity, is very likely to have important technological implications for catalytic reactions of large molecules. - Graphical abstract: TEM images of the calcined mesoporous catalyst MSC{sub x} (x=1.1), in which no aggregated ZrO{sub 2} particles can be observed. The corresponding electron diffraction (insets in figures) indicated the final product was a mesoporous material with a crystalline framework.

  17. Facile large-scale synthesis of brain-like mesoporous silica nanocomposites via a selective etching process

    NASA Astrophysics Data System (ADS)

    Chen, Yu; Wang, Qihua; Wang, Tingmei


    The core-shell structured mesoporous silica nanomaterials (MSNs) are experiencing rapid development in many applications such as heterogeneous catalysis, bio-imaging and drug delivery wherein a large pore volume is desirable. We develop a one-pot method for large-scale synthesis of brain-like mesoporous silica nanocomposites based on the reasonable change of the intrinsic nature of the -Si-O-Si- framework of silica nanoparticles together with a selective etching strategy. The as-synthesized products show good monodispersion and a large pore volume of 1.0 cm3 g-1. The novelty of this approach lies in the use of an inorganic-organic hybrid layer to assist the creation of large-pore morphology on the outermost shell thereby promoting efficient mass transfer or storage. Importantly, the method is reliable and grams of products can be easily prepared. The morphology on the outermost silica shell can be controlled by simply adjusting the VTES-to-TEOS molar ratio (VTES: triethoxyvinylsilane, TEOS: tetraethyl orthosilicate) as well as the etching time. The as-synthesized products exhibit fluorescence performance by incorporating rhodamine B isothiocyanate (RITC) covalently into the inner silica walls, which provide potential application in bioimaging. We also demonstrate the applications of as-synthesized large-pore structured nanocomposites in drug delivery systems and stimuli-responsive nanoreactors for heterogeneous catalysis.The core-shell structured mesoporous silica nanomaterials (MSNs) are experiencing rapid development in many applications such as heterogeneous catalysis, bio-imaging and drug delivery wherein a large pore volume is desirable. We develop a one-pot method for large-scale synthesis of brain-like mesoporous silica nanocomposites based on the reasonable change of the intrinsic nature of the -Si-O-Si- framework of silica nanoparticles together with a selective etching strategy. The as-synthesized products show good monodispersion and a large pore volume

  18. Controllable synthesis of hollow mesoporous silica spheres and application as support of nano-gold

    SciTech Connect

    Wang, Tao; Ma, Weihua Shangguan, Junnan; Jiang, Wei; Zhong, Qin


    Hollow silica spheres with mesoporous structure were synthesized by sol–gel/emulsion method. In the process, the surfactant, cetyltrimethylammonium bromide (CTAB) was used to stabilize the oil droplet and also used as structure direct agent. The diameter of the hollow silica spheres, ranging from 895 nm to 157 nm, can be controlled by changing the ratio of ethanol to water and the concentration of the surfactant as well. The shell thickness of the spheres decreased when the ratio of ethanol to water decreased. The proposed mechanism of the formation of silica spheres could elucidate the experimental results well. Furthermore, the resultant hollow mesoporous silica spheres were then employed as support of nano-gold which was used to catalyze the isomerization reaction of propylene oxide to produce allyl alcohol. - Graphical abstract: It is the schematic mechanism for the formation of hollow mesoporous silica spheres. - Highlights: • The formation mechanism of the hollow spheres is proposed. • The isomerization of propylene oxide can be catalyzed by the nano-gold/SiO{sub 2}. • The hollow silica spheres can be prepared controllably.

  19. Synthesis of ordered mesoporous silica and alumina with controlled macroscopic morphologies

    NASA Astrophysics Data System (ADS)

    Alsyouri, Hatem Mohammad Sadi

    The ability to synthesize nanostructured inorganic materials with controlled microstructural and morphological features will provide materials with unique characteristics in unprecedented ways. This thesis investigates the synthesis of porous silica and alumina materials with controlled microstructures and desirable shapes using novel approaches based on template-assisted synthesis and chemical vapor deposition (CVD) techniques. It primarily focuses on fabricating mesoporous materials with unique microstructures and different morphologies (particles and membranes) and exploring the potential of the particle morphology in a polymer reaction application. The template-assisted growth of mesoporous silica under acidic and quiescent conditions at an oil-water interface can generate mesostructured silica at the interface with fibrous, gyroidal, spherical, and film morphologies. Synthesis conditions can be used to alter the growth environment and control the product morphology. Fiber morphology is obtained at narrow range of experimental conditions due to slow and one-dimensional diffusion of silicon alkoxide through the interface. Variation in these conditions can alter the axial growth of silica and yield non-fibrous shapes. The fibers grow from their base attached to the interface and coalesce to form fibers with larger diameters. Gas transport in the mesoporous silica fibers is governed by combination of Knudsen and surface diffusion mechanisms. Surface diffusion contributes to 40% of the net flow reflecting a highly smooth pore surfaces. Real Knudsen and surface diffusivities are in the order of 10-3 and 10 -5 cm2/s respectively. The one-dimensional mesopores are 45 time longer than the macroscopic fiber length and align helically around the fiber axis, confirming the literature observations, with a pitch value of 1.05 micron. For preparation of mesoporous silica materials as membranes, a novel counter diffusion self assembly (CDSA) approach is demonstrated. This

  20. Biological Applications and Transmission Electron Microscopy Investigations of Mesoporous Silica Nanoparticles

    SciTech Connect

    Brian G. Trewyn


    The research presented and discussed within involves the development of novel biological applications of mesoporous silica nanoparticles (MSN) and an investigation of mesoporous material by transmission electron microscopy (TEM). Mesoporous silica nanoparticles organically functionalized shown to undergo endocytosis in cancer cells and drug release from the pores was controlled intracellularly and intercellularly. Transmission electron microscopy investigations demonstrated the variety of morphologies produced in this field of mesoporous silica nanomaterial synthesis. A series of room-temperature ionic liquid (RTIL) containing mesoporous silica nanoparticle (MSN) materials with various particle morphologies, including spheres, ellipsoids, rods, and tubes, were synthesized. By changing the RTIL template, the pore morphology was tuned from the MCM-41 type of hexagonal mesopores to rotational moire type of helical channels, and to wormhole-like porous structures. These materials were used as controlled release delivery nanodevices to deliver antibacterial ionic liquids against Escherichia coli K12. The involvement of a specific organosiloxane function group, covalently attached to the exterior of fluorescein doped mesoporous silica nanoparticles (FITC-MSN), on the degree and kinetics of endocytosis in cancer and plant cells was investigated. The kinetics of endocystosis of TEG coated FITC-MSN is significantly quicker than FITC-MSN as determined by flow cytometry experiments. The fluorescence confocal microscopy investigation showed the endocytosis of TEG coated-FITC MSN triethylene glycol grafted fluorescein doped MSN (TEG coated-FITC MSN) into both KeLa cells and Tobacco root protoplasts. Once the synthesis of a controlled-release delivery system based on MCM-41-type mesoporous silica nanorods capped by disulfide bonds with superparamagnetic iron oxide nanoparticles was completed. The material was characterized by general methods and the dosage and kinetics of the

  1. A Single-Step Synthesis of Electroactive Mesoporous ProDOT-Silica Structures.


    Kim, Jeonghun; Kim, Byeonggwan; Anand, Chokkalingam; Mano, Ajayan; Zaidi, Javaid S M; Ariga, Katsuhiko; You, Jungmok; Vinu, Ajayan; Kim, Eunkyoung


    The single-step preparation of highly ordered mesoporous silica hybrid nanocomposites with conjugated polymers was explored using a novel cationic 3,4-propylenedioxythiophene (ProDOT) surfactant (PrS). The method does not require high-temperature calcination or a washing procedure. The combination of self-assembly of the silica surfactant and in situ polymerization of the ProDOT tail is responsible for creation of the mesoporosity with ultralarge pores, large pore volume, and electroactivity. As this novel material exhibits excellent textural parameters together with electrical conductivity, we believe that this could find potential applications in various fields. This novel concept of creating mesoporosity without a calcination process is a significant breakthrough in the field of mesoporous materials and the method can be further generalized as a rational preparation of various mesoporous hybrid materials having different structures and pore diameters. PMID:26037244

  2. Transcription of G-quartet supramolecular aggregates into hierarchical mesoporous silica nanotubes.


    Min, Liang; Li, Tao; Tan, Qi; Tan, Xiaoping; Pan, Wu; He, Li; Zhang, Jie; Ou, Encai; Xu, Weijian


    The use of 5-guanosine monophosphate (GMP) with Sr(2+) ions to form G-quadruplex bundles as supramolecular templates for the preparation of hierarchical mesoporous silica nanotube materials is reported here, and some mesopores with a diameter of 4-22 nm were obtained. Furthermore, some mesopore channels which run perpendicularly to the center axis of the tube and penetrate right through the outer wall of the nanotubes were achieved by removing the templates. Besides, porous hollow silica spheres were obtained by changing some of the reaction conditions during the process of preparation. Their structures are stable even after high temperature calcination. A formation mechanism was proposed and discussed, and their structures were characterized using a number of means including X-ray diffraction, IR spectra, N2 adsorption-desorption isotherms, scanning electron microscopy (SEM) and transmission electron microscopy (TEM). PMID:27068442

  3. Functionalization of SBA-15 mesoporous silica by Cu-phosphonate units: Probing of synthesis route

    SciTech Connect

    Laskowski, Lukasz; Laskowska, Magdalena


    Mesoporous silica SBA-15 containing propyl-copper phosphonate units was investigated. The structure of mesoporous samples was tested by N{sub 2} isothermal sorption (BET and BHJ analysis), TEM microscopy and X-Ray scattering. Quantitative analysis EDX has given information about proportions between component atoms in the sample. Quantitative elemental analysis has been carried out to support EDX. To examine bounding between copper atoms and phosphonic units the Raman spectroscopy was carried out. As a support of Raman scattering, the theoretical calculations were made based on density functional theory, with the B3LYP method. By comparison of the calculated vibrational spectra of the molecule with experimental results, distribution of the active units inside silica matrix has been determined. - Graphical abstract: The present study is devoted to mesoporous silica SBA-15 containing propyl-copper phosphonate units. The species were investigated to confirm of synthesis procedure correctness by the micro-Raman technique combined with DFT numerical simulations. Complementary research was carried out to test the structure of mesoporous samples. - Highlights: • SBA-15 silica functionalized with propyl-copper phosphonate units was synthesized. • Synthesis efficiency probed by Raman study supported with DFT simulations. • Homogenous distribution of active units was proved. • Synthesis route enables precise control of distance between copper ions.

  4. Shape Control of Mesoporous Silica Nanomaterials Templated with Dual Cationic Surfactants and Their Antibacterial Activities

    PubMed Central

    Hao, Nanjing; Chen, Xuan; Jayawardana, Kalana W.; Wu, Bin; Sundhoro, Madanodaya; Yan, Mingdi


    Mesoporous silica nanomaterials of different shapes (film, platelet, sphere, rod) were synthesized simply by tuning the mole ratio of dual cationic surfactant templates, cetyltrimethylammonium bromide (CTAB) and tetrabutylammonium iodine (TBAI). The film showed the most potent antibacterial activities against mycobacteria. PMID:26364920

  5. CD44-engineered mesoporous silica nanoparticles for overcoming multidrug resistance in breast cancer

    NASA Astrophysics Data System (ADS)

    Wang, Xin; Liu, Ying; Wang, Shouju; Shi, Donghong; Zhou, Xianguang; Wang, Chunyan; Wu, Jiang; Zeng, Zhiyong; Li, Yanjun; Sun, Jing; Wang, Jiandong; Zhang, Longjiang; Teng, Zhaogang; Lu, Guangming


    Multidrug resistance is a major impediment for the successful chemotherapy in breast cancer. CD44 is over-expressed in multidrug resistant human breast cancer cells. CD44 monoclonal antibody exhibits anticancer potential by inhibiting proliferation and regulating P-glycoprotein-mediated drug efflux activity in multidrug resistant cells. Thereby, CD44 monoclonal antibody in combination with chemotherapeutic drug might be result in enhancing chemosensitivity and overcoming multidrug resistance. The purpose of this study is to investigate the effects of the CD44 monoclonal antibody functionalized mesoporous silica nanoparticles containing doxorubicin on human breast resistant cancer MCF-7 cells. The data showed that CD44-modified mesoporous silica nanoparticles increased cytotoxicity and enhanced the downregulation of P-glycoprotein in comparison to CD44 antibody. Moreover, CD44-engineered mesoporous silica nanoparticles provided active target, which promoted more cellular uptake of DOX in the resistant cells and more retention of DOX in tumor tissues than unengineered counterpart. Animal studies of the resistant breast cancer xenografts demonstrated that CD44-engineered drug delivery system remarkably induced apoptosis and inhibited the tumor growth. Our results indicated that the CD44-engineered mesoporous silica nanoparticle-based drug delivery system offers an effective approach to overcome multidrug resistance in human breast cancer.

  6. Synthesis of stable hollow silica microspheres with mesoporous shell in nonionic W/O emulsion.


    Li, Wenjiang; Sha, Xiaoxiang; Dong, Wenjun; Wang, Zichen


    Stable hollow silica microspheres were synthesized by a solgel method in nonionic W/O emulsion; the mesoporous shell wall of the spheres could have potential applications as controlled release capsules for drugs, dyes, cosmetics and inks, artificial cells, catalysts, and fillers. PMID:12430477

  7. Cell-specific intracellular anticancer drug delivery from mesoporous silica nanoparticles with pH sensitivity.


    Luo, Zhong; Cai, Kaiyong; Hu, Yan; Zhang, Beilu; Xu, Dawei


    A nanoreservoir for efficient intracellular anticancer drug delivery based on mesoporous silica nanoparticles end-capped with lactobionic acid-grafted bovine serum albumin is fabricated. It demonstrates great potential for both cell-specific endocytosis and intracellular pH-responsive controlled release of drugs. A possible endocytosis pathway/mechanism of the smart controlled drug release system is proposed. PMID:23184747

  8. A new redox strategy for low-temperature formation of strong basicity on mesoporous silica.


    Zhu, Li; Lu, Feng; Liu, Xiao-Dan; Liu, Xiao-Qin; Sun, Lin-Bing


    A redox strategy was designed to generate strong basicity on mesoporous silica by using the redox interaction of a precursor with methanol vapor. The formation of strongly basic sites was realized at 400 °C, which breaks the tradition of thermally induced decomposition that usually requires much higher temperatures (>600 °C). PMID:26006787

  9. Multicompartment mesoporous silica nanoparticles with branched shapes: an epitaxial growth mechanism.


    Suteewong, Teeraporn; Sai, Hiroaki; Hovden, Robert; Muller, David; Bradbury, Michelle S; Gruner, Sol M; Wiesner, Ulrich


    Mesoporous nanomaterials have attracted widespread interest because of their structural versatility for applications including catalysis, separation, and nanomedicine. We report a one-pot synthesis method for a class of mesoporous silica nanoparticles (MSNs) containing both cubic and hexagonally structured compartments within one particle. These multicompartment MSNs (mc-MSNs) consist of a core with cage-like cubic mesoporous morphology and up to four branches with hexagonally packed cylindrical mesopores epitaxially growing out of the cubic core vertices. The extent of cylindrical mesostructure growth can be controlled via a single additive in the synthesis. Results suggest a path toward high levels of architectural complexity in locally amorphous, mesostructured nanoparticles, which could enable tuning of different pore environments of the same particle for specific chemistries in catalysis or drug delivery. PMID:23599490

  10. Synthesis and characterization of nanoparticulate MnS within the pores of mesoporous silica

    NASA Astrophysics Data System (ADS)

    Barry, Louse; Copley, Mark; Holmes, Justin D.; Otway, David J.; Kazakova, Olga; Morris, Michael A.


    Mesoporous silica was loaded with nanoparticulate MnS via a simple post-synthesis treatment. The mesoporous material that still contained surfactant was passivated to prevent MnS formation at the surface. The surfactant was extracted and a novel manganese ethylxanthate was used to impregnate the pore network. This precursor thermally decomposes to yield MnS particles that are smaller or equal to the pore size. The particles exhibit all three common polymorphs. The passivation treatment is most effective at lower loadings because at the highest loadings (SiO 2:MnS molar ratio of 6:1) large particles (>50 nm) form at the exterior of the mesoporous particles. The integrity of the mesoporous network is maintained through the preparation and high order is maintained. The MnS particles exhibit unexpected ferromagnetism at low temperatures. Strong luminescence of these samples is observed and this suggests that they may have a range of important application areas.

  11. The dynamic association processes leading from a silica precursor to a mesoporous SBA-15 material.


    Alfredsson, Viveka; Wennerström, Håkan


    During the last two decades, the synthesis of silica with an ordered mesoporous structure has been thoroughly explored. The basis of the synthesis is to let silica monomers polymerize in the presence of an amphiphilic template component. In the first studies, cationic surfactants were used as structure inducer. Later it was shown that pluronic copolymers also could have the role. One advantage with the pluronics copolymers is that they allow for a wider variation in the radius of pores in the resulting silica material. Another advantage lies in the higher stability resulting from the thicker walls between the pores. Mesoporous silica has a very high area to volume ratio, and the ordered structure ensures surface homogeneity. There are a number of applications of this type of material. It can be used as support for catalysts, as templates to produces other mesoporous inorganic materials, or in controlled release applications. The synthesis of mesoporous silica is, from a practical point of view, simple, but there are significant possibilities to vary synthesis conditions with a concomitant effect on the properties of the resulting material. It is clear that the structural properties on the nanometer scale are determined by the self-assembly properties of the amphiphile, and this knowledge has been used to optimize pore geometry and pore size. To have a practical functional material it is desirable to also control the structure on a micrometer scale and larger. In practice, one has largely taken an empirical approach in optimizing reaction conditions, paying less attention to underlying chemical and physicochemical mechanisms that lead from starting conditions to the final product. In this Account, we present our systematic studies of the processes involved not only in the formation of the mesoporous structure as such, but also of the formation of structures on the micrometer scale. The main point is to show how the ongoing silica polymerization triggers a sequence

  12. Elongated silica nanoparticles with a mesh phase mesopore structure by fluorosurfactant templating.


    Tan, Bing; Dozier, Alan; Lehmler, Hans-Joachim; Knutson, Barbara L; Rankin, Stephen E


    Mesoporous silica materials with pore structures such as 2D hexagonal close packed, bicontinuous cubic, lamellar, sponge, wormhole-like, and rectangular have been made by using surfactant templating sol-gel processes. However, there are still some "intermediate" phases, in particular mesh phases, that are formed by surfactants but which have not been made into analogous silica pore structures. Here, we describe the one-step synthesis of mesoporous silica with a mesh phase pore structure. The cationic fluorinated surfactant 1,1,2,2-tetrahydroperfluorodecylpyridinium chloride (HFDePC) is used as the template. Like many fluorinated surfactants, HFDePC forms intermediate phases in water (including a mesh phase) over a wider range of compositions than do hydrocarbon surfactants. The materials produced by this technique are novel elongated particles in which the layers of the mesh phase are oriented orthogonal to the main axis of the particles. PMID:15301475

  13. Wet powder processing of sol-gel derived mesoporous silica-hydroxyapatite hybrid powders.


    Andersson, Jenny; Johannessen, Espen; Areva, Sami; Järn, Mikael; Lindén, Mika


    This paper describes a method by which a porous silica coating layer can be obtained on different apatite particles through a simple sol-gel synthesis route. Sol-gel derived powders of hydroxyapatite (HAP) and beta tricalciumphosphate (beta-TCP) were coated with a mesoporous silica using C16TAB (hexadecyltrimethylammonium bromide) as a template in order to induce mesophase formation. Further calcination of the material removes the template from the mesophase and leaves a highly ordered hexagonal arranged mesoporous silica structure with a core of HAP/beta-TCP. The phase purity of the SiO2/apatite composites has been thoroughly investigated by the means of FT-IR, XRD, and solid state 31P MAS NMR. The phase purity of these materials is shown to be dependent on the solubility properties of the used apatites. The hybrid materials are suitable as a multifunctional biomaterial where osteoconductive properties can be combined with drug delivery. PMID:17037853

  14. Synthesis of mesoporous hollow silica nanospheres using polymeric micelles as template and their application as a drug-delivery carrier.


    Sasidharan, Manickam; Zenibana, Haruna; Nandi, Mahasweta; Bhaumik, Asim; Nakashima, Kenichi


    Mesoporous hollow silica nanospheres with uniform particle sizes of 31-33 nm have been successfully synthesized by cocondensation of tetramethoxysilane (TMOS) and alkyltrimethoxysilanes [RSi(OR)3], where the latter also acts as a porogen. ABC triblock copolymer micelles of poly(styrene-b-2-vinyl pyridine-b-ethylene oxide) (PS-PVP-PEO) with a core-shell-corona architecture have been employed as a soft template at pH 4. The cationic shell block with 2-vinyl pyridine groups facilitates the condensation of silica precursors under the sol-gel reaction conditions. Phenyltrimethoxysilane, octyltriethoxysilane, and octadecyltriethoxysilanes were used as porogens for generating mesopores in the shell matrix of hollow silica and the octadecyl precursor produced the largest mesopore among the different porogens, of dimension ca. 4.1 nm. The mesoporous hollow particles were thoroughly characterized by small-angle X-ray diffraction (SXRD), thermal (TG/DTA) and nitrogen sorption analyses, infra-red (FTIR) and nuclear magnetic resonance ((13)C-CP MAS NMR and (29)Si MAS NMR) spectroscopies, and transmission electron microscopy (TEM). The mesoporous hollow silica nanospheres have been investigated for drug-delivery application by an in vitro method using ibuprofen as a model drug. The hollow silica nanospheres exhibited higher storage capacity than the well-known mesoporous silica MCM-41. Propylamine functionalized hollow particles show a more sustained release pattern than their unfunctionalized counterparts, suggesting a huge potential of hollow silica nanospheres in the controlled delivery of small drug molecules. PMID:23887599

  15. Mixed surfactants-directed the mesoporous silica materials with various morphologies and structures

    NASA Astrophysics Data System (ADS)

    Lin, Huiming; Qu, Fengyu; Wu, Xiang; Xue, Ming; Zhu, Guangshan; Qiu, Shilun


    A new mixed surfactants system using alkyl carboxylic acids and quaternized poly[bis(2-chloroethyl)ether-alt-1,3-bis[3-(dimethylamino)propyl] urea] (PEPU) as the co-template was used to synthesize mesoporous silica materials with various morphologies and structures, including flakes, regular spheres, nanoparticles, and tube-spheres. The cationic polymer connected the anionic surfactant micelle to the anionic polysilicate species to induce the synthesis of the mesoporous silica materials. The structure and property of the surfactant and the cationic polymer determined the formation of mesoporous silica, and also had a signification influence on the morphology and structure of the final materials. To further explore the possible formation mechanism of these mesoporous materials, zeta potential was utilized to evaluate the interaction between the anionic surfactant and the cationic co-template. In addition, the structure, morphology, and porosity of these materials were characterized by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and N 2 adsorption-desorption measurements.

  16. Rhizopus oryzae lipase immobilized on hierarchical mesoporous silica supports for transesterification of rice bran oil.


    Ramachandran, Prashanth; Narayanan, Guru Krupa; Gandhi, Sakthivel; Sethuraman, Swaminathan; Krishnan, Uma Maheswari


    The tunable textural properties of self-oriented mesoporous silica were investigated for their suitability as enzyme immobilization matrices to support transesterification of rice bran oil. Different morphologies of mesoporous silica (rod-like, rice-like, and spherical) were synthesized and characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM), and nitrogen adsorption-desorption isotherms. The surface area, pore size, and ordered arrangement of the pores were found to influence the immobilization and activity of the enzyme in the mesopores. The immobilization in rod-like silica was highest with an immobilization efficiency of 63 % and exhibited minimal activity loss after immobilization. Functionalization of the mesoporous surface with ethyl groups further enhanced the enzyme immobilization. The free enzyme lost most of its activity at 50 °C while the immobilized enzyme showed activity even up to 60 °C. Transesterified product yield of nearly 82 % was obtained for 24 h of reaction with enzyme immobilized on ethyl-functionalized SBA-15 at an oil:methanol ratio of 1:3. Fourier transform infrared spectroscopy (FT-IR) and Gas chromatography-mass spectrometry (GC-MS) were used to characterize the transesterified product obtained. The reusability of the immobilized enzyme was studied for 3 cycles. PMID:25488500

  17. EPR in functional structures based on doped (nano, meso)-porous silica and titanium dioxide

    NASA Astrophysics Data System (ADS)

    Kassiba, A.; Makowska-Janusik, M.; Mehdi, A.


    EPR investigations are performed on mesoporous silica (SBA15) functionalized by Nickel-cyclam complexes (1,4,8,11-tetraazacyclotetradecane groups chelating nickel ions) and on mesoporous titanium dioxide with nitrogen doping. For functionalized silica, the magnetic behaviour of organometallic groups, their mutual interactions and dispersion in the host matrices are compared with respect to the doping rates and the synthesis procedures. The relaxation processes were analyzed from the thermal evolution of the paramagnetic spin susceptibilities and EPR line-widths. Particularly, some samples show the formation of clusters where phonon assisted one dimensional (1D) ferromagnetic ordering occurs below 45 K. For the mesoporous TiO2, systematic EPR investigations were performed on two main classes of materials with regard to the porosity degrees. The EPR experiments point out the efficiency of EPR method to probe the degree of functionalization of mesoporous silica or the nitrogen doping achievement in TiO2, and in general to give a valuable feedback to improve the synthesis routes of smart materials.

  18. Mesoporous silica-coated plasmonic nanostructures for surface-enhanced Raman scattering detection and photothermal therapy.


    Yang, Jianping; Shen, Dengke; Zhou, Lei; Li, Wei; Fan, Jianwei; El-Toni, Ahmed Mohamed; Zhang, Wei-xian; Zhang, Fan; Zhao, Dongyuan


    The design and fabrication of core-shell and yolk-shell nanostructures with surface plasmon resonance (SPR)-active center protected by permeable mesoporous channels can raise the new vitality into the catalysis and biological applications. Hybrid plasmonic-mesoporous silica nanocarriers consisting of Ag and Au-Ag alloy nanoparticles are fabricated through spatially confined galvanic replacement approach. The plasmonic absorption peaks can be finely controlled to the near-infrared (NIR) region (500-790 nm) that is beneficial for tissue transmittance. The mesoporous silica shell facilitates also protection of Au-Ag cores and affords the channels between the exterior and interior capsule environments, thereby endowing the multiple applications. In the present work, it is successfully demonstrated that mesoporous silica-coated Au-Ag alloy core-shell and yolk-shell nanocarriers can serve as good substrates for surface-enhanced Raman scattering (SERS) detection. The SERS signal intensities of nanocarriers are highly dependent on the SPR peaks and the contents of gold. Simultaneously, the synthesized Au-Ag@mSiO2 nanocarriers with SPR peak at ≈790 nm can be applied in NIR-sensitive SERS detection and photothermal therapy. PMID:24665061

  19. Adsorption of Methyl Blue on Mesoporous Materials Using Rice Husk Ash as Silica Source.


    Nguyen, Nhat Thien; Chen, Shiao-shing; Nguyen, Nguyen Cong; Nguyen, Hau Thi; Tsai, Hsiao Hsin; Chang, Chang Tang


    It is recognized that recycling and reuse of waste can result in significant savings in materials and energy. In this research, the adsorption of methyl blue (MB) using waste rice husk ash (Rha) and mesoporous silica materials made from Rha (R-MCM) were analyzed. Mesoporous silica materials were synthesized using cetyltrimethyl ammonium bromide (CTAB) as a cationic surfactant and Rha as the silica source. The prepared samples were characterized by Brunnaur-Emmet-Teller (BET) adsorption isotherm analyzer and transmission electron microscope (TEM) analysis. The results showed the surface area of R-MCM materials was 1347 m2g-1 and the pore volume was 0.906 cm3g-1. TEM analysis showed that the mesoporous materials generally exhibited ordered hexagonal arrays of mesopores with a uniform pore size. The effects on adsorption performance under different initial dye concentrations, different pH values and different dosages of adsorbent were also studied. Both Langmuir and Freundlich adsorption models were applied to describe the equilibrium isotherms. The results show that the maximum removal efficiency of MB more than 99%. PMID:27451772

  20. Silica mesoporous thin films as containers for benzotriazole for corrosion protection of 2024 aluminium alloys

    NASA Astrophysics Data System (ADS)

    Recloux, Isaline; Mouanga, Maixent; Druart, Marie-Eve; Paint, Yoann; Olivier, Marie-Georges


    This work contributes to the development of a new environmentally friendly alternative pretreatment for 2024 aluminium alloys to replace hexavalent chromium based conversion layers in the aeronautical field. A silica mesoporous thin film, synthesized through the evaporation induced self-assembly process, was doped with benzotriazole to obtain active corrosion protection. Inhibitor loading contents were correlated with pore characteristics. The release kinetics was studied as function of pH. The application of the doped mesoporous film on 2024 aluminium alloy revealed a slowing down of corrosion processes, demonstrating its potential as an active inhibitor storage layer.

  1. Surface texture and physicochemical characterization of mesoporous carbon--wrapped Pd-Fe catalysts for low-temperature CO catalytic oxidation.


    Han, Weiliang; Zhang, Guodong; Zhao, Kun; Lu, Gongxuan; Tang, Zhicheng


    In this paper, mesoporous carbon (meso-C) with three-dimensional mesoporous channels was synthesized through a nanocasting route using three-dimensional mesoporous silica KIT-6 as the template. Mesoporous carbon wrapped Pd-Fe nanocomposite catalysts were synthesized by the co-precipitation method. The effects of the experimental conditions, such as pH value, Fe loading content and calcination temperature, on CO oxidation were studied in detail. The prepared Pd-Fe/meso-C catalysts showed excellent catalytic activity after optimizing the experimental conditions. The surface tetravalent Pd content, existing forms of Fe species, surface chemical adsorbed oxygen concentration, and pore channels of mesoporous carbon played vital roles in achieving the highest performance for the Pd-Fe/meso-C catalyst. The reaction pathway was conjectured according to the XPS analysis of the Pd-Fe/meso-C catalysts for CO oxidation, which maybe adhered to the Langmuir-Hinshelwood + redox mechanism. The effect of moisture on CO conversion was investigated, and the superior Pd-Fe/meso-C catalyst could maintain its activity beyond 12 h. This catalyst also showed excellent activity compared to the reported values in the existing literature. PMID:26456796

  2. Self-assembly of supramolecular triarylamine nanowires in mesoporous silica and biocompatible electrodes thereof

    NASA Astrophysics Data System (ADS)

    Licsandru, Erol-Dan; Schneider, Susanne; Tingry, Sophie; Ellis, Thomas; Moulin, Emilie; Maaloum, Mounir; Lehn, Jean-Marie; Barboiu, Mihail; Giuseppone, Nicolas


    Biocompatible silica-based mesoporous materials, which present high surface areas combined with uniform distribution of nanopores, can be organized in functional nanopatterns for a number of applications. However, silica is by essence an electrically insulating material which precludes applications for electro-chemical devices. The formation of hybrid electroactive silica nanostructures is thus expected to be of great interest for the design of biocompatible conducting materials such as bioelectrodes. Here we show that we can grow supramolecular stacks of triarylamine molecules in the confined space of oriented mesopores of a silica nanolayer covering a gold electrode. This addressable bottom-up construction is triggered from solution simply by light irradiation. The resulting self-assembled nanowires act as highly conducting electronic pathways crossing the silica layer. They allow very efficient charge transfer from the redox species in solution to the gold surface. We demonstrate the potential of these hybrid constitutional materials by implementing them as biocathodes and by measuring laccase activity that reduces dioxygen to produce water.Biocompatible silica-based mesoporous materials, which present high surface areas combined with uniform distribution of nanopores, can be organized in functional nanopatterns for a number of applications. However, silica is by essence an electrically insulating material which precludes applications for electro-chemical devices. The formation of hybrid electroactive silica nanostructures is thus expected to be of great interest for the design of biocompatible conducting materials such as bioelectrodes. Here we show that we can grow supramolecular stacks of triarylamine molecules in the confined space of oriented mesopores of a silica nanolayer covering a gold electrode. This addressable bottom-up construction is triggered from solution simply by light irradiation. The resulting self-assembled nanowires act as highly conducting

  3. Direct Assembly of Mesoporous Silica Functionalized with Polypeptides for Efficient Dye Adsorption.


    Lu, Yi-Syuan; Bastakoti, Bishnu Prasad; Pramanik, Malay; Malgras, Victor; Yamauchi, Yusuke; Kuo, Shiao-Wei


    Herein, we introduce a new polypeptide-functionalized mesoporous silica template fabricated from a biodegradable poly(ethylene oxide-b-ɛ-caprolactone) (PEO-b-PCL) diblock copolymer and a poly(tyrosine) (PTyr) biopolymer. The crystallization behavior of the PEO-b-PCL diblock copolymer changes after blending, but the secondary structure of PTry remains stable. After selective solvent extraction in THF, the PEO-b-PCL is removed, but PTyr remains within the silica matrix due to its different solubility. Fourier-transform IR spectroscopic analysis (FTIR), thermal gravitometry analysis (TGA), small-angle X-ray scattering (SAXS), and X-ray diffraction (XRD) studies confirm the retention of PTyr to form a polypeptide-functionalized mesoporous material. The adsorption of methylene blue hydrate (MB) from aqueous solution into the polypeptide-functionalized mesoporous silica is investigated, thus revealing that the nanocomposite exhibits a high adsorption capacity relative to pure silica due to hydrogen-bonding interactions between the hydroxy phenolic group of PTyr and the N-containing aromatic ring from MB. PMID:26626026

  4. Effect of electrolytes on proteins physisorption on ordered mesoporous silica materials.


    Salis, Andrea; Medda, Luca; Cugia, Francesca; Monduzzi, Maura


    This short review highlights the effect of electrolytes on the performance of proteins-mesoporous silica conjugates which can open interesting perspectives in biotechnological fields, particularly nanomedicine and biocatalysis. Indeed therapeutic proteins and peptides represent a challenging innovation for several kinds of diseases, but since their self-life in biological fluids is very short, they need a stealth protective carrier. Similarly, enzymes need a solid support to improve thermal stability and to allow for recycling. Ordered mesoporous silica materials represent a valid choice as widely demonstrated. Both proteins and silica mesoporous materials possess charged surfaces, and here, the crucial role of pH, buffer, ionic strength and electrolyte type is posed in relation with loading/release of proteins onto/from the silica support through the analysis of adsorption and release processes. A delicate interplay of electrostatic and van der Waals interactions arises from considering electrolytes' effects on the two different charged surfaces. Clear outcomes concern the effect of pH and ionic strength. Protein loading onto the silica matrix is favored by an adsorbing solution having a pH close to the protein pI, and by a high ionic strength that reduces the Debye length. Release is instead favored by an adsorbing solution characterized by an intermediate ionic strength, close to the physiological values. Significant specific ions effects are shown to affect both proteins and silica matrices, as well as protein adsorption onto silica matrices. Further work is needed to quantify specific ion effects on the preservation of the biological activity, and on the release performance. PMID:26009265

  5. Anhydrous phosphoric Acid functionalized sintered mesoporous silica nanocomposite proton exchange membranes for fuel cells.


    Zeng, Jie; He, Beibei; Lamb, Krystina; De Marco, Roland; Shen, Pei Kang; Jiang, San Ping


    A novel inorganic proton exchange membrane based on phosphoric acid (PA)-functionalized sintered mesoporous silica, PA-meso-silica, has been developed and investigated. After sintering at 650 °C, the meso-silica powder forms a dense membrane with a robust and ordered mesoporous structure, which is critical for retention of PA and water within the porous material. The PA-meso-silica membrane achieved a high proton conductivity of 5 × 10(-3) to 5 × 10(-2) S cm(-1) in a temperature range of 80-220 °C, which is between 1 and 2 orders of magnitudes higher than a typical membrane Nafion 117 or polybenzimidazole (PBI)/PA in the absence of external humidification. Furthermore, the PA-meso-silica membranes exhibited good chemical stability along with high performance at elevated temperatures, producing a peak power density of 632 mW cm(-2) using a H2 fuel at 190 °C in the absence of external humidification. The high membrane proton conductivity and excellent fuel cell performance demonstrate the utility of PA-meso-silica as a new class of inorganic proton exchange membranes for use in the high-temperature proton exchange membrane fuel cells (PEMFCs). PMID:24125494

  6. Effect of polyvinylpyrrolidone on mesoporous silica morphology and esterification of lauric acid with 1-butanol catalyzed by immobilized enzyme

    NASA Astrophysics Data System (ADS)

    Zhang, Jinyu; Zhou, Guowei; Jiang, Bin; Zhao, Minnan; Zhang, Yan


    Mesoporous silica materials with a range of morphology evolution, i.e., from curved rod-shaped mesoporous silica to straight rod-shaped mesoporous silica, were successfully prepared using polyvinylpyrrolidone (PVP) and triblock copolymer as dual template. The effects of PVP molecular weight and concentration on mesoporous silica structure parameters were studied. Results showed that surface area and pore volume continuously decreased with increased PVP molecular weight. Mesoporous silica prepared with PVP K30 also possessed larger pore diameter, interplanar spacing (d100), and cell parameter (a0) than that prepared with PVP K15 and PVP K90. In addition, with increased PVP concentration, d100 and a0 continuously decreased. The mechanism of morphology evolution caused by the change in PVP concentration was investigated. The conversion rate of lauric acid with 1-butanol catalyzed by immobilized Porcine pancreatic lipase (PPL) was also evaluated. Results showed that PPL immobilized on amino-functionalized straight rod-shaped mesoporous silica maintained 50% of its esterification conversion rate even after five cycles of use with a maximum conversion rate was about 90.15%.

  7. Codelivery of anticancer drugs and siRNA by mesoporous silica nanoparticles.


    Hanafi-Bojd, Mohammad Yahya; Ansari, Legha; Malaekeh-Nikouei, Bizhan


    The most common method for cancer treatment is chemotherapy. Multidrug resistance (MDR) is one of the major obstacles in chemotherapeutic treatment of many human cancers. One strategy to overcome this challenge is the delivery of anticancer drugs and siRNA simultaneously using nanoparticles. Mesoporous silica nanoparticles are one of the most popular nanoparticles for cargo delivery because of their intrinsic porosity. This paper highlights recent advances in codelivery of chemotherapeutic and siRNA with mesoporous silica nanoparticles for cancer therapy. In addition, synthesis and functionalization approaches of these nanoparticles are summarized. This review presents insight into the utilization of nanoparticles and combination therapy to achieve more promising results in chemotherapy. PMID:27582236

  8. Controlled synthesis of uniform and monodisperse upconversion core/mesoporous silica shell nanocomposites for bimodal imaging.


    Liu, Jianan; Bu, Wenbo; Zhang, Shengjian; Chen, Feng; Xing, Huaiyong; Pan, Limin; Zhou, Liangping; Peng, Weijun; Shi, Jianlin


    Here we report the design and controlled synthesis of monodisperse and precisely size-controllable UCNP@mSiO(2) nanocomposites smaller than 50 nm by directly coating a mesoporous silica shell (mSiO(2)) on upconversion nanocrystals NaYF(4):Tm/Yb/Gd (UCNPs), which can be used as near-infrared fluorescence and magnetic resonance imaging (MRI) agents and a platform for drug delivery as well. Some key steps such as transferring hydrophobic UCNPs to the water phase by using cetyltrimethylammonium bromide (CTAB), removal of the excess amount of CTAB, and temperature-controlled ultrasonication treatment should be adopted and carefully monitored to obtain uniform upconversion core/mesoporous silica shell nanocomposites. The excellent performance of the core-shell-structured nanocomposite in near-infrared fluorescence and magnetic resonance imaging was also demonstrated. PMID:22252972

  9. Interfacially Controlled Synthesis of Hollow Mesoporous Silica Spheres with Radially Oriented Pore Structures

    SciTech Connect

    Li, Juan; Liu, Jun; Wang, Donghai; Guo, Ruisong; Li, Xiaolin; Qi, Wen N.


    This paper reports an alternative process to prepare hollow mesoporous silica spheres (HMS) using a single cationic surfactant with a tunable wall thickness and radially oriented pore structures. Using N,N-dimethylformide (DMF) as the intermediate solvent bridging the organic and aqueous phase, hollow mesoporous silica spheres were synthesized with interfacial hydrolysis reactions at the surface of liquid droplets. These spheres have an ordered pore structure aligned along the radial direction, and the wall thickness and sphere sizes can be tuned by adjusting the experimental conditions. Transmission electron microscopy and nitrogen absorption techniques were used to characterize HMS and its formation procedure. A hypothetic formation mechanism was proposed on the basis of a morphology transformation with the correct amount of DMF and a careful observation of the early hydrolysis stages. Au and magnetic Fe3O4 nanoparticles have been encapsulated in the HMS hollow core for potential applications.

  10. Interfacially controlled synthesis of hollow mesoporous silica spheres with radially oriented pore structures.


    Li, Juan; Liu, Jun; Wang, Donghai; Guo, Ruisong; Li, Xiaolin; Qi, Wen


    This paper reports an alternative process to prepare hollow mesoporous silica spheres (HMS) using a single cationic surfactant with a tunable wall thickness and radially oriented pore structures. Using N,N-dimethylformide (DMF) as the intermediate solvent bridging the organic and aqueous phase, hollow mesoporous silica spheres were synthesized with interfacial hydrolysis reactions at the surface of liquid droplets. These spheres have an ordered pore structure aligned along the radial direction, and the wall thickness and sphere sizes can be tuned by adjusting the experimental conditions. Transmission electron microscopy and nitrogen absorption techniques were used to characterize HMS and its formation procedure. A hypothetic formation mechanism was proposed on the basis of a morphology transformation with the correct amount of DMF and a careful observation of the early hydrolysis stages. Au and magnetic Fe(3)O(4) nanoparticles have been encapsulated in the HMS hollow core for potential applications. PMID:20575542

  11. Potential of ordered mesoporous silica for oral delivery of poorly soluble drugs.


    Vialpando, Monica; Martens, Johan A; Van den Mooter, Guy


    The use of ordered mesoporous silica is one of the more recent and rapidly developing formulation techniques for enhancing the solubility of poorly water-soluble drugs. Their large surface area and pore volume make ordered mesoporous silica materials excellent candidates for efficient drug loading and rapid release. While this new approach offers many promising advantages, further research is still necessary to elucidate the molecular mechanisms and to improve our scientific insight into the behavior of this system. In this review, the significant developments to date are presented and research challenges highlighted. Aspects of downstream processability are discussed in view of their special bulk powder properties and unique pore architecture. Lastly, perspectives for successful oral dosage form development are presented. PMID:22833866

  12. Biomedical Applications of Functionalized Hollow Mesoporous Silica Nanoparticles: Focusing on Molecular Imaging

    PubMed Central

    Shi, Sixiang; Chen, Feng; Cai, Weibo


    Hollow mesoporous silica nanoparticles (HMSNs), with a large cavity inside each original mesoporous silica nanoparticle (MSN), have recently gained increasing interest due to their tremendous potential for cancer imaging and therapy. The last several years have witnessed a rapid development in engineering of functionalized HMSNs (i.e. f-HMSNs) with various types of inorganic functional nanocrystals integrated into the system for imaging and therapeutic applications. In this review article, we summarize the recent progress in the design and biological applications of f-HMSNs, with a special emphasis on molecular imaging. Commonly used synthetic strategies for the generation of high quality HMSNs will be discussed in detail, followed by a systematic review of engineered f-HMSNs for optical, positron emission tomography, magnetic resonance, and ultrasound imaging in preclinical studies. Lastly, we also discuss the challenges and future research directions regarding the use of f-HMSNs for cancer imaging and therapy. PMID:24279491

  13. New triethoxysilylated 10-vertex closo-decaborate clusters. Synthesis and controlled immobilization into mesoporous silica.


    Abi-Ghaida, Fatima; Laila, Zahra; Ibrahim, Ghassan; Naoufal, Daoud; Mehdi, Ahmad


    Novel silylated hydroborate clusters comprising the closo-decaborate cage were prepared and characterized by (1)H, (13)C, (11)B, (29)Si NMR and mass spectroscopy ESI. The synthesis of such silylated clusters was achieved using reactive derivatives of [B10H10](2-), [1-B10H9N2](-) and [2-B10H9CO](-). These silylated decaborate clusters constitute a new class of precursors that can be covalently anchored onto various silica supports without any prior surface modification. As a proof of concept, the synthesized precursors were successfully anchored on mesoporous silica, SBA-15 type, in different percentages, where the mesoporous material retained its structure. All materials modified with closo-decaborate were characterized by (11)B and (29)Si solid state NMR, XRD, TEM and nitrogen sorption. PMID:25042868

  14. Nanorods of Various Oxides and Hierarchically Structured Mesoporous Silica by Sol-Gel Electrophoresis

    SciTech Connect

    Limmer, Steven J.; Hubler, Timothy L.; Cao, Guozhong


    In this paper, we report the template-based growth of nanorods of oxides and hierarchically structured mesoporous silica, formed by means of a combination of sol-gel processing and elecrophoretic deposition. Both single metal oxides (TiO2) and complex oxides (Pb(Zr0.52Ti0.48)O3) have been grown by this method. This method has also been applied to the growth of nanorods of mesoporous silica having an ordered pore structure, where the pores are aligned parallel to the long axis of the nanorod. Uniformly sized nanorods of about 125-200 nm in diameter and 10 um in length were grown over large areas with near unidirectional alignment. Appropriate sol preparation yielded the desired stoichiometric chemical composition and crystal structure of the oxide nanorods, with a heat treatment (500-700 C for 15-30 min) for crystallization, densification and any necessary pyrolysis.

  15. Large pore mesoporous silica nanomaterials for application in delivery of biomolecules

    NASA Astrophysics Data System (ADS)

    Knežević, Nikola Ž.; Durand, Jean-Olivier


    Various approaches for the synthesis of mesoporous silicate nanoparticles (MSN) with large pore (LP) diameters (in the range of 3-50 nm) are reviewed in this article. The work also covers the construction of magnetic analogues of large pore-mesoporous silica nanoparticles (LPMMSN) and their biomedical applications. The constructed materials exhibit vast potential for application in the loading and delivery of large drug molecules and biomolecules. Literature reports on the application of LPMSN and LPMMSN materials for the adsorption and delivery of proteins, enzymes, antibodies, and nucleic acids are covered in depth, which exemplify their highly potent characteristics for use in drug and biomolecule delivery to diseased tissues.Various approaches for the synthesis of mesoporous silicate nanoparticles (MSN) with large pore (LP) diameters (in the range of 3-50 nm) are reviewed in this article. The work also covers the construction of magnetic analogues of large pore-mesoporous silica nanoparticles (LPMMSN) and their biomedical applications. The constructed materials exhibit vast potential for application in the loading and delivery of large drug molecules and biomolecules. Literature reports on the application of LPMSN and LPMMSN materials for the adsorption and delivery of proteins, enzymes, antibodies, and nucleic acids are covered in depth, which exemplify their highly potent characteristics for use in drug and biomolecule delivery to diseased tissues. Dedicated to Professor Jeffrey I. Zink on the occasion of his 70th birthday.

  16. Phosphate adsorption on aluminum-coordinated functionalized macroporous–mesoporous silica: Surface structure and adsorption behavior

    SciTech Connect

    Huang, Weiya; Li, Dan; Zhu, Yi; Xu, Kai; Li, Jianqiang; Han, Boping; Zhang, Yuanming


    Graphical abstract: - Highlights: • Al-coordinated functionalized macroporous–mesoporous silica for phosphate removal. • It had the maximum adsorption capacity of 23.59 mg P/g. • Over 95% of the final adsorption capacity reached in the first 1 min. - Abstract: In this study, Al(III)-coordinated diamino-functionalized macroporous–mesoporous silica was synthesized and characterized by X-ray diffraction, N{sub 2} adsorption–desorption, Fourier transform infrared spectroscopy, scanning and transmission electron microscopy. Because of well-defined and interconnecting macroporous–mesoporous networks, the resulting adsorbent (MM-SBA) exhibited a significantly better phosphate adsorption performance and faster removal rate, as compared with the mesoporous adsorbent (M-SBA). Based on the Freundlich and Langmuir models, the phosphate adsorption capacity and the maximum adsorption capacity of MM-SBA were 7.99 mg P/g and 23.59 mg P/g, respectively. In the kinetic study of MM-SBA, over 95% of its final adsorption capacity reached in the first 1 min; whereas that of M-SBA was less than 79%.

  17. Mesoporous and biocompatible surface active silica aerogel synthesis using choline formate ionic liquid.


    Meera, Kamal Mohamed Seeni; Sankar, Rajavelu Murali; Jaisankar, Sellamuthu N; Mandal, Asit Baran


    In this paper, we report the preparation and characterization of mesoporous and biocompatible transparent silica aerogel by the sol-gel polymerization of tetraethyl orthosilicate using ionic liquid. Choline cation based ionic liquid allows the silica framework to form in a non collapsing environment and controls the pore size of the gel. FT-IR spectra reveal the interaction of ionic liquid with surface -OH of the gel. DSC thermogram giving the evidence of confinement of ionic liquid within the silica matrix, which helps to avoid the shrinkage of the gel during the aging process. Nitrogen sorption measurements of gel prepared with ionic liquid exhibit a low surface area of 100.53 m2/g and high average pore size of 3.74 nm. MTT assay proves the biocompatibility and cell viability of the prepared gels. This new nanoporous silica material can be applied to immobilize biological molecules, which may retain their stability over a longer period. PMID:21565470

  18. Efficient Immobilization of Ammonium Tungstophosphate at the Mesoporous Silica Support for the Removal of Cs Ion.


    Park, Younjin; Shin, Won Sik; Choi, Sang-June


    The ammonium salt of phosphotugstic acid (NH4PTA) deposited on the surface of mesoporous silica (SBA-15) support was prepared and characterized using several analytical techniques. The spectroscopic results showed that the NH4PTA was evenly dispersed on the internal and external silica surfaces. The ion exchange capacity tests demonstrated that the specific activity for Cs removal increased with insertion of the NH4PTA phase on the silica surface. The results showed that the ion exchange capacity of Cs increased with increasing the PTA loading. The NH4PTA at a loading of 50 wt% supported on silica showed the highest ion exchange capacity for Cs ion among the loading range of 20-50 wt%. The effects of co-existing cations and nitric acid on the Cs sorption efficiency onto the composites were also studied. PMID:26716312

  19. Effects of electric field on confined electrolyte in a hexagonal mesoporous silica

    NASA Astrophysics Data System (ADS)

    Lu, Weiyi; Kim, Taewan; Han, Aijie; Chen, Xi; Qiao, Yu


    In an electrowetting experiment on a surface treated hexagonal mesoporous silica, it is noticed that the effective solid-liquid interfacial tension is quite insensitive to the applied voltage, while the accessible nanopore volume decreases significantly as the voltage is increased. When the voltage is higher than 900 V, the liquid infiltration cannot be detected. The liquid defiltration is quite insensitive to the electric field. These unique phenomena may be attributed to the field responsive ion behaviors in the confining nanoenvironment.

  20. Mesoporous silica nanotubes hybrid membranes for functional nanofiltration

    NASA Astrophysics Data System (ADS)

    El-Safty, Sherif A.; Shahat, Ahmed; Mekawy, Moataz; Nguyen, Hoa; Warkocki, Wojciech; Ohnuma, Masato


    The development of nanofiltration systems would greatly assist in the production of well-defined particles and biomolecules with unique properties. We report a direct, simple synthesis of hexagonal silica nanotubes (NTs), which vertically aligned inside anodic alumina membranes (AAM) by means of a direct templating method of microemulsion phases with cationic surfactants. The direct approach was used as soft templates for predicting ordered assemblies of surfactant/silica composites through strong interactions within AAM pockets. Thus, densely packed NTs were successfully formed in the entirety of the AAM channels. These silica NTs were coated with layers of organic moieties to create a powerful technique for the ultrafine filtration. The resulting modified-silica NTs were chemically robust and showed affinity toward the transport of small molecular particles. The rigid silica NTs inside AAM channels had a pore diameter of <= 4 nm and were used as ultrafine filtration systems for noble metal nanoparticles (NM NPs) and semiconductor nanocrystals (SC NCs) fabricated with a wide range of sizes (1.0-50 nm) and spherical/pyramidal morphologies. Moreover, the silica NTs hybrid membranes were also found to be suitable for separation of biomolecules such as cytochrome c (CytC). Importantly, this nanofilter design retains high nanofiltration efficiency of NM NPs, SC NCs and biomolecules after a number of reuse cycles. Such retention is crucial in industrial applications.

  1. Self-assembly of supramolecular triarylamine nanowires in mesoporous silica and biocompatible electrodes thereof.


    Licsandru, Erol-Dan; Schneider, Susanne; Tingry, Sophie; Ellis, Thomas; Moulin, Emilie; Maaloum, Mounir; Lehn, Jean-Marie; Barboiu, Mihail; Giuseppone, Nicolas


    Biocompatible silica-based mesoporous materials, which present high surface areas combined with uniform distribution of nanopores, can be organized in functional nanopatterns for a number of applications. However, silica is by essence an electrically insulating material which precludes applications for electro-chemical devices. The formation of hybrid electroactive silica nanostructures is thus expected to be of great interest for the design of biocompatible conducting materials such as bioelectrodes. Here we show that we can grow supramolecular stacks of triarylamine molecules in the confined space of oriented mesopores of a silica nanolayer covering a gold electrode. This addressable bottom-up construction is triggered from solution simply by light irradiation. The resulting self-assembled nanowires act as highly conducting electronic pathways crossing the silica layer. They allow very efficient charge transfer from the redox species in solution to the gold surface. We demonstrate the potential of these hybrid constitutional materials by implementing them as biocathodes and by measuring laccase activity that reduces dioxygen to produce water. PMID:26892311

  2. Coherent anti-Stokes Raman scattering microscopy driving the future of loaded mesoporous silica imaging.


    Fussell, Andrew L; Mah, Pei Ting; Offerhaus, Herman; Niemi, Sanna-Mari; Salonen, Jarno; Santos, Hélder A; Strachan, Clare


    This study reports the use of variants of coherent anti-Stokes Raman scattering (CARS) microscopy as a novel method for improved physicochemical characterization of drug-loaded silica particles. Ordered mesoporous silica is a biomaterial that can be loaded to carry a number of biochemicals, including poorly water-soluble drugs, by allowing the incorporation of drug into nanometer-sized pores. In this work, the loading of two poorly water-soluble model drugs, itraconazole and griseofulvin, in MCM-41 silica microparticles is characterized qualitatively, using the novel approach of CARS microscopy, which has advantages over other analytical approaches used to date and is non-destructive, rapid, label free, confocal and has chemical and physical specificity. The study investigated the effect of two solvent-based loading methods, namely immersion and rotary evaporation, and microparticle size on the three-dimensional (3-D) distribution of the two loaded drugs. Additionally, hyperspectral CARS microscopy was used to confirm the amorphous nature of the loaded drugs. Z-stacked CARS microscopy suggested that the drug, but not the loading method or particle size range, affected 3-D drug distribution. Hyperspectral CARS confirmed that the drug loaded in the MCM-41 silica microparticles was in an amorphous form. The results show that CARS microscopy and hyperspectral CARS microscopy can be used to provide further insights into the structural nature of loaded mesoporous silica microparticles as biomaterials. PMID:25064000

  3. Alendronate decorated nano hydroxyapatite in mesoporous silica: Cytotoxicity and osteogenic properties

    NASA Astrophysics Data System (ADS)

    Huang, Wei; Liu, Weiqiang; She, Zhending; Wu, Hongkai; Shi, Xuetao


    Mesoporous silica is a promising drug delivery vehicle due to its large surface area and order porous structure. Hydroxyapatite-modified mesoporous silica materials (MSH) have been developed, and the cytotoxicity of MSH and unmodified mesoporous silica (HMS) has also been studied in this work. The results indicated that MSH exhibited lower cytotoxicity than HMS. The drug release property of MSH was also investigated in this paper. Alendronate (AL) was laden into MSH and HMS, respectively. MSH exhibited long release period lasting over 30 days with a weak burst release in the first 5 days; however, the AL release period of HMS was just 5 days with a remarkable burst release. In addition, the osteogenic commitment induced in human marrow mesenchymal stem cells (MSCs) by MSH-alendronate (MSH-AL) was also investigated, and the osteogenesis of MSCs was evaluated by alkaline phosphatase (ALP) assay. The osteogenesis of MSCs induced by MSH-AL is comparable to that induced by the osteogenic medium. Taken together, MSH can be severed as potential bone repair materials with lower cytotoxicity.

  4. Cancer therapy improvement with mesoporous silica nanoparticles combining photodynamic and photothermal therapy.


    Zhao, Z X; Huang, Y Z; Shi, S G; Tang, S H; Li, D H; Chen, X L


    In this work, we develop novel mesoporous silica composite nanoparticles (hm-SiO2(AlC4Pc)@Pd) for the co-delivery of photosensitizer (PS) tetra-substituted carboxyl aluminum phthalocyanine (AlC4Pc) and small Pd nanosheets as a potential dual carrier system to combine photodynamic therapy (PDT) with photothermal therapy (PTT). In the nanocomposite, PS AlC4Pc was covalently conjugated to a mesoporous silica network, and small Pd nanosheets were coated onto the surface of mesoporous silica by both coordination and electrostatic interaction. Since small Pd nanosheets and AlC4Pc display matched maximum absorptions in the 600-800 nm near-infrared (NIR) region, the fabricated hm-SiO2(AlC4Pc)@Pd nanocomposites can generate both singlet oxygen and heat upon 660 nm single continuous wavelength (CW) laser irradiation. In vitro results indicated that the cell-killing efficacy by simultaneous PDT/PTT treatment using hm-SiO2(AlC4Pc)@Pd was higher than PDT or PTT treatment alone after exposure to a 660 nm CW-NIR laser. PMID:24971525

  5. Large-Pore Mesoporous Silica with Three-Dimensional Wormhole Framework Structures.


    Park, In; Pinnavaia, Thomas J


    Large-pore mesoporous silica with 3D wormhole framework structures (denoted MSU-J) are prepared through a supramolecular hydrogen-bonding assembly pathway from low-cost sodium silicate as the silica source and commercially available mono- and triamine Jeffamine and Surfonamine surfactants as structure-directing porogens. The calcined mesostructures exhibit large pore sizes (up to 8.2 nm), surface areas (632-1030 m(2)/g) and pore volumes (0.5-2.0 cm(3)/g), depending on the surfactant chain length and synthesis temperature (25-65 °C). The textural properties of these new wormhole mesostructures are comparable to those of hexagonal SBA-15 derivatives and large pore MCM-48. However, unlike the SBA-15 structure type, wherein the 3D pore network is formed by connecting 1D cylindrical mesopores through micropores, MSU-J mesophases have wormhole framework structures containing fully interconnected 3D mesopores that can minimize the diffusion limitations often encountered in adsorption and chemical catalysis. Also, unlike large pore MCM-48, which requires cost-intensive tetraethylorthosilicate as a silica source and the use of a co-surfactant as a pore expander under strong acid conditions, MSU-J mesostructures are assembled from low cost sodium silicate in the presence of a single Jeffamine or Surfonamine porogen at near-neutral pH. PMID:20126285

  6. Cancer therapy improvement with mesoporous silica nanoparticles combining photodynamic and photothermal therapy

    NASA Astrophysics Data System (ADS)

    Zhao, Z. X.; Huang, Y. Z.; Shi, S. G.; Tang, S. H.; Li, D. H.; Chen, X. L.


    In this work, we develop novel mesoporous silica composite nanoparticles (hm-SiO2(AlC4Pc)@Pd) for the co-delivery of photosensitizer (PS) tetra-substituted carboxyl aluminum phthalocyanine (AlC4Pc) and small Pd nanosheets as a potential dual carrier system to combine photodynamic therapy (PDT) with photothermal therapy (PTT). In the nanocomposite, PS AlC4Pc was covalently conjugated to a mesoporous silica network, and small Pd nanosheets were coated onto the surface of mesoporous silica by both coordination and electrostatic interaction. Since small Pd nanosheets and AlC4Pc display matched maximum absorptions in the 600-800 nm near-infrared (NIR) region, the fabricated hm-SiO2(AlC4Pc)@Pd nanocomposites can generate both singlet oxygen and heat upon 660 nm single continuous wavelength (CW) laser irradiation. In vitro results indicated that the cell-killing efficacy by simultaneous PDT/PTT treatment using hm-SiO2(AlC4Pc)@Pd was higher than PDT or PTT treatment alone after exposure to a 660 nm CW-NIR laser.

  7. Protocells: Modular Mesoporous Silica Nanoparticle-Supported Lipid Bilayers for Drug Delivery.


    Butler, Kimberly S; Durfee, Paul N; Theron, Christophe; Ashley, Carlee E; Carnes, Eric C; Brinker, C Jeffrey


    Mesoporous silica nanoparticle-supported lipid bilayers, termed 'protocells,' represent a potentially transformative class of therapeutic and theranostic delivery vehicle. The field of targeted drug delivery poses considerable challenges that cannot be addressed with a single 'magic bullet'. Consequently, the protocell has been designed as a modular platform composed of interchangeable biocompatible components. The mesoporous silica core has variable size and shape to direct biodistribution and a controlled pore size and surface chemistry to accommodate diverse cargo. The encapsulating supported lipid bilayer can be modified with targeting and trafficking ligands as well as polyethylene glycol (PEG) to effect selective binding, endosomal escape of cargo, drug efflux prevention, and potent therapeutic delivery, while maintaining in vivo colloidal stability. This review describes the individual components of the platform, including the mesoporous silica nanoparticle core and supported lipid bilayer, their assembly (by multiple techniques) into a protocell, and the combined, often synergistic, performance of the protocell based on in vitro and in vivo studies, including the assessment of biocompatibility and toxicity. In closing, the many emerging variations of the protocell theme and the future directions for protocell research are commented on. PMID:26780591

  8. Fabrication of high specificity hollow mesoporous silica nanoparticles assisted by Eudragit for targeted drug delivery.


    She, Xiaodong; Chen, Lijue; Velleman, Leonora; Li, Chengpeng; Zhu, Haijin; He, Canzhong; Wang, Tao; Shigdar, Sarah; Duan, Wei; Kong, Lingxue


    Hollow mesoporous silica nanoparticles (HMSNs) are one of the most promising carriers for effective drug delivery due to their large surface area, high volume for drug loading and excellent biocompatibility. However, the non-ionic surfactant templated HMSNs often have a broad size distribution and a defective mesoporous structure because of the difficulties involved in controlling the formation and organization of micelles for the growth of silica framework. In this paper, a novel "Eudragit assisted" strategy has been developed to fabricate HMSNs by utilising the Eudragit nanoparticles as cores and to assist in the self-assembly of micelle organisation. Highly dispersed mesoporous silica spheres with intact hollow interiors and through pores on the shell were fabricated. The HMSNs have a high surface area (670 m(2)/g), small diameter (120 nm) and uniform pore size (2.5 nm) that facilitated the effective encapsulation of 5-fluorouracil within HMSNs, achieving a high loading capacity of 194.5 mg(5-FU)/g(HMSNs). The HMSNs were non-cytotoxic to colorectal cancer cells SW480 and can be bioconjugated with Epidermal Growth Factor (EGF) for efficient and specific cell internalization. The high specificity and excellent targeting performance of EGF grafted HMSNs have demonstrated that they can become potential intracellular drug delivery vehicles for colorectal cancers via EGF-EGFR interaction. PMID:25617610

  9. Mesoporous silica as a membrane for ultra-thin implantable direct glucose fuel cells.


    Sharma, Tushar; Hu, Ye; Stoller, Meryl; Feldman, Marc; Ruoff, Rodney S; Ferrari, Mauro; Zhang, Xiaojing


    The design, fabrication and characterization of an inorganic catalyst based direct glucose fuel cell using mesoporous silica coating as a functional membrane is reported. The desired use of mesoporous silica based direct glucose fuel cell is for a blood vessel implantable device. Blood vessel implantable direct glucose fuel cells have access to higher continuous glucose concentrations. However, reduction in the implant thickness is required for application in the venous system as part of a stent. We report development of an implantable device with a platinum thin-film (thickness: 25 nm) deposited on silicon substrate (500 μm) to serve as the anode, and graphene pressed on a stainless steel mesh (175 μm) to serve as the cathode. Control experiments involved the use of a surfactant-coated polypropylene membrane (50 μm) with activated carbon (198 μm) electrodes. We demonstrate that a mesoporous silica thin film (270 nm) is capable of replacing the conventional polymer based membranes with an improvement in the power generated over conventional direct glucose fuel cells. PMID:21637881

  10. Predictable Heating and Positive MRI Contrast from a Mesoporous Silica-Coated Iron Oxide Nanoparticle.


    Hurley, Katie R; Ring, Hattie L; Etheridge, Michael; Zhang, Jinjin; Gao, Zhe; Shao, Qi; Klein, Nathan D; Szlag, Victoria M; Chung, Connie; Reineke, Theresa M; Garwood, Michael; Bischof, John C; Haynes, Christy L


    Iron oxide nanoparticles have great potential as diagnostic and therapeutic agents in cancer and other diseases; however, biological aggregation severely limits their function in vivo. Aggregates can cause poor biodistribution, reduced heating capability, and can confound their visualization and quantification by magnetic resonance imaging (MRI). Herein, we demonstrate that the incorporation of a functionalized mesoporous silica shell can prevent aggregation and enable the practical use of high-heating, high-contrast iron oxide nanoparticles in vitro and in vivo. Unmodified and mesoporous silica-coated iron oxide nanoparticles were characterized in biologically relevant environments including phosphate buffered saline, simulated body fluid, whole mouse blood, lymph node carcinoma of prostate (LNCaP) cells, and after direct injection into LNCaP prostate cancer tumors in nude mice. Once coated, iron oxide nanoparticles maintained colloidal stability along with high heating and relaxivity behaviors (SARFe = 204 W/g Fe at 190 kHz and 20 kA/m and r1 = 6.9 mM(-1) s(-1) at 1.4 T). Colloidal stability and minimal nonspecific cell uptake allowed for effective heating in salt and agarose suspensions and strong signal enhancement in MR imaging in vivo. These results show that (1) aggregation can lower the heating and imaging performance of magnetic nanoparticles and (2) a coating of functionalized mesoporous silica can mitigate this issue, potentially improving clinical planning and practical use. PMID:26991550

  11. Doxorubicin-loaded mesoporous silica nanoparticle composite nanofibers for long-term adjustments of tumor apoptosis

    NASA Astrophysics Data System (ADS)

    Yuan, Ziming; Pan, Yue; Cheng, Ruoyu; Sheng, Lulu; Wu, Wei; Pan, Guoqing; Feng, Qiming; Cui, Wenguo


    There is a high local recurrence (LR) rate in breast-conserving therapy (BCT) and enhancement of the local treatment is promising as a way to improve this. Thus we propose a drug delivery system using doxorubicin (DOX)-loaded mesoporous silica nanoparticle composite nanofibers which can release anti-tumor drugs in two phases—burst release in the early stage and sustained release at a later stage—to reduce the LR of BCT. In the present study, we designed a novel composite nanofibrous scaffold to realize the efficient release of drugs by loading both DOX and DOX-loaded mesoporous silica nanoparticles into an electrospun PLLA nanofibrous scaffold. In vitro results demonstrated that this kind of nanomaterial can release DOX in two phases, and the results of in vivo experiments showed that this hybrid nanomaterial significantly inhibited the tumor growth in a solid tumor model. Histopathological examination demonstrated that the apoptosis of tumor cells in the treated group over a 10 week period was significant. The anti-cancer effects were also accompanied with decreased expression of Bcl-2 and TNF-α, along with up-regulation of Bax, Fas and the activation of caspase-3 levels. The present study illustrates that the mesoporous silica nanoparticle composite nanofibrous scaffold could have anti-tumor properties and could be further developed as adjuvant therapeutic protocols for the treatment of cancer.

  12. Biological applications and transmission electron microscopy investigation of mesoporous silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Trewyn, Brian G.

    The research presented and discussed within involves the development of novel biological applications of mesoporous silica nanoparticles (MSN) and an investigation of mesoporous material by transmission electron microscopy (TEM). A series of room-temperature ionic liquid (RTIL) containing mesoporous silica nanoparticle (MSN) materials with various particle morphologies, including spheres, ellipsoids, rods, and tubes, were synthesized. By changing the RTIL template, the pore morphology was tuned from the MCM-41 type of hexagonal mesopores to rotational moire type of helical channels, and to wormhole-like porous structures. These materials were used as controlled release delivery nanodevices to deliver antibacterial ionic liquids against Escherichia coli K12. The involvement of a specific organosiloxane function group, covalently attached to the exterior of fluorescein doped mesoporous silica nanoparticles (FITC-MSN), on the degree and kinetics of endocytosis in cancer and plant cells was investigated. The kinetics of endocystosis of TEG coated FITC-MSN is significantly quicker than FITC-MSN as determined by flow cytometry experiments. The fluorescence confocal microscopy investigation showed the endocytosis of TEG coated-FITC MSN triethylene glycol grafted fluorescein doped MSN (TEG coated-FITC MSN) into both HeLa cells and Tobacco root protoplasts. Once the synthesis of a controlled-release delivery system based on MCM-41-type mesoporous silica nanorods capped by disulfide bonds with superparamagnetic iron oxide nanoparticles was completed. The material was characterized by general methods and the dosage and kinetics of the antioxidant dependent release was measured. Finally, the biological interaction of the material was determined along with TEM measurements. An electron microscopy investigation proved that the pore openings of the MSN were indeed blocked by the Fe 3O4 nanoparticles. The biological interaction investigation demonstrated Fe3O4-capped MSN

  13. Surface engineering on mesoporous silica chips for enriching low molecular weight phosphorylated proteins

    NASA Astrophysics Data System (ADS)

    Hu, Ye; Peng, Yang; Lin, Kevin; Shen, Haifa; Brousseau, Louis C., III; Sakamoto, Jason; Sun, Tong; Ferrari, Mauro


    Phosphorylated peptides and proteins play an important role in normal cellular activities, e.g., gene expression, mitosis, differentiation, proliferation, and apoptosis, as well as tumor initiation, progression and metastasis. However, technical hurdles hinder the use of common fractionation methods to capture phosphopeptides from complex biological fluids such as human sera. Herein, we present the development of a dual strategy material that offers enhanced capture of low molecular weight phosphoproteins: mesoporous silica thin films with precisely engineered pore sizes that sterically select for molecular size combined with chemically selective surface modifications (i.e. Ga3+, Ti4+ and Zr4+) that target phosphoroproteins. These materials provide high reproducibility (CV = 18%) and increase the stability of the captured proteins by excluding degrading enzymes, such as trypsin. The chemical and physical properties of the composite mesoporous thin films were characterized by X-ray diffraction, transmission electron microscopy, X-ray photoelectron spectroscopy, energy dispersive X-ray spectroscopy and ellipsometry. Using mass spectroscopy and biostatistics analysis, the enrichment efficiency of different metal ions immobilized on mesoporous silica chips was investigated. The novel technology reported provides a platform capable of efficiently profiling the serum proteome for biomarker discovery, forensic sampling, and routine diagnostic applications.Phosphorylated peptides and proteins play an important role in normal cellular activities, e.g., gene expression, mitosis, differentiation, proliferation, and apoptosis, as well as tumor initiation, progression and metastasis. However, technical hurdles hinder the use of common fractionation methods to capture phosphopeptides from complex biological fluids such as human sera. Herein, we present the development of a dual strategy material that offers enhanced capture of low molecular weight phosphoproteins: mesoporous

  14. Heterogeneous copper-silica catalyst from agricultural biomass and its catalytic activity

    NASA Astrophysics Data System (ADS)

    Andas, Jeyashelly; Adam, Farook; Rahman, Ismail Ab.


    A series of highly mesoporous copper catalysts (5-20 wt.%) supported on silica rice husk were synthesized via sol-gel route at room temperature. The FT-IR and 29Si MAS NMR spectroscopic studies revealed the successful substitution of copper into the silica matrix. Copper in the +2 oxidation state was evidenced from the DR/UV-vis and XPS analyses. Introduction of copper up to 10 wt.% (RH-10Cu) results in a progressive enhancement in the BET surface area. The activity of the copper catalysts was studied in the liquid-phase oxidation of phenol with H2O2 yielding catechol (CAT) and hydroquinone (HQ). Phenol conversion was influenced by various experimental conditions such as temperature, catalyst dosage, molar ratio of reactants, nature of solvent and percentage metal loading. Excellent activity was achieved when 10 wt.% copper was used and decreased with further increase in the copper loading. RH-10Cu could be regenerated several times without significant loss in the catalytic activity.

  15. Probing hydrodesulfurization over bimetallic phosphides using monodisperse Ni2-xMxP nanoparticles encapsulated in mesoporous silica

    NASA Astrophysics Data System (ADS)

    Danforth, Samuel J.; Liyanage, D. Ruchira; Hitihami-Mudiyanselage, Asha; Ilic, Boris; Brock, Stephanie L.; Bussell, Mark E.


    Metal phosphide nanoparticles encapsulated in mesoporous silica provide a well-defined system for probing the fundamental chemistry of the hydrodesulfurization (HDS) reaction over this new class of hydrotreating catalysts. To investigate composition effects in bimetallic phosphides, the HDS of dibenzothiophene (DBT) was carried out over a series of Ni-rich Ni2-xMxP@mSiO2 (M = Co, Fe) nanocatalysts (x ≤ 0.50). The Ni2-xMxP nanoparticles (average diameters: 11-13 nm) were prepared by solution-phase arrested precipitation and encapsulated in mesoporous silica, characterized by a range of techniques (XRD, TEM, IR spectroscopy, BET surface area, CO chemisorption) and tested for DBT HDS activity and selectivity. The highest activity was observed for a Ni1.92Co0.08P@mSiO2 nanocatalyst, but the overall trend was a decrease in HDS activity with increasing Co or Fe content. In contrast, the highest turnover frequency (TOF) was observed for the most Co- and Fe-rich compositions based on sites titrated by CO chemisorption. IR spectral studies of adsorbed CO on the Ni2-xMxP@mSiO2 catalysts indicate that an increase in electron density occurs on Ni sites as the Co or Fe content is increased, which may be responsible for the increased TOFs of the catalytic sites. The Ni2-xMxP@mSiO2 nanocatalysts exhibit a strong preference for the direct desulfurization pathway (DDS) for DBT HDS that changes only slightly with increasing Co or Fe content.

  16. Electrografting of 3-Aminopropyltriethoxysilane on a Glassy Carbon Electrode for the Improved Adhesion of Vertically Oriented Mesoporous Silica Thin Films.


    Nasir, Tauqir; Zhang, Lin; Vilà, Neus; Herzog, Grégoire; Walcarius, Alain


    Vertically oriented mesoporous silica has proven to be of interest for applications in a variety of fields (e.g., electroanalysis, energy, and nanotechnology). Although glassy carbon is widely used as an electrode material, the adherence of silica deposits is rather poor, causing mechanical instability. A solution to improve the adhesion of mesoporous silica films onto glassy carbon electrodes without compromising the vertical orientation and the order of the mesopores will greatly contribute to the use of this kind of modified carbon electrode. We propose here the electrografting of 3-aminopropyltriethoxysilane on glassy carbon as a molecular glue to improve the mechanical stability of the silica film on the electrode surface without disturbing the vertical orientation and the order of the mesoporous silica obtained by electrochemically assisted self-assembly. These findings are supported by a series of surface chemistry techniques such as X-ray photoelectron spectroscopy, scanning and transmission electron microscopy, and cyclic voltammetry. Finally, methylviologen was used as a model redox probe to investigate the cathodic potential region of both glassy carbon and indium tin oxide electrodes modified with mesoporous silica in order to demonstrate further the interest in the approach developed here. PMID:27065214

  17. Synthesis of mesoporous carbon-silica-polyaniline and nitrogen-containing carbon-silica films and their corrosion behavior in simulated proton exchange membrane fuel cells environment

    NASA Astrophysics Data System (ADS)

    Wang, Tao; He, Jianping; Sun, Dun; Guo, Yunxia; Ma, Yiou; Hu, Yuan; Li, Guoxian; Xue, Hairong; Tang, Jing; Sun, Xin

    In this study, polyaniline is deposited onto mesoporous carbon-silica-coated 304 stainless steel using electropolymerization method. Variation of the electropolymerization time and applied potential can affect the growth of polyaniline, and lead to different structural and electrochemical properties of the films. Nitrogen-containing groups are successfully introduced onto the mesoporous carbon-silica film by pyrolyzing treatment under N 2 atmosphere and the electrical conductivity is improved observably compared with the carbon-silica film. The electrochemical properties of the mesoporous carbon-silica-polyaniline films and nitrogen-containing carbon-silica composite films are examined by using potentiodynamic polarization, potentiostatic polarization and electrochemical impedance spectroscopy. The corrosion tests in 0.5 M H 2SO 4 system display that the carbon-silica-polyaniline films show the optimal protective performance. However, according to potentiostatic polarization process, nitrogen-containing carbon-silica film with a water contact angle 95° is extremely stable and better for the protection of stainless steel in simulated fuel cell environment compared to carbon-silica-polyaniline film. Therefore, the nitrogen-containing carbon-silica-coated 304 stainless steel is a promising candidate for bipolar plate materials in PEMFCs.

  18. Waste-Glycerol-Directed Synthesis of Mesoporous Silica and Carbon with Superior Performance in Room-Temperature Hydrogen Production from Formic Acid

    NASA Astrophysics Data System (ADS)

    Lee, Dong-Wook; Jin, Min-Ho; Park, Ji Chan; Lee, Chun-Boo; Oh, Duckkyu; Lee, Sung-Wook; Park, Jin-Woo; Park, Jong-Soo


    The development of easier, cheaper, and more ecofriendly synthetic methods for mesoporous materials remains a challenging topic to commercialize them, and the transformation of waste glycerol, as a biodiesel byproduct, into something useful and salable is one of the pending issues to be resolved. Here we first report that mesoporous silica (KIE-6) and carbon (KIE-7) can be simultaneously synthesized by using cheap and ecofriendly crude-waste-glycerol of biodiesel with or without glycerol purification, and we demonstrated the excellent performance of the mesoporous material as a catalyst support for formic acid decomposition. As a result, Pd-MnOx catalysts supported on NH2-functionalized KIE-6 showed the highest catalytic activity (TOF: 540.6 h-1) ever reported for room-temperature formic acid decomposition without additives. Moreover, we conducted life-cycle assessment (LCA) from biomass cultivation through biodiesel production to KIE-6 and KIE-7 preparation, and it was confirmed that CO2 emission during synthesis of KIE-6 and KIE-7 could be reduced by 87.1% and 85.7%, respectively. We believe that our study suggested more ecofriendly and industry-friendly approaches for preparation of mesoporous materials, and utilization of waste glycerol.

  19. Waste-Glycerol-Directed Synthesis of Mesoporous Silica and Carbon with Superior Performance in Room-Temperature Hydrogen Production from Formic Acid.


    Lee, Dong-Wook; Jin, Min-Ho; Park, Ji Chan; Lee, Chun-Boo; Oh, Duckkyu; Lee, Sung-Wook; Park, Jin-Woo; Park, Jong-Soo


    The development of easier, cheaper, and more ecofriendly synthetic methods for mesoporous materials remains a challenging topic to commercialize them, and the transformation of waste glycerol, as a biodiesel byproduct, into something useful and salable is one of the pending issues to be resolved. Here we first report that mesoporous silica (KIE-6) and carbon (KIE-7) can be simultaneously synthesized by using cheap and ecofriendly crude-waste-glycerol of biodiesel with or without glycerol purification, and we demonstrated the excellent performance of the mesoporous material as a catalyst support for formic acid decomposition. As a result, Pd-MnOx catalysts supported on NH2-functionalized KIE-6 showed the highest catalytic activity (TOF: 540.6 h(-1)) ever reported for room-temperature formic acid decomposition without additives. Moreover, we conducted life-cycle assessment (LCA) from biomass cultivation through biodiesel production to KIE-6 and KIE-7 preparation, and it was confirmed that CO2 emission during synthesis of KIE-6 and KIE-7 could be reduced by 87.1% and 85.7%, respectively. We believe that our study suggested more ecofriendly and industry-friendly approaches for preparation of mesoporous materials, and utilization of waste glycerol. PMID:26515193

  20. Waste-Glycerol-Directed Synthesis of Mesoporous Silica and Carbon with Superior Performance in Room-Temperature Hydrogen Production from Formic Acid

    PubMed Central

    Lee, Dong-Wook; Jin, Min-Ho; Park, Ji Chan; Lee, Chun-Boo; Oh, Duckkyu; Lee, Sung-Wook; Park, Jin-Woo; Park, Jong-Soo


    The development of easier, cheaper, and more ecofriendly synthetic methods for mesoporous materials remains a challenging topic to commercialize them, and the transformation of waste glycerol, as a biodiesel byproduct, into something useful and salable is one of the pending issues to be resolved. Here we first report that mesoporous silica (KIE-6) and carbon (KIE-7) can be simultaneously synthesized by using cheap and ecofriendly crude-waste-glycerol of biodiesel with or without glycerol purification, and we demonstrated the excellent performance of the mesoporous material as a catalyst support for formic acid decomposition. As a result, Pd-MnOx catalysts supported on NH2-functionalized KIE-6 showed the highest catalytic activity (TOF: 540.6 h−1) ever reported for room-temperature formic acid decomposition without additives. Moreover, we conducted life-cycle assessment (LCA) from biomass cultivation through biodiesel production to KIE-6 and KIE-7 preparation, and it was confirmed that CO2 emission during synthesis of KIE-6 and KIE-7 could be reduced by 87.1% and 85.7%, respectively. We believe that our study suggested more ecofriendly and industry-friendly approaches for preparation of mesoporous materials, and utilization of waste glycerol. PMID:26515193

  1. A magnetic mesoporous silica nanoparticle-based drug delivery system for photosensitive cooperative treatment of cancer with a mesopore-capping agent and mesopore-loaded drug

    NASA Astrophysics Data System (ADS)

    Knežević, Nikola Ž.; Lin, Victor S.-Y.


    Lately, there has been a growing interest in anticancer therapy with a combination of different drugs that work by different mechanisms of action, which decreases the possibility that resistant cancer cells will develop. Herein we report on the development of a drug delivery system for photosensitive delivery of a known anticancer drug camptothecin along with cytotoxic cadmium sulfide nanoparticles from a magnetic drug nanocarrier. Core-shell nanoparticles consisting of magnetic iron-oxide-cores and mesoporous silica shells are synthesized with a high surface area (859 m2 g-1) and hexagonal packing of mesopores, which are 2.6 nm in diameter. The mesopores are loaded with anticancer drug camptothecin while entrances of the mesopores are blocked with 2-nitro-5-mercaptobenzyl alcohol functionalized CdS nanoparticles through a photocleavable carbamate linkage. Camptothecin release from this magnetic drug delivery system is successfully triggered upon irradiation with UV light, as measured by fluorescence spectroscopy. Photosensitive anticancer activity of the drug delivery system is monitored by viability studies on Chinese hamster ovarian cells. The treatment of cancer cells with drug loaded magnetic material leads to a decrease in viability of the cells due to the activity of capping CdS nanoparticles. Upon exposure to low power UV light (365 nm) the loaded camptothecin is released which induces additional decrease in viability of CHO cells. Hence, the capping CdS nanoparticles and loaded camptothecin exert a cooperative anticancer activity. Responsiveness to light irradiation and magnetic activity of the nanocarrier enable its potential application for selective targeted treatment of cancer.

  2. Preparation of fluorescent mesoporous hollow silica-fullerene nanoparticles via selective etching for combined chemotherapy and photodynamic therapy

    NASA Astrophysics Data System (ADS)

    Yang, Yannan; Yu, Meihua; Song, Hao; Wang, Yue; Yu, Chengzhong


    Well-dispersed mesoporous hollow silica-fullerene nanoparticles with particle sizes of ~50 nm have been successfully prepared by incorporating fullerene molecules into the silica framework followed by a selective etching method. The fabricated fluorescent silica-fullerene composite with high porosity demonstrates excellent performance in combined chemo/photodynamic therapy.Well-dispersed mesoporous hollow silica-fullerene nanoparticles with particle sizes of ~50 nm have been successfully prepared by incorporating fullerene molecules into the silica framework followed by a selective etching method. The fabricated fluorescent silica-fullerene composite with high porosity demonstrates excellent performance in combined chemo/photodynamic therapy. Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr02769a

  3. Stabilizing Surfactant Templated Cylindrical Mesopores in Polymer and Carbon Films through Composite Formation with Silica Reinforcement

    SciTech Connect

    Song, Lingyan; Feng, Dan; Lee, Hae-Jeong; Wang, Chengqing; Wu, Quanyan; Zhao, Dongyuan; Vogt, Bryan D.


    A facile approach to maintain the periodic mesostructure of cylindrical pores in polymer-resin and carbon films after thermal template removal is explored through the reactive coassembly of resol (carbon precursor) and tetraethylorthosilicate (silica precursor) with triblock copolymer Pluronic F127. Without silica, a low porosity, disordered film is formed after pyrolysis despite the presence of an ordered mesostructure prior to template removal. However for silica concentration greater than 25 wt %, pyrolysis at 350 C yields a mesoporous silica-polymer film with well-defined pore mesostructure. These films remain well ordered upon carbonization at 800 C. In addition to the mesostructural stability, the addition of silica to the matrix impacts other morphological characteristics. For example, the average pore size and porosity of the films increase from 3.2 to 7.5 nm and 12 to 45%, respectively, as the concentration of silica in the wall matrix increases from 0 to 32 wt %. The improved thermal stability of the ordered mesostructure with the addition of silica to the matrix is attributed to the reinforcement of the mechanical properties leading to resistance to stress induced collapse of the mesostructure during template removal.

  4. Exoelectrogenic biofilm as a template for sustainable formation of a catalytic mesoporous structure.


    Yates, Matthew D; Cusick, Roland D; Ivanov, Ivan; Logan, Bruce E


    Mesoporous structures can increase catalytic activity by maximizing the ratio of surface area to volume, but current synthesis techniques utilize expensive polymers and toxic chemicals. A Geobacter sulfurreducens biofilm was used as a sustainable template to form mesoporous Pd structures while eliminating the need for synthetic chemicals. The bulk of the biofilm material was removed by thermal treatments after nanoparticle formation, producing a catalytic Pd mesoporous (pore size 9.7 ± 0.1 nm) structure attached to the graphite electrode with a 1.5-2 µm thick backbone composed of nanoparticles (∼200 nm). A control electrode electrochemically plated with Pd in the absence of a biofilm exhibited a variable planar Pd base (∼0.5-3 µm thick) with sporadic Pd extrusions (∼2 µm across, 1-5 µm tall) from the surface. The biotemplated mesoporous structure produced 15-20% higher stable current densities during H2 oxidation tests than the electrochemically plated control electrode, even though 30% less Pd was present in the biotemplated catalyst. These results indicate that electroactive biofilms can be used as a sustainable base material to produce nanoporous structures without the need for synthetic polymers. Biotechnol. Bioeng. 2014;111: 2349-2354. © 2014 Wiley Periodicals, Inc. PMID:24771104

  5. Hierarchical mesoporous silica nanoparticles as superb light scattering materials.


    Ryu, Jaehoon; Yun, Juyoung; Lee, Jungsup; Lee, Kisu; Jang, Jyongsik


    A novel approach to enhance the light scattering effect was explored by applying hierarchical silica nanoparticles in DSSCs as scattering layers. The WSN-incorporated cells showed a PCE value of 9.53% and a PCE enhancement of 30.19% compared with those of the reference cells. PMID:26699659

  6. Triconstituent co-assembly to ordered mesostructured polymer-silica and carbon-silica nanocomposites and large-pore mesoporous carbons with high surface areas.


    Liu, Ruili; Shi, Yifeng; Wan, Ying; Meng, Yan; Zhang, Fuqiang; Gu, Dong; Chen, Zhenxia; Tu, Bo; Zhao, Dongyuan


    Highly ordered mesoporous polymer-silica and carbon-silica nanocomposites with interpenetrating networks have been successfully synthesized by the evaporation-induced triconstituent co-assembly method, wherein soluble resol polymer is used as an organic precursor, prehydrolyzed TEOS is used as an inorganic precursor, and triblock copolymer F127 is used as a template. It is proposed for the first time that ordered mesoporous nanocomposites have "reinforced concrete"-structured frameworks. By adjusting the initial mass ratios of TEOS to resol, we determined the obtained nanocomposites possess continuous composition with the ratios ranging from zero to infinity for the two constituents that are "homogeneously" dispersed inside the pore walls. The presence of silicates in nanocomposites dramatically inhibits framework shrinkage during the calcination, resulting in highly ordered large-pore mesoporous carbon-silica nanocomposites. Combustion in air or etching in HF solution can remove carbon or silica from the carbon-silica nanocomposites and yield ordered mesoporous pure silica or carbon frameworks. The process generates plenty of small pores in carbon or/and silica pore walls. Ordered mesoporous carbons can then be obtained with large pore sizes of approximately 6.7 nm, pore volumes of approximately 2.0 cm(3)/g, and high surface areas of approximately 2470 m(2)/g. The pore structures and textures can be controlled by varying the sizes and polymerization degrees of two constituent precursors. Accordingly, by simply tuning the aging time of TEOS, ordered mesoporous carbons with evident bimodal pores at 2.6 and 5.8 nm can be synthesized. PMID:16939291

  7. Investigation of Mg modified mesoporous silicas and their CO 2 adsorption capacities

    NASA Astrophysics Data System (ADS)

    Zhao, Huiling; Yan, Wei; Bian, Zijun; Hu, Jun; Liu, Honglai


    CO 2 adsorption properties on Mg modified silica mesoporous materials were investigated. By using the methods of co-condensation, dispersion and ion-exchange, Mg 2+ was introduced into SBA-15 and MCM-41, and transformed into MgO in the calcination process. The basic MgO can provide active sites to enhance the acidic CO 2 adsorption capacity. To improve the amount and the dispersion state of the loading MgO, the optimized modification conditions were also investigated. The XRD and TEM characteristic results, as well as the CO 2 adsorption performance showed that the CO 2 adsorption capacity not only depended on the pore structures of MCM-41 and SBA-15, but also on the improvement of the dispersion state of MgO by modification. Among various Mg modified silica mesoporous materials, the CO 2 adsorption capacity increased from 0.42 mmol g -1 of pure silica SBA-15 to 1.35 mmol g -1 of Mg-Al-SBA-15-I1 by the ion-exchange method enhanced with Al 3+ synergism. Moreover, it also increased from 0.67 mmol g -1 of pure silica MCM-41 to 1.32 mmol g -1 of Mg-EDA-MCM-41-D10 by the dispersion method enhanced with the incorporation of ethane diamine. The stability test by 10 CO 2 adsorption/desorption cycles showed Mg-urea-MCM-41-D10 possessed quite good recyclability.

  8. Supercritical fluid-mediated alumination of mesoporous silica and its beneficial effect on hydrothermal stability.


    O'Neil, Adam S; Mokaya, Robert; Poliakoff, Martyn


    We have investigated the use of supercritical fluids (SCFs) as carriers/solvents during the postsynthesis alumination of mesoporous silica. SCFs were found to be ideally suited for transport of Al into mesoporous silica and to lead to Al-grafted aluminosilicate materials that exhibit exceptional hydrothermal (steam) stability even for highly aluminated materials. The improvements in steam stability arising from the use of SCFs as grafting media (as compared to aqueous or organic solvents) are remarkable, especially for Al-grafted MCM-41 materials with high (Si/Al < or = 10) Al contents. It is proposed that under supercritical fluid conditions Al is sorbed on the surface of the pore walls of the host Si-MCM-41 with little penetration into the pore wall region, that is, the low solvating power of SCFs ensures the deposition of Al onto rather than into the silica framework. This is because the host silica framework cannot undergo any significant hydrolysis (to allow penetration of Al into the pore wall region) during the SCF-mediated alumination. Removal of the Al (i.e., dealumination) which occurs during steaming is therefore less detrimental to the structural integrity of SCF-grafted Al-MCM-41 materials since any dealumination that occurs will not involve removal of Al from deep within the pore walls. PMID:12207501

  9. In vitro and in vivo evaluation of ordered mesoporous silica as a novel adsorbent in liquisolid formulation

    PubMed Central

    Chen, Bao; Wang, Zhouhua; Quan, Guilan; Peng, Xinsheng; Pan, Xin; Wang, Rongchang; Xu, Yuehong; Li, Ge; Wu, Chuanbin


    Background A liquisolid technique has been reported to be a new approach to improve the release of poorly water-soluble drugs for oral administration. However, an apparent limitation of this technique is the formulation of a high dose because a large amount of liquid vehicle is needed, which finally results in a low-dose liquisolid formulation. Silica as an absorbent has been used extensively in liquisolid formulations. Although nanoparticle silica can be prepared and used to improve liquid adsorption capacity, loading a high dose of drug into a liquisolid is still a challenge. With the aim of improving adsorption capacity and accordingly achieving high drug loading, ordered mesoporous silica with a high surface area and narrow pore size distribution was synthesized and used in a liquisolid formulation. Methods Ordered mesoporous silica was synthesized and its particle size and morphology were tailored by controlling the concentration of cetyltrimethyl ammonium bromide. The ordered mesoporous silica synthesized was characterized by transmission electron microscopy, scanning electron microscopy, Fourier transform infrared spectroscopy, small-angle x-ray diffraction, wide angle x-ray diffraction, and nitrogen adsorption-desorption measurements. The liquid adsorption capacity of ordered mesoporous silica was subsequently compared with that of conventional silica materials using PEG400 as the model liquid. Carbamazepine was chosen as a model drug to prepare the liquisolid formulation, with ordered mesoporous silica as the adsorbent material. The preparation was evaluated and compared with commercially available fast-release carbamazepine tablets in vitro and in vivo. Results Characterization of the ordered mesoporous silica synthesized in this study indicated a huge Brunauer–Emmett–Teller surface area (1030 m2/g), an ordered mesoporous structure with a pore size of 2.8 nm, and high adsorption capacity for liquid compared with conventional silica. Compared with fast

  10. Catalytic pyrolysis of waste rice husk over mesoporous materials

    PubMed Central


    Catalytic fast pyrolysis of waste rice husk was carried out using pyrolysis-gas chromatography/mass spectrometry [Py-GC/MS]. Meso-MFI zeolite [Meso-MFI] was used as the catalyst. In addition, a 0.5-wt.% platinum [Pt] was ion-exchanged into Meso-MFI to examine the effect of Pt addition. Using a catalytic upgrading method, the activities of the catalysts were evaluated in terms of product composition and deoxygenation. The structure and acid site characteristics of the catalysts were analyzed by Brunauer-Emmett-Teller surface area measurement and NH3 temperature-programmed desorption analysis. Catalytic upgrading reduced the amount of oxygenates in the product vapor due to the cracking reaction of the catalysts. Levoglucosan, a polymeric oxygenate species, was completely decomposed without being detected. While the amount of heavy phenols was reduced by catalytic upgrading, the amount of light phenols was increased because of the catalytic cracking of heavy phenols into light phenols and aromatics. The amount of aromatics increased remarkably as a result of catalytic upgrading, which is attributed to the strong Brönsted acid sites and the shape selectivity of the Meso-MFI catalyst. The addition of Pt made the Meso-MFI catalyst even more active in deoxygenation and in the production of aromatics. PMID:22221540

  11. Catalytic pyrolysis of waste rice husk over mesoporous materials

    NASA Astrophysics Data System (ADS)

    Jeon, Mi-Jin; Kim, Seung-Soo; Jeon, Jong-Ki; Park, Sung Hoon; Kim, Ji Man; Sohn, Jung Min; Lee, See-Hoon; Park, Young-Kwon


    Catalytic fast pyrolysis of waste rice husk was carried out using pyrolysis-gas chromatography/mass spectrometry [Py-GC/MS]. Meso-MFI zeolite [Meso-MFI] was used as the catalyst. In addition, a 0.5-wt.% platinum [Pt] was ion-exchanged into Meso-MFI to examine the effect of Pt addition. Using a catalytic upgrading method, the activities of the catalysts were evaluated in terms of product composition and deoxygenation. The structure and acid site characteristics of the catalysts were analyzed by Brunauer-Emmett-Teller surface area measurement and NH3 temperature-programmed desorption analysis. Catalytic upgrading reduced the amount of oxygenates in the product vapor due to the cracking reaction of the catalysts. Levoglucosan, a polymeric oxygenate species, was completely decomposed without being detected. While the amount of heavy phenols was reduced by catalytic upgrading, the amount of light phenols was increased because of the catalytic cracking of heavy phenols into light phenols and aromatics. The amount of aromatics increased remarkably as a result of catalytic upgrading, which is attributed to the strong Brönsted acid sites and the shape selectivity of the Meso-MFI catalyst. The addition of Pt made the Meso-MFI catalyst even more active in deoxygenation and in the production of aromatics.

  12. Catalytic Conversion of Pinus densiflora Over Mesoporous Catalysts Using Pyrolysis Process.


    Joo, Sung Kyun; Lee, In-Gu; Lee, Hyung Won; Chea, Kwang-Seok; Jo, Tae Su; Jung, Sang-Chul; Kim, Sang Chai; Ko, Chang Hyun; Park, Young-Kwon


    Catalytic pyrolysis experiments were conducted to investigate the possibility of obtaining valuable chemicals from Pinus densiflora, a native Korean tree species occupying 21.4% of the total area under forests in South Korea. Two representative mesoporous catalysts, Al-MCM-41 and Al-MSU-F, as well as hierarchical mesoporous MFI (Meso-MFI) that has both mesopores and micropores, were used as catalysts. Compared to non-catalytic pyrolysis, catalytic pyrolysis was shown to reduce the fractions of levoglucosan, phenolics, and acids in bio-oil, while increasing the fractions of aromatics, PAHs, and furans. Meso-MFI with strong acid sites showed a high selectivity toward aromatics and PAHs, whereas Al-MCM-41 and Al-MSU-F with weak acid sites exhibited a high selectivity toward furanic compounds. The results of this study indicate that choosing a catalyst with an adequate quantity of acidic sites with the required strength is critical for enhancing the production of desired chemicals from Pinus densiflora. PMID:27433632

  13. Functionalized magnetic mesoporous silica nanoparticles for U removal from low and high pH groundwater.


    Li, Dien; Egodawatte, Shani; Kaplan, Daniel I; Larsen, Sarah C; Serkiz, Steven M; Seaman, John C


    U(VI) species display limited adsorption onto sediment minerals and synthetic sorbents in pH <4 or pH >8 groundwater. In this work, magnetic mesoporous silica nanoparticles (MMSNs) with magnetite nanoparticle cores were functionalized with various organic molecules using post-synthetic methods. The functionalized MMSNs were characterized using N2 adsorption-desorption isotherms, thermogravimetric analysis (TGA), transmission electron microscopy (TEM), (13)C cross polarization and magic angle spinning (CPMAS) nuclear magnetic resonance (NMR) spectroscopy, and powder X-ray diffraction (XRD), which indicated that mesoporous silica (MCM-41) particles of 100-200nm formed around a core of magnetic iron oxide, and the functional groups were primarily grafted into the mesopores of ∼3.0nm in size. The functionalized MMSNs were effective for U removal from pH 3.5 and 9.6 artificial groundwater (AGW). Functionalized MMSNs removed U from the pH 3.5 AGW by as much as 6 orders of magnitude more than unfunctionalized nanoparticles or silica and had adsorption capacities as high as 38mg/g. They removed U from the pH 9.6 AGW as much as 4 orders of magnitude greater than silica and 2 orders of magnitude greater than the unfunctionalized nanoparticles with adsorption capacities as high as 133mg/g. These results provide an applied solution for treating U contamination that occurs at extreme pH environments and a scientific foundation for solving critical industrial issues related to environmental stewardship and nuclear power production. PMID:27341378

  14. Synthesis and characterization of mesoporous silica from selectively acid-treated saponite as the precursors.


    Okada, Kiyoshi; Yoshizaki, Hisako; Kameshima, Yoshikazu; Nakajima, Akira; Madhusoodana, Chengala D


    Mesoporous silicas were synthesized by hydrothermal treatment of selectively acid-treated saponite (an ideal structural formula: Na(1/3)Mg(3)(Si(11/3)Al(1/3))O(10)(OH)(2)), having a 2:1 type layered structure as the silica source and its porous properties were examined and compared with that from kaolinite (an ideal structural formula: Al(2)Si(2)O(5)(OH)(4)), having a 1:1 type layered structure. Synthetic saponite was selectively leached in H(2)SO(4) solutions with various concentrations (0.05-1 M) at 70 degrees C for 0.5 h. The resulting products (precursors) were mixed with cetyltrimethylammonium bromide (CTABr), NaOH and H(2)O, hydrothermally treated at 110 degrees C and removed the CTABr by calcining at 560 degrees C. A hexagonal mesoporous phase was obtained with higher Si/(Al(+Mg)) ratios of the resulting precursors. The XRD patterns of these products show the peaks assigned by a hexagonal lattice with a(0)=4.0-4.6 nm and the crystallinity becomes higher with higher Si/(Al(+Mg)) ratios of the precursors. The specific surface area (S(BET)) values of the present mesoporous silicas range from 800 to 1100 m(2)/g at CTABr/precursor=0.1 and although they are not as high as those from precursors prepared from calcining and acid-treatment of kaolinite (1420 m(2)/g), they are increased to 1400-1500 m(2)/g by increasing the ratio CTABr/precursor 0.2. The reason for the difference in the optimum preparation conditions between saponite and kaolinite may be attributed to the difference in the linkage of the SiO(4) tetrahedra in these precursors (i.e. layered or framework structures), which result in great differences in the selective leaching rates and structures of the resulting silica-rich products. PMID:17570387

  15. Programmed packaging of mesoporous silica nanocarriers for matrix metalloprotease 2-triggered tumor targeting and release.


    Zou, Zhen; He, Xiaoxiao; He, Dinggeng; Wang, Kemin; Qing, Zhihe; Yang, Xue; Wen, Li; Xiong, Jun; Li, Liling; Cai, Linli


    The development of multifunctional nanocarrier with each unit functioning at the correct time and location is a challenge for clinical applications. With this in mind, a type of intelligent mesoporous silica nanocarrier (PGFMSN) is proposed for matrix metalloprotease 2 (MMP 2)-triggered tumor targeting and release by integrating programmed packing and MMP 2-degradable gelatin. Mesoporous silica nanoparticles (MSN) are first functionalized with folic acid (FA) as a target ligand to improve cell uptake. Then gelatin is introduced onto FA-MSN via temperature-induced gelation, where gelatin layer blocks drugs inside the mesopores and protects the targeting ligand. To prolong blood-circulation lifetime, PEG is further decorated to obtain PGFMSN. All units are programmatically incorporated in a simple way and coordinated in an optimal fashion. Cells, multicellular spheroids and in vivo results demonstrate that PGFMSN is shielded against nonspecific uptake. After circulating to tumor tissue, the up-regulated MMP-2 hydrolyzes gelatin layer to deshield PEG and switch on the function of FA, which facilitate the selective uptake by tumor cells through folate-receptor-mediated endocytosis. Meanwhile, the packaged drug is released due to the shedding of gelatin layer. It is shown that doxorubicin (DOX)-loaded exhibits superior tumor targeting, drug internalization, cytotoxicity, and antitumor efficacy over free DOX, non-PEGylated and non-targeted nanoparticles, which provides potential applications for targeted cancer therapy. PMID:25941780

  16. Structural investigation of nonionic fluorinated micelles by SANS in relation to mesoporous silica materials.


    Michaux, Florentin; Blin, Jean-Luc; Teixeira, José; Stébé, Marie José


    In an attempt to answer the question if there is dependence between the pore ordering of the mesoporous silica, obtained through the cooperative template mechanism, and the shape of the micellar aggregates of the surfactant solutions, the micellar structures of two nonionic fluorinated surfactant based-systems are studied by SANS. By fitting the experimental spectra with theoretical models, the structural evolution of the molecular aggregates can be described, and some important parameters can be obtained, such as the water and eventually oil penetration into the surfactant film, the aggregation number, the area per polar head of the surfactant, and the surfactant chain conformations. We have shown that for the C(8)F(17)C(2)H(4)(OC(2)H(4))(9)OH system, the micelles are prolate spheroids. The increase of the surfactant concentration in water does not change the characteristics of the interfacial film, but the aggregation number raises and the particles become more elongated. By contrast, the experimental curves of C(7)F(15)C(2)H(4)(OC(2)H(4))(8)OH cannot be fitted considering a small particle model. However, progressive incorporation of fluorocarbon induces a change of size and shape of the globules, which become smaller and more and more spherical. Regarding the material mesopore ordering, it appears that the micelles that lead to hexagonal mesoporous silica materials are described with a model of quasi-spherical globules. On the contrary, when large micelles are found, only wormhole-like structures are obtained. PMID:22145934

  17. [Preparation and anti-cancer activity in vitro of curcumin loaded mesoporous silica nanoparticle].


    He, Li-li; Gu, Jian


    This paper is to prepare curcumin (Cur) loaded mesoporous silica nanoparticle (Cur-MSN), evaluate its release behavior and anti-cancer activity in vitro. Mesoporous silica nanoparticle (MSN) was prepared by polymerization method and Cur-MSN was obtained using solvent evaporation method and impregnation centrifugation method. The preparation method was optimized using entrapment efficiency (EE) and loading efficiency (LE) as indexes. Cur-MSN was characterized with scanning electron microscope and its particle size and zeta potential were determined. Finally, in vitro release behavior in 0.2% SDS solution and its cell-killing effect on HeLa cells were also evaluated. The Cur-MSN prepared with process optimization method was round and uniform and exhibited typical mesoporous characterization. The mean particle size and Zeta potential of Cur-MSN were 75.8 nm and -30.1 mV, respectively. EE and LE of three batches of Cur-MSN were (72.55 ± 2.01)% and (16.21 ± 1.12)%, respectively. In vitro release behavior of Cur-MSN showed a sustained release profile with 83.5% cumulative release within 96 h. The killing effect of Cur-MSN on HeLa cells was dose-dependent with IC50 of 19.40 mg x L(-1), which was similar to that of Cur. PMID:27071254

  18. Tetracycline-Containing MCM-41 Mesoporous Silica Nanoparticles for the Treatment of Escherichia coli.


    Koneru, Bhuvaneswari; Shi, Yi; Wang, Yu-Chieh; Chavala, Sai H; Miller, Michael L; Holbert, Brittany; Conson, Maricar; Ni, Aiguo; Di Pasqua, Anthony J


    Tetracycline (TC) is a well-known broad spectrum antibiotic, which is effective against many Gram positive and Gram negative bacteria. Controlled release nanoparticle formulations of TC have been reported, and could be beneficial for application in the treatment of periodontitis and dental bone infections. Furthermore, TC-controlled transcriptional regulation systems (Tet-on and Tet-off) are useful for controlling transgene expression in vitro and in vivo for biomedical research purposes; controlled TC release systems could be useful here, as well. Mesoporous silica nanomaterials (MSNs) are widely studied for drug delivery applications; Mobile crystalline material 41 (MCM-41), a type of MSN, has a mesoporous structure with pores forming channels in a hexagonal fashion. We prepared 41 ± 4 and 406 ± 55 nm MCM-41 mesoporous silica nanoparticles and loaded TC for controlled dug release; TC content in the TC-MCM-41 nanoparticles was 18.7% and 17.7% w/w, respectively. Release of TC from TC-MCM-41 nanoparticles was then measured in phosphate-buffered saline (PBS), pH 7.2, at 37 °C over a period of 5 h. Most antibiotic was released from both over this observation period; however, the majority of TC was released over the first hour. Efficacy of the TC-MCM-41 nanoparticles was then shown to be superior to free TC against Escherichia coli (E. coli) in culture over a 24 h period, while blank nanoparticles had no effect. PMID:26528964

  19. Adsorptive recovery of Au3+ from aqueous solutions using bayberry tannin-immobilized mesoporous silica.


    Huang, Xin; Wang, Yanpin; Liao, Xuepin; Shi, Bi


    Tannin is well known to be an inexpensive and ubiquitous natural biomass, which has high chelating affinity towards many metal ions. In this study, bayberry tannin (BT) was immobilized on mesoporous silica matrix to prepare a novel adsorbent, which was subsequently used for the adsorptive recovery of Au(3+) from aqueous solutions. It was found that bayberry tannin-immobilized mesoporous silica (BT-SiO(2)) was able to effectively recover Au(3+) from acidic solutions (pH 2.0). The equilibrium adsorption capacity of Au(3+) on BT-SiO(2) was high up to 642.0 mg/g at 323 K. Due to its mesoporous structure, BT-SiO(2) exhibited an extremely fast adsorption rate to Au(3+) as compared with other tannin gel adsorbent. The presence of other coexisting metal ions, such as Pb(2+), Ni(2+), Cu(2+) and Zn(2+), did not decrease the adsorption capacity of Au(3+) on BT-SiO(2), and BT-SiO(2) had almost no adsorption capacity to these coexisting metal ions, which suggested the high adsorption selectivity of BT-SiO(2) to Au(3+). Additionally, about 73% of adsorbed Au(3+) can be desorbed using aqua regia, and the Au(3+) solution was concentrated about 18.0 times as compared with the original solution. Consequently, the outstanding characteristics of BT-SiO(2) provide the possibility of effective recovery and concentration of Au(3+) from diluted solutions. PMID:20728986

  20. Graphene-mediated surface enhanced Raman scattering in silica mesoporous nanocomposite films.


    Carboni, Davide; Lasio, Barbara; Alzari, Valeria; Mariani, Alberto; Loche, Danilo; Casula, Maria F; Malfatti, Luca; Innocenzi, Plinio


    Silica mesoporous nanocomposite films containing graphene nanosheets and gold nanoparticles have been prepared via a one-pot synthesis using silicon tetrachloride, gold(III) chloride tetrahydrate, a 1-N-vinyl-2-pyrrolidone dispersion of exfoliated graphene and Pluronic F127 as a structuring agent. The composite films have shown graphene-mediated surface-enhanced Raman scattering (G-SERS). Graphene has been introduced as dispersed bilayer sheets while gold has been thermally reduced in situ to form nanoparticles of around 6 nm which preferentially nucleate on the surface of the graphene nanosheets. The presence of graphene and gold nanoparticles does not interfere with the self-assembly process and the formation of silica mesoporous films ordered as 2D hexagonal structures. The material has shown a remarkable analytical enhancement factor ranging from 80 up to 136 using rhodamine 6G as a Raman probe. The films have been characterised by grazing incidence X-ray diffraction, FTIR and UV-vis spectroscopy studies; transmission electron microscopy and spectroscopic ellipsometry have been used to study the morphology, thickness and porosities of the samples. Raman spectroscopy has been employed to characterise the graphene nanosheets embedded into the mesoporous films and the enhanced Raman scattering. PMID:25278085

  1. Capillary Condensation Pathways of CO2 under Templated Mesoporous Silica Confinement

    NASA Astrophysics Data System (ADS)

    Wang, Bo; Sokol, Paul


    Adsorption of CO2 in porous medium has been of great current interest due to its potential for mitigating the global warming caused by greenhouse gases. In particular, the behavior of confined CO2 in mesoporous media near room temperature is particularly relevant to sequestration efforts. Realistic mesoporous systems, such as shales and coals, represent a complex fractal pore structure that complicates the interpretation of adsorption studies. We present the results of a study focused on the adsorption of CO2 in model mesoporous media with well-defined pore structures. Templated porous glasses, such as MCM-41 which has a regular network of 1D pores, provide an ideal system for fundamental studies of the adsorption process. In this study, we focus on the structure of adsorbed CO2 films which evolves in a mixture of phases and the development of nucleation occurs during the formation of high density liquid CO2 inside the confining matrix. We have used Small Angle Neutron Scattering to study the spatial distribution of material radially and transversely within the pores. The 30m SANS NG7 at NIST was used to map out the details of CO2 condensation pathway under mesoporous silica confinement.

  2. Gated silica mesoporous supports for controlled release and signaling applications.


    Coll, Carmen; Bernardos, Andrea; Martínez-Máñez, Ramón; Sancenón, Félix


    Blending molecular and supramolecular advances with materials science has resulted in recent years in the development of new organic-inorganic hybrid materials displaying innovative functionalities. One appealing concept in this field is the development of gated nanodevices. These materials are prepared by grafting molecular or supramolecular caps onto the external surface of mesoporous inorganic scaffolds loaded with a particular cargo. The caps or "gates" can then be opened and the cargo delivered at will upon the application of a given stimulus. In this Account, we report some of the recent advances we have made in designing such materials for drug delivery and as new chromo-fluorogenic probes. For controlled release applications, we have prepared capped hybrid mesoporous supports capable of being selectively opened by applying certain physical and chemical stimuli. We report examples of gated materials opened by changes in pH (using polyamines as caps), light (employing spiropyran derivatives or gold nanoparticles), and temperature (using selected paraffins). We also report gated materials opened by enzymes that cleave capping molecules based on lactose, hydrolyzed starch, and peptides. The use of enzymes is especially appealing because molecular caps built of enzyme-specific sequences made of peptides or other cleavable molecules could allow on-command delivery of drugs and biomolecules in specialized contexts. In the second part of the manuscript, we revisit the possibility of using hybrid gated nanomaterials as sensory systems. In such systems, when target analytes interact with the cap, their presence triggers the transport of a dye from pores to the solution, resulting in a chromo-fluorogenic signal that allows their detection. Two approaches are possible. In the first one, pores remain open and the dye can diffuse into the solution, until the presence of a target analyte binds to receptors in the caps and closes the gate. In the second approach, the caps

  3. Synthesis, characterization, and catalytic application of ordered mesoporous carbon–niobium oxide composites

    SciTech Connect

    Gao, Juan-Li; Gao, Shuang; Liu, Chun-Ling; Liu, Zhao-Tie; Dong, Wen-Sheng


    Graphical abstract: The ordered mesoporous carbon–niobium oxide composites have been synthesized by a multi-component co-assembly method associated with a carbonization process. - Highlights: • Ordered mesoporous carbon–niobium oxide composites were synthesized. • The content of Nb{sub 2}O{sub 5} in the composites could be tuned from 38 to 75%. • Niobium species were highly dispersed in amorphous carbon framework walls. • The composites exhibited good catalytic performance in the dehydration of fructose. - Abstract: Ordered mesoporous carbon–niobium oxide composites have been synthesized by a multi-component co-assembly method associated with a carbonization process using phenolic resol as carbon source, niobium chloride as precursor and amphiphilic triblock copolymer Pluronic F127 as template. The resulting materials were characterized using a combination of techniques including differential scanning calorimetry–thermogravimetric analysis, N{sub 2} physical adsorption, X-ray diffraction, transmission electron microscopy, and X-ray photoelectron spectroscopy. The results show that with increasing the content of Nb{sub 2}O{sub 5} from 38 to 75% the specific surface area decreases from 306.4 to 124.5 m{sup 2} g{sup −1}, while the ordered mesoporous structure is remained. Niobium species is well dispersed in the amorphous carbon framework. The mesoporous carbon–niobium oxide composites exhibit high catalytic activity in the dehydration of fructose to 5-hydroxymethylfurfural. A 100% conversion of fructose and a 76.5% selectivity of 5-hydroxymethylfurfural were obtained over the carbon–niobium oxide composite containing 75% Nb{sub 2}O{sub 5} under the investigated reaction conditions.

  4. Synthesis and characterization of amorphous mesoporous silica using TEMPO-functionalized amphiphilic templates

    NASA Astrophysics Data System (ADS)

    de Vries, Wilke; Doerenkamp, Carsten; Zeng, Zhaoyang; de Oliveira, Marcos; Niehaus, Oliver; Pöttgen, Rainer; Studer, Armido; Eckert, Hellmut


    Inorganic-organic hybrid materials based on amorphous mesoporous silica containing organized nitroxide radicals within its mesopores have been prepared using the micellar self-assembly of TEOS solutions containing the nitroxide functionalized amphiphile (4-(N,N-dimethyl-N-hexadecylammonium)-2,2,6,6-tetramethyl-piperidin-N-oxyl-iodide) (CAT-16). This template has been used both in its pure form and in various mixtures with cetyl trimethylammonium bromide (CTAB). The samples have been characterized by chemical analysis, N2 sorption studies, magnetic susceptibility measurements, and various spectroscopic methods. While electron paramagnetic resonance (EPR) spectra indicate that the strength of the intermolecular spin-spin interactions can be controlled via the CAT-16/CTAB ratio, nuclear magnetic resonance (NMR) data suggest that these interactions are too weak to facilitate cooperative magnetism.

  5. Core-shell-type magnetic mesoporous silica nanocomposites for bioimaging and therapeutic agent delivery.


    Wang, Yao; Gu, Hongchen


    Advances in nanotechnology and nanomedicine offer great opportunities for the development of nanoscaled theranostic platforms. Among various multifunctional nanocarriers, magnetic mesoporous silica nanocomposites (M-MSNs) attract prominent research interest for their outstanding properties and potential biomedical applications. This Research News article highlights recent progress in the design of core-shell-type M-MSNs for both diagnostic and therapeutic applications. First, an overview of synthetic strategies for three representative core-shell-type M-MSNs with different morphologies and structures is presented. Then, the diagnostic functions of M-MSNs is illustrated for magnetic resonance imaging (MRI) applications. Next, magnetic targeted delivery and stimuli-responsive release of drugs, and effective package of DNA/siRNA inside mesopores using M-MSNs as therapeutic agent carriers are discussed. The article concludes with some important challenges that need to be overcome for further practical applications of M-MSNs in nanomedicine. PMID:25238634

  6. Films Consisting of Innumerable Tapered Nanopillars of Mesoporous Silica for Universal Antireflection Coatings.


    Miyata, Hirokatsu; Kitamura, Shin; Watanabe, Masatoshi; Takahashi, Masahiko


    Films with a fine structure consisting of innumerable nanopillars of mesoporous silica (MPS) are formed by a reactive ion etching process with a fluorine-containing gas. Each nanopillar has a tapered shape with a uniform height, which effectively suppresses reflection by the formation of an ideal graded refractive index structure. The nanopillars are spontaneously formed under low-pressure conditions, wherein locally deposited Al-F compounds, originating from an alumina plate in the etching chamber, work as a fine etching mask. The high etching rate of the MPS film allows a very high aspect ratio of the nanopillars. The refractive index of the MPS nanopillars can be universally tuned by a controlled incorporation of TiO2 into the mesopores, which results in effective reduction of reflectance on a given substrate. The outstanding antireflection performance is experimentally demonstrated for glass substrates with a wide refractive index range. PMID:27017295

  7. Water adsorption properties controlled by coating/filling ordered mesoporous silica inside cellulose membranes.


    Kimura, Tatsuo


    Porous organic membranes have been utilized as hard templates not only for replication of porous macrostructures but also for fabrication of hierarchical porous solids through infiltration of precursor solutions in ordered mesoporous materials. However, such organic membranes are usually burned out as sacrificial skeletons by calcination. In addition, replicated macropores are too big to enhance properties due to inorganic oxide frameworks. In this study, when cellulose membranes were used as organic membranes, a coating/filling technology of ordered mesoporous silicas was proposed and the water adsorption-desorption properties were directly investigated by using the composite membranes after extraction of nonionic surfactants used. The composite membranes possessed enough adsorption capacity for water, which will be potentially useful for improving total energy efficiency in heat-pump and desiccant air conditioning systems. PMID:23925426

  8. Mixed anionic surfactant-templated mesoporous silica nanoparticles for fluorescence detection of Fe(3.).


    Gai, Fangyuan; Zhou, Tianlei; Chu, Guang; Li, Ye; Liu, Yunling; Huo, Qisheng; Akhtar, Farid


    This work demonstrates a novel method for the synthesis of large pore mesoporous silica nanoparticles (MSNs) with a pore diameter of 10.3 nm and a particle diameter of ∼50 nm based on the incorporation of mixed anionic surfactants sodium dodecyl benzene sulfonate (SDBS) and sodium dodecyl sulphate (SDS) as the template in the synthesis process. The dispersity, morphology, pore structure and size of mesoporous nanoparticles were adjusted by changing the molar ratio of two anionic surfactants, the concentration of the co-structure-directing agent (3-aminopropyltrimethoxysilane) and the reaction temperature. The results of synthesis experiments suggested that the formation of large pore MSNs involved a nucleation and growth process. MSNs were post-grafted with a Schiff base moiety for fluorescence sensing of Fe(3+) in water. The applicability of functionalized MSNs was demonstrated by selective fluorescence detection of Fe(3+) in aqueous media. PMID:26616310

  9. Biocompatible mesoporous silica nanoparticles with different morphologies for animal cell membrane penetration

    SciTech Connect

    Trewyn, B.; Nieweg, J.; Zhao, Y,; Lin, V.


    Two MCM-41 type, fluorescein-labeled mesoporous silica nanomaterials (MSNs) consisting of spherical and tube-shaped particles were synthesized and characterized. Both materials have hexagonally arranged mesopores with high surface area (>950 m{sup 2}/g) and a narrow distribution of pore diameters. The cellular uptake efficiency and kinetics of both MSNs were measured in a cancer cell line (CHO) and a noncancerous cell line (fibroblasts) by flow cytometry and fluorescence confocal microscopy. The correlation between the particle morphology and aggregation of MSNs to the effectiveness of cellular uptake was investigated. We envision that our study on the morphology dependent endocytosis of MSNs would lead to future developments of efficient transmembrane nanodevices for intracellular sensing and gene/drug delivery.

  10. Mesoporous silica nanoparticles for treating spinal cord injury

    NASA Astrophysics Data System (ADS)

    White-Schenk, Désirée.; Shi, Riyi; Leary, James F.


    An estimated 12,000 new cases of spinal cord injury (SCI) occur every year in the United States. A small oxidative molecule responsible for secondary injury, acrolein, is an important target in SCI. Acrolein attacks essential proteins and lipids, creating a feed-forward loop of oxidative stress in both the primary injury area and the surrounding areas. A small molecule used and FDA-approved for hypertension, hydralazine, has been found to "scavenge" acrolein after injury, but its delivery and short half-life, as well as its hypertension effects, hinder its application for SCI. Nanomedical systems broaden the range of therapeutic availability and efficacy over conventional medicine. They allow for targeted delivery of therapeutic molecules to tissues of interest, reducing side effects of untargeted therapies in unwanted areas. Nanoparticles made from silica form porous networks that can carry therapeutic molecules throughout the body. To attenuate the acrolein cascade and improve therapeutic availability, we have used a one-step, modified Stober method to synthesize two types of silica nanoparticles. Both particles are "stealth-coated" with poly(ethylene) glycol (PEG) (to minimize interactions with the immune system and to increase circulation time), which is also a therapeutic agent for SCI by facilitating membrane repair. One nanoparticle type contains an amine-terminal PEG (SiNP-mPEG-Am) and the other possesses a terminal hydrazide group (SiNP-mPEG-Hz). The former allows for exploration of hydralazine delivery, loading, and controlled release. The latter group has the ability to react with acrolein, allowing the nanoparticle to scavenge directly. The nanoparticles have been characterized and are being explored using neuronal PC-12 cells in vitro, demonstrating the potential of novel silica nanoparticles for use in attenuating secondary injury after SCI.

  11. Yolk-shell nanoarchitectures with a Ru-containing core and a radially oriented mesoporous silica shell: facile synthesis and application for one-pot biomass conversion by combining with enzyme.


    Wei, Wei; Zhao, Yu; Peng, Shichao; Zhang, Haoyang; Bian, Yipeng; Li, Hexing; Li, Hui


    In this paper, we develop a facile strategy for fabricating a yolk-shell structured catalytic system that consists of a core made of Ru supported on mesoporous carbon, which is encaged within a silica shell that has ordered radial mesochannels. A region-selective etching mechanism for the formation of the yolk-shell nanoarchitectures is proposed based on the stronger adsorption ability of the carbon core for etching agent than that of the silica shell for etching agent. By combining such material with amyloglucosidase, one-pot hydrolysis-hydrogenation of dextrin to sorbitol can be conducted, delivering enhanced efficiency and showing great promise for biomass conversion applications. PMID:25405326

  12. Sodium silicate as source of silica for synthesis of mesoporous SBA-15

    NASA Astrophysics Data System (ADS)

    Rahmat, Norhasyimi; Hamzah, Fazlena; Sahiron, Norsuraya; Mazlan, Marissa; Mukmin Zahari, Muhammad


    Ordered mesoporous silica SBA-15 was prepared using hydrothermal synthesis using sodium silicate (Na2SiO3) as the silica source and amphiphilic block copolymer Pluronic P123 as the structure directing agent. The influence of the mass Na2SiO3, ripening duration, aging time and calcination temperature on the structural and mesoporous properties of silica was studied. X-ray diffraction (XRD), Fourier transform infrared (FTIR), Scanning electron microscopy (SEM) and the nitrogen adsorption desorption using Brunauer Emmett Teller (BET) are some instruments used to characterize the results of investigation. From XRD analysis, SBA-15 synthesized from sodium silicate yield 2D-hexagonal symmetry (p6mm). From FTIR analysis, functional group Si-O-Si symmetric stretching modes and asymmetric Si- O-Si stretching modes were present. The sample with the highest mass of Na2SiO3 and the shortest aging time exhibited the largest surface area and large pore size. The results also showed the morphological structure could be tuned during ripening stage.

  13. Synthesis, characterization, and biodistribution studies of (99m)Tc-labeled SBA-16 mesoporous silica nanoparticles.


    de Barros, André Luís Branco; de Oliveira Ferraz, Karina Silva; Dantas, Thais Cristina Soares; Andrade, Gracielle Ferreira; Cardoso, Valbert Nascimento; Sousa, Edésia Martins Barros de


    Along with anti-cancer drug delivery researches, many efforts have been done to develop new tracers for diagnostic applications. Based on advances in molecular imaging, nanoparticles can be used to visualize, characterize and measure biological process at molecular and cellular level. Therefore, the purpose of this study was to synthesize, characterize and radiolabeled mesoporous silica nanoparticles (MSNs) for in vivo applications. The nanoparticles were synthesized, functionalized with 3-aminopropyltriethoxysilane (APTES) and then, anchored with diethylenetriaminepentaacetic acid (DTPA). Particles were physicochemical characterized by elemental analysis (CHN), thermogravimetric analysis (TGA), Fourier transform infrared spectroscopy (FTIR), and zeta potential, and were morphologically characterized by scanning electron microscopy (SEM), low-angle X-ray diffraction (XRD) and transmission electron microscopy (TEM) techniques. Results indicate that functionalization process was successfully achieved. Next, functionalized silica nanoparticles were radiolabeled with technetium-99m showing high radiochemical yields and high radiolabeled stability. These findings allow the use of the particles for in vivo applications. Biodistribution and scintigraphic images were carried out in healthy mice in order to determine the fate of the particles. Results from in vivo experiments showed high uptake by liver, as expected due to phagocytosis. However, particles also showed a significant uptake in the lungs, indicated by high lung-to-non-target tissue ratio. In summary, taking into account the great potential of these silica mesoporous structures to carry molecules this platform could be a good strategy for theranostic purposes. PMID:26249579

  14. Poly(lactic) acid fibers loaded with mesoporous silica for potential applications in the active food packaging

    NASA Astrophysics Data System (ADS)

    Cacciotti, Ilaria; Nanni, Francesca


    Multifunctional fibrous systems based on poly(lactic) acid (PLA), mesoporous silica (SiO2) and ascorbic acid (AA) were produced by means of electrospinning technique, for potential applications in the active food packaging sector, as platform for the controlled release of antioxidant and/or antimicrobial agents with the additional filtering function. The ascorbic acid was physisorbed on the surface of mesoporous silica in order to stabilize it and to extend its antioxidant action. The influence of mesoporous silica and ascorbic acid on the microstructural and mechanical properties was investigated, revealing a revelant mechanical reinforcement in the case of fibers loaded only with SiO2 and a decrement in the case of SiO2 with physisorbed ascorbic acid, due to the worse interface between the fillers and the polymeric matrix.

  15. Adsorption of lysozyme on hyaluronic acid functionalized SBA-15 mesoporous silica: a possible bioadhesive depot system.


    Medda, Luca; Casula, Maria F; Monduzzi, Maura; Salis, Andrea


    Silica-based ordered mesoporous materials are very attractive matrices to prepare smart depot systems for several kinds of therapeutic agents. This work focuses on the well-known SBA-15 mesoporous silica and lysozyme, an antimicrobial protein. In order to improve the bioadhesion properties of SBA-15 particles, the effect of hyaluronic acid (HA) functionalization on lysozyme adsorption was investigated. SBA-15 samples having high (H-SBA) and low (L-SBA) levels of functionalization were analyzed during the three steps of the preparations: (1) introduction of the -NH2 groups to obtain the SBA-NH2 samples; (2) functionalization with HA to obtain the SBA-HA matrices; (3) adsorption of lysozyme. All silica matrices were characterized through N2-adsorption/desorption isotherms, small-angle X-ray scattering, transmission electron microscopy, thermogravimetric analysis, and Fourier transform infrared spectroscopy. The whole of the experimental data suggests that a high level of functionalization of the silica surface allows for a negligible lysozyme adsorption mainly due to unfavorable electrostatic interactions (H-SBA-NH2) or steric hindrance (H-SBA-HA). A low degree of functionalization of the silica surface brings about a very good performance toward lysozyme adsorption, being 71% (L-SBA-NH2) and 63% (L-SBA-HA) respectively, compared to that observed for original SBA-15. Finally, two different kinetic models--a "pseudo-second order" and a "intraparticle diffusion"--were compared to fit lysozyme adsorption data, the latter being more reliable than the former. PMID:25295387

  16. Nanostructured, mesoporous Au/TiO2 model catalysts – structure, stability and catalytic properties

    PubMed Central

    Roos, Matthias; Böcking, Dominique; Gyimah, Kwabena Offeh; Kucerova, Gabriela; Bansmann, Joachim; Biskupek, Johannes; Kaiser, Ute; Hüsing, Nicola


    Summary Aiming at model systems with close-to-realistic transport properties, we have prepared and studied planar Au/TiO2 thin-film model catalysts consisting of a thin mesoporous TiO2 film of 200–400 nm thickness with Au nanoparticles, with a mean particle size of ~2 nm diameter, homogeneously distributed therein. The systems were prepared by spin-coating of a mesoporous TiO2 film from solutions of ethanolic titanium tetraisopropoxide and Pluronic P123 on planar Si(100) substrates, calcination at 350 °C and subsequent Au loading by a deposition–precipitation procedure, followed by a final calcination step for catalyst activation. The structural and chemical properties of these model systems were characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), N2 adsorption, inductively coupled plasma ionization spectroscopy (ICP–OES) and X-ray photoelectron spectroscopy (XPS). The catalytic properties were evaluated through the oxidation of CO as a test reaction, and reactivities were measured directly above the film with a scanning mass spectrometer. We can demonstrate that the thin-film model catalysts closely resemble dispersed Au/TiO2 supported catalysts in their characteristic structural and catalytic properties, and hence can be considered as suitable for catalytic model studies. The linear increase of the catalytic activity with film thickness indicates that transport limitations inside the Au/TiO2 film catalyst are negligible, i.e., below the detection limit. PMID:22003465

  17. In vitro study and biocompatibility of calcined mesoporous silica microparticles in mouse lung.


    Al-Salam, Suhail; Balhaj, Ghazala; Al-Hammadi, Suleiman; Sudhadevi, Manjusha; Tariq, Saeed; Biradar, Ankush V; Asefa, Tewodros; Souid, Abdul-Kader


    We report on the pneumatocyte structure and function of mouse lung specimens exposed in vitro to two calcined mesoporous silica particles, MCM41-cal (spheres, ∼300 to 1000 nm in diameter) and SBA15-cal (irregular rods averaging ∼500 nm in diameter and ∼1000 nm in length). These mesoporous silica particles are in consideration for potential medical application as delivery vehicles for genes, drugs, and bio-imagers. In the study, lung specimens (about 10 mg each) were excised from male Balb/c mice, immediately immersed in Krebs-Henseleit buffer, ice-cold, and continuously gassed with O(2):CO(2) (95:5). The samples were incubated at 37°C in the same buffer with and without 200 μg/mL MCM41-cal or SBA15-cal for 5-14 h. The tissues were then rinsed thoroughly and processed for light and electron microscopy. Normal alveolar morphology was evident in all the studied specimens. There was no significant difference in the number of apoptotic cells between the treated and untreated samples. Despite their relatively large sizes, the particles were abundantly present in pneumocytes, macrophages, endothelial cells, fibroblasts, and interstitium. They were seen in different areas of the cytoplasm, suggesting intracellular movements. Their presence did not appear to disturb cellular configuration or micro-organelles. Due to their rigidity and surface charges, some were firmly attached to (indenting) the nuclear membrane. The rate of respiration (cellular mitochondrial O(2) consumption, in μM O(2)/min/mg) in specimens exposed to 200 μg/mL particles for up to 12 h was the same as untreated specimens. These findings confirm "reasonable" bioavailability and biocompatibility of calcined mesoporous silicas with mouse lung within at least 5-14 h of exposure time. PMID:21470958

  18. Magnetic properties of magnetite nanoparticles coated with mesoporous silica by sonochemical method

    SciTech Connect

    Ursachi, Irina; Vasile, Aurelia; Chiriac, Horia; Postolache, Petronel; Stancu, Alexandru


    Highlights: Black-Right-Pointing-Pointer MCM-41-coating of magnetite nanoparticles performed under ultrasonic irradiation. Black-Right-Pointing-Pointer Ultrasonic irradiation accelerates the formation of the MCM-41 framework. Black-Right-Pointing-Pointer The hysteretic response to an applied field was investigated applying FORC diagram. Black-Right-Pointing-Pointer The average coercive field of the Fe{sub 3}O{sub 4} nanoparticles increased after coating. -- Abstract: In this paper we present the magnetic properties of mesoporous silica-coated Fe{sub 3}O{sub 4} nanoparticles. The coating of magnetite nanoparticles with mesoporous silica shell was performed under ultrasonic irradiation. The obtained mesoporous silica-coated magnetite nanoparticles were characterized by powder X-ray diffraction, focused ion beam-scanning electron microscopy, nitrogen adsorption-desorption isotherms and vibrating sample magnetometer. The hysteretic behavior was studied using first-order reversal curves diagrams. The X-ray diffraction result indicates that the extreme chemical and physical conditions created by acoustic cavitations have an insignificant effect on crystallographic structural characteristic of magnetite nanoparticles. Changes in the coercivity distributions of the magnetite nanoparticles were observed on the first-order reversal curves diagrams for the samples with coated particles compared with the samples containing uncoated particles of magnetite. The coated particles show an increased most probable coercivity of about 20% compared with the uncoated particles which can be associated with an increased anisotropy due to coating even if the interaction field distribution measured on the diagrams are virtually identical for coated/uncoated samples.

  19. Nanowire Ice of Phase VI and Distorted VII in Mesoporous Silica Nanotorus Superlattice

    NASA Astrophysics Data System (ADS)

    Zhu, Jinlong; Zhang, Jianzhong; Zhao, Yusheng


    The motivation of nano H2O realization and characterization is the highly polarized nature of H2O molecules and the spatial hydrogen bonded networks both in liquid and solid form. The hydrogen bonding character of water molecules results in a remarkably rich phase diagram in the pressure-temperature space. Water/Ice confined in nanochannels showed novel structures and properties as results of hydrophobic and hydrophilic interactions and hydrogen bonding interaction between water molecule and the surface of nanochannel. Studies on nano H2O can provide potential pathway to understand the complicated structure evolutions of ice in the P- T space, because the interplay between nano-confinement and strong intermolecular hydrogen interactions can lead to even richer ice structures which were not found in the none-confined bulk form. The high pressure experiment indicated that the pressure of nanowire ice VI and VII shifted up to 1.7 GPa and 2.5 GPa, and about ~ 0.65 GPa and 0.4 GPa higher than that of normal ice. The nano size effect and the strength of mesoporous silica nanotorus are responsible for the pressure shifts of ice phase regions. More pronounced, the cubic ice VII changed into a tetragonal distorted ``psuedocubic'' structure of the nanowire ice when confined in the mesoporous tubes. The degree of tetragonality increased with increasing pressure, which is resulted from the uniaxial pressure nanowire ice felt, and the anisotropic hydrogen bonding interactions including the H2O-H2O hydrogen bonds in the bulk of the ice and the H2O-silica -OH hydrogen bonds between the interface of nanowire ice and mesoporous silica. The experimental work has benefited from the use of CHESS at Cornell University, which is supported by the NSF award DMR-0936384.

  20. Hollow mesoporous silica as a high drug loading carrier for regulation insoluble drug release.


    Geng, Hongjian; Zhao, Yating; Liu, Jia; Cui, Yu; Wang, Ying; Zhao, Qinfu; Wang, Siling


    The purpose of this study was to develop a high drug loading hollow mesoporous silica nanoparticles (HMS) and apply for regulation insoluble drug release. HMS was synthesized using hard template phenolic resin nanoparticles with the aid of cetyltrimethyl ammonium bromide (CTAB), which was simple and inexpensive. To compare the difference between normal mesoporous silica (NMS) and hollow mesoporous silica in drug loading efficiency, drug release behavior and solid state, NMS was also prepared by soft template method. Transmission electron microscopy (TEM), specific surface area analysis, FT-IR and zeta potential were employed to characterize the morphology structure and physicochemical property of these carriers. The insoluble drugs, carvedilol and fenofibrate(Car and Fen), were chosen as the model drug to be loaded into HMS and NMS. We also chose methylene blue (MB) as a basic dye to estimate the adsorption ability of these carriers from macroscopic and microscopic view, and the drug-loaded carriers were systematically studied by differential scanning calorimetry (DSC), X-ray diffraction (XRD) and UV-vis spectrophotometry. What' more, the in vivo process of HMS was also study by confocal microscopy and in vivo fluorescence imaging. In order to confirm the gastrointestinal safety of HMS, the pathological examination of stomach and intestine also be evaluated. HMS allowed a higher drug loading than NMS and exhibited a relative sustained release curve, while NMS was immediate-release. And the effect of preventing drugs crystallization was weaker than NMS. As for in vivo process, HMS was cleared relatively rapidly from the mouse gastrointestinal and barely uptake by intestinal epithelial cell in this study due to its large particle size. And the damage of HMS to gastrointestinal could be ignored. This study provided a simple method to obtain high drug loading and regulation insoluble drug release, expanded the application of inorganic carriers in drug delivery system

  1. Preparation and Characterization of Rifampin Loaded Mesoporous Silica Nanoparticles as a Potential System for Pulmonary Drug Delivery

    PubMed Central

    Mohseni, Meysam; Gilani, Kambiz; Mortazavi, Seyed Alireza


    The goal of this research is to determine the feasibility of loading rifampin into mesoporous silica nanoparticles. Rifampin was selected as a model lipophilic molecule since it is a well-documented and much used anti tuberculosis drug. The mesoporous silica nanoparticles were prepared by using tetraethyl ortho silicate and cetyltrimethyl ammonium bromide (as surfactant). The prepared nanoparticles were characterized in terms of their particle size measurement and porosimetry. The results showed that the particle size is 218 ± 46 nm (mean ± SD) and surface area is 816 m2g-1. In order to load rifampin within the mesopores, adsorption experiments using three different solvents (methanol, water and dimethyl sulfoxide) were carried out. The loading procedure resulted in a significant improvement in the amount of rifampin loaded into mesoporous silica nanoparticles and methanol was found to be a suitable solvent, providing a drug entrapment efficiency of 52 %. Rifampin loaded nanoparticles underwent different in-vitro tests including, SEM and drug release. The in-vitro drug release was investigated using buffer phosphate (pH=7.4). Regarding the drug release study, a biphasic pattern of release was observed. The drug-loaded mesoporous silica nanoparticles were capable of releasing 95% of their drug content after 24 h, following a faster release in the first four hours. The prepared rifampin loaded nanoparticles seem to have potential for use as a pulmonary drug delivery. PMID:25561909

  2. The effect of aging temperature on structure characteristics of ordered mesoporous silicas

    NASA Astrophysics Data System (ADS)

    Deryło-Marczewska, A.; Marczewski, A. W.; Skrzypek, I.; Pikus, S.; Kozak, M.


    A series of mesoporous silica materials were synthesized by applying Pluronic type polymers as pore creating agents. In order to differentiate the characteristics of porous structure of the obtained sorbents the temperature of aging process was changed in the synthesis. The parameters characterizing the pore structure were estimated from nitrogen adsorption/desorption isotherms. The changes of pore arrangement of the obtained materials being a result of different synthesis conditions were investigated by using a small angle X-ray scattering method. Correlations between the values of structure parameters and aging temperature were found.

  3. Effect of addition of pore expanding agent on changes of structure characteristics of ordered mesoporous silicas

    NASA Astrophysics Data System (ADS)

    Derylo-Marczewska, A.; Marczewski, A. W.; Skrzypek, I.; Pikus, S.; Kozak, M.


    A series of mesoporous silica materials were synthesized by applying two types of Pluronic copolymers as pore creating agents. Differentiation of pore structure of the obtained sorbents was attained by changing the amount of trimethylbenzene as pore expander introduced to a reacting mixture. The parameters characterizing porous structure were estimated from nitrogen adsorption/desorption isotherms. The changes of pore arrangement in the synthesized materials were investigated by using X-ray diffraction. The structural transformations were found at the TMB/polymer ratio of 0.8 and 1. Correlations between the values of structure parameters and the content of TMB were found.

  4. Self-Assembled Mercaptan on Mesoporous Silica (SAMMS) technology of mercury removal and stabilization

    SciTech Connect

    Feng, Xiangdong; Liu, Jun; Fryxell, G.E.


    This paper explains the technology developed to produce Self-Assembled Mercaptan on Mesoporous Silica (SAMMS) for mercury removal from aqueous wastewater and from organic wastes. The characteristics of SAMMS materials, including physical characteristics and mercury loading, and its application for mercury removal and stabilization are discussed. Binding kinetics and binding speciations are reported. Preliminary cost estimates are provided for producing SAMMS materials and for mercury removal from wastewater. The characteristics of SAMMS in mercury separation were studied at PNNL using simulated aqueous tank wastes and actual tritiated pump oil wastes from Savannah River Site; preliminary results are outlined. 47 refs., 16 figs., 16 tabs.

  5. Highly sensitive and stable relative humidity sensors based on WO3 modified mesoporous silica

    NASA Astrophysics Data System (ADS)

    Tomer, Vijay K.; Duhan, Surender


    This study investigates the effectiveness of using WO3 loaded mesoporous silica nanocomposite developed using one step hydrothermal method for measuring relative humidity (RH) at room temperature. On measuring the sensing response, the nanocomposite sensor exhibits excellent linearity, negligible hysteresis, swift response and recovery time, good repeatability, and outstanding stability in 11%-98% RH range. The complex impedance spectra of the sensor at different RHs were used to explore the humidity sensing mechanism. This work could encourage a right approach to blueprint practical humidity sensors with high sensitivity, long stability and fast response/recovery time.

  6. Cancer therapy improvement with mesoporous silica nanoparticles combining targeting, drug delivery and PDT.


    Gary-Bobo, Magali; Hocine, Ouahiba; Brevet, David; Maynadier, Marie; Raehm, Laurence; Richeter, Sébastien; Charasson, Virginie; Loock, Bernard; Morère, Alain; Maillard, Philippe; Garcia, Marcel; Durand, Jean-Olivier


    The synthesis of mesoporous silica nanoparticles (MSN) covalently encapsulating fluoresceine or a photosensitizer, functionalized with galactose on the surface is described. Confocal microscopy experiments demonstrated that the uptake of galactose-functionalized MSN by colorectal cancer cells was mediated by galactose receptors leading to the accumulation of the nanoparticles in the endosomal and lysosomal compartments. The MSN functionalized with a photosensitizer and galactose were loaded with the anti-cancer drug camptothecin. Those MSN combining drug delivery and photodynamic therapy were tested on three cancer cell lines and showed a dramatic enhancement of cancer cell death compared to separate treatments. PMID:22178618

  7. Neoglycoenzyme-Gated Mesoporous Silica Nanoparticles: Toward the Design of Nanodevices for Pulsatile Programmed Sequential Delivery.


    Díez, Paula; Sánchez, Alfredo; de la Torre, Cristina; Gamella, María; Martínez-Ruíz, Paloma; Aznar, Elena; Martínez-Máñez, Ramón; Pingarrón, José M; Villalonga, Reynaldo


    We report herein the design of a stimulus-programmed pulsatile delivery system for sequential cargo release based on the use of a lactose-modified esterase as a capping agent in phenylboronic acid functionalized mesoporous silica nanoparticles. The dual-release mechanism was based on the distinct stability of the cyclic boronic acid esters formed with lactose residues and the long naturally occurring glycosylation chains in the modified neoglycoenzyme. Cargo delivery in succession was achieved using glucose and ethyl butyrate as triggers. PMID:26966914

  8. Adsorption of CO 2, CH 4 and N 2 on ordered mesoporous silica molecular sieve

    NASA Astrophysics Data System (ADS)

    Liu, Xiuwu; Li, Jingwen; Zhou, Li; Huang, Desheng; Zhou, Yaping


    Five samples of ordered mesoporous silica SBA-15 were synthesized. Its pore size was in the range 5-9 nm, and the specific surface area was in the range 500-900 m 2/g, which was controlled by the temperature and time of aging on crystallization. Adsorption isotherms of CO 2, CH 4 and N 2 on the samples were collected at 298 K, and the adsorption rates of the gases were also compared for different pressures. It was concluded that SBA-15 with the textural property studied was a good adsorbent for the separation of carbon dioxide from its mixture with methane and nitrogen.

  9. Mesoporous silica nanoparticles with controlled loading of cationic dendrimer for gene delivery

    NASA Astrophysics Data System (ADS)

    Lin, Jian-Tao; Wang, Chao; Zhao, Yi; Wang, Guan-Hai


    In this work, a series of polyamidoamine (PAMAM) dendrimer-functionalized mesoporous silica nanoparticles (MSNs) with predictable and adjustable cationic charge densities for gene delivery were designed, synthesized and characterized. The ‘clickable’ MSNs with controlled and randomly distributed azide groups were synthesized by co-condensation method, and PAMAM dendrimer was conjugated to MSNs via quantitative click modification. The structures of PAMAM-functionalized MSNs were characterized by FTIR, XRD and TEM analyses. Dendrimer-functionalized MSNs formed complexes with plasmid DNA (pDNA), and the complexes were successfully transfected into human kidney cell 293 T. The in vitro cytotoxicity and gene transfection efficacy were also investigated.

  10. Aerosol Droplet Delivery of Mesoporous Silica Nanoparticles: A Strategy for Respiratory-Based Therapeutics

    PubMed Central

    Li, Xueting; Xue, Min; Raabe, Otto G.; Aaron, Holly L.; Eisen, Ellen A.; Evans, James E.; Hayes, Fred A.; Inaga, Sumire; Tagmout, Abderrahmane; Takeuchi, Minoru; Vulpe, Chris; Zink, Jeffrey I.; Risbud, Subhash H.; Pinkerton, Kent E.


    A highly versatile nanoplatform that couples mesoporous silica nanoparticles (MSN) with an aerosol technology to achieve direct nanoscale delivery to the respiratory tract is described. This novel method can deposit MSN nanoparticles throughout the entire respiratory tract, including nasal, tracheobronchial and pulmonary regions using a water-based aerosol. This delivery method was successfully tested in mice by inhalation. The MSN nanoparticles used have the potential for carrying and delivering therapeutic agents to highly specific target sites of the respiratory tract. The approach provides a critical foundation for developing therapeutic treatment protocols for a wide range of diseases where aerosol delivery to the respiratory system would be desirable. PMID:25819886

  11. Structure evolution of mesoporous silica SBA-15 and MCM-41 under swift heavy ion irradiation

    NASA Astrophysics Data System (ADS)

    Lou, Y.; Toquer, G.; Dourdain, S.; Rey, C.; Grygiel, C.; Simeone, D.; Deschanels, X.


    Two types of mesoporous silica pellets, SBA-15 and MCM-41, were prepared and irradiated by 20Ne 278 MeV (max. fluence = 2.5 × 1014 ion/cm2) and 36Ar 493 MeV beams (max. fluence = 1 × 1013 ion/cm2). Irradiated and non-irradiated samples were characterized by nitrogen adsorption/desorption analysis, small angle X-ray scattering, and infrared spectrometry. The different behaviours of the two materials under different conditions are observed and discussed. We point out that SBA-15 is more robust than MCM-41 under irradiation.

  12. Biosensing Paraoxon in Simulated Environmental Samples by Immobilized Organophosphorus Hydrolase in Functionalized Mesoporous Silica

    SciTech Connect

    Lei, Chenghong; Valenta, Michelle M.; Saripalli, Prasad; Ackerman, Eric J.


    There is a critical need for highly sensitive, cost-effective sensors to conduct ecological analyses for environmental and homeland security related applications. We report here on a method which significantly overcomes this difficulty, and demonstrate its application in a biosensor for aquatic environmental applications. A fast-responding and stable biosensor was developed via immobilization of organophosphorus hydrolase (OPH) in functionalized mesoporous silica (FMS) with pore sizes in tens of nanometers. The sensor was tested for detection of paraoxon in simulated environmental samples, under wide ranging physico-chemical conditions.

  13. Nanocomposite hydrogels for cartilage tissue engineering: mesoporous silica nanofibers interlinked with siloxane derived polysaccharide.


    Buchtová, Nela; Réthoré, Gildas; Boyer, Cécile; Guicheux, Jérôme; Rambaud, Frédéric; Vallé, Karine; Belleville, Philippe; Sanchez, Clément; Chauvet, Olivier; Weiss, Pierre; Le Bideau, Jean


    Injectable materials for mini-invasive surgery of cartilage are synthesized and thoroughly studied. The concept of these hybrid materials is based on providing high enough mechanical performances along with a good medium for chondrocytes proliferation. The unusual nanocomposite hydrogels presented herein are based on siloxane derived hydroxypropylmethylcellulose (Si-HPMC) interlinked with mesoporous silica nanofibers. The mandatory homogeneity of the nanocomposites is checked by fluorescent methods, which show that the silica nanofibres dispersion is realized down to nanometric scale, suggesting an efficient immobilization of the silica nanofibres onto the Si-HPMC scaffold. Such dispersion and immobilization are reached thanks to the chemical affinity between the hydrophilic silica nanofibers and the pendant silanolate groups of the Si-HPMC chains. Tuning the amount of nanocharges allows tuning the resulting mechanical features of these injectable biocompatible hybrid hydrogels. hASC stem cells and SW1353 chondrocytic cells viability is checked within the nanocomposite hydrogels up to 3 wt% of silica nanofibers. PMID:23666665

  14. Highly efficient VOx/SBA-15 mesoporous catalysts for oxidative dehydrogenation of propane.


    Liu, Yong-Mie; Cao, Yong; Zhu, Ka-Ke; Yan, Shi-Run; Dai, Wei-Lin; He, He-Yong; Fan, Kang-Nian


    Highly dispersed vanadia species on SBA-15 mesoporous silica have been found to exhibit a highly efficient catalytic performance for the oxidative dehydrogenation (ODH) of propane to light olefins (propene + ethylene). PMID:12478769

  15. Observations on size confinement effect in B-C-N nanoparticles embedded in mesoporous silica channels

    SciTech Connect

    Tripathi, Neeti; Yamashita, Masaru; Akai, Tomoko; Uchida, Takeyuki


    Fluorescent B-C-N/silica nanoparticles were synthesized by solution impregnation method. Effect of B-C-N particle size on the optical properties was investigated by varying the silica pore sizes. Formation of B-C-N nanoparticles within the mesoporous matrix is confirmed by x-ray diffraction, transmission electron microscopy, and Fourier transform infrared spectroscopy. Furthermore, a remarkable blue-shift in emission peak centres with decreasing pore size in conjugation with band gap modification, ascribed to the size confinement effect. A detailed analysis of experimental results by theoretically defined confinement models demonstrates that the B-C-N nanoparticles in the size range of 3–13 nm falls within the confinement regime. This work demonstrated the experimental evidence of the size confinement effect in smaller size B-C-N nanoparticles.

  16. Ordered mesoporous silica films with pores oriented perpendicular to a titanium nitride substrate.


    Robertson, Calum; Beanland, Richard; Boden, Stuart A; Hector, Andrew L; Kashtiban, Reza J; Sloan, Jeremy; Smith, David C; Walcarius, Alain


    The production of thin mesoporous silica films with small (∼2-3 nm) pores oriented perpendicular to a titanium nitride growth surface is demonstrated using two methods. These are the growth from a Stöber silica solution with surfactant ordering at the surface of the electrode, and electrochemically assisted growth from an acidic sol achieved by polarisation of the electrode surface. The thickness, pore order and pore size that can be achieved with these two methods is contrasted. A number of methods to vary the pore size by using different surfactants and swelling agents are explored. The advantage of applying these growth methods on titanium nitride surfaces is that it provides access to a wider electrochemical window for nanowire growth and sensor applications with non-aqueous electrolytes whilst retaining good film growth and adhesion properties. PMID:25589465

  17. Mesoporous silica nanoparticles with controllable morphology prepared from oil-in-water emulsions.


    Gustafsson, Hanna; Isaksson, Simon; Altskär, Annika; Holmberg, Krister


    Mesoporous silica nanoparticles are an important class of materials with a wide range of applications. This paper presents a simple protocol for synthesis of particles as small as 40nm and with a pore size that can be as large as 9nm. Reaction conditions including type of surfactant, type of catalyst and presence of organic polymer were investigated in order to optimize the synthesis. An important aim of the work was to understand the mechanism behind the formation of these unusual structures and an explanation based on silica condensation in the small aqueous microemulsion droplets that are present inside the drops of an oil-in-water emulsion is put forward. PMID:26803604

  18. Engineering and characterization of mesoporous silica-coated magnetic particles for mercury removal from industrial effluents

    NASA Astrophysics Data System (ADS)

    Dong, Jie; Xu, Zhenghe; Wang, Feng


    Mesoporous silica coatings were synthesized on dense liquid silica-coated magnetite particles using cetyl-trimethyl-ammonium chloride (CTAC) as molecular templates, followed by sol-gel process. A specific surface area of the synthesized particles as high as 150 m 2/g was obtained. After functionalization with mercapto-propyl-trimethoxy-silane (MPTS) through silanation reaction, the particles exhibited high affinity of mercury in aqueous solutions. Atomic force microscopy (AFM), zeta potential measurement, thermal gravimetric analysis (TGA), analytical transmission electron microscopy (TEM), X-ray photoelectron spectroscopy (XPS) and atomic absorption spectroscopy (AAS) were used to characterize the synthesis processes, surface functionalization, and mercury adsorption on the synthesized magnetite particles. The loading capacity of the particles for mercury was determined to be as high as 14 mg/g at pH 2. A unique feature of strong magnetism of the synthesized nanocomposite particles makes the subsequent separation of the magnetic sorbents from complex multiphase suspensions convenient and effective.

  19. Fluorescent monodisperse spherical particles based on mesoporous silica containing rhodamine 6G

    NASA Astrophysics Data System (ADS)

    Trofimova, E. Yu.; Grudinkin, S. A.; Kukushkina, Yu. A.; Kurdyukov, D. A.; Medvedev, A. V.; Yagovkina, M. A.; Golubev, V. G.


    Fluorescent monodisperse spherical silica (SiO2) particles with a regular mesoporous structure containing encapsulated Rhodamine 6G (R6G) dye have been synthesized. The as-synthesized particles have been coated with SiO2 and SiO2-CTAB (cetyltrimethylammonium bromide, C16H33N(CH3)3Br) shells in order to prevent uncontrolled release of the dye from pores. The kinetics of R6G release from the pores of silica particles has been studied. It has been found that the particles synthesized by adding CTAB and R6G to the reaction mixture, as well as the particles coated with the SiO2-CTAB shell, are characterized by the maximum duration of dye release from the pores, which is probably associated with the formation of chemical bonds between R6G and CTAB molecules.

  20. Catalytic process for hydrocarbon cracking using synthetic mesoporous crystalline material

    SciTech Connect

    Le, Q.N.; Thomson, R.T.


    A process is described for catalytic cracking of naphtha feedstock which comprises contacting feedstock containing at least 20 wt % C7-C12 alkanes under catalytic reaction conditions with inorganic, porous, non-layered crystalline phase catalyst material exhibiting, after calcination, an X-ray diffraction pattern with at least one peak at a d-spacing greater than 18 Angstrom units and having a benzene adsorption capacity greater than 15 grams of benzene per 100 grams of said material at 50 torr and 25 C, said catalyst material having active Bronsted acid sites; and wherein said cracking conditions include total pressure up to 500 kPa and reaction temperature of 425 to 650 C for less than 50 wt % partial feedstock cracking; thereby producing cracking effluent containing at least 20 wt % isomeric C4-C5 aliphatics including at least 10 wt % C4-C5 tertiary alkene, and at least 10 wt % C4-C5 isoalkane, based on C[sub 5[minus

  1. Mesoporous Nano-Silica Serves as the Degradation Inhibitor in Polymer Dielectrics

    NASA Astrophysics Data System (ADS)

    Yang, Yang; Hu, Jun; He, Jinliang


    A new generation of nano-additives for robust high performance nanodielectrics is proposed. It is demonstrated for the first time that mesoporous material could act as “degradation inhibitor” for polymer dielectrics to sequestrate the electrical degradation products then restrain the electrical aging process especially under high temperature conditions, which is superior to the existing additives of nanodielectrics except further increasing the dielectric strength. Polyethylenimine (PEI) loaded nano-scaled mesoporous silica MCM-41 (nano-MS) is doped into the dielectric matrix to prepare the PP/MCM-41-PEI nanocomposites. PEI provides the amines to capture the electrical degradation products while the MCM-41 brackets afford large adsorption surface, bring down the activating temperature of the absorbent then enhance the absorptive capacity. The electrical aging tests confirm the contribution of the mesoporous structure to electrical aging resistance and FT-IR analysis of the electrical degraded regions demonstrates the chemical absorption especially under high temperature conditions. Take the experimental data as examples, extending the aging durability and dielectric strength of polymer dielectrics by 5 times and 16%, respectively, can have substantial commercial significance in energy storage, power electronics and power transmission areas.

  2. Triblock siloxane copolymer surfactant: template for spherical mesoporous silica with a hexagonal pore ordering.


    Stébé, M J; Emo, M; Forny-Le Follotec, A; Metlas-Komunjer, L; Pezron, I; Blin, J L


    Ordered mesoporous silica materials with a spherical morphology have been prepared for the first time through the cooperative templating mechanism (CTM) by using a silicone triblock copolymer as template. The behavior of the pure siloxane copolymer amphiphile in water was first investigated. A direct micellar phase (L(1)) and a hexagonal (H(1)) liquid crystal were found. The determination of the structural parameters by SAXS measurements leads us to conclude that in the hexagonal liquid crystal phase a part of the ethylene oxide group is not hydrated as observed for the micelles. Mesoporous materials were then synthesized from the cooperative templating mechanism. The recovered materials were characterized by SAXS measurements, nitrogen adsorption-desorption analysis, and transmission and scanning electron microscopy. The results clearly evidence that one can control the morphology and the nanostructuring of the resulting material by modifying the synthesis parameters. Actually, highly ordered mesoporous materials with a spherical morphology have been obtained with a siloxane copolymer/tetramethoxysilane molar ratio of 0.10 after hydrothermal treatment at 100 °C. Our study also supports the fact that the interactions between micelles and the hydrolyzed precursor are one of the key parameters governing the formation of ordered mesostructures through the cooperative templating mechanism. Indeed, we have demonstrated that when the interactions between micelles are important, only wormhole-like structures are recovered. PMID:23305163

  3. Mesoporous Nano-Silica Serves as the Degradation Inhibitor in Polymer Dielectrics.


    Yang, Yang; Hu, Jun; He, Jinliang


    A new generation of nano-additives for robust high performance nanodielectrics is proposed. It is demonstrated for the first time that mesoporous material could act as "degradation inhibitor" for polymer dielectrics to sequestrate the electrical degradation products then restrain the electrical aging process especially under high temperature conditions, which is superior to the existing additives of nanodielectrics except further increasing the dielectric strength. Polyethylenimine (PEI) loaded nano-scaled mesoporous silica MCM-41 (nano-MS) is doped into the dielectric matrix to prepare the PP/MCM-41-PEI nanocomposites. PEI provides the amines to capture the electrical degradation products while the MCM-41 brackets afford large adsorption surface, bring down the activating temperature of the absorbent then enhance the absorptive capacity. The electrical aging tests confirm the contribution of the mesoporous structure to electrical aging resistance and FT-IR analysis of the electrical degraded regions demonstrates the chemical absorption especially under high temperature conditions. Take the experimental data as examples, extending the aging durability and dielectric strength of polymer dielectrics by 5 times and 16%, respectively, can have substantial commercial significance in energy storage, power electronics and power transmission areas. PMID:27338622

  4. Prediction of Thermal Conductivity of Aluminum Nanocluster-Filled Mesoporous Silica (Al/MCM-41)

    NASA Astrophysics Data System (ADS)

    Huang, Congliang; Feng, Yanhui; Zhang, Xinxin; Li, Jing; Cui, Liu; Wang, Ge; Yang, Mu


    MCM-41 consists of a hexagonal array of long, unconnected cylindrical pores with diameters that can be tailored within the range 1.6 nm to 10 nm. As a porous silica nanomaterial, MCM-41 is a promising porous substrate for mesoporous composites with extremely high or low thermal conductivity. In this article, the structural unit of MCM-41 was established first and an equilibrium molecular dynamics simulation was performed to determine the shell thermal conductivity of MCM-41. Then, based on one-dimensional (1D) heat transfer analysis, a mathematical expression for the effective thermal conductivity (ETC) of Al nanocluster-filled mesoporous MCM-41 (Al/MCM-41) was obtained. The effects of porosity and the filling ratio of nanoclusters in the mesochannels were further investigated. As the porosity is greater than 75 %, the ETC of only-air-filling mesoporous MCM-41 in all directions tends to approach the thermal conductivity of air. It seems that Al nanoclusters have negligible effects on the ETC of the composite, except that mesochannels are almost completely filled with Al nanowires.

  5. Enzyme-entrapped mesoporous silica for treatment of uric acid disorders.


    Muthukoori, Shanthini; Narayanan, Naagarajan; Chandra, Manuguri Sesha Sarath; Sethuraman, Swaminathan; Krishnan, Uma Maheswari


    Gout is an abnormality in the body resulting in the accumulation of uric acid mainly in joints. Dissolution of uric acid crystals into soluble allantoin by the enzyme uricase might provide a better alternative for the treatment of gout. This work aims to investigate the feasibility of a transdermal patch loaded with uricase for better patient compliance. Mesoporous silica (SBA-15) was chosen as the matrix for immobilisation of uricase. Highly oriented mesoporous SBA-15 was synthesized, characterized and uricase was physisorbed in the mesoporous material. The percentage adsorption and release of enzyme in borate buffer was monitored. The release followed linear kinetics and greater than 80% enzyme activity was retained indicating the potential of this system as an effective enzyme immobilization matrix. The enzyme permeability was studied with Wistar rat skin and human cadaver skin. It was found that in case of untreated rat skin 10% of enzyme permeated through skin in 100 h. The permeation increased by adding permeation enhancer (combination of oleic acid in propylene glycol (OA in PG)). The permeation enhancement was studied under two concentrations of OA in PG (1%, 5%) in both rat and human cadaver skin and it was found that 1% OA in PG showed better result in rat skin and 5% OA in PG showed good results in human cadaver skin. PMID:23802423

  6. Nanotherapeutics of PTEN Inhibitor with Mesoporous Silica Nanocarrier Effective for Axonal Outgrowth of Adult Neurons.


    Kim, Min Soo; El-Fiqi, Ahmed; Kim, Jong-Wan; Ahn, Hong-Sun; Kim, Hyukmin; Son, Young-Jin; Kim, Hae-Won; Hyun, Jung Keun


    Development of therapeutic strategies such as effective drug delivery is an urgent and yet unmet need for repair of damaged nervous systems. Phosphatase and tensin homolog deleted on chromosome 10 (PTEN) regulates axonal regrowth of central and peripheral nervous systems; its inhibition, meanwhile, facilitates axonal outgrowth of injured neurons. Here we show that nanotherapeutics based on mesoporous silica nanoparticles loading PTEN-inhibitor bisperoxovanadium (BpV) are effective for delivery of drug molecules and consequent improvement of axonal outgrowth. Mesoporous nanocarriers loaded BpV drug at large amount (27 μg per 1 mg of carrier), and released sustainably over 10 d. Nanocarrier-BpV treatment of primary neurons from the dorsal root ganglions (DRGs) of rats and mice at various concentrations induced them to actively take up the nanocomplexes with an uptake efficiency as high as 85%. The nanocomplex-administered neurons exhibited significantly enhanced axonal outgrowth compared with those treated with free-BpV drug. The expression of a series of proteins involved in PTEN inhibition and downstream signaling was substantially up-/down-regulated by the nanocarrier-BpV system. Injection of the nanocarriers into neural tissues (DRG, brain cortex, and spinal cord), moreover, demonstrated successful integration into neurons, glial cells, oligodendrocytes, and macrophages, suggesting the possible nanotherapeutics applications in vivo. Together, PTEN-inhibitor delivery via mesoporous nanocarriers can be considered a promising strategy for stimulating axonal regeneration in central and peripheral nervous systems. PMID:27386893

  7. Mesoporous Nano-Silica Serves as the Degradation Inhibitor in Polymer Dielectrics

    PubMed Central

    Yang, Yang; Hu, Jun; He, Jinliang


    A new generation of nano-additives for robust high performance nanodielectrics is proposed. It is demonstrated for the first time that mesoporous material could act as “degradation inhibitor” for polymer dielectrics to sequestrate the electrical degradation products then restrain the electrical aging process especially under high temperature conditions, which is superior to the existing additives of nanodielectrics except further increasing the dielectric strength. Polyethylenimine (PEI) loaded nano-scaled mesoporous silica MCM-41 (nano-MS) is doped into the dielectric matrix to prepare the PP/MCM-41-PEI nanocomposites. PEI provides the amines to capture the electrical degradation products while the MCM-41 brackets afford large adsorption surface, bring down the activating temperature of the absorbent then enhance the absorptive capacity. The electrical aging tests confirm the contribution of the mesoporous structure to electrical aging resistance and FT-IR analysis of the electrical degraded regions demonstrates the chemical absorption especially under high temperature conditions. Take the experimental data as examples, extending the aging durability and dielectric strength of polymer dielectrics by 5 times and 16%, respectively, can have substantial commercial significance in energy storage, power electronics and power transmission areas. PMID:27338622

  8. One-pot pseudomorphic crystallization of mesoporous porous silica to hierarchical porous zeolites

    SciTech Connect

    Xing, Jun-Ling; Jiang, Shu-Hua; Pang, Jun-Ling; Yuan, En-Hui; Ma, Xiao-Jing; Lam, Koon-Fung; Xue, Qing-Song; Zhang, Kun


    Hierarchically porous silica with mesopore and zeolitic micropore was synthesized via pseudomorphic crystallization under high-temperature hydrothermal treatment in the presence of cetyltrimethylammonium tosylate and tetrapropylammonium ions. A combined characterization using small-angle X-ray diffraction (XRD), nitrogen adsorption, high-resolution transmission electron microscopy (TEM), thermogravimetric analysis (TG), and elemental analysis showed that dual templates, CTA{sup +} and TPA{sup +} molecules, can work in a cooperative manner to synthesize mesoporous zeolite in a one-pot system by precisely tuning the reaction conditions, such as reaction time and temperature, and type and amount of heterometal atoms. It is found that the presence of Ti precursor is critical to the successful synthesis of such nanostructure. It not only retards the nucleation and growth of crystalline MFI domains, but also acts as nano-binder or nano-glue to favor the assembly of zeolite nanoblocks. - Graphical abstract: Display Omitted - Highlights: • A facile method to synthesize mesoporous zeolites with hierarchical porosity was presented. • It gives a new insight into keeping the balance between mesoscopic and molecular ordering in hierarchical porous materials. • A new understanding on the solid–solid transformation mechanism for the synthesis of titanosilicate zeolites was proposed.

  9. Progammed synthesis of magnetic mesoporous silica coated carbon nanotubes for organic pollutant adsorption

    NASA Astrophysics Data System (ADS)

    Tong, Yue; Zhang, Min; Xia, Peixiong; Wang, Linlin; Zheng, Jing; Li, Weizhen; Xu, Jingli


    Magnetic mesoporous silica coated carbon nanotubes were produced from hydrophilic monodisperse magnetic nanoparticles decorated carbon nanotubes using well controlled programmed synthesis method and were characterized by TEM, XRD, FTIR, TGA, N2 adsorption-desorption and VSM. The well-designed mesoporous magnetic nanotubes had a large specific area, a highly open mesoporous structure and high magnetization. Firstly, SiO2-coated maghemite/CNTs nanoparticles (CNTs/Fe3O4@SiO2 composites) were synthesized by the combination of high temperature decomposition process and an sol-gel method, in which the iron acetylacetonate as well as TEOS acted as the precursor for maghemite and SiO2, respectively. The CNTs/Fe3O4@SiO2 composites revealed a core-shell structure, Then, CNTs/Fe3O4@mSiO2 was obtained by extracting cetyltrimethylammonium bromide (CTAB) via an ion-exchange procedure. The resulting composites show not only a magnetic response to an externally applied magnetic field, but also can be a good adsorbent for the organic pollutant in the ambient temperature.

  10. Silylated mesoporous silica membranes on polymeric hollow fiber supports: synthesis and permeation properties.


    Kim, Hyung-Ju; Brunelli, Nicholas A; Brown, Andrew J; Jang, Kwang-Suk; Kim, Wun-gwi; Rashidi, Fereshteh; Johnson, Justin R; Koros, William J; Jones, Christopher W; Nair, Sankar


    We report the synthesis and organic/water separation properties of mesoporous silica membranes, supported on low-cost and scalable polymeric (polyamide-imide) hollow fibers, and modified by trimethylsilylation with hexamethyldisilazane. Thin (∼1 μm) defect-free membranes are prepared, with high room-temperature gas permeances (e.g., 20,000 GPU for N2). The membrane morphology is characterized by multiple techniques, including SEM, TEM, XRD, and FT-ATR spectroscopy. Silylation leads to capping of the surface silanol groups in the mesopores with trimethylsilyl groups, and does not affect the integrity of the mesoporous silica structure and the underlying hollow fiber. The silylated membranes are evaluated for pervaporative separation of ethanol (EtOH), methylethyl ketone (MEK), ethyl acetate (EA), iso-butanol (i-BuOH), and n-butanol (n-BuOH) from their dilute (5 wt %) aqueous solutions. The membranes show separation factors in the range of 4-90 and high organic fluxes in the range of 0.18-2.15 kg m(-2) h(-1) at 303 K. The intrinsic selectivities (organic/water permeability ratios) of the silylated membranes at 303 K are 0.33 (EtOH/water), 0.5 (MEK/water), 0.25 (EA/water), 1.25 (i-BuOH/water), and 1.67 (n-BuOH/water) respectively, in comparison to 0.05, 0.015, 0.005, 0.08, and 0.14 for the unmodified membranes. The silylated membranes allow upgradation of water/organics feeds to permeate streams with considerably higher organics content. The selective and high-flux separation is attributed to both the organophilic nature of the modified mesopores and the large effective pore size. Comparison with other organics/water separation membranes reveals that the present membranes show promise due to high flux, use of scalable and low-cost supports, and good separation factors that can be further enhanced by tailoring the mesopore silylation chemistry. PMID:25255051

  11. Characterization and acidic properties of Al-SBA-15 materials prepared by post-synthesis alumination of a low-cost ordered mesoporous silica

    SciTech Connect

    Gomez-Cazalilla, M.; Merida-Robles, J.M.; Gurbani, A.; Rodriguez-Castellon, E.; Jimenez-Lopez, A.


    A series of Al-containing SBA-15 type materials with different Si/Al ratio, were prepared by post-synthesis modification of a pure highly ordered mesoporous silica SBA-15 obtained by using sodium silicate as silica source, and amphiphilic block copolymer as structure-directing agent. A high level of aluminum incorporation was achieved, reaching an Si/Al ratio of up to 5.5, without any significant loss in the textural properties of SBA-15. These materials were fully characterized by powder X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), {sup 27}Al NMR spectroscopy, and N{sub 2} adsorption at 77 K. The acid properties of these materials have been evaluated by NH{sub 3}-TPD, adsorption of pyridine and deuterated acetonitrile coupled to FTIR spectroscopy. The effective acidity of these materials was evaluated using two catalytic reactions: 2-propanol dehydrogenation and 1-butene isomerization. The adsorption of basic probe molecules and the catalytic behavior revealed an evolution of the acid properties with the Al content. These studies have shown that the Al-SBA-15 materials contain Bronsted and Lewis acid sites with medium acidity which makes them appropriate to be used as acid catalysts in heterogeneous catalysis, catalytic supports, and adsorbents. - Graphical abstract: Al KLL spectra of Al-SBA-15 materials with different Si/Al ratios.

  12. Cobalt- and iron-based nanoparticles hosted in SBA-15 mesoporous silica and activated carbon from biomass: Effect of modification procedure

    NASA Astrophysics Data System (ADS)

    Tsoncheva, Tanya; Genova, Izabela; Paneva, Daniela; Dimitrov, Momtchil; Tsyntsarski, Boyko; Velinov, Nicolay; Ivanova, Radostina; Issa, Gloria; Kovacheva, Daniela; Budinova, Temenujka; Mitov, Ivan; Petrov, Narzislav


    Ordered mesoporous silica of SBA-15 type and activated carbon, prepared from waste biomass (peach stones), are used as host matrix of nanosized iron and cobalt particles. The effect of preparation procedure on the state of loaded nanoparticles is in the focus of investigation. The obtained materials are characterized by Boehm method, low temperature physisorption of nitrogen, XRD, UV-Vis, FTIR, Mossbauer spectroscopy and temperature programmed reduction with hydrogen. The catalytic behaviour of the samples is tested in methanol decomposition. The dispersion, oxidative state and catalytic behaviour of loaded cobalt and iron nanoparticles are successfully tuned both by the nature of porous support and the metal precursor used during the samples preparation. Facile effect of active phase deposition from aqueous solution of nitrate precursors is assumed for activated carbon support. For the silica based materials the catalytic activity could be significantly improved when cobalt acetylacetonate is used during the modification. The complex effect of pore topology and surface functionality of different supports on the active phase formation is discussed.

  13. Ordered hexagonal mesoporous aluminosilicates with low Si/Al ratio: synthesis, characterization, and catalytic application.


    Liu, Aifeng; Che, Hongwei; Liu, Chuanzhi; Fu, Quanrong; Jiang, Ruijiao; Wang, Cheng; Wang, Liang


    Ordered hexagonal mesoporous aluminosilicates with lower Si/Al ratio below 5 have been successfully synthesized via the co-assembly of preformed aluminosilicate precursors with Gemini surfactant [C12H25N+(CH3)2(CH2)6N+(CH3)2C12H25] x 2Br(-) as the template. Powder X-ray diffraction, transmission electron microscopy, scanning electron microscopy, N2 adsorption-desorption isotherm measurements, Fourier transform infrared spectroscopy, 27Al nuclear magnetic resonance, thermogravimetric analysis, and temperature-programmed desorption of cyclohexylamine are employed to characterize the resulting samples. The phenol alkylation reaction is carried out to evaluate their catalytic performances. These studies indicate that the sample with a low Si/Al ratio of 3 still retains a highly ordered hexagonal mesoporous structure. And it also possesses the highest acidity of 0.96 mmol among the samples with lower Si/Al ratios below 5 due to its higher specific surface area together with more content of tetrahedrally coordinated Al in the framework. The catalytic tests confirm that the acidity of the samples plays a key role in determining their catalytic performances. PMID:24738433

  14. Organically functionalized mesoporous silica as a support for synthesis and catalysis

    NASA Astrophysics Data System (ADS)

    McEleney, Kevin Andrew

    Mesoporous silicates are excellent materials for supported catalysis due to their ease of functionalization, tunable pore size and high surface areas. Mesoporous silicates have been utilized in a variety of applications such as drug delivery scaffolds and catalyst supports. Functionalization of the surface can be achieved by either grafting of alkoxy silanes or co-condensation of the organosilane with the inorganic silica source. My research in this area can be divided into two components. In the first, we address the significant issue of metal contamination after reactions that are catalyzed by transition metals. In the second, we examine the design of new catalysts based on organic/inorganic composites. Ruthenium catalyzed processes such as olefin metathesis or asymmetric hydrogenation, are often underutilized due to the difficulty of removing the ruthenium by-products. Attempts to remove ruthenium involve treating the solution with a scavenging reagent followed by silica chromatography. Often these scavenging agents are expensive phosphines or toxic agents like lead tetra-acetate. SBA-15 functionalized with aminopropyl triethoxysilane displays a high affinity for ruthenium. Furthermore, it can be utilized to remove ruthenium by-products from olefin metathesis or hydrogenation reactions without the need for silica chromatography. We have also prepared sulfur-functionalized mesoporous silicates that have a high affinity for palladium. The materials after loading prove to be active catalysts for a variety of palladium catalyzed processes such as Suzuki-Miyaura and Sonogashira couplings. The catalysts are recyclable with moderate loss of activity and structure, depending on the method of incorporation of the thiol. We have characterized the as-synthesized and used catalysts by nitrogen sorption, TEM, X-ray photoelectron spectroscopy (XPS) and a variety of homogeneity tests were performed on the catalysts. Periodic mesoporous organosilicates (PMOs) are a well known

  15. Multifunctional mesoporous silica nanoparticles for combined therapeutic, diagnostic and targeted action in cancer treatment.


    Rosenholm, Jessica M; Sahlgren, Cecilia; Lindén, Mika


    The main objective in the development of nanomedicine is to obtain delivery platforms for targeted delivery of drugs or imaging agents for improved therapeutic efficacy, reduced side effects and increased diagnostic sensitivity. A (nano)material class that has been recognized for its controllable properties on many levels is ordered mesoporous inorganic materials, typically in the form of amorphous silica (SiO2). Characteristics for this class of materials include mesoscopic order, tunable pore dimensions in the (macro)molecular size range, a high pore volume and surface area, the possibility for selective surface functionality as well as morphology control. The robust but biodegradable ceramic matrix moreover provides shelter for incorporated agents (drugs, proteins, imaging agents, photosensitizers) leaving the outer particle surface free for further modification. The unique features make these materials particularly amenable to modular design, whereby functional moieties and features may be interchanged or combined to produce multifunctional nanodelivery systems combining targeting, diagnostic, and therapeutic actions. This review covers the latest developments related to the use of mesoporous silica nanoparticles (MSNs) as nanocarriers in biomedical applications, with special focus on cancer therapy and diagnostics. PMID:21443474

  16. Mesoporous Silica Nanoparticles Decorated with Carbosilane Dendrons as New Non-viral Oligonucleotide Delivery Carriers.


    Martínez, Ángel; Fuentes-Paniagua, Elena; Baeza, Alejandro; Sánchez-Nieves, Javier; Cicuéndez, Mónica; Gómez, Rafael; de la Mata, F Javier; González, Blanca; Vallet-Regí, María


    A novel nanosystem based on mesoporous silica nanoparticles covered with carbosilane dendrons grafted on the external surface of the nanoparticles is reported. This system is able to transport single-stranded oligonucleotide into cells, avoiding an electrostatic repulsion between the cell membrane and the negatively charged nucleic acids thanks to the cationic charge provided by the dendron coating under physiological conditions. Moreover, the presence of the highly ordered pore network inside the silica matrix would make possible to allocate other therapeutic agents within the mesopores with the aim of achieving a double delivery. First, carbosilane dendrons of second and third generation possessing ammonium or tertiary amine groups as peripheral functional groups were prepared. Hence, different strategies were tested in order to obtain their suitable grafting on the outer surface of the nanoparticles. As nucleic acid model, a single-stranded DNA oligonucleotide tagged with a fluorescent Cy3 moiety was used to evaluate the DNA adsorption capacity. The hybrid material functionalised with the third generation of a neutral dendron showed excellent DNA binding properties. Finally, the cytotoxicity as well as the capability to deliver DNA into cells, was tested in vitro by using a human osteoblast-like cell line, achieving good levels of internalisation of the vector DNA/carbosilane dendron-functionalised material without affecting the cellular viability. PMID:26361378

  17. Mesoporous-silica nanofluidic channels for quick enrichment/extraction of trace pesticide molecules

    NASA Astrophysics Data System (ADS)

    Xu, Pengcheng; Chen, Chuanzhao; Li, Xinxin


    As nanofluidic channels, uniaxially oriented mesoporous-silica is, for the first time, in-situ self-assembled in a microfluidic chip for quick enrichment/extraction of ng L-1(ppt)-level organo-phosphorous (OP) pesticide residue from aqueous solution to ethanol. This micro/nano combined pre-treatment chip is essential for following gas chromatography-mass spectrometry (GC-MS) quantitative analysis. Featuring huge surface area and dense silanol groups at the inwall surface, the mesoporous-silica is uniaxially self-assembled in a micro-reservoir to form a pile of nanofluidic channels (diameter = 2.1 nm). The captured/enriched pesticide molecules in the nanochannels can be efficiently extracted by much smaller volume of ethanol due to its much higher solubility to OP. In our affirming experiment, three mixed OP pesticides of dichlorvos, paraoxon and chlorpyrifos (in water) are captured/enriched by the nano-channels and eluted/extracted by only 0.6 mL ethanol. The whole process only takes 16 min. The GC-MS quantitative results for the extracted three pesticides indicate that the extraction recovery achieves 80%. The achieved limit of quantification (LOQ) and the limit of detection (LOD) are 100 ng L-1 and 30 ng L-1, respectively. The nanofluidic-channel pre-treatment technique is promising in various application fields like agriculture and food safety security.

  18. Hybrid lipid-capped mesoporous silica for stimuli-responsive drug release and overcoming multidrug resistance.


    Han, Ning; Zhao, Qinfu; Wan, Long; Wang, Ying; Gao, Yikun; Wang, Pu; Wang, Zhanyou; Zhang, Jinghai; Jiang, Tongying; Wang, Siling


    Multidrug resistance (MDR) is known to be a great obstruction to successful chemotherapy, and considerable efforts have been devoted to reverse MDR including designing various functional drug delivery systems. In this study, hybrid lipid-capped mesoporous silica nanoparticles (LTMSNs), aimed toward achieving stimuli-responsive drug release to circumvent MDR, were specially designated for drug delivery. After modifying MSNs with hydrophobic chains through disulfide bond on the surface, lipid molecules composing polymer d-α-tocopherol polyethylene glycol 1000 succinate (TPGS) with molar ratio of 5:1 were subsequently added to self-assemble into a surrounded lipid layer via hydrophobic interaction acting as smart valves to block the pore channels of carrier. The obtained LTMSNs had a narrow size distribution of ca. 190 nm and can be stably dispersed in body fluids, which may ensure a long circulating time and ideal enhanced permeability and retention effect. Doxorubicin (DOX) was chosen as a model drug to be encapsulated into LTMSNs. Results showed that this hybrid lipid-capped mesoporous silica drug delivery system can achieve redox and pH-responsive release of DOX, thereby avoiding the premature leakage of drug before reaching the specific site and releasing DOX within the cancerous cells. Owing to the presence of TPGS-containing lipid layer, LTMSNs-DOX exhibited higher uptake efficiency, cytotoxicity, and increased intracellular accumulation in resistant MCF-7/Adr cells compared with DOX solution, proving to be a promising vehicle to realize intracellular drug release and inhibit drug efflux. PMID:25584634

  19. Further Insight into the Definite Morphology and Formation Mechanism of Mesoporous Silica KCC-1.


    Febriyanti, E; Suendo, V; Mukti, R R; Prasetyo, A; Arifin, A F; Akbar, M A; Triwahyono, S; Marsih, I N; Ismunandar


    The unique three-dimensional pore structure of KCC-1 has attracted significant attention and has proven to be different compared to other conventional mesoporous silica such as the MCM-41 family, SBA-15, or even MSN nanoparticles. In this research, we carefully examine the morphology of KCC-1 to define more appropriate nomenclature. We also propose a formation mechanism of KCC-1 based on our experimental evidence. Herein, the KCC-1 morphology was interpreted mainly on the basis of compiling all observation and information taken from SEM and TEM images. Further analysis on TEM images was carried out. The gray value intensity profile was derived from TEM images in order to determine the specific pattern of this unique morphology that is found to be clearly different from that of other types of porous spherical-like morphologies. On the basis of these results, the KCC-1 morphology would be more appropriately reclassified as bicontinuous concentric lamellar morphology. Some physical characteristics such as the origin of emulsion, electrical conductivity, and the local structure of water molecules in the KCC-1 emulsion were disclosed to reveal the formation mechanism of KCC-1. The origin of the KCC-1 emulsion was characterized by the observation of the Tyndall effect, conductometry to determine the critical micelle concentration, and Raman spectroscopy. In addition, the morphological evolution study during KCC-1 synthesis completes the portrait of the formation of mesoporous silica KCC-1. PMID:27120557

  20. Improved Performance of Lipase Immobilized on Tannic Acid-Templated Mesoporous Silica Nanoparticles.


    Jiang, Yanjun; Sun, Wenya; Zhou, Liya; Ma, Li; He, Ying; Gao, Jing


    Mesoporous silica nanoparticles were synthesized by using tannic acid as a pore-forming agent, which is an environmentally friendly, cheap, and non-surfactant template. SEM and TEM images indicated that the tannic acid-templated mesoporous silica nanoparticles (TA-MSNs) are monodisperse spherical-like particles with an average diameter of 195 ± 16 nm. The Brunauer-Emmett-Teller (BET) results showed that the TA-MSNs had a relatively high surface area (447 m(2)/g) and large pore volume (0.91 cm(3)/g), and the mean pore size was ca. 10.1 nm. Burkholderia cepacia lipase was immobilized on the TA-MSNs by physical adsorption for the first time, and the properties of immobilized lipase (BCL@TA-MSNs) were investigated. The BCL@TA-MSNs exhibited satisfactory thermal stability; strong tolerance to organic solvents such as methanol, ethanol, isooctane, n-hexane, and tetrahydrofuran; and high operational reusability when BCL@TA-MSNs were applied in esterification and transesterification reactions. After recycling 15 times in the transesterification reaction for biodiesel production, over 85 % of biodiesel yield can be maintained. With these desired characteristics, the TA-MSNs may provide excellent candidates for enzyme immobilization. PMID:27011329

  1. Mesoporous-silica nanofluidic channels for quick enrichment/extraction of trace pesticide molecules

    PubMed Central

    Xu, Pengcheng; Chen, Chuanzhao; Li, Xinxin


    As nanofluidic channels, uniaxially oriented mesoporous-silica is, for the first time, in-situ self-assembled in a microfluidic chip for quick enrichment/extraction of ng L−1(ppt)-level organo-phosphorous (OP) pesticide residue from aqueous solution to ethanol. This micro/nano combined pre-treatment chip is essential for following gas chromatography-mass spectrometry (GC-MS) quantitative analysis. Featuring huge surface area and dense silanol groups at the inwall surface, the mesoporous-silica is uniaxially self-assembled in a micro-reservoir to form a pile of nanofluidic channels (diameter = 2.1 nm). The captured/enriched pesticide molecules in the nanochannels can be efficiently extracted by much smaller volume of ethanol due to its much higher solubility to OP. In our affirming experiment, three mixed OP pesticides of dichlorvos, paraoxon and chlorpyrifos (in water) are captured/enriched by the nano-channels and eluted/extracted by only 0.6 mL ethanol. The whole process only takes 16 min. The GC-MS quantitative results for the extracted three pesticides indicate that the extraction recovery achieves 80%. The achieved limit of quantification (LOQ) and the limit of detection (LOD) are 100 ng L−1 and 30 ng L−1, respectively. The nanofluidic-channel pre-treatment technique is promising in various application fields like agriculture and food safety security. PMID:26596908

  2. Pb (II) removal from aqueous media by EDTA-modified mesoporous silica SBA-15.


    Huang, Jin; Ye, Meng; Qu, Yuqi; Chu, Lianfeng; Chen, Rui; He, Qizhuang; Xu, Dongfang


    An organic-inorganic hybrid mesoporous silica material was synthesized by two-step post-grafting method of SBA-15 with 3-aminopropyltrimethoxy-silane (APTES) and thionyl dichloride (SOCl(2)) activated ethylenediaminetetraacetic acid (EDTA) in sequence and measured by means of Fourier transform infrared spectroscopy (FT-IR), X-ray diffraction (XRD), elemental analysis (EA), transmission electron microscopy (TEM), nitrogen (N(2)) adsorption-desorption analysis and back titration. The material was found having the beneficial properties of mesoporous silica SBA-15 and EDTA. Adsorption potential of the material for Pb (II) removal from aqueous solution was investigated by varying experimental conditions such as pH, contact time and initial metal concentration. The removal efficiency of Pb(2+) was high under studied experimental conditions. The adsorption equilibrium could be reached within 20 min and the kinetic data were fitted well by pseudo-second-order and intraparticle diffusion model. The adsorbent exhibited a favorable performance and its maximum adsorption capacity calculated by the Langmuir model was 273.2 mg g(-1). Recycling experiments showed the adsorbent could be regenerated by acid treatment without altering its properties. The chemical states of the elements involved in the adsorption were analyzed by X-ray photoelectron spectroscopy (XPS). The results demonstrated that the adsorption mechanism of the material involved Na Pb ion-exchange and carboxyl group dominated surface complexation. PMID:22874637

  3. Reversing Cancer Multidrug Resistance in Xenograft Models via Orchestrating Multiple Actions of Functional Mesoporous Silica Nanoparticles.


    Yang, Debin; Wang, Tingfang; Su, Zhigui; Xue, Lingjing; Mo, Ran; Zhang, Can


    A multistimuli responsive drug delivery system (DDS) based on sulfhydryl and amino-cofunctionalized mesoporous silica nanoparticles (SH/NH2-MSNs) has been developed, in which the multifunctional hyaluronic acid (HA) derivatives were grafted onto the SH/NH2-MSNs by disulfide bonds for targeting delivery, controlling drug release and reversing multidrug resistance (MDR). The doxorubicin (Dox) loaded multifunctional HA derivatives modified mesoporous silica nanoparticles (Dox/HHS-MSNs) were enzyme and redox sensitive, which could respond to the intracellular stimuli of hyaluronidase (HAase) and glutathione (GSH) successively and prevent drug leakage before reaching the tumor tissues. The cellular uptake experiments showed that Dox/HHS-MSNs were vulnerable to be endocytosed into the Dox-resistant human breast adenocarcinoma (MCF-7/ADR) cells, efficiently realized the endolysosomal escape and remained in the cytoplasm. Because of orchestrating multiple actions above including active targeting, endolysosomal escape and efficient multilevel drug release, Dox/HHS-MSNs could induce the strongest apoptosis and cytotoxicity of MCF-7/ADR cells. Furthermore, a series of in vivo studies on MCF-7/ADR tumor-bearing xenograft mouse models demonstrated that Dox/HHS-MSNs possessed the enhanced tumor-targeting capacity and the best therapeutic efficacy to reverse cancer MDR. PMID:27420116

  4. Cholera toxin subunit B-mediated intracellular trafficking of mesoporous silica nanoparticles toward the endoplasmic reticulum

    NASA Astrophysics Data System (ADS)

    Walker, William Andrew

    In recent decades, pharmaceutical research has led to the development of numerous treatments for human disease. Nanoscale delivery systems have the potential to maximize therapeutic outcomes by enabling target specific delivery of these therapeutics. The intracellular localization of many of these materials however, is poorly controlled, leading to sequestration in degradative cellular pathways and limiting the efficacy of their payloads. Numerous proteins, particularly bacterial toxins, have evolved mechanisms to subvert the degradative mechanisms of the cell. Here, we have investigated a possible strategy for shunting intracellular delivery of encapsulated cargoes from these pathways by modifying mesoporous silica nanoparticles (MSNs) with the well-characterized bacterial toxin Cholera toxin subunit B (CTxB). Using established optical imaging methods we investigated the internalization, trafficking, and subcellular localization of our modified MSNs in an in vitro animal cell model. We then attempted to demonstrate the practical utility of this approach by using CTxB-modified mesoporous silica nanoparticles to deliver propidium iodide, a membrane-impermeant fluorophore.

  5. Glucose- and pH-responsive nanogated ensemble based on polymeric network capped mesoporous silica.


    Tan, Lei; Yang, Mei-Yan; Wu, Hai-Xia; Tang, Zhao-Wen; Xiao, Jian-Yun; Liu, Chuan-Jun; Zhuo, Ren-Xi


    In this paper, a glucose and pH-responsive release system based on polymeric network capped mesoporous silica nanoparticles (MSN) has been presented. The poly(acrylic acid) (PAA) brush on MSN was obtained through the surface-initiated atom transfer radical polymerization (SI-ATRP) of t-butyl acrylate and the subsequent hydrolysis of the ester bond. Then the PAA was glycosylated with glucosamine to obtain P(AA-AGA). To block the pore of silica, the P(AA-AGA) chains were cross-linked through the formation of boronate esters between 4,4-(ethylenedicarbamoyl)phenylboronic acid (EPBA) and the hydroxyl groups of P(AA-AGA). The boronate esters disassociated in the presence of glucose or in acidic conditions, which lead to opening of the mesoporous channels and the release of loaded guest molecules. The rate of release could be tuned by varying the pH or the concentration of glucose in the environment. The combination of two stimuli exhibited an obvious enhanced release capacity in mild acidic conditions (pH 6.0). PMID:25735191

  6. Mesoporous Silica Nanoparticles in Cancer Therapy: Relevance of the Targeting Function.


    Pasqua, Luigi; Leggio, Antonella; Sisci, Diego; Andò, Sebastiano; Morelli, Catia


    In the last years, the oncologic research is focusing on the optimization of the clinical approach to the tumor disease, through the development of new therapeutic strategies combining currently used antineoplastic drugs to targeted delivery systems. In fact, due to the drugs poor selectivity for cancer cells, an highly aggressive style of dosing is necessary to eradicate tumors, causing severe toxicity to normal cells. Therefore, localized drug delivery would, ideally, improve the therapeutic efficacy, minimizing side effects. Mesoporous silica nanoparticles (MSNs) have been proposed as a promising class of versatile drug/DNA delivery vehicles, as well as efficient tools for fluorescent cell tracking. To date, the major limitation is that MSNs enter the cells regardless of a target-specific functionalization. Therefore, this review is aimed to give a brief up to date overview on mesoporous silica based-drug delivery vehicles, specifically applied to tumor therapy, giving particular emphasis to the importance of a targeting function grafted on the carrier surface, so to avoid an indiscriminate uptake by cells. PMID:26996622

  7. Synthesis and improved SERS performance of silver nanoparticles-decorated surface mesoporous silica microspheres

    NASA Astrophysics Data System (ADS)

    Jiang, Tao; Wang, Xiaolong; Zhang, Li; Zhou, Jun; Zhao, Ziqi


    This study reported the improved Raman enhancement ability of silver nanoparticles (Ag NPs) decorated on surface mesoporous silica microspheres (MSiO2@Ag) than that of Ag NPs on solid silica microspheres (SSiO2@Ag). These two kinds of hybrid structures were prepared by a facile single-step hydrothermal reaction with polyvinylpyrrolidone (PVP) serves as both a reductant and stabilizer. The as-synthesized MSiO2@Ag microspheres show more significant surface-enhanced Raman scattering (SERS) activity for 4-mercaptobenzoic acid (4MBA) than SSiO2@Ag microspheres with enhancement factors as 9.20 × 106 and 4.39 × 106, respectively. The proposed reason for the higher SERS activity is estimated to be the contribution of more Raman probe molecules at the mesoporous channels where an enhanced electromagnetic field exists. Such a field was identified by theoretical calculation result. The MSiO2@Ag microspheres were eventually demonstrated for the SERS detection of a typical chemical toxin namely methyl parathion with a detection limit as low as 1 × 10-3 ppm, showing its promising potential in biosensor application.

  8. A new strategy for intracellular delivery of enzyme using mesoporous silica nanoparticles: superoxide dismutase.


    Chen, Yi-Ping; Chen, Chien-Tsu; Hung, Yann; Chou, Chih-Ming; Liu, Tsang-Pai; Liang, Ming-Ren; Chen, Chao-Tsen; Mou, Chung-Yuan


    We developed mesoporous silica nanoparticle (MSN) as a multifunctional vehicle for enzyme delivery. Enhanced transmembrane delivery of a superoxide dismutase (SOD) enzyme embedded in MSN was demonstrated. Conjugation of the cell-penetrating peptide derived from the human immunodeficiency virus 1 (HIV) transactivator protein (TAT) to mesoporous silica nanoparticle is shown to be an effective way to enhance transmembrane delivery of nanoparticles for intracellular and molecular therapy. Cu,Zn-superoxide dismutase (SOD) is a key antioxidant enzyme that detoxifies intracellular reactive oxygen species, ROS, thereby protecting cells from oxidative damage. In this study, we fused a human Cu,Zn-SOD gene with TAT in a bacterial expression vector to produce a genetic in-frame His-tagged TAT-SOD fusion protein. The His-tagged TAT-SOD fusion protein was expressed in E. coli using IPTG induction and purified using FMSN-Ni-NTA. The purified TAT-SOD was conjugated to FITC-MSN forming FMSN-TAT-SOD. The effectiveness of FMSN-TAT-SOD as an agent against ROS was investigated, which included the level of ROS and apoptosis after free radicals induction and functional recovery after ROS damage. Confocal microscopy on live unfixed cells and flow cytometry analysis showed characteristic nonendosomal distribution of FMSN-TAT-SOD. Results suggested that FMSN-TAT-SOD may provide a strategy for the therapeutic delivery of antioxidant enzymes that protect cells from ROS damage. PMID:23289802

  9. Effective antifouling using quorum-quenching acylase stabilized in magnetically-separable mesoporous silica.


    Lee, Byoungsoo; Yeon, Kyung-Min; Shim, Jongmin; Kim, Sang-Ryoung; Lee, Chung-Hak; Lee, Jinwoo; Kim, Jungbae


    Highly effective antifouling was achieved by immobilizing and stabilizing an acylase, disrupting bacterial cell-to-cell communication, in the form of cross-linked enzymes in magnetically separable mesoporous silica. This so-called "quorum-quenching" acylase (AC) was adsorbed into spherical mesoporous silica (S-MPS) with magnetic nanoparticles (Mag-S-MPS), and further cross-linked for the preparation of nanoscale enzyme reactors of AC in Mag-S-MPS (NER-AC/Mag-S-MPS). NER-AC effectively stabilized the AC activity under rigorous shaking at 200 rpm for 1 month, while free and adsorbed AC lost more than 90% of their initial activities in the same condition within 1 and 10 days, respectively. When applied to the membrane filtration for advanced water treatment, NER-AC efficiently alleviated the biofilm maturation of Pseudomonas aeruginosa PAO1 on the membrane surface, thereby enhancing the filtration performance by preventing membrane fouling. Highly stable and magnetically separable NER-AC, as an effective and sustainable antifouling material, has a great potential to be used in the membrane filtration for water reclamation. PMID:24601563

  10. Stabilization of quercetin flavonoid in MCM-41 mesoporous silica: positive effect of surface functionalization.


    Berlier, Gloria; Gastaldi, Lucia; Ugazio, Elena; Miletto, Ivana; Iliade, Patrizia; Sapino, Simona


    Antioxidants can prevent UV-induced skin damage mainly by neutralizing free radicals. For this purpose, quercetin (Q) is one of the most employed flavonoids even if the potential usefulness is limited by its unfavorable physicochemical properties. In this context, mesoporous silica (MCM-41) is herein proposed as a novel vehicle able to improve the stability and performance of this phenolic substrate in topical products. Complexes of Q with plain or octyl-functionalized MCM-41 were successfully prepared with different weight ratios by a kneading method, and then, they were characterized by XRD, gas-volumetric (BET), TGA, DSC, and FTIR analyses. The performances of the different complexes were evaluated in vitro in terms of membrane diffusion profiles, storage and photostability, antiradical and chelating activities. The physicochemical characterization confirmed an important host/guest interaction due to the formation of Si-OH/quercetin hydrogen-bonded adducts further strengthened by octyl functionalization through van der Waals forces. The immobilization of Q, particularly on octyl-functionalized silica, increased the stability without undermining the antioxidant efficacy opening the way for an innovative employment of mesoporous composite materials in the skincare field. PMID:23245887

  11. Molecular ordering of mixed surfactants in mesoporous silicas: A solid-state NMR study

    SciTech Connect

    Kobayashi, Takeshi; Mao, Kanmi; Wang, Shy-Guey; Lin, Victor S.-Y.; Pruski, Marek


    The use of mixed surfactants in the synthesis of mesoporous silica nanoparticles (MSNs) is of importance in the context of adjusting pore structures, sizes and morphologies. In the present study, the arrangement of molecules in micelles produced from a mixture of two surfactants, cetyltrimethylammonium bromide (CTAB) and cetylpyridinium bromide (CPB) was detailed by solid-state NMR spectroscopy. Proximities of methyl protons in the trimethylammonium headgroup of CTAB and protons in the pyridinium headgroup of CPB were observed under fast magic angle spinning (MAS) by {sup 1}H-{sup 1}H double quantum (DQ) MAS NMR and NOESY. This result suggested that CTAB and CPB co-exist in the pores without forming significant monocomponent domain structures. {sup 1}H-{sup 29}Si heteronuclear correlation (HETCOR) NMR showed that protons in the headgroups of CTAB are in closer proximity to the silica surface than those in the CPB headgroups. The structural information obtained in this investigation leads to better understanding of the mechanisms of self-assembly and their role in determining the structure and morphology of mesoporous materials.

  12. Curcumin-loaded silica-based mesoporous materials: Synthesis, characterization and cytotoxic properties against cancer cells.


    Bollu, Vishnu Sravan; Barui, Ayan Kumar; Mondal, Sujan Kumar; Prashar, Sanjiv; Fajardo, Mariano; Briones, David; Rodríguez-Diéguez, Antonio; Patra, Chitta Ranjan; Gómez-Ruiz, Santiago


    Two different silica based (MSU-2 and MCM-41) curcumin loaded mesoporous materials V3 and V6 were synthesized and characterized by several physico-chemical techniques. Release kinetic study revealed the slow and sustained release of curcumin from those materials in blood simulated fluid (pH: 7.4). The materials V3 and V6 were found to be biocompatible in non-cancerous CHO cell line while exhibiting significant cytotoxicity in different cancer cells (human lung carcinoma cells: A549, human breast cancer cells: MCF-7, mouse melanoma cells: B16F10) compared to pristine curcumin indicating the efficacy of the mesoporous silica materials based drug delivery systems (DDSs). The generation of intracellular reactive oxygen species (ROS) and down regulation of anti-apoptotic protein leading to the induction of apoptosis were found to be the plausible mechanisms behind the anti-cancer activity of these DDSs. These results suggest that curcumin-loaded drug delivery system may be successfully employed as an alternative treatment strategy for cancer therapeutics through a nanomedicine approach in near future. PMID:27040234

  13. Mesoporous-silica nanofluidic channels for quick enrichment/extraction of trace pesticide molecules.


    Xu, Pengcheng; Chen, Chuanzhao; Li, Xinxin


    As nanofluidic channels, uniaxially oriented mesoporous-silica is, for the first time, in-situ self-assembled in a microfluidic chip for quick enrichment/extraction of ng L(-1)(ppt)-level organo-phosphorous (OP) pesticide residue from aqueous solution to ethanol. This micro/nano combined pre-treatment chip is essential for following gas chromatography-mass spectrometry (GC-MS) quantitative analysis. Featuring huge surface area and dense silanol groups at the inwall surface, the mesoporous-silica is uniaxially self-assembled in a micro-reservoir to form a pile of nanofluidic channels (diameter = 2.1 nm). The captured/enriched pesticide molecules in the nanochannels can be efficiently extracted by much smaller volume of ethanol due to its much higher solubility to OP. In our affirming experiment, three mixed OP pesticides of dichlorvos, paraoxon and chlorpyrifos (in water) are captured/enriched by the nano-channels and eluted/extracted by only 0.6 mL ethanol. The whole process only takes 16 min. The GC-MS quantitative results for the extracted three pesticides indicate that the extraction recovery achieves 80%. The achieved limit of quantification (LOQ) and the limit of detection (LOD) are 100 ng L(-1) and 30 ng L(-1), respectively. The nanofluidic-channel pre-treatment technique is promising in various application fields like agriculture and food safety security. PMID:26596908

  14. Dopamine modulated ionic permeability in mesoporous silica sphere based biomimetic compartment.


    Liu, Wei; Yang, Xiaohai; He, Dinggeng; He, Leiliang; Li, Li; Liu, Yu; Liu, Jianbo; Wang, Kemin


    The building of artificial systems with similar structure and function as cellular compartments will expand our understanding of compartmentalization related biological process and facilitate the construction of biomimetic highly functional structures. Herein, surface phenylboronic acid functionalized mesoporous silica sphere was developed as a biomimetic dopamine gated compartment, in which the ionic permeability can be well modulated through the dopamine-binding induced charge reversal. As the phenylboronic acid is negatively charged, the negatively charged 1, 3, 6, 8-pyrenetetrasulfonic acid (TPSA) was hindered from permeation into the biomimetic compartment. However, the presence of dopamine and its binding with phenylboronic acid reversed the gatekeeper shell from negative to positive charged and gated the permeation of TPSA into the interior. The dopamine gated permeation phenomenon resembles that in biological system, and thus the phenylboronic acid functionalized mesoporous silica sphere was taken as a simple model for dopamine gated ion channel decorated biological compartment. It will also contribute to the development of artificial cell and responsive nanoreactor. PMID:26962763

  15. Thermoresponsive mesoporous silica nanoparticles as a carrier for skin delivery of quercetin.


    Ugazio, Elena; Gastaldi, Lucia; Brunella, Valentina; Scalarone, Dominique; Jadhav, Sushilkumar A; Oliaro-Bosso, Simonetta; Zonari, Daniele; Berlier, Gloria; Miletto, Ivana; Sapino, Simona


    Recently, mesoporous silica nanoparticles (MSNs) have emerged as promising drug delivery systems able to preserve the integrity of the carried substance and/or to selectively reach a target site; however, they have rarely been explored for skin application. In this study, thermoresponsive MSNs, designed to work at physiologic cutaneous temperature, are proposed as innovative topical carriers for quercetin (Q), a well-known antioxidant. The thermosensitive nanoparticles were prepared by functionalizing two different types of matrices, with pore size of 3.5nm (MSNsmall) and 5.0nm (MSNbig), carrying out a free radical copolymerization of N-isopropylacrylamide (NIPAM) and 3-(methacryloxypropyl)trimethoxysilane (MPS) inside the mesopores. The obtained copolymer-grafted MSNs (copoly-MSNs) were physico-chemically characterized and their biocompatibility was attested on a human keratinocyte cell line (HaCaT). The release profiles were assessed and the functional activity of Q, free or loaded, was evaluated in terms of antiradical and metal chelating activities. Ex vivo accumulation and permeation through porcine skin were also investigated. The characterization confirmed the copolymer functionalization of the MSNs. In addition, both the bare and functionalized silica matrices were found to be biocompatible. Among the copolymer-grafted complexes, Q/copoly-MSNbig exhibited more evident thermoresponsive behavior proving the potential of these thermosensitive systems for advanced dermal delivery. PMID:27421910

  16. Enantioselectively controlled release of chiral drug (metoprolol) using chiral mesoporous silica materials

    NASA Astrophysics Data System (ADS)

    Guo, Zhen; Du, Yu; Liu, Xianbin; Ng, Siu-Choon; Chen, Yuan; Yang, Yanhui


    Chiral porous materials have attracted burgeoning attention on account of their potential applications in many areas, such as enantioseparation, chiral catalysis, chemical sensors and drug delivery. In this report, chiral mesoporous silica (CMS) materials with various pore sizes and structures were prepared using conventional achiral templates (other than chiral surfactant) and a chiral cobalt complex as co-template. The synthesized CMS materials were characterized by x-ray diffraction, nitrogen physisorption, scanning electron microscope and transmission electron microscope. These CMS materials, as carriers, were demonstrated to be able to control the enantioselective release of a representative chiral drug (metoprolol). The release kinetics, as modeled by the power law equation, suggested that the release profiles of metoprolol were remarkably dependent on the pore diameter and pore structure of CMS materials. More importantly, R- and S-enantiomers of metoprolol exhibited different release kinetics on CMS compared to the corresponding achiral mesoporous silica (ACMS), attributable to the existence of local chirality on the pore wall surface of CMS materials. The chirality of CMS materials on a molecular level was further substantiated by vibrational circular dichroism measurements.

  17. The effects of ageing time on the microstructure and properties of mesoporous silica-hydroxyapatite nanocomposite

    NASA Astrophysics Data System (ADS)

    Yousefpour, Mardali; Taherian, Zahra


    In this study, a mesoporous silica-hydroxyapatite nanocomposite (MCM-41/HA) was synthesized via sol-gel technique as a drug delivery system. The synthesis of MCM-41/hydroxyapatite nanocomposite was carried out at room temperature. The effect of various ageing time on the nanocomposite properties was studied during synthesis process. 0, 24, 36, and 48 h aging times were chosen. Textural properties and microstructure of the nanocomposites were characterized by X-ray diffraction (XRD), Transmission Electron Microscopy (TEM), Energy Dispersive X-ray Spectroscopy (EDS), Electron Diffraction pattern (ED), and N2 adsorption-desorption. Results showed that ageing process led to HA crystals nucleation and growth on the surface of mesoporous silica. At 48 h of aging time, the surface area and total pore volume increased from 36.2 to 334 m2/g and 0.14-0.7 cm3/g, respectively. In contrast, the average pore diameter considerably decreased from 20.1 nm for (MCM-41/HA)24 to 8.39 nm for (MCM-41/HA)48. Furthermore, it was observed more homogeneous pore distribution with increasing the ageing time. In conclusion, the ageing time play an important role on textural properties of MCM-41/HA nanocomposite which could have a major effect on drug delivery properties such as molecular loading and release kinetics.

  18. Immobilization of tetramethylguanidine on mesoporous SBA-15 silica: a heterogeneous basic catalyst for transesterification of soybean oil.


    Xie, Wenlei; Fan, Mingliang


    An active heterogeneous catalyst, namely 1,1,3,3-tetramethylguanidine (TMG) immobilized on mesoporous SBA-15 silica (SBA-15-pr-TMG), was prepared and the catalytic activity was investigated for transesterification of soybean oil with methanol. The heterogeneous catalysts were characterized using Hammett titration method, Fourier transform infrared spectra, X-ray diffraction, scanning electron microscopy, transmission electron microscopy, N2 adsorption-desorption, and X-ray photoelectron spectroscopy techniques. It is shown that the activity of the catalysts for the transesterification reaction is closely related to their basic properties. By using this catalyst, an environmentally benign process for biodiesel production in a heterogeneous manner was developed. When the reaction was carried out at reflux of methanol, with a molar ratio of methanol to soybean oil of 15:1, a reaction time 12h and a catalyst amount 5 wt%, the oil conversion of 91.7% was achieved. The catalyst could be recovered easily and reused without significant degradation in activity. PMID:23664065

  19. Silanol-assisted carbinolamine formation in an amine-functionalized mesoporous silica surface: Theoretical investigation by fragmentation methods


    de Lima Batista, Ana P.; Zahariev, Federico; Slowing, Igor I.; Braga, Ataualpa A. C.; Ornellas, Fernando R.; Gordon, Mark S.


    The aldol reaction catalyzed by an amine-substituted mesoporous silica nanoparticle (amine-MSN) surface was investigated using a large molecular cluster model (Si392O958C6NH361) combined with the surface integrated molecular orbital/molecular mechanics (SIMOMM) and fragment molecular orbital (FMO) methods. Three distinct pathways for the carbinolamine formation, the first step of the amine-catalyzed aldol reaction, are proposed and investigated in order to elucidate the role of the silanol environment on the catalytic capability of the amine-MSN material. The computational study reveals that the most likely mechanism involves the silanol groups actively participating in the reaction, forming and breaking covalent bonds in the carbinolamine step.more » Furthermore, the active participation of MSN silanol groups in the reaction mechanism leads to a significant reduction in the overall energy barrier for the carbinolamine formation. In addition, a comparison between the findings using a minimal cluster model and the Si392O958C6NH361 cluster suggests that the use of larger models is important when heterogeneous catalysis problems are the target.« less

  20. Silanol-assisted carbinolamine formation in an amine-functionalized mesoporous silica surface: Theoretical investigation by fragmentation methods

    SciTech Connect

    de Lima Batista, Ana P.; Zahariev, Federico; Slowing, Igor I.; Braga, Ataualpa A. C.; Ornellas, Fernando R.; Gordon, Mark S.


    The aldol reaction catalyzed by an amine-substituted mesoporous silica nanoparticle (amine-MSN) surface was investigated using a large molecular cluster model (Si392O958C6NH361) combined with the surface integrated molecular orbital/molecular mechanics (SIMOMM) and fragment molecular orbital (FMO) methods. Three distinct pathways for the carbinolamine formation, the first step of the amine-catalyzed aldol reaction, are proposed and investigated in order to elucidate the role of the silanol environment on the catalytic capability of the amine-MSN material. The computational study reveals that the most likely mechanism involves the silanol groups actively participating in the reaction, forming and breaking covalent bonds in the carbinolamine step. Furthermore, the active participation of MSN silanol groups in the reaction mechanism leads to a significant reduction in the overall energy barrier for the carbinolamine formation. In addition, a comparison between the findings using a minimal cluster model and the Si392O958C6NH361 cluster suggests that the use of larger models is important when heterogeneous catalysis problems are the target.

  1. Peptide-laden mesoporous silica nanoparticles with promoted bioactivity and osteo-differentiation ability for bone tissue engineering.


    Luo, Zuyuan; Deng, Yi; Zhang, Ranran; Wang, Mengke; Bai, Yanjie; Zhao, Qiang; Lyu, Yalin; Wei, Jie; Wei, Shicheng


    Combination of mesoporous silica materials and bioactive factors is a promising niche-mimetic solution as a hybrid bone substitution for bone tissue engineering. In this work, we have synthesized biocompatible silica-based nanoparticles with abundant mesoporous structure, and incorporated bone-forming peptide (BFP) derived from bone morphogenetic protein-7 (BMP-7) into the mesoporous silica nanoparticles (MSNs) to obtain a slow-release system for osteogenic factor delivery. The chemical characterization demonstrates that the small osteogenic peptide is encapsulated in the mesoporous successfully, and the nitrogen adsorption-desorption isotherms suggest that the peptide encapsulation has no influence on mesoporous structure of MSNs. In the cell experiment, the peptide-laden MSNs (p-MSNs) show higher MG-63 cell proliferation, spreading and alkaline phosphatase (ALP) activity than the bare MSNs, indicating good in vitro cytocompatibility. Simultaneously, the osteogenesis-related proteins expression and calcium mineral deposition disclose enhanced osteo-differentiation of human mesenchymal stem cells (hMSCs) under the stimulation of the p-MSNs, confirming that BFP released from MSNs could significantly promote the osteogenic differentiation of hMSCs, especially at 500μg/mL of p-MSNs concentration. The peptide-modified MSNs with better bioactivity and osteogenic differentiation make it a potential candidate as bioactive material for bone repairing, bone regeneration, and bio-implant coating applications. PMID:25969416

  2. Stimulus-response mesoporous silica nanoparticle-based chemiluminescence biosensor for cocaine determination.


    Chen, Zhonghui; Tan, Yue; Xu, Kefeng; Zhang, Lan; Qiu, Bin; Guo, Longhua; Lin, Zhenyu; Chen, Guonan


    Mesoporous silica nanoparticles (MSN) based controlled release system had been coupled with diverse detection technologies to establish biosensors for different targets. Chemiluminescence (CL) system of luminol/H2O2 owns the characters of simplicity, low cost and high sensitivity, but the targets of which are mostly focused on some oxidants or which can participate in a chemical reaction that yields a product with a role in the CL reaction. In this study, chemiluminescent detection technique had been coupled with mesoporous silica-based controlled released system for the first time to develop a sensitive biosensor for the target which does not cause effect to the CL system itself. Cocaine had been chosen a model target, the MSN support was firstly loaded with glucose, then the positively charged MSN interacted with negatively charged oligonucleotides (the aptamer cocaine) to close the mesopores of MSN. At the present of target, cocaine binds with its aptamer with high affinity; the flexible linear aptamer structured will become stems structured through currently well-defined non-Waston-Crick interactions and causes the releasing of entrapped glucose into the solution. With the assistant of glucose oxidase (GOx), the released glucose can react with the dissolved oxgen to produce gluconic acid and H2O2, the latter can enhance the CL of luminol in the NaOH solution. The enhanced CL intensity has a relationship with the cocaine concentration in the range of 5.0-60μM with the detection limit of 1.43μM. The proposed method had been successfully applied to detect cocaine in serum samples with high selectivity. The same strategy can be applied to develop biosensors for different targets. PMID:26278045

  3. Study of Mesoporous Silica Nanoparticles' (MSNs) intracellular trafficking and their application as drug delivery vehicles

    NASA Astrophysics Data System (ADS)

    Yanes, Rolando Eduardo

    Mesoporous silica nanoparticles (MSNs) are attractive drug delivery vehicle candidates due to their biocompatibility, stability, high surface area and efficient cellular uptake. In this dissertation, I discuss three aspects of MSNs' cellular behavior. First, MSNs are targeted to primary and metastatic cancer cell lines, then their exocytosis from cancer cells is studied, and finally they are used to recover intracellular proteins. Targeting of MSNs to primary cancer cells is achieved by conjugating transferrin on the surface of the mesoporous framework, which resulted in enhancement of nanoparticle uptake and drug delivery efficacy in cells that overexpress the transferrin receptor. Similarly, RGD peptides are used to target metastatic cancer cell lines that over-express integrin alphanubeta3. A circular RGD peptide is bound to the surface of MSNs and the endocytosis and cell killing efficacy of camptothecin loaded nanoparticles is significantly improved in cells that express the target receptor. Besides targeting, I studied the ultimate fate of phosphonate coated mesoporous silica nanoparticles inside cells. I discovered that the nanoparticles are exocytosed from cells through lysosomal exocytosis. The nanoparticles are exocytosed in intact form and the time that they remain inside the cells is affected by the surface properties of the nanoparticles and the type of cells. Cells that have a high rate of lysosomal exocytosis excrete the nanoparticles rapidly, which makes them more resistant to drug loaded nanoparticles because the amount of drug that is released inside the cell is limited. When the exocytosis of MSNs is inhibited, the cell killing efficacy of nanoparticles loaded with camptothecin is enhanced. The discovery that MSNs are exocytosed by cells led to a study to determine if proteins could be recovered from the exocytosed nanoparticles. The procedure to isolate exocytosed zinc-doped iron core MSNs and identify the proteins bound to them was developed

  4. Preparation, characterization and catalytic properties of MCM-48 supported tungstophosphoric acid mesoporous materials for green synthesis of benzoic acid

    SciTech Connect

    Wu, Hai-Yan; Zhang, Xiao-Li; Chen, Xi; Chen, Ya; Zheng, Xiu-Cheng


    MCM-48 and tungstophosphoric acid (HPW) were prepared and applied for the synthesis of HPW/MCM-48 mesoporous materials. The characterization results showed that HPW/MCM-48 obtained retained the typical mesopore structure of MCM-48, and the textural parameters decreased with the increase loading of HPW. The catalytic oxidation results of benzyl alcohol and benzaldehyde with 30% H{sub 2}O{sub 2} indicated that HPW/MCM-48 was an efficient catalyst for the green synthesis of benzoic acid. Furthermore, 35 wt% HPW/MCM-48 sample showed the highest activity under the reaction conditions. Highlights: • 5–45 wt% HPW/MCM-48 mesoporous catalysts were prepared and characterized. • Their catalytic activities for the green synthesis of benzoic acid were investigated. • HPW/MCM-48 was approved to be an efficient catalyst. • 5 wt% HPW/MCM-48 exhibited the highest catalytic activity.

  5. Stable Encapsulation of Air in Mesoporous Silica Nanoparticles: Fluorocarbon-Free Nanoscale Ultrasound Contrast Agents.


    Yildirim, Adem; Chattaraj, Rajarshi; Blum, Nicholas T; Goldscheitter, Galen M; Goodwin, Andrew P


    While gas-filled micrometer-sized ultrasound contrast agents vastly improve signal-to-noise ratios, microbubbles have short circulation lifetimes and poor extravasation from the blood. Previously reported fluorocarbon-based nanoscale contrast agents are more stable but their contrast is generally lower owing to their size and dispersity. The contrast agents reported here are composed of silica nanoparticles of ≈100 nm diameter that are filled with ≈3 nm columnar mesopores. Functionalization of the silica surface with octyl groups and resuspension with Pluronic F127 create particles with pores that remain filled with air but are stable in buffer and serum. Administration of high intensity focused ultrasound (HIFU) allows sensitive imaging of the silica nanoparticles down to 10(10) particles mL(-1) , with continuous imaging for at least 20 min. Control experiments with different silica particles supported the hypothesis that entrapped air could be pulled into bubble nuclei, which can then in turn act as acoustic scatterers. This process results in very little hemolysis in whole blood, indicating potential for nontoxic blood pool imaging. Finally, the particles are lyophilized and reconstituted or stored in PBS (phosphate-buffered saline, at least for four months) with no loss in contrast, indicating stability to storage and reformulation. PMID:26990167

  6. Distribution of 1-Butyl-3-methylimidazolium Bistrifluoromethylsulfonimide in Mesoporous Silica as a Function of Pore Filling

    SciTech Connect

    Han, Kee Sung; Wang, Xiqing; Hagaman, Edward {Ed} W; Dai, Sheng


    Rotational dynamics of the ionic liquid (IL) 1-butyl-3-methlyimidazolium bistrifluoromethylsulfonimide, [C4mim][Tf2N], 1, as a neat liquid and confined in mesoporous silica were investigated by 1H spin-spin (T2) and spin-lattice (T1) relaxation measurements and 13C NMR spectroscopy. Translational dynamics (self-diffusion) were monitored via the diffusion coefficient, D, obtained with 1H pulsed field gradient NMR measurements. These data were used to determine the distribution of 1 in the pores of KIT-6, a mesoporous silica with a bicontinuous gyroid pore structure, as a function of filling fraction. Relaxation studies performed as a function of filling factor and temperature, reveal a dynamic heterogeneity in both translational and rotational motions for 1 at filling factors, f, = 0.2-1.0 (f = 1 corresponds to fully filled pores). Spin-lattice and spin-spin relaxation times reveal the motion of 1 in silica mesopores conform to that expected for a two-dimensional relaxation model. The relaxation dynamics are interpreted using a two-state, fast exchange model for all motions; a slow rotation (and translation) of molecules in contact with the surface and a faster motion approximated by the values for bulk relaxation and diffusion. 1 retains liquid like behavior at all filling factors and temperatures that extend to ca. 50 degrees below the bulk melting point. Translational motion in these systems, interpreted with MD-simulated diffusivity limits, confirms the high propensity of 1 to form a monolayer film on the silica surface at low filling factors.. The attractive interaction of 1 with the surface is greater than that for self-association of 1. The trends in diffusion data at short and long diffusion time suggest that the population of surface-bound 1 is in intimate contact with 1 in the pores. This condition is most easily met at higher filling fractions with successive additions of 1 increasing the layer thickness built up on the surface layer.

  7. Removal of malachite green dye from aqueous solution using mesoporous silica synthesized from 1-octyl-3-methylimidazolium chloride ionic liquid

    NASA Astrophysics Data System (ADS)

    Ekka, Basanti; Nayak, Soumitra Ranjan; Dash, Priyabrat; Patel, Raj Kishore


    In this research, mesoporous silica was synthesized via a modified sol-gel route using 1-octyl-3-methylimidazolium chloride and was employed to remove malachite green (MG) dye from aqueous solution. Subsequently, this material was characterized and identified by different techniques such as Fourier transform infrared spectroscopy (FT-IR), N2 adsorption-desorption method, scanning electron microscopy (SEM), and thermosgravimetric analysis (TGA). Unique properties such as high surface area and pore diameter, in addition to highly reactive atoms and presence of various functional groups make the mesoporous silica possible for efficient removal of malachite green (MG). In batch experimental set-up, optimum conditions for quantitative removal of MG by mesoporous silica was attained by varying different variables such as adsorbent dosage, initial dye concentration, contact time, and pH. Optimum values were set as pH of 8.0, 0.5 g of adsorbent at contact time of 120 min. The adsorption of MG follows the pseudo-second-order rate equation. Equilibrium data fitted well with the Freundlich model at all amount of adsorbent, while maximum adsorption capacity was 5.981 mg g-1 for 0.5 g mesoporous silica synthesized in IL.

  8. Esterase- and pH-responsive poly(β-amino ester)-capped mesoporous silica nanoparticles for drug delivery.


    Fernando, Isurika R; Ferris, Daniel P; Frasconi, Marco; Malin, Dmitry; Strekalova, Elena; Yilmaz, M Deniz; Ambrogio, Michael W; Algaradah, Mohammed M; Hong, Michael P; Chen, Xinqi; Nassar, Majed S; Botros, Youssry Y; Cryns, Vincent L; Stoddart, J Fraser


    Gating of mesoporous silica nanoparticles (MSNs) with the stimuli-responsive poly(β-amino ester) has been achieved. This hybrid nanocarrier releases doxorubicin (DOX) under acidic conditions or in the presence of porcine liver esterase. The DOX loaded poly(β-amino ester)-capped MSNs reduce cell viability when tested on MDA-MB-231 human breast cancer cells. PMID:25820516

  9. A novel mesoporous carbon-silica-titania nanocomposite as a high performance anode material in lithium ion batteries.


    Zhou, Yuanyuan; Kim, Younghun; Jo, Changshin; Lee, Jinwoo; Lee, Chul Wee; Yoon, Songhun


    An ordered mesoporous carbon-silica-titania material was prepared using the tetra-constituents co-assembly method. As regards its anode performance in lithium ion batteries, the composite material anode exhibited a high capacity (875 mAh g(-1)), a higher initial efficiency (56%) and an improved rate. PMID:21424009

  10. Efficiency enhancement in dye sensitized solar cells using dual function mesoporous silica as scatterer and back recombination inhibitor

    NASA Astrophysics Data System (ADS)

    Tanvi; Mahajan, Aman; Bedi, R. K.; Kumar, Subodh; Saxena, Vibha; Aswal, D. K.


    In the present work, we report the usage of mesoporous silica for improving light harvesting as well as for suppression of back recombination without affecting the extent of dye loading on TiO2 films. Synthesized mesoporous SiO2 was characterized by X-ray photoelectron spectroscopy, X-ray diffraction, Brunauer Emmett and Teller measurement, Scanning electron microscopy and Transmission electron microscopy. DSSCs were fabricated by incorporating different wt% of mesoporous SiO2 in TiO2 paste. An improvement of 50% was observed for devices fabricated using 0.75 wt% of mesoporous SiO2. The mechanism behind the improvement was investigated using electrochemical impedance spectroscopy and UV-Vis spectroscopy.

  11. Selective synthesis of 6,8-di-t-butylated flavan over Zn-Al containing mesoporous silica catalysts.


    Selvaraj, M; Sinha, P K; Park, D-W; Kim, Il; Kawi, S; Ha, C S


    We demonstrate a much green synthesis method for highly selective synthesis of 6,8-di-t-butylated flavan (6,8-DTBF) by liquid phase alkylation of 2,4-di-t-butylphenol (2,4-DTBP) with cinnamyl alcohol (Cin-OH) over mesoporous Zn-Al-MCM-41 catalysts synthesized under direct basic hydrothermal method. The main alkylated product, 6,8-DTBF is importantly used as an intermediate in the manufacture of biosynthetic organic compounds. The recyclable mesoporous Zn-Al-MCM-41 catalysts have also been reused in this reaction to study their catalytic activities. The influences of various reaction parameters such as temperature, time, ratios of reactant (2,4-DTBP-to-Cin-OH) have been extensively investigated for the synthesis of 6,8-DTBF. In addition, dimethyl sulfoxide (DMSO) has also been used as a solvent in this catalytic reaction. The mesoporous Zn-Al-MCM-41(75) gives excellent catalytic activity with 6,8-DTBF selectivity (86.0%) and 2,4-DTBP conversion (63.1%), and these catalytic results have also compared with that obtained using other mesoporous and microporous catalysts. On the basis of catalytic activity obtained by using the all catalysts, the Zn-Al-MCM-41(75) catalyst is found to be a highly active, recyclable and eco-friendly heterogeneous catalyst in the liquid-phase alkylation of 2,4-DTBP. PMID:23047727

  12. Dummy molecularly imprinted mesoporous silica prepared by hybrid imprinting method for solid-phase extraction of bisphenol A.


    Yu, Dan; Hu, Xiaolei; Wei, Shoutai; Wang, Qiang; He, Chiyang; Liu, Shaorong


    A novel hybrid dummy imprinting strategy was developed to prepare a mesoporous silica for the solid-phase extraction (SPE) of bisphenol A (BPA). A new covalent template-monomer complex (BPAF-Si) was first synthesized with 2,2-bis(4-hydroxyphenyl)hexafluoropropane (BPAF) as the template. The imprinted silica was obtained through the gelation of BPAF-Si with tetraethoxysilane and the subsequent removal of template by thermal cleavage, and then it was characterized by FT-IR spectroscopy, scanning electron microscopy, transmission electron microscopy, and nitrogen adsorption-desorption isotherms. Results showed that the new silica had micron-level particle size and ordered mesoporous structure. The static binding test verified that the imprinted silica had much higher recognition ability for BPA than the non-imprinted silica. The imprinted silica also showed high extraction efficiencies and high enrichment factor for SPE of BPA. Using the imprinted silica, a SPE-HPLC-UV method was developed and successfully applied for detecting BPA in BPA-spiked tap water and lake water samples with a recovery of 99-105%, a RSD of 2.7-5.0% and a limit of detection (S/N=3) of 0.3ng/mL. The new imprinted silica avoided the interference of the residual template molecules and reduced the non-specific binding sites, and therefore it can be utilized as a good sorbent for SPE of BPA in environmental water samples. PMID:25892637

  13. Electrostatic interaction effect for human DNA separation with functionalized mesoporous silicas

    SciTech Connect

    Choi, Hong Kyung; Chang, Jeong Ho; Ko, Il Hwan; Lee, Jin Hyung; Jeong, Bong Yong; Kim, Jong Hee; Kim, Jung Bae


    This work describes the development of highly efficient human DNA separation with functionalized mesoporous silica (FMS) materials. To demonstrate the electrostatic interaction effect between the target DNA molecules and FMS, three aminofunctionality types comprised of a mono-, a di-, and a tri-amine functional group were introduced on the inner surfaces of mesoporous silica particles. Systematic characterization of the synthesized materials was achieved by solid-state {sup 29}Si and {sup 13}C-NMR techniques, BET, FT-IR, and XPS. The DNA separation efficiency was explored via the function of the amino-group number, the amount used, and the added NaCl concentration. The DNA adsorption yields were high in terms of the use of triaminofunctionalized FMS at the 10 ng/L level, and the DNA desorption efficiency showed the optimum level at over 3.0 M NaCl concentration. The use of FMS in a DNA separation process provides numerous advantages over the conventional silica-based process. -- Graphical abstract: Control of electrostatic interaction for DNA biding by aminofunctionalized modification: mono-amine (MA), di-amine (DA), and tri-amine (TA). The red-ball means the amine groups of FMS. Display Omitted Highlights: {yields} Highly efficient and direct DNA separation was demonstrated with aminofunctionalized FMS. {yields} Systematic characterization of the synthesized materials was achieved by solid-state {sup 29}Si and {sup 13}C-NMR techniques, BET, FT-IR, and XPS. {yields} The DNA separation efficiency was explored via the function of the amino-group number, particles size, amount of FMS used, and the NaCl concentration. {yields} The electrostatic interaction between the target DNA labeled by cyanine (Cy-5) and aminofunctionalized FMS were achieved via confocal microscopy.

  14. Enhancement of Alkaline Protease Activity and Stability via Covalent Immobilization onto Hollow Core-Mesoporous Shell Silica Nanospheres.


    Ibrahim, Abdelnasser Salah Shebl; Al-Salamah, Ali A; El-Toni, Ahmed M; Almaary, Khalid S; El-Tayeb, Mohamed A; Elbadawi, Yahya B; Antranikian, Garabed


    The stability and reusability of soluble enzymes are of major concerns, which limit their industrial applications. Herein, alkaline protease from Bacillus sp. NPST-AK15 was immobilized onto hollow core-mesoporous shell silica (HCMSS) nanospheres. Subsequently, the properties of immobilized proteases were evaluated. Non-, ethane- and amino-functionalized HCMSS nanospheres were synthesized and characterized. NPST-AK15 was immobilized onto the synthesized nano-supports by physical and covalent immobilization approaches. However, protease immobilization by covalent attachment onto the activated HCMSS-NH₂ nanospheres showed highest immobilization yield (75.6%) and loading capacity (88.1 μg protein/mg carrier) and was applied in the further studies. In comparison to free enzyme, the covalently immobilized protease exhibited a slight shift in the optimal pH from 10.5 to 11.0, respectively. The optimum temperature for catalytic activity of both free and immobilized enzyme was seen at 60 °C. However, while the free enzyme was completely inactivated when treated at 60 °C for 1 h the immobilized enzyme still retained 63.6% of its initial activity. The immobilized protease showed higher V(max), k(cat) and k(cat)/K(m), than soluble enzyme by 1.6-, 1.6- and 2.4-fold, respectively. In addition, the immobilized protease affinity to the substrate increased by about 1.5-fold. Furthermore, the enzyme stability in various organic solvents was significantly enhanced upon immobilization. Interestingly, the immobilized enzyme exhibited much higher stability in several commercial detergents including OMO, Tide, Ariel, Bonux and Xra by up to 5.2-fold. Finally, the immobilized protease maintained significant catalytic efficiency for twelve consecutive reaction cycles. These results suggest the effectiveness of the developed nanobiocatalyst as a candidate for detergent formulation and peptide synthesis in non-aqueous media. PMID:26840303

  15. Enhancement of Alkaline Protease Activity and Stability via Covalent Immobilization onto Hollow Core-Mesoporous Shell Silica Nanospheres

    PubMed Central

    Ibrahim, Abdelnasser Salah Shebl; Al-Salamah, Ali A.; El-Toni, Ahmed M.; Almaary, Khalid S.; El-Tayeb, Mohamed A.; Elbadawi, Yahya B.; Antranikian, Garabed


    The stability and reusability of soluble enzymes are of major concerns, which limit their industrial applications. Herein, alkaline protease from Bacillus sp. NPST-AK15 was immobilized onto hollow core-mesoporous shell silica (HCMSS) nanospheres. Subsequently, the properties of immobilized proteases were evaluated. Non-, ethane- and amino-functionalized HCMSS nanospheres were synthesized and characterized. NPST-AK15 was immobilized onto the synthesized nano-supports by physical and covalent immobilization approaches. However, protease immobilization by covalent attachment onto the activated HCMSS–NH2 nanospheres showed highest immobilization yield (75.6%) and loading capacity (88.1 μg protein/mg carrier) and was applied in the further studies. In comparison to free enzyme, the covalently immobilized protease exhibited a slight shift in the optimal pH from 10.5 to 11.0, respectively. The optimum temperature for catalytic activity of both free and immobilized enzyme was seen at 60 °C. However, while the free enzyme was completely inactivated when treated at 60 °C for 1 h the immobilized enzyme still retained 63.6% of its initial activity. The immobilized protease showed higher Vmax, kcat and kcat/Km, than soluble enzyme by 1.6-, 1.6- and 2.4-fold, respectively. In addition, the immobilized protease affinity to the substrate increased by about 1.5-fold. Furthermore, the enzyme stability in various organic solvents was significantly enhanced upon immobilization. Interestingly, the immobilized enzyme exhibited much higher stability in several commercial detergents including OMO, Tide, Ariel, Bonux and Xra by up to 5.2-fold. Finally, the immobilized protease maintained significant catalytic efficiency for twelve consecutive reaction cycles. These results suggest the effectiveness of the developed nanobiocatalyst as a candidate for detergent formulation and peptide synthesis in non-aqueous media. PMID:26840303

  16. Development and application of multi-functionalized mesoporous silica nanomaterials in intracellular drug delivery and heterogeneous catalysis

    NASA Astrophysics Data System (ADS)

    Tsai, Chih-Hsiang

    This dissertation presents research on the development of mesoporous silica nanomaterials and their applications on the fields of drug delivery system and heterogeneous catalysis. Mesoporous silica nanoparticles (MSNs) featuring several particular physicochemical properties are of great interest in material science and applied chemistry. With high biocompatibility and large pore size, MSNs have been regarded as a highly promising platform for intracellular controlled release of drugs and biomolecules. On the other hand, the robust silica framework and easy surface functionalization make MSNs decent solid supports for various types of heterogeneous catalysis. A newly developed surfactant-assistant drug delivery system is investigated. A series of biocompatible phosphate monoester surfactant (PMES) containing PMES-MSN were synthesized and well characterized. The formation mechanism of these special radially-aligned mesostructure was systematic studied by TEM technique and carbon nanocasting. We found that the particle size and shape as well as the structural integrity can be tuned by the ratio of aminopropyltrimethoxysilane (APTMS) and PMES. For biological application, the controlled release of the hydrophobic drug, resveratrol, was tested both in solution and in vitro. It showed that the surfactant-containing PMES-MSNs has a loading capacity around 4 times higher than its surfactant-free counterpart. In addition, a sustained release pattern was observed in the PMES-MSNs release system, indicating the feature of surfactant-assistance. The in vitro study in HeLa cells demonstrated that PMES-MSNs can be efficiently endocytosed. We also observed an endosomal escape of PMES-MSNs within the HeLa cells probably due to proton sponge effect and the assistance of PMES. A series of bifunctionalized MSN catalysts with diarylammonium triflate groups (DAT) as active acid sites and pentafluorophenyl groups (PFP) as secondary functional groups for the catalysis of esterification

  17. Multifunctional polymer-capped mesoporous silica nanoparticles for pH-responsive targeted drug delivery

    NASA Astrophysics Data System (ADS)

    Niedermayer, Stefan; Weiss, Veronika; Herrmann, Annika; Schmidt, Alexandra; Datz, Stefan; Müller, Katharina; Wagner, Ernst; Bein, Thomas; Bräuchle, Christoph


    A highly stable modular platform, based on the sequential covalent attachment of different functionalities to the surface of core-shell mesoporous silica nanoparticles (MSNs) for targeted drug delivery is presented. A reversible pH-responsive cap system based on covalently attached poly(2-vinylpyridine) (PVP) was developed as drug release mechanism. Our platform offers (i) tuneable interactions and release kinetics with the cargo drug in the mesopores based on chemically orthogonal core-shell design, (ii) an extremely robust and reversible closure and release mechanism based on endosomal acidification of the covalently attached PVP polymer block, (iii) high colloidal stability due to a covalently coupled PEG shell, and (iv) the ability to covalently attach a wide variety of dyes, targeting ligands and other functionalities at the outer periphery of the PEG shell. The functionality of the system was demonstrated in several cell studies, showing pH-triggered release in the endosome, light-triggered endosomal escape with an on-board photosensitizer, and efficient folic acid-based cell targeting.A highly stable modular platform, based on the sequential covalent attachment of different functionalities to the surface of core-shell mesoporous silica nanoparticles (MSNs) for targeted drug delivery is presented. A reversible pH-responsive cap system based on covalently attached poly(2-vinylpyridine) (PVP) was developed as drug release mechanism. Our platform offers (i) tuneable interactions and release kinetics with the cargo drug in the mesopores based on chemically orthogonal core-shell design, (ii) an extremely robust and reversible closure and release mechanism based on endosomal acidification of the covalently attached PVP polymer block, (iii) high colloidal stability due to a covalently coupled PEG shell, and (iv) the ability to covalently attach a wide variety of dyes, targeting ligands and other functionalities at the outer periphery of the PEG shell. The

  18. Molecular Simulation Study of the Early Stages of Formation of Bioinspired Mesoporous Silica Materials.


    Centi, Alessia; Jorge, Miguel


    The use of bioinspired templates, such as polyamines and polypeptides, could lead to significant improvements in the synthesis conditions under which mesoporous materials are traditionally produced, removing the need for strong pH as well as high temperature or pressure. In this work, we perform atomistic molecular dynamics simulations of 1,12-diaminododecane surfactants, in water and in the presence of silica monomers, to investigate the early stages of synthesis of one of the first examples of bioinspired silica materials. Different surfactant concentrations and pH were considered, clarifying the influence of the charge state of the molecules on the self-assembly process. We show that the amphiphilic amines form stable lamellar structures at equilibrium in the range from intermediate to high pH values. In a later stage, when silica species are added to the system, our results reveal that, in the same range of pH, silicates strongly adsorb around these aggregates at the interface with water. This causes a considerable modification of the curvature of the layer, which suggests a tendency for the system to evolve from a lamellar phase to the formation of vesicle structures. Furthermore, we show that silica monomers are able to penetrate the layer spontaneously when defects are created as a result of surfactants' head-to-head repulsion. These findings are in agreement with experimental observations and support the pillaring mechanism postulated for this class of materials. However, our simulations indicate that the aggregation process is driven by charge matching between surfactant heads and silica monomers rather than by hydrogen bond interactions between neutral species, as had been previously hypothesized. PMID:27340948

  19. Fabrication of Ordered Mesoporous Silica with Encapsulated Iron Oxide Particles using Ferritin-Doped Block Copolymer Templates

    NASA Astrophysics Data System (ADS)

    Hess, D.; Watkins, J.; Naik, R.


    Recently, two-dimensional arrays of iron oxide clusters were fabricated by dip-coating a silica substrate into an aqueous solution. Here we report the encapsulation of ferritin in 3D mesoporous silica structures by the replication of block copolymer templates in supercritical CO2. In our approach, preparation of the highly ordered, doped template via spincasting and microphase separation and silica network formation occur in discreet steps. A solution of an amphiphilic PEO-PPO-PEO triblock copolymer (Pluronic) template, horse spleen ferritin and a low concentration of PTSA acid was prepared and spin-coated onto a Si wafer. Upon drying the block copolymer microphase separates resulting in partitioning of the acid catalyst and ferritin to the hydrophilic domain. The polymer template was then exposed to a solution of supercritical carbon dioxide and tetraethyl orthosilicate (TEOS) at 125 bar and 40^oC. Equilibrium limited CO2 sorption in the block copolymer template resulted in modest dialation of the microphase segregated structure. Under these conditions, the precursor was readily infused into the copolymer and reacted within the hydrophilic domain containing the acid catalyst. The resultant film was calcined in air at 400^oC for 6 hours producing a well-ordered iron oxide-doped mesoporous silica film. TEM and XRD revealed crystalline iron oxide structures within the mesoporous silica supports. Magnetic properties were analyzed using a superconducting quantum intereference device (SQUID).

  20. Preparation of bio-compatible boron nanoparticles and novel mesoporous silica nanoparticles for bio-applications

    NASA Astrophysics Data System (ADS)

    Gao, Zhe

    This dissertation presents the synthesis and characterization of several novel inorganic and hybrid nanoparticles, including the bio-compatible boron nanoparticles (BNPs) for boron neutron capture therapy (BNCT), tannic acid-templated mesoporous silica nanoparticles and degradable bridged silsesquioxane silica nanoparticles. Chapter 1 provides background information of BNCT and reviews the development of design and synthesizing silica nanoparticles and the study of silica material degradability. Chapter 2 describes the preparation and characterization of dopamine modified BNPs and the preliminary cell study of them. The BNPs were first produced via ball milling, with fatty acid on the surface to stabilize the combustible boron elements. This chapter will mainly focus on the ligand-exchange strategy, in which the fatty acids were replaced by non-toxic dopamines in a facile one-pot reaction. The dopamine-coated BNPs (DA-BNPs) revealed good water dispersibility and low cytotoxicity. Chapter 3 describes the synthesis of tannic acid template mesoporous silica nanoparticles (TA-TEOS SiNPs) and their application to immobilize proteins. The monodispersed TA SiNPs with uniform pore size up to approximately 13 nm were produced by utilizing tannic acid as a molecular template. We studied the influence of TA concentration and reaction time on the morphology and pore size of the particles. Furthermore, the TA-TEOS particles could subsequently be modified with amine groups allowing them to be capable of incorporating imaging ligands and other guest molecules. The ability of the TA-TEOS particles to store biomolecules was preliminarily assessed with three proteins of different charge characteristics and dimensions. The immobilization of malic dehydrogenase on TA-TEOS enhanced the stability of the enzyme at room temperature. Chapter 4 details the synthesis of several bridged silsesquioxanes and the preparation of degradable hybrid SiNPs via co-condensation of bridged

  1. Synthesis and Characterization of Ordered Mesoporous Silica with Controlled Macroscopic Morphology for Membrane Applications

    NASA Astrophysics Data System (ADS)

    Stohlman, Olive R.


    Ordered mesoporous materials have tunable pore sizes between 2 and 50 nm and are characterized by ordered pore structures and high surface areas (~1000 m2/g). This makes them particularly favorable for a number of membrane applications such as protein separation, polymer extrusion, nanowire fabrication and membrane reactors. These membranes can be fabricated as top-layers on macroporous supports or as embedded membranes in a dense matrix. The first part of the work deals with the hydrothermal synthesis and water-vapor/oxygen separation properties of supported MCM-48 and a new Al-MCM-48 type membrane for potential use in air conditioning systems. Knudsen-type permeation is observed in these membranes. The combined effect of capillary condensation and the aluminosilicate matrix resulted in the highest separation factor (142) in Al-MCM-48 membranes, with a water vapor permeance of 6x10 -8mol/m2·Pa·s. The second part focuses on synthesis of embedded mesoporous silica membranes with helically ordered pores by a novel Counter Diffusion Self-Assembly (CDSA) method. This method is an extension of the interfacial synthesis method for fiber synthesis using tetrabutylorthosilicate (TBOS) and cetyltrimethylammonium bromide (CTAB) as the silica source and surfactant respectively. The initial part of this study determined the effect of TBOS height and humidity on fiber formation. From this study, the range of TBOS heights for best microscopic and macroscopic ordering were established. Next, the CDSA method was used to successfully synthesize membranes, which were characterized to have good support plugging and an ordered pore structure. Factors that influence membrane synthesis and plug microstructure were determined. SEM studies revealed the presence of gaps between the plugs and support pores, which occur due to shrinking of the plug on drying. Development of a novel liquid deposition method to seal these defects constituted the last part of this work. Post sealing, excess

  2. Transition metal-chelating surfactant micelle templates for facile synthesis of mesoporous silica nanoparticles

    SciTech Connect

    Lee, Hye Sun; Kim, Won Hee; Lee, Jin Hyung; Choi, Doo Jin; Jeong, Young-Keun; Chang, Jeong Ho


    Highly ordered mesoporous silica nanoparticles with tunable morphology and pore-size are prepared by the use of a transition metal-chelating surfactant micelle complex using Co{sup 2+}, Ni{sup 2+}, Cu{sup 2+}, and Zn{sup 2+} ions. These metal ions formed a metal-P123 micelle complex in an aqueous solution, while the metal ions are chelated to the hydrophilic domain such as the poly(ethylene oxide) group of a P123 surfactant. The different complexation abilities of the utilized transition metal ions play an important role in determining the formation of nano-sized ordered MSNs due to the different stabilization constant of the metal-P123 complex. Consequently, from a particle length of 1700 nm in the original mesoporous silica materials, the particle length of ordered MSNs through the metal-chelating P123 micelle templates can be reduced to a range of 180-800 nm. Furthermore, the variation of pore size shows a slight change from 8.8 to 6.6 nm. In particular, the Cu{sup 2+}-chelated MSNs show only decreased particle size to 180 nm. The stability constants for the metal-P123 complex are calculated on the basis of molar conductance measurements in order to elucidate the formation mechanism of MSNs by the metal-chelating P123 complex templates. In addition, solid-state {sup 29}Si, {sup 13}C-NMR and ICP-OES measurements are used for quantitative characterization reveal that the utilized metal ions affect only the formation of a metal-P123 complex in a micelle as a template. - Graphical abstract: Metal-chelating surfactant micelle templates support a simple and facile preparations of size-tunable ordered MSNs. Black-Small-Square Highlights: Black-Right-Pointing-Pointer Facile preparation of mesoporous silica nanoparticles (MSNs) was achieved by metal-chelating surfactant micelle complex using Co{sup 2+}, Ni{sup 2+}, Cu{sup 2+}, and Zn{sup 2+} ions. Black-Right-Pointing-Pointer Different complexation of metal ions plays an important role in determining the formation of

  3. Study of interface interactions in ZnO/Mesoporous silica nanocomposite

    NASA Astrophysics Data System (ADS)

    Reddy A, R. C.; Babu K, Sowri; Ch, Sujatha; Reddy K, V. G.


    The Photoluminescence (PL) properties of ZnO/Mesoporous silica (MPS) nanocomposite annealed under different temperatures were studied. A broad PL band at 395 nm has been observed in all samples and analysis was made by using Gaussian fitting. As the temperature increased, emission bands were blue shifted and the relative intensity ratio of the oxygen vacancies at ZnO-SiO2 interface to the oxygen vacancies in inner ZnO crystallites was increased. The emission peaks at 363 nm and 384 nm are attributed to the near band edge emission (NBE) and to the phonon replica emission. At 550C the exciton confinement effect disappears due to the large amount of surface effects. The influence of porosity of host media on Si-O-Zn cross linking bonds was also investigated. ZnO nanoparticles were loaded into nanocrystalline silica (NCS) and silica gel (SG). The surface area increases monotonously from NCS to MPS through SG. Si-O-Zn cross linking bonds were almost absent in the sample prepared with NCS. It exhibits NBE emission at 360 nm which was found to be absent in other samples prepared with SG and MPS. It was also found that the emission intensity of the samples decreases with aging. This is due to diffusion of oxygen atoms from the atmosphere to interior of the sample.

  4. Immune response to functionalized mesoporous silica nanoparticles for targeted drug delivery.


    Heidegger, Simon; Gössl, Dorothée; Schmidt, Alexandra; Niedermayer, Stefan; Argyo, Christian; Endres, Stefan; Bein, Thomas; Bourquin, Carole


    Multifunctional mesoporous silica nanoparticles (MSN) have attracted substantial attention with regard to their high potential for targeted drug delivery. For future clinical applications it is crucial to address safety concerns and understand the potential immunotoxicity of these nanoparticles. In this study, we assess the biocompatibility and functionality of multifunctional MSN in freshly isolated, primary murine immune cells. We show that the functionalized silica nanoparticles are rapidly and efficiently taken up into the endosomal compartment by specialized antigen-presenting cells such as dendritic cells. The silica nanoparticles showed a favorable toxicity profile and did not affect the viability of primary immune cells from the spleen in relevant concentrations. Cargo-free MSN induced only very low immune responses in primary cells as determined by surface expression of activation markers and release of pro-inflammatory cytokines such as Interleukin-6, -12 and -1β. In contrast, when surface-functionalized MSN with a pH-responsive polymer capping were loaded with an immune-activating drug, the synthetic Toll-like receptor 7 agonist R848, a strong immune response was provoked. We thus demonstrate that MSN represent an efficient drug delivery vehicle to primary immune cells that is both non-toxic and non-inflammagenic, which is a prerequisite for the use of these particles in biomedical applications. PMID:26659601

  5. Adsorption characterization of gaseous volatile organic compound on mesoporous silica particles prepared from spent diatomaceous earth.


    Bei, Lei-Lei; Tao, Hong; Ma, Chih-Ming; Shiue, Angus; Chang, Chang-Tang


    This study used spent diatomaceous earth (SDE) from drink processing as source of Si and cationic surfactant (CTAB) as a template for the synthesis of mesoporous silica Materials (MSM) through hydrothermal method. The MSM was characterized by Small-angle X-ray Diffraction (SXRD), Scanning Electron Microscopy (SEM), Thermo Gravimetric Analysis (TGA), Fourier Transform Infrared (FT-IR) spectroscopy and N2 adsorption-desorption analyzer. The results showed that the surface area, pore volume and pore size was roughly ranged from 880 to 1060 m2 g(-1), 1.05 cm3 g(-1) and 4.0 nm, respectively. The properties of the synthesized MSM were also compared with those prepared from pure silica sources (MCM-41) and got almost the same characteristics. The synthesized MSM was used as adsorbent at 25 degrees C with carrier gas of air. The adsorption equilibrium revealed that adsorption capacity of MSM was 59.6, 65.7, 69.6, 84.9 mg g(-1) while the acetone concentration was 600, 800, 1000 ppm, 1600 ppm respectively. Results showed that breakthrough curves correlate to the challenge vapor concentration, adsorbent loading, and the flow rate. The results obtained in the present work demonstrated that it was feasibility of using the SDE as a potential source of silica to prepare MSM. PMID:24734749

  6. Synthesis and Nanofiltration Membrane Performance of Oriented Mesoporous Silica Thin Films on Macroporous Supports.


    Clark Wooten, M Kaitlyn; Koganti, Venkat R; Zhou, Shanshan; Rankin, Stephen E; Knutson, Barbara L


    Silica thin films with accessible hexagonal close-packed (HCP) pores have been deposited on macroporous supports to achieve composite nanofiltration membranes. The properties of these pore channels have been characterized through solvent flux and solute diffusion experiments. A chemically neutral surface (provided by a cross-linked layer of P123 copolymer) for silica thin film synthesis on the alumina macroporous support promotes the alignment of HCP channels vertical to the substrate, where the mesopore templating agent is block copolymer P123 (poly(ethylene glycol)-block-poly(propylene glycol)-block-poly(ethylene glycol)). Vertical pore alignment is achieved for thin films (less than ∼100 nm) on a neutral surface and by sandwiching thicker films (∼240 nm) between two chemically neutral surfaces. Solvent flux through the composite membranes is consistent with accessible 10 nm diameter pores. Size selectivity of the membranes is characterized from the permeability of fluorescently tagged solutes (ranging from 4000 to 70 000 Da), where a size cut off occurs at 69 000 Da for the model protein bovine serum albumin. These permeability studies of the nanofiltration membranes serve to demonstrate solute transport in oriented silica thin film membranes and also highlight their versatility for membrane-based separations. PMID:27479791

  7. pH and ion strength modulated ionic species loading in mesoporous silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Liu, Wei; Liu, Jianbo; Yang, Xiaohai; Wang, Kemin; Wang, Qing; Yang, Meng; Li, Li; Xu, Jianguo


    Mesoporous silica nanoparticles (MSN) have emerged as appealing host materials to accommodate guest molecules for biomedical applications, and recently various methods have been developed to modulate the loading of guest molecules in the silica matrix. Herein, it was demonstrated that pH and ion strength showed great influence on the loading of charged species into the nanoparticles, taking MCM-41 as a host MSN model and methylviologen (MV2+) and 1,5-naphthalene disulfonate (NDS2-) as typical charged ionic guest molecules. As the pH increased from 3.0 to 8.0, the loading amount of MV2+ increased gradually, while on the contrary, it decreased gradually for NDS2-, for the solution pH changed the electrostatic interaction between the silica matrix and the ionic guest molecules. Additionally, the adding of NaCl reduced the electrostatic interaction, which resulted in a decreasing of the electrostatic rejection and electrostatic accumulation for the molecules carrying the same and the opposite charge to the particle respectively. Thus, pH and ion strength can be employed as simple approaches to modulate the loading of charged molecules and permselectivity in MSN. This work has a definite guidance function for molecule loading, transport modulation, controlled release as well as sensors based on MSN.

  8. Drug delivery formulations of ordered and nonordered mesoporous silica: comparison of three drug loading methods.


    Limnell, Tarja; Santos, Hélder A; Mäkilä, Ermei; Heikkilä, Teemu; Salonen, Jarno; Murzin, Dmitry Yu; Kumar, Narendra; Laaksonen, Timo; Peltonen, Leena; Hirvonen, Jouni


    A poorly soluble model drug, indomethacin (IMC), was loaded into two types of silica particles using three different loading methods. The loading efficiency and the extent/rate of drug release were evaluated. Widely used equipment in pharmaceutical laboratories, rotavapor and fluid bed, were used in the loading. The porous materials used were ordered mesoporous silica MCM-41 and nonordered silica gel Syloid 244 FP EU. The materials differ both in their pore properties and particle sizes. Tablets were successfully compressed from the IMC-loaded particles. Mechanical stability of the porous structures was studied with XRPD and nitrogen sorption after tableting and drug release was evaluated at pH 5.5 before and after tableting. The release of the poorly soluble IMC was faster from the Syloid than from the MCM-41, presumably due to the larger pore size and smaller particle size. Loading of IMC into the MCM-41 microparticles improved the drug dissolution, and blending the microparticles with pharmaceutical excipients improved the IMC release even further. The fast release was also maintained after tableting. Loading of IMC into the Syloid particles alone was sufficient to produce similar IMC release profiles, as in the case of MCM-41 with the excipients. PMID:21520084

  9. Preparation of the narrow size distribution USPIO in mesoporous silica for magnetic field guided drug delivery and release

    NASA Astrophysics Data System (ADS)

    Zapotoczny, B.; Guskos, N.; Kozioł, J. J.; Dudek, M. R.


    Ultra-small superparamagnetic iron oxides (USPIO) with an average diameter of 2 nm were synthesized in mesoporous silica using the method of co-precipitation of Fe2+ and Fe3+ ions in aqueous solution directly in the silica nanopores. Two types of the silica material, hexagonal phase MCM-41 and mesoporous silica spheres (MSS), were used. The resulting magnetically modified silica samples show high-quality superparamagnetic properties which persist also at low temperatures near 2 K. Their magnetization saturation in an applied external magnetic field exceeds 15 emu/g. The magnetically modified silica samples were studied with the help of the ferromagnetic resonance (FMR), SQUID-magnetometry, X-ray diffraction (XRD), dynamic light scattering (DLS) and TEM/EDX microscopy. The studies were complemented by confirming the possibility of drug release by the modified silica samples where the standard fluorescent dye was used as an example. The prepared material is suggested to be considered for magnetic field guided drug delivery and release.

  10. Anisotropic growth-induced synthesis of dual-compartment Janus mesoporous silica nanoparticles for bimodal triggered drugs delivery.


    Li, Xiaomin; Zhou, Lei; Wei, Yong; El-Toni, Ahmed Mohamed; Zhang, Fan; Zhao, Dongyuan


    Multifunctional dual-compartment Janus mesoporous silica nanocomposites of UCNP@SiO2@mSiO2&PMO (UCNP = upconversion nanoparticle, PMO = periodic mesoporous organosilica) containing core@shell@shell structured UCNP@SiO2@mSiO2 nanospheres and PMO single-crystal nanocubes have been successfully synthesized via a novel anisotropic island nucleation and growth approach with the ordered mesostructure. The asymmetric Janus nanocomposites show a very uniform size of ~300 nm and high surface area of ~1290 m(2)/g. Most importantly, the Janus nanocomposites possess the unique dual independent mesopores with different pore sizes (2.1 nm and 3.5-5.5 nm) and hydrophobicity/hydrophilicity for loading of multiple guests. The distinct chemical properties of the silica sources and the different mesostructures of the dual-compartments are the necessary prerequisites for the formation of the Janus nanostructure. With the assistance of the near-infrared (NIR) to ultraviolet/visible (UV-vis) optical properties of UCNPs and heat-sensitive phase change materials, the dual-compartment Janus mesoporous silica nanocomposites can be further applied into nanobiomedicine for heat and NIR light bimodal-triggered dual-drugs controllable release. It realizes significantly higher efficiency for cancer cell killing (more than 50%) compared to that of the single-triggered drugs delivery system (~25%). PMID:25251874

  11. Effect of core-shell structure and chitosan addition on catalytic activities of copper-containing silica-aluminosilicate composites in deNO(x) reaction by H2.


    Chamnankid, Busaya; Samanpratan, Rattanaporn; Kongkachuichay, Paisan


    Mesoporous silica-aluminosilicate composites were used as supports for selective catalytic reduction of NO by H2 using copper catalyst. Effect of loading techniques and structures of the supports on the catalytic performance were investigated. The nature, the oxidation state of copper, the structural properties and the morphology of the catalysts were characterized by means of UV-vis spectra, Fourier Transform Infrared Spectroscopy (FTIR), nitrogen sorption, and transmission electron microscopy, respectively. By using substitution technique, the copper(II) species were introduced into the silica-aluminosilicate framework by replacing aluminum atoms that located in the tetrahedral coordination. On the other hand, by using incipient wetness impregnation method, the copper species were deposited on the surface of composite materials. Upon testing their performances in deNO(x) reaction, the catalysts prepared by incipient wetness impregnation method showed higher catalytic activity than those prepared by substitution technique in any copper content. The core-shell structure was able to enhance the catalytic performance. It was found that, among the tested catalysts, the 1.5% Cu loaded core-shell mesoporous silica aluminosilicate composites prepared by an incipient wetness impregnation yielded the highest NO conversion of approximately 59%. However, the addition of chitosan creating macroporosity and controlling the uniform small clusters did not improve the catalytic performance. PMID:23447996

  12. Biocompatible zwitterionic sulfobetaine copolymer-coated mesoporous silica nanoparticles for temperature-responsive drug release.


    Sun, Jiao-Tong; Yu, Zhi-Qiang; Hong, Chun-Yan; Pan, Cai-Yuan


    A novel nanocontainer, which could regulate the release of payloads, has been successfully fabricated by attaching zwitterionic sulfobetaine copolymer onto the mesoporous silica nanoparticles (MSNs). RAFT polymerization is employed to prepare the hybrid poly(2-(dimethylamino)ethyl methacrylate)-coated MSNs (MSN-PDMAEMA). Subsequently, the tertiary amine groups in PDMAEMA are quaternized with 1,3-propanesultone to get poly(DMAEMA-co-3-dimethyl(methacryloyloxyethyl)ammonium propanesulfonate)-coated MSNs [MSN-Poly(DMAEMA-co-DMAPS)]. The zwitterionic PDMAPS component endows the nanocarrier with biocompatibility, and the PDMAEMA component makes the copolymer shell temperature-responsive. Controlled release of loaded rhodamine B has been achieved in the saline solutions. PMID:22488562

  13. Label electrochemical immunosensor for prostate-specific antigen based on graphene and silver hybridized mesoporous silica.


    Li, Yueyun; Han, Jian; Chen, Runhai; Ren, Xiang; Wei, Qin


    Prostate-specific antigen (PSA), as the specificity of prostate cancer markers, has been widely used in prostate cancer diagnosis and screening. In this study, we fabricated an electrochemical immunosensor for PSA detection using the amino-functionalized graphene sheet-ferrocenecarboxaldehyde composite materials (NH2-GS@FCA) and silver hybridized mesoporous silica nanoparticles (Ag@NH2-MCM48). Under optimal conditions, the fabricated immunosensor showed a wide linear range with PSA concentration (0.01-10.0ng·ml(-1)). Low detection limit (2pg·ml(-1)) proved the high sensitivity. In addition, the immunosensor possessed good stability and reproducibility. Moreover, the application to PSA analysis in serum samples yielded satisfactory results. PMID:25448622

  14. Hyaluronic acid-functionalized mesoporous silica nanoparticles for efficient photodynamic therapy of cancer cells.


    Gary-Bobo, Magali; Brevet, David; Benkirane-Jessel, Nadia; Raehm, Laurence; Maillard, Philippe; Garcia, Marcel; Durand, Jean-Olivier


    Mesoporous silica nanoparticles (MSN) for photodynamic therapy (PDT) were coated with poly-(L-lysine) and hyaluronic acid (HA) by using the layer-by-layer method. HA is able to target cancer cells over-expressing the corresponding CD44 receptor. MSN functionalized with HA (MSN-HA) were more efficient than MSN without the targeting moiety when PDT was performed at low fluence (14 Jcm(-2)) and low dosage of MSN (20 μgmL(-1)) on HCT 116 colorectal cancer cells, known to over-express the CD44 receptor. Incubation of HCT-116 cancer cells with an excess of HA impaired the PDT effect with MSN-HA thus demonstrating that an active endocytosis mechanism was involved in the uptake of MSN-HA by these cells. PMID:22959805

  15. Synthesis of Ordered Mesoporous Silica for Energy-efficient Adsorption Systems

    NASA Astrophysics Data System (ADS)

    Endo, Akira; Komori, Kou; Inagi, Yuki; Fujisaki, Satoko; Yamamoto, Takuji

    Energy-efficient adsorption systems, such as adsorption heat pump, desiccant cooling, humidity control system, and so on, are expected as a energy exchange process because they are able to utilize low temperature exhaust heat. As an adsorbent for such systems, materials with large adsorption capacity in the pressure range of practical operation are preferable. To enable the design and synthesis of materials with large heat storage capacity, the pore structure of adsorbents should be optimized for each systems. In this paper, we synthesized ordered mesoporous silica (MPS) with an arrow pore size distribution of around 2nm by a solvent evaporation method and evaluated their water adsorption properties. The adsorption isotherms for MPSs showed steep increase at a relative humidity corresponding to their pore size. Since MPSs have a large adsorption capacity than conventional materials in the relative humidity region of practical operation, they are expected for new adsorbents for energy-efficient adsorption systems.

  16. A solid-state NMR investigation of the structure of mesoporous silica nanoparticle supported rhodium catalysts

    SciTech Connect

    Rapp, Jennifer; Huang, Yulin; Natella, Michael; Cai, Yang; Lin, Victor S.-Y.; Pruski, Marek


    A detailed study of the chemical structure of mesoporous silica catalysts containing rhodium ligands and nanoparticles (RhP-MSN) was carried out by multi-dimensional solid-state NMR techniques. The degree of functionalization of the rhodium-phosphinosilyl complex to the surface of the RhP-MSN channels was determined by {sup 29}Si NMR experiments. The structural assignments of the rhodium-phosphinosilyl complex were unambiguously determined by employing the novel, indirectly detected heteronuclear correlation ({sup 13}C-{sup 1}H and {sup 31}P-{sup 1}H idHETCOR) techniques, which indicated that oxidation of the attached phosphinosilyl groups and detachment of Rh was enhanced upon syngas conversion.

  17. [Preparation and stability of β-carotene loaded using mesoporous silica nanoparticles as carriers system].


    Liu, Jing; Ren, Zhi-hui; Wang, Hai-yuan; Jin, Xing-hua


    1,3,5-Trimethylbenzene (1,3,5-TMB) was used as the pore-enlarging modifier to expand the pore size of MCM-41 (mobil company of matter) mesoporous silica nanoparticles. The solvent impregnation method was adopted to assemble non-water-soluble β-carotene into the pore channel of MCM-41. The MCM-41 and drug assemblies were characterized by TEM, FT-IR, elemental analysis and N2 adsorption-desorption. The results showed that MCM-41 has good sphericity and regular pore structure. The research also investigated the optimal loading time, the drug loading and the vitro stability of the β-carotene. As a drug carrier, the modified MCM-41 showing a shorter drug loading time, the drug loading as high as 85.58% and the stability of β-carotene in drug assemblies has improved. The study of this new formulation provides a new way for β-carotene application. PMID:26983203

  18. pH-responsive mesoporous silica nanoparticles employed in controlled drug delivery systems for cancer treatment

    PubMed Central

    Yang, Ke-Ni; Zhang, Chun-Qiu; Wang, Wei; Wang, Paul C.; Zhou, Jian-Ping; Liang, Xing-Jie


    In the fight against cancer, controlled drug delivery systems have emerged to enhance the therapeutic efficacy and safety of anti-cancer drugs. Among these systems, mesoporous silica nanoparticles (MSNs) with a functional surface possess obvious advantages and were thus rapidly developed for cancer treatment. Many stimuli-responsive materials, such as nanoparticles, polymers, and inorganic materials, have been applied as caps and gatekeepers to control drug release from MSNs. This review presents an overview of the recent progress in the production of pH-responsive MSNs based on the pH gradient between normal tissues and the tumor microenvironment. Four main categories of gatekeepers can respond to acidic conditions. These categories will be described in detail. PMID:24738037

  19. Mesoporous Silica Nanoparticles with Co-Condensed Gadolinium Chelates for Multimodal Imaging

    PubMed Central

    Taylor-Pashow, Kathryn M. L.; Della Rocca, Joseph; Lin, Wenbin


    Several mesoporous silica nanoparticle (MSN) contrast agents have been synthesized using a co-condensation method to incorporate two different Gd3+ complexes at very high loadings (15.5–28.8 wt %). These MSN contrast agents, with an MCM-41 type pore structure, were characterized using a variety of methods including SEM and TEM, nitrogen adsorption measurements, thermogravimetric analysis (TGA), direct current plasma (DCP) spectroscopy, and powder X-ray diffraction (PXRD). The magnetic resonance (MR) relaxivities of these contrast agents were determined using a 3 T MR scanner. The r1 relaxivities of these nanoparticles range from 4.1 to 8.4 mM−1s−1 on a per Gd basis. Additionally, the MSN particles were functionalized with an organic fluorophore and cancer cell targeting peptide to allow for demonstration of both the optical and MR contrast enhancing capabilities in vitro. PMID:24527205

  20. Polymer-coated mesoporous silica nanoparticles for the controlled release of macromolecules.


    Bhattacharyya, Sanjib; Wang, Henson; Ducheyne, Paul


    With the goal of achieving constant release of large biological molecules over an extended period of time we focused on hybrid inorganic/organic nanoparticles. We synthesized poly(ethylene glycol) (PEG)-coated mesoporous silica nanoparticles (MSNs) with incorporated trypsin inhibitor (TI), a model protein molecule for growth factors. Due to the goal of incorporating large protein molecules the pore size of the as-synthesized MSNs was expanded by a hydrothermal treatment prior to TI incorporation. In vitro release from the MSNs without the thin polymer film shows an initial burst followed by continuous release. In the case of polymer-coated MSNs the initial burst release was completely suppressed and approximate zero order release was achieved for 4 weeks. PMID:22688089

  1. Cellular Endocytosis and Trafficking of Cholera Toxin B-Modified Mesoporous Silica Nanoparticles

    PubMed Central

    Walker, William A.; Tarannum, Mubin; Vivero-Escoto, Juan L.


    In this study, mesoporous silica nanoparticles (MSNs) were functionalized with Cholera toxin subunit B (CTxB) protein to influence their intracellular trafficking pathways. The CTxB-MSN carrier was synthesized, and its chemical and structural properties were characterized. Endocytic pathway inhibition assays showed that the uptake of CTxB-MSNs in human cervical cancer (HeLa) cells was partially facilitated by both chlatrin- and caveolae-mediated endocytosis mechanisms. Laser scanning confocal microscopy (LSCM) experiments demonstrated that CTxB-MSNs were taken up by the cells and partially trafficked through the trans-Golgi network into to the endoplasmic reticulum in a retrograde fashion. The delivery abilities of CTxB-MSNs were evaluated using propidium iodide, an impermeable cell membrane dye. LSCM images depicted the release of propidium iodide in the endoplasmic reticulum and cell nucleus of HeLa cells. PMID:27134749

  2. Advances in Peptide Functionalization on Mesoporous Silica Nanoparticles for Controlled Drug Release.


    Hu, Jing-Jing; Xiao, Dong; Zhang, Xian-Zheng


    During the last decade, using versatile, promising, and fascinating mesoporous silica nanoparticles (MSNs) as site-specific and stimuli-responsive drug delivery systems (DDSs) has received concentrated research interest. As one of the most attractive surface modification units, peptides have inherent bioactivity, biodegradability and biocompatibility. Recent progresses in the utilization of versatile peptides for surface functionalization of MSNs to achieve cell-specific targeting, fluorescence imaging, and intracellular diagnosis and treatment of tumors are summarized in this review. The various functional peptides decorated on the MSNs are introduced and classified into three types, including targeting peptides, stimuli-responsive peptides and multifunctional chimeric peptides. The limitations and challenges of peptide modified MSNs and their potential applications are further discussed. PMID:27152737

  3. Mesoporous Silica Nanoparticles as Controlled Release Drug Delivery and Gene Transfection Carriers

    SciTech Connect

    Igor I. Slowing; Juan L. Viveo-Escoto; Chia-Wen Wu; Victor S. Y. Lin


    In this review, we highlight the recent research developments of a series of surface-functionalized mesoporous silica nanoparticle (MSN) materials as efficient drug delivery carriers. The synthesis of this type of MSN materials is described along with the current methods for controlling the structural properties and chemical functionalization for biotechnological and biomedical applications. We summarized the advantages of using MSN for several drug delivery applications. The recent investigations of the biocompatibility of MSN in vitro are discussed. We also describe the exciting progress on using MSN to penetrate various cell membranes in animal and plant cells. The novel concept of gatekeeping is introduced and applied to the design of a variety of stimuli-responsive nanodevices. We envision that these MSN-based systems have a great potential for a variety of drug delivery applications, such as the site-specific delivery and intracellular controlled release of drugs, genes, and other therapeutic agents.

  4. Development of mesoporous silica nanomaterials as a vehicle for anticancer drug delivery

    PubMed Central

    Yanes, Rolando E; Tamanoi, Fuyuhiko


    The development of delivery vehicles that would carry therapeutic agents selectively to cancer cells has become an important focus in biomedical research. Nanoparticles have received much attention because the advances made in this field have resulted in multiple biocompatible materials. In particular, mesoporous silica nanoparticles (MSNs) offer a solid framework with porous structure and high surface area that allows for the attachment of different functional groups. In this article we discuss the different surface modifications made to MSNs that have allowed for the construction of targeted nanoparticles to enhance accumulation and uptake in target sites, the incorporation of nanomachines for controlled cargo release and the combination with superparamagnetic metals for MRI cell labeling. We also discuss biocompatibility, biodistribution and drug-delivery efficacy of MSNs. Finally, we mention the construction of multifunctional nanoparticles that combine all of the previously examined nanoparticle modifications. PMID:22506096

  5. Dual-cargo selectively controlled release based on a pH-responsive mesoporous silica system.


    Gui, Wanyuan; Wang, Wenqian; Jiao, Xiangyu; Chen, Lifeng; Wen, Yongqiang; Zhang, Xueji


    A pH-controlled delivery system based on mesoporous silica nanoparticles (MSNs) was constructed for dual-cargo selective release. To achieve a better controlled-release effect, a modified sol-gel method was employed to obtain MSNs with tunable particle and pore sizes. The systems selectively released different kinds of cargo when stimulated by different pH values. At the lower pH value (pH 2.0) only one kind of cargo was released from the MSNs, whereas at a higher pH value (pH 7.0) only the other kind of cargo was released from the MSNs. The multi-cargo delivery system has brought the concept of selective release to new advances in the field of functional nanodevices and allows more accurate and controllable delivery of specific cargoes, which is expected to have promising applications in nanomedicine. PMID:25492672

  6. Cyclodextrin and Polyethylenimine Functionalized Mesoporous Silica Nanoparticles for Delivery of siRNA Cancer Therapeutics

    PubMed Central

    Shen, Jianliang; Kim, Han-Cheon; Su, Hua; Wang, Feng; Wolfram, Joy; Kirui, Dickson; Mai, Junhua; Mu, Chaofeng; Ji, Liang-Nian; Mao, Zong-Wan; Shen, Haifa


    Effective delivery holds the key to successful in vivo application of therapeutic small interfering RNA (siRNA). In this work, we have developed a universal siRNA carrier consisting of a mesoporous silica nanoparticle (MSNP) functionalized with cyclodextrin-grafted polyethylenimine (CP). CP provides positive charge for loading of siRNA through electrostatic interaction and enables effective endosomal escape of siRNA. Using intravital microscopy we were able to monitor tumor enrichment of CP-MSNP/siRNA particles in live mice bearing orthotopic MDA-MB-231 xenograft tumors. CP-MSNP delivery of siRNA targeting the M2 isoform of the glycolytic enzyme pyruvate kinase (PKM2) resulted in effective knockdown of gene expression in vitro and in vivo. Suppression of PKM2 led to inhibition of tumor cell growth, invasion, and migration. PMID:24672582

  7. Effects of Synthesis Process on Luminescence Properties and Structure of Mesoporous Carbon-Silica Nanocomposite

    NASA Astrophysics Data System (ADS)

    Sato, Koji; Ishikawa, Yukari; Ishii, Yosuke; Kawasaki, Shinji; Muto, Shunsuke; Yamamoto, Yuta


    The effects of hydrolysis and polycondensation reactions for synthesizing light-emitting mesoporous carbon-silica (MPCS) nanocomposite on the structure, chemical bonding state, and luminescence properties of MPCS were investigated by controlling the concentration (0.02 to 5 M) of HCl, which was used as a catalyst for hydrolysis and polycondensation. The progress of hydrolysis and polycondensation reactions provides a nanometer-order pore/wall structure and results in a strong light-emitting property. The pore/wall structure was obtained using HCl at concentrations of 0.2 M and higher, but it became disordered with increasing HCl concentration (2 and 5 M). The luminescence color of the MPCS nanocomposite can be changed from yellowish-white to bluish-white by changing the concentration of HCl.

  8. Probing the Microenvironment in the Confined Pores of Mesoporous Silica Nanoparticles

    PubMed Central


    The microenvironment inside of the pores of mesoporous silica nanoparticles is probed using spectroscopic techniques. The probe molecules are sealed inside of the pores by a nanovalve system that is capable of controlling the access to the pore and ensuring the exclusive probing of the pore environment without any interference from the probe molecules on the outer surface of the particles or from the surrounding solution. Rigidochromism studies are used to evaluate the rigidity of the solvent matrix inside of the pore, and dynamic fluorescence anisotropy experiments are employed to determine the rotational diffusion freedom of the probe molecule. The data show that those probe molecules are neither completely free to move nor tightly attached to the pore wall, and their mobility is changed by altering the charge of the pore wall. PMID:24803992

  9. Influence of metal electrodes on the response of humidity sensors coated with mesoporous silica

    NASA Astrophysics Data System (ADS)

    Bearzotti, Andrea


    Interesting effects of different metal electrodes on the behaviour of mesoporous based humidity sensors have been observed and studied by chemical characterization and electric measurements. The devices were prepared on passivated silicon slices utilizing an interdigitated structure as contacts. For comparison, the response of a device implemented on an alumina substrate has been reported. A block copolymer Pluronic F-127 has been used as the organic template and has been partially removed from the films by thermal calcination. A thin film mesoporous membrane has been deposited by dip-coating on the substrates in a sol-gel solution containing non-ionic block copolymers. Silica mesostructured films have been produced using an evaporation induced self-assembling process. The films were calcined at 150 °C to obtain the best performances in terms of stability, hysteresis and reproducibility of the response. The performance of the sensor has been found to be dependent on the film preparation method, the used electrodes and the substrate when exposed to different contents of relative humidity. Electrical characterization was performed under vacuum and dark conditions to investigate the properties of the materials in the absence of interfering chemicals, while the sensory properties were obtained in a controlled environment.

  10. Functionalized self-assembled monolayers on mesoporous silica nanoparticles with high surface coverage

    PubMed Central


    Mesoporous silica nanoparticles (MSNs) containing vinyl-, propyl-, isobutyl- and phenyl functionalized monolayers were reported. These functionalized MSNs were prepared via molecular self-assembly of organosilanes on the mesoporous supports. The relative surface coverage of the organic monolayers can reach up to 100% (about 5.06 silanes/nm2). These monolayer functionalize MSNs were analyzed by a number of techniques including transmission electron microscope, fourier transform infrared spectroscopy, X-ray diffraction pattern, cross-polarized Si29 MAS NMR spectroscopy, and nitrogen sorption measurement. The main elements (i.e., the number of absorbed water, the reactivity of organosilanes, and the stereochemistry of organosilane) that greatly affected the surface coverage and the quality of the organic functionalized monolayers on MSNs were fully discussed. The results show that the proper amount of physically absorbed water, the use of high active trichlorosilanes, and the functional groups with less steric hindrance are essential to generate MSNs with high surface coverage of monolayers. PMID:22720819

  11. In situ green synthesis of fluorescent monodispersed mesoporous silica spheres/poly(p-phenylenevinylene) composites.


    Yamada, Yuri; Nakamura, Tadashi; Yano, Kazuhisa


    A facile one-pot synthesis for the composite materials fabricated from conjugated polymer, poly(p-phenylenevinylene) (PPV), and monodispersed mesoporous silica spheres (MMSS) is demonstrated. Composite materials having superior photoluminescence properties are easily obtained using ethylene glycol as a reaction solvent in which PPV monomers are effectively exchanged with cationic surfactants in MMSS and subsequently polymerized in the solution. The method can prevent serious reduction of photoluminescence properties which occurs inevitably during thermal treatment (200°C) to polymerize PPV. In our method, the temperature of 100°C is enough to obtain the fully polymerized PPV, which is confirmed in Fourier transform infrared (FT-IR) spectrum. Reaction mechanism is verified through direct observation of its distinguishable color changes in the reaction solution and the measurement of surface electrical potential (ζ-potential). The obtained results strongly support that PPV chains are impregnated within mesopores in isolated condition, leading to high fluorescence quantum yield (nearly 80%). Compared to the conventional route, this method reduces multistep synthesis to one-step and eliminates high temperature and high vacuum process, leading to the facile eco-friendly procedure. PMID:26852353

  12. Nonionic fluorinated-hydrogenated surfactants for the design of mesoporous silica materials.


    Michaux, F; Blin, J L; Stébé, M J


    We have investigated the influence of the ratio between the volume of the hydrophilic head (VA) and the volume of the hydrophobic part (VB) of the surfactant on the mesopore ordering. To understand the difference of behavior we have performed a complete study dealing with fluorinated [Rm(F)(EO)n] and hydrogenated [Rm(H)(EO)n] surfactants. Their mixtures have also been taken into account. Here only the phase diagrams and the structural parameters of the liquid crystal phases of the mixed systems are reported. We have shown that the mutual or partial miscibility of the fluorinated and the hydrogenated surfactants depends on the number of oxyethylene units of each surfactant. To follow, various systems were used for the preparation of silica mesoporous materials via a cooperative templating mechanism (CTM). Results clearly reveal that VA/VB ratios in the range between 0.95 and 1.78 lead to the formation of well-ordered mesostructures. Wormhole-like structures are obtained for higher or lower values. Moreover, results show that from the VA/VB point of view, polyoxyethylene fluoroalkyl ether surfactants behave like their hydrogenated analogues. PMID:18759404

  13. Enzyme responsive drug delivery system based on mesoporous silica nanoparticles for tumor therapy in vivo.


    Liu, Yun; Ding, Xingwei; Li, Jinghua; Luo, Zhong; Hu, Yan; Liu, Junjie; Dai, Liangliang; Zhou, Jun; Hou, Changjun; Cai, Kaiyong


    To reduce the toxic side effects of traditional chemotherapeutics in vivo, we designed and constructed a biocompatible, matrix metalloproteinases (MMPs) responsive drug delivery system based on mesoporous silica nanoparticles (MSNs). MMPs substrate peptide containing PLGLAR (sensitive to MMPs) was immobilized onto the surfaces of amino-functionalized MSNs via an amidation reaction, serving as MMPs sensitive intermediate linker. Bovine serum albumin was then covalently coupled to linker as end-cap for sealing the mesopores of MSNs. Lactobionic acid was further conjugated to the system as targeting motif. Doxorubicin hydrochloride was used as the model anticancer drug in this study. A series of characterizations revealed that the system was successfully constructed. The peptide-functionalized MSNs system demonstrated relatively high sensitivity to MMPs for triggering drug delivery, which was potentially important for tumor therapy since the tumor's microenvironment overexpressed MMPs in nature. The in vivo experiments proved that the system could efficiently inhibit the tumor growth with minimal side effects. This study provides an approach for the development of the next generation of nanotherapeutics toward efficient cancer treatment. PMID:25789511

  14. Enzyme responsive drug delivery system based on mesoporous silica nanoparticles for tumor therapy in vivo

    NASA Astrophysics Data System (ADS)

    Liu, Yun; Ding, Xingwei; Li, Jinghua; Luo, Zhong; Hu, Yan; Liu, Junjie; Dai, Liangliang; Zhou, Jun; Hou, Changjun; Cai, Kaiyong


    To reduce the toxic side effects of traditional chemotherapeutics in vivo, we designed and constructed a biocompatible, matrix metalloproteinases (MMPs) responsive drug delivery system based on mesoporous silica nanoparticles (MSNs). MMPs substrate peptide containing PLGLAR (sensitive to MMPs) was immobilized onto the surfaces of amino-functionalized MSNs via an amidation reaction, serving as MMPs sensitive intermediate linker. Bovine serum albumin was then covalently coupled to linker as end-cap for sealing the mesopores of MSNs. Lactobionic acid was further conjugated to the system as targeting motif. Doxorubicin hydrochloride was used as the model anticancer drug in this study. A series of characterizations revealed that the system was successfully constructed. The peptide-functionalized MSNs system demonstrated relatively high sensitivity to MMPs for triggering drug delivery, which was potentially important for tumor therapy since the tumor’s microenvironment overexpressed MMPs in nature. The in vivo experiments proved that the system could efficiently inhibit the tumor growth with minimal side effects. This study provides an approach for the development of the next generation of nanotherapeutics toward efficient cancer treatment.

  15. Highly selective and sensitive detection of glutathione using mesoporous silica nanoparticles capped with disulfide-containing oligo(ethylene glycol) chains.


    El Sayed, Sameh; Giménez, Cristina; Aznar, Elena; Martínez-Máñez, Ramón; Sancenón, Félix; Licchelli, Maurizio


    Mesoporous silica nanoparticles loaded with safranin O and capped with disulfide-containing oligo(ethylene glycol) chains were used for the selective and sensitive fluorimetric detection of glutathione. PMID:25482517

  16. Targeting Innate Immunity with dsRNA-Conjugated Mesoporous Silica Nanoparticles Promotes Antitumor Effects on Breast Cancer Cells.


    Ultimo, Amelia; Giménez, Cristina; Bartovsky, Pavel; Aznar, Elena; Sancenón, Félix; Marcos, M Dolores; Amorós, Pedro; Bernardo, Ana R; Martínez-Máñez, Ramón; Jiménez-Lara, Ana M; Murguía, José R


    We describe herein a Toll-like receptor 3 (TLR3) targeting delivery system based on mesoporous silica nanoparticles capped with the synthetic double stranded RNA polyinosinic-polycytidylic acid (poly(I:C)) for controlled cargo delivery in SK-BR-3 breast carcinoma cells. Our results show that poly(I:C)-conjugated nanoparticles efficiently targeted breast cancer cells due to dsRNA-TLR3 interaction. Such interaction also triggered apoptotic pathways in SK-BR-3, significantly decreasing cells viability. Poly(I:C) cytotoxic effect in breast carcinoma cells was enhanced by loading nanoparticles' mesopores with the anthracyclinic antibiotic doxorubicin, a commonly used chemotherapeutic agent. PMID:26641630

  17. The surface of ordered mesoporous benzene-silica hybrid material: an infrared and ab initio molecular modeling study.


    Onida, Barbara; Borello, Luisa; Busco, Claudia; Ugliengo, Piero; Goto, Yasutomo; Inagaki, Shinji; Garrone, Edoardo


    Joint IR and computational results allow a detailed characterization of the surface properties of a mesoporous benzene-silica hybrid material with crystal-like wall structure. After outgassing at 450 degrees C, hydroxyl species mainly consist of noninteracting silanols, with both O-H and Si-O stretching modes at lower frequencies than those of SiOH in silica. Interaction with several probe molecules, followed both by experiment and calculus, shows that the aryl group in the coordination sphere of Si imparts a lesser acidity with respect to the isolated silanol in silica. In contrast, adsorption isotherms indicate that the interaction with acetone is stronger with benzene-silica than with silica: this is interpreted in terms of secondary interactions taking place between the slightly acidic CH in acetone and the electronic cloud in benzene-like rings. This suggests that both the inorganic component and the organic one play a role in dictating the surface behavior. PMID:16852474

  18. One-step synthesis of magnetic hollow mesoporous silica (MHMS) nanospheres for drug delivery nanosystems via electrostatic self-assembly templated approach.


    Liu, Fang; Wang, Jingnan; Cao, Qingyun; Deng, Haidong; Shao, Guang; Deng, David Y B; Zhou, Wuyi


    In this work, yolk-shell structured magnetic hollow mesoporous silica (MHMS) nanospheres with controllable magnetic responsibility, high specific surface area, a huge cavity and ink-bottle type mesopores were successfully synthesized in one-step by an electrostatic self-assembly templated approach. The obtained MHMS nanospheres exhibited low cytotoxicity, excellent biocompatibility and potential application in the biomedical field. PMID:25563752

  19. Development of TRPN dendrimer-modified disordered mesoporous silica for CO{sub 2} capture

    SciTech Connect

    Zhang, Xiaoyun; Zhang, Sisi; Qin, Hongyan; Wu, Wei


    Highlights: • A novel series of TRPN dendrimers are synthesized. • Structurally disordered mesoporous silica was used to develop the CO{sub 2} adsorbent. • The CO{sub 2} adsorption capacity is relatively high. • The sorbent exhibits a high stability after 12 cycling runs. • The sorbent achieves complete desorption at low temperature (60 °C). - Abstract: A novel series of tri(3-aminopropyl) amine (TRPN) dendrimers were synthesized and impregnated on structurally disordered mesoporous silica (DMS) to generate CO{sub 2} adsorbents (TS). The physicochemical and adsorption properties of the adsorbents before and after dendrimer modification were characterized by X-ray diffraction (XRD), thermogravimetric analysis (TGA), Fourier transform infrared spectroscopy (FTIR), transmission electron microscopy (TEM) and N{sub 2} adsorption–desorption (N{sub 2}-BET) techniques. CO{sub 2} adsorption–desorption tests indicated that the sorbent demonstrates high CO{sub 2} adsorption capacity (138.1 mg g{sup −1} for G1 sample TS-G1-3CN-50 and 91.7 mg g{sup −1} for G2 sample TS-G2-6CN-50), and can completely desorb CO{sub 2} under vacuum at 60 °C. Its CO{sub 2} adsorption capacity at 25 °C increases with the amine loading, achieving the highest adsorption capacity (140.6 mg g{sup −1} for TS-G1-3CN) at 60%. The developed TS materials exhibited excellent cycling stability. After 12 consecutive adsorption–desorption runs, TS-G1-3CN-50 shows an adsorption capacity of 136.0 mg g{sup −1}, retaining 98.5% of its original value.

  20. Enzyme responsive mesoporous silica nanoparticles for targeted tumor therapy in vitro and in vivo

    NASA Astrophysics Data System (ADS)

    Liu, Junjie; Zhang, Beilu; Luo, Zhong; Ding, Xingwei; Li, Jinghua; Dai, Liangliang; Zhou, Jun; Zhao, Xiaojing; Ye, Jingya; Cai, Kaiyong


    This study reports a biocompatible controlled drug release system based on mesoporous silica nanoparticles (MSNs) for tumor microenvironment responsive drug delivery. It was fabricated by grafting phenylboronic acid conjugated human serum albumin (PBA-HSA) onto the surfaces of MSNs as a sealing agent, via an intermediate linker of a functional polypeptide, which was composed of two functional units: the polycation cell penetrating peptide (CPP) polyarginine, and matrix metalloproteinase 2 (MMP-2) substrate peptide. A series of characterizations confirmed that the system had been successfully constructed. In vitro tests proved that the anticancer drug loading system could efficiently induce cell apoptosis in vitro. More importantly, the in vivo tumor experiments confirmed that the anticancer loading system could efficiently inhibit tumor growth with minimal side effects.This study reports a biocompatible controlled drug release system based on mesoporous silica nanoparticles (MSNs) for tumor microenvironment responsive drug delivery. It was fabricated by grafting phenylboronic acid conjugated human serum albumin (PBA-HSA) onto the surfaces of MSNs as a sealing agent, via an intermediate linker of a functional polypeptide, which was composed of two functional units: the polycation cell penetrating peptide (CPP) polyarginine, and matrix metalloproteinase 2 (MMP-2) substrate peptide. A series of characterizations confirmed that the system had been successfully constructed. In vitro tests proved that the anticancer drug loading system could efficiently induce cell apoptosis in vitro. More importantly, the in vivo tumor experiments confirmed that the anticancer loading system could efficiently inhibit tumor growth with minimal side effects. Electronic supplementary information (ESI) available: FTIR spectra, TGA curves, BET and BJH parameters, zeta potentials of nanoparticles; cleavage assay of the peptide detected by HPLC and MS; dose-dependent cytotoxicity of MSNs

  1. A mesoporous silica nanoparticle with charge-convertible pore walls for efficient intracellular protein delivery

    NASA Astrophysics Data System (ADS)

    Park, Hee Sung; Kim, Chan Woo; Lee, Hong Jae; Hye Choi, Ji; Lee, Se Geun; Yun, Young-Pil; Kwon, Ick Chan; Lee, Seung Jin; Jeong, Seo Young; Lee, Sang Cheon


    We report a smart mesoporous silica nanoparticle (MSN) with a pore surface designed to undergo charge conversion in intracellular endosomal condition. The surface of mesopores in the silica nanoparticles was engineered to have pH-hydrolyzable citraconic amide. Solid-state nuclear magnetic resonance (NMR), Fourier-transform infrared (FT-IR) spectroscopy, and Brunauer-Emmett-Teller (BET) analyses confirmed the successful modification of the pore surfaces. MSNs (MSN-Cit) with citraconic amide functionality on the pore surfaces exhibited a negative zeta potential (-10 mV) at pH 7.4 because of the presence of carboxylate end groups. At cellular endosomal pH (~5.0), MSN-Cit have a positive zeta potential (16 mV) indicating the dramatic charge conversion from negative to positive by hydrolysis of surface citraconic amide. Cytochrome c (Cyt c) of positive charges could be incorporated into the pores of MSN-Cit by electrostatic interactions. The release of Cyt c can be controlled by adjusting the pH of the release media. At pH 7.4, the Cyt c release was retarded, whereas, at pH 5.0, MSN-Cit facilitated the release of Cyt c. The released Cyt c maintained the enzymatic activity of native Cyt c. Hemolytic activity of MSN-Cit over red blood cells (RBCs) was more pronounced at pH 5.0 than at pH 7.0, indicating the capability of intracellular endosomal escape of MSN carriers. Confocal laser scanning microscopy (CLSM) studies showed that MSN-Cit effectively released Cyt c in endosomal compartments after uptake by cancer cells. The MSN developed in this work may serve as efficient intracellular carriers of many cell-impermeable therapeutic proteins.

  2. Development of efficient amine-modified mesoporous silica SBA-15 for CO{sub 2} capture

    SciTech Connect

    Zhang, Xiaoyun; Qin, Hongyan; Zheng, Xiuxin; Wu, Wei


    Graphical abstract: - Highlights: • A secondary amine AN-TEPA is used to modify the SBA-15. • CO{sub 2} adsorption capacity (180.1 mg g{sup −1}-adsorbent for 70% amine loading) is high. • The sorbent exhibits a high stability after 12 cycling runs. • The modified SBA-15 achieves complete desorption at low temperature (100 °C). - Abstract: A novel CO{sub 2} sorbent was prepared by impregnating mesoporous silica, SBA-15, with acrylonitrile (AN)-modified tetraethylenepentamine (TEPA) in order to increase CO{sub 2} adsorption capacity and improve cycling stability. The mesoporous silica with pre- and post-surface modification was investigated by X-ray diffraction characterization (XRD), N{sub 2} adsorption–desorption test (N{sub 2}-BET), transmission electron microscopy (TEM), Fourier transform infrared (FTIR) spectroscopy and thermogravimetric analysis (TGA). The adsorption/desorption performance of S-TN (TN: AN modified TEPA) and S-TEPA was studied by dynamic adsorption. Test results showed that the solid base-impregnated SBA-15 demonstrated high CO{sub 2} adsorption capacity (180.1 mg g{sup −1}-adsorbent for 70% amine loading level). Compared to S-TEPA (24.1% decrease of initial capacity), S-TN with 50% amine loading exhibited improved cycling stability, 99.9% activity reserved (from initial 153.0 mg g{sup −1} to 151.3 mg g{sup −1}) after 12 cycles of adsorption/desorption at 100 °C. A mechanism of molecular structure of the loaded amine was attributed to the improved performance.

  3. Development and Testing of Diglycolamide Functionalized Mesoporous Silica for Sorption of Trivalent Actinides and Lanthanides.


    Shusterman, Jennifer A; Mason, Harris E; Bowers, Jon; Bruchet, Anthony; Uribe, Eva C; Kersting, Annie B; Nitsche, Heino


    Sequestration of trivalent actinides and lanthanides present in used nuclear fuel and legacy wastes is necessary for appropriate long-term stewardship of these metals, particularly to prevent their release into the environment. Organically modified mesoporous silica is an efficient material for recovery and potential subsequent separation of actinides and lanthanides because of its high surface area, tunable ligand selection, and chemically robust substrate. We have synthesized the first novel hybrid material composed of SBA-15 type mesoporous silica functionalized with diglycolamide ligands (DGA-SBA). Because of the high surface area substrate, the DGA-SBA was found to have the highest Eu capacity reported so far in the literature of all DGA solid-phase extractants. The sorption behavior of europium and americium on DGA-SBA in nitric and hydrochloric acid media was tested in batch contact experiments. DGA-SBA was found to have high sorption of Am and Eu in pH 1, 1 M, and 3 M nitric and hydrochloric acid concentrations, which makes it promising for sequestration of these metals from used nuclear fuel or legacy waste. The kinetics of Eu sorption were found to be two times slower than that for Am in 1 M HNO3. Additionally, the short-term susceptibility of DGA-SBA to degradation in the presence of acid was probed using (29)Si and (13)C solid-state NMR spectroscopy. The material was found to be relatively stable under these conditions, with the ligand remaining intact after 24 h of contact with 1 M HNO3, an important consideration in use of the DGA-SBA as an extractant from acidic media. PMID:26334933

  4. Sugar and pH dual-responsive mesoporous silica nanocontainers based on competitive binding mechanisms

    NASA Astrophysics Data System (ADS)

    Yilmaz, M. Deniz; Xue, Min; Ambrogio, Michael W.; Buyukcakir, Onur; Wu, Yilei; Frasconi, Marco; Chen, Xinqi; Nassar, Majed S.; Stoddart, J. Fraser; Zink, Jeffrey I.


    A sugar and pH dual-responsive controlled release system, which is highly specific towards molecular stimuli, has been developed based on the binding between catechol and boronic acid on a platform of mesoporous silica nanoparticles (MSNs). By grafting phenylboronic acid stalks onto the silica surface, catechol-containing β-cyclodextrins can be attached to the orifices of the MSNs' nanopores through formation of boronate esters which block access to the nanopores. These esters are stable enough to prevent cargo molecules from escaping. The boronate esters disassociate in the presence of sugars, enabling the molecule-specific controlled-release feature of this hybrid system. The rate of release has been found to be tunable by varying both the structures and the concentrations of sugars, as a result of the competitive binding nature associated with the mechanism of its operation. Acidification also induces the release of cargo molecules. Further investigations show that the presence of both a low pH and sugar molecules provides cooperative effects which together control the rate of release.A sugar and pH dual-responsive controlled release system, which is highly specific towards molecular stimuli, has been developed based on the binding between catechol and boronic acid on a platform of mesoporous silica nanoparticles (MSNs). By grafting phenylboronic acid stalks onto the silica surface, catechol-containing β-cyclodextrins can be attached to the orifices of the MSNs' nanopores through formation of boronate esters which block access to the nanopores. These esters are stable enough to prevent cargo molecules from escaping. The boronate esters disassociate in the presence of sugars, enabling the molecule-specific controlled-release feature of this hybrid system. The rate of release has been found to be tunable by varying both the structures and the concentrations of sugars, as a result of the competitive binding nature associated with the mechanism of its operation

  5. Folic acid-functionalized mesoporous silica nanospheres hybridized with AIE luminogens for targeted cancer cell imaging

    NASA Astrophysics Data System (ADS)

    Wang, Zilong; Xu, Bin; Zhang, Lei; Zhang, Jibo; Ma, Tenghe; Zhang, Jiabao; Fu, Xueqi; Tian, Wenjing


    Fluorescent nanoparticles (FNPs) have been found to be useful as visualization tools for biological sensing, probing, imaging, and monitoring. Applied to targeted cancer cell imaging, FNPs are highly desirable for early stage cancer diagnosis and treatment. However, the light emission from most of the FNPs reported is severely limited because of the aggregation-caused quenching (ACQ) effect. Herein, we present highly emissive inorganic-organic nanoparticles with core-shell structures for targeted cancer cell imaging. Coated with a folate-functionalized silica shell, 9,10-distyrylanthracene (DSA) fluorogens with aggregation-induced emission (AIE) properties served as the fluorescent core, affording folate-functionalized fluorescent silica nanoparticles (FFSNPs) with a high fluorescence quantum yield (up to 20%). The FFSNPs are of small size (diameter ~60 nm), monodispersed, stable in aqueous suspension, and pose little toxicity to living cells and thus can be utilized for targeted HeLa cell imaging. In addition, the FFSNPs are mesoporous and therefore can potentially be used as vehicles for controlled, externally activated release of anticancer drugs.Fluorescent nanoparticles (FNPs) have been found to be useful as visualization tools for biological sensing, probing, imaging, and monitoring. Applied to targeted cancer cell imaging, FNPs are highly desirable for early stage cancer diagnosis and treatment. However, the light emission from most of the FNPs reported is severely limited because of the aggregation-caused quenching (ACQ) effect. Herein, we present highly emissive inorganic-organic nanoparticles with core-shell structures for targeted cancer cell imaging. Coated with a folate-functionalized silica shell, 9,10-distyrylanthracene (DSA) fluorogens with aggregation-induced emission (AIE) properties served as the fluorescent core, affording folate-functionalized fluorescent silica nanoparticles (FFSNPs) with a high fluorescence quantum yield (up to 20%). The

  6. In vivo delivery of bovine viral diahorrea virus, E2 protein using hollow mesoporous silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Mahony, D.; Cavallaro, A. S.; Mody, K. T.; Xiong, L.; Mahony, T. J.; Qiao, S. Z.; Mitter, N.


    Our work focuses on the application of mesoporous silica nanoparticles as a combined delivery vehicle and adjuvant for vaccine applications. Here we present results using the viral protein, E2, from bovine viral diarrhoea virus (BVDV). BVDV infection occurs in the target species of cattle and sheep herds worldwide and is therefore of economic importance. E2 is a major immunogenic determinant of BVDV and is an ideal candidate for the development of a subunit based nanovaccine using mesoporous silica nanoparticles. Hollow type mesoporous silica nanoparticles with surface amino functionalisation (termed HMSA) were characterised and assessed for adsorption and desorption of E2. A codon-optimised version of the E2 protein (termed Opti-E2) was produced in Escherichia coli. HMSA (120 nm) had an adsorption capacity of 80 μg Opti-E2 per mg HMSA and once bound E2 did not dissociate from the HMSA. Immunisation studies in mice with a 20 μg dose of E2 adsorbed to 250 μg HMSA was compared to immunisation with Opti-E2 (50 μg) together with the traditional adjuvant Quillaja saponaria Molina tree saponins (QuilA, 10 μg). The humoral responses with the Opti-E2/HMSA nanovaccine although slightly lower than those obtained for the Opti-E2 + QuilA group demonstrated that HMSA particles are an effective adjuvant that stimulated E2-specific antibody responses. Importantly the cell-mediated immune responses were consistently high in all mice immunised with Opti-E2/HMSA nanovaccine formulation. Therefore we have shown the Opti-E2/HMSA nanoformulation acts as an excellent adjuvant that gives both T-helper 1 and T-helper 2 mediated responses in a small animal model. This study has provided proof-of-concept towards the development of an E2 subunit nanoparticle based vaccine.Our work focuses on the application of mesoporous silica nanoparticles as a combined delivery vehicle and adjuvant for vaccine applications. Here we present results using the viral protein, E2, from bovine viral

  7. Branch number matters: Promoting catalytic reduction of 4-nitrophenol over gold nanostars by raising the number of branches and coating with mesoporous SiO2.


    Ndokoye, Pancras; Zhao, Qidong; Li, Xinyong; Li, Tingting; Tade, Moses O; Wang, Shaobin


    In this study, we demonstrate for the first time that highly branched gold nanostars (AuNSs) and silica-coated AuNSs (AuNSs@mSiO2) could potentially serve as efficient hydrogenation catalysts. The catalytic activity could be promoted by raising the number of tipped-branches of AuNSs, which reveals that the tips play an important role as active sites. The fabricated sharply-pointed AuNSs benefit the electron transfer from BH4 anions to 4-nitrophenol. Coating AuNSs with mesoporous silica (AuNSs@mSiO2) further enhanced the reduction rate and recyclability, and also contributed to reducing the induction period. The AuNSs@mSiO2 (50-100nm in diameter) are large enough to be catalytically inactive, but they consist of sharply-pointed tips with the radius of 2.6-3.6nm, which are rich in coordinately unsaturated sites similar to those of nanoparticles and clusters. Such features in structure and activity would also extend their application range in heterogeneous catalysis. PMID:27235790

  8. Activators generated by electron transfer for atom transfer radical polymerization of styrene in the presence of mesoporous silica nanoparticles

    SciTech Connect

    Khezri, Khezrollah; Roghani-Mamaqani, Hossein


    Graphical abstract: Effect of mesoporous silica nanoparticles (MCM-41) on the activator generated by electron transfer for atom transfer radical polymerization (AGET ATRP) is investigated. Decrement of conversion and number average molecular weight and also increment of polydispersity index (PDI) values are three main results of addition of MCM-41 nanoparticles. Incorporation of MCM-41 nanoparticles in the polystyrene matrix can clearly increase thermal stability and decrease glass transition temperature of the nanocomposites. - Highlights: • Spherical morphology, hexagonal structure, and high surface area with regular pore diameters of the synthesized MCM-41 nanoparticles are examined. • AGET ATRP of styrene in the presence of MCM-41 nanoparticles is performed. • Effect of MCM-41 nanoparticles addition on the polymerization rate, conversion and molecular weights of the products are discussed. • Improvement in thermal stability of the nanocomposites and decreasing T{sub g} values was also observed by incorporation of MCM-41 nanoparticles. - Abstract: Activator generated by electron transfer for atom transfer radical polymerization was employed to synthesize well-defined mesoporous silica nanoparticles/polystyrene composites. Inherent features of spherical mesoporous silica nanoparticles were evaluated by nitrogen adsorption/desorption isotherm, X-ray diffraction and scanning electron microscopy analysis techniques. Conversion and molecular weight evaluations were carried out using gas and size exclusion chromatography respectively. By the addition of only 3 wt% mesoporous silica nanoparticles, conversion decreases from 81 to 58%. Similarly, number average molecular weight decreases from 17,116 to 12,798 g mol{sup −1}. However, polydispersity index (PDI) values increases from 1.24 to 1.58. A peak around 4.1–4.2 ppm at proton nuclear magnetic resonance spectroscopy results clearly confirms the living nature of the polymerization. Thermogravimetric

  9. Catalytic ozonation of selected pharmaceuticals over mesoporous alumina-supported manganese oxide.


    Yang, Li; Hu, Chun; Nie, Yulun; Qu, Jiuhui


    Catalytic ozonation of five pharmaceutical compounds (PhACs)-phenazone, ibuprofen, diphenhydramine, phenytoin, and diclofenac sodium in alumina-supported manganese oxide (MnOx) suspension was carried out with a semicontinuous laboratory reactor. MnOx supported by mesoporous alumina (MnOx/MA) was highly effective in mineralizing the PhACs in aqueous solution. Fourier transform infrared (FTIR) spectroscopy and in situ attenuated total reflection FTIR (ATR-FTIR) spectroscopy were used to examine the interaction of ozone with different catalysts undervarious conditions. The crucial active sites, surface oxide species at 1380 cm(-1), were formed by the interaction of ozone with Lewis acid sites on the alumina surface. New surface hydroxyl groups at 2915 and 2845 cm(-1) were produced by the interaction of the catalyst and ozone in aqueous suspension and became active sites in the presence of MnOx. The introduction of MnOx enhanced the formation and activation of surface hydroxyl groups, causing higher catalytic reactivity. On the basis of these findings, a reaction mechanism is proposed for the catalytic ozonation of PhACs in MnOx/MA suspension. PMID:19452911

  10. In Vivo Integrity and Biological Fate of Chelator-Free Zirconium-89-Labeled Mesoporous Silica Nanoparticles

    PubMed Central


    Traditional chelator-based radio-labeled nanoparticles and positron emission tomography (PET) imaging are playing vital roles in the field of nano-oncology. However, their long-term in vivo integrity and potential mismatch of the biodistribution patterns between nanoparticles and radio-isotopes are two major concerns for this approach. Here, we present a chelator-free zirconium-89 (89Zr, t1/2 = 78.4 h) labeling of mesoporous silica nanoparticle (MSN) with significantly enhanced in vivo long-term (>20 days) stability. Successful radio-labeling and in vivo stability are demonstrated to be highly dependent on both the concentration and location of deprotonated silanol groups (−Si–O–) from two types of silica nanoparticles investigated. This work reports 89Zr-labeled MSN with a detailed labeling mechanism investigation and long-term stability study. With its attractive radio-stability and the simplicity of chelator-free radio-labeling, 89Zr-MSN offers a novel, simple, and accurate way for studying the in vivo long-term fate and PET image-guided drug delivery of MSN in the near future. PMID:26213260

  11. Investigation of Hexagonal Mesoporous Silica-Supported Composites for Trace Moisture Adsorption

    NASA Astrophysics Data System (ADS)

    Li, Li; Tang, Nian; Wang, Yaxue; Cen, Wanglai; Liu, Jie; Zhou, Yongyan


    Moisture control is an important part of effective maintenance program for gas-insulated switchgear (GIS). Herein, hexagonal mesoporous silica (HMS) materials were synthesized by adopting dodecylamine as a structure directing agent, which was then employed as a host for supporting polyethylenimine (PEI) without further calcinations or extraction treatment. The physicochemical properties of the silica support and composites were characterized, and the moisture adsorption capacity of these composites was determined. The reserved template agents resulted in a dramatic improvement in moisture adsorption amount. Among them, 50PEI/DHMS showed the highest adsorption value. The enhanced adsorption could be attributed to the generated hydrogen bonding between amino groups and H2O molecules and the improved diffusion of moisture into the bulk networks of PEI polymers due to its better spatial dispersion imposed by the long alkyl chains of template agents, which was confirmed by thermogravimetry results and hydrogen efficiency analysis. Moreover, the maintained terminal amino groups of templates could also function as active sites for moisture adsorption. The results herein imply that the PEI/DHMS composites could be appealing materials for capturing moisture in GIS.

  12. Cationic poly(ɛ-caprolactone) surface functionalized mesoporous silica nanoparticles and their application in drug delivery

    NASA Astrophysics Data System (ADS)

    Zhang, Yan; Wang, Zhaojun; Zhou, Weimin; Min, Guoquan; Lang, Meidong


    Cationic poly(ɛ-caprolactone) modified hollow mesoporous silica (HMSNs) was achieved by a post graft method via covalent linkage between the silanols on the surface of silica and the trimethoxysilane groups at the end of the poly(γ-(carbamic acid benzyl ester)-ɛ-caprolactone). The trimethoxysilane groups were introduced to poly(γ-(carbamic acid benzyl ester)-ɛ-caprolactone) by ring opening polymerization of γ-(carbamic acid benzyl ester)-ɛ-caprolactone (γCABɛCL) with 3-aminopropyl trimethoxysilane as initiator. Subsequently, the polymer was grafted to the HMSNs and the protected groups of Cbz were removed, thus the amino groups were obtained accordingly. The structure of the polymer was confirmed by 1H NMR. In addition, the TEM and SEM demonstrated that the HMSNs were spherical and the polymer was well coated on the spheres. FTIR, TGA and N2 adsorption results proved that the modified processes were effective and the structure of the HMSNs was well reserved. The cationic surface was further confirmed by zeta potential. Moreover, the potential application of the HMSNs in drug delivery was studied with ammonium glycyrrhizinate (AMG) as model drug. Results showed that the cationic HMSNs could be an efficient AMG carrier.

  13. Synthesis of Biomolecule-Modified Mesoporous Silica Nanoparticles for Targeted Hydrophobic Drug Delivery to Cancer Cells

    PubMed Central

    Ferris, Daniel P.; Lu, Jie; Gothard, Chris; Yanes, Rolando; Thomas, Courtney R.; Olsen, John-Carl; Stoddart, J. Fraser; Tamanoi, Fuyuhiko; Zink, Jeffrey I.


    Synthetic methodologies integrating hydrophobic drug delivery and biomolecular targeting with mesoporous silica nanoparticles are described. Transferrin and cyclic-RGD peptides are covalently attached to the nanoparticles utilizing different techniques and provide selectivity between primary and metastatic cancer cells. The increase in cellular uptake of the targeted particles is examined using fluorescence microscopy and flow cytometry. Transferrin-modified silica nanoparticles display enhancement in particle uptake by Panc-1 cancer cells over that of normal HFF cells. The endocytotic pathway for these particles is further investigated through plasmid transfection of the transferrin receptor into the normal HFF cell line, which results in an increase in particle endocytosis as compared to unmodified HFF cells. By designing and attaching a synthetic cyclic-RGD, selectivity between primary cancer cells (BT-549) and metastatic cancer cells (MDA-MB 435) is achieved with enhanced particle uptake by the metastatic cancer cell line. Incorporation of the hydrophobic drug Camptothecin into these two types of biomolecular-targeted nanoparticles causes an increase in mortality of the targeted cancer cells compared to that caused by both the free drug and nontargeted particles. These results demonstrate successful biomolecular-targeted hydrophobic drug delivery carriers that selectively target specific cancer cells and result in enhanced drug delivery and cell mortality. PMID:21595023

  14. Multifunctional mesoporous silica nanoparticles mediated co-delivery of paclitaxel and tetrandrine for overcoming multidrug resistance.


    Jia, Lejiao; Li, Zhenyu; Shen, Jingyi; Zheng, Dandan; Tian, Xiaona; Guo, Hejian; Chang, Ping


    The objective of the study is to fabricate multifunctional mesoporous silica nanoparticles for achieving co-delivery of conventional antitumor drug paclitaxel (PTX) and the multidrug resistance reversal agent tetrandrine (TET) expecting to overcome multidrug resistance of MCF-7/ADR cells. The nanoparticles were facile to prepare by self-assemble in situ drug loading approach. Namely, PTX and TET were solubilized in the cetyltrimethylammonium bromide (CTAB) micelles and simultaneously silica resources hydrolyze and condense to form nanoparticles. The obtained nanoparticles, denoted as PTX/TET-CTAB@MSN, exhibited pH-responsive release property with more easily released in the weak acidic environment. Studies on cellular uptake of nanoparticles demonstrated TET could markedly increase intracellular accumulation of nanoparticles. Furthermore, the PTX/TET-CTAB@MSN suppressed tumor cells growth more efficiently than only delivery of PTX (PTX-CTAB@MSN) or the free PTX. Moreover, the nanoparticle loading drugs with a PTX/TET molar ratio of 4.4:1 completely reversed the resistance of MCF-7/ADR cells to PTX and the resistance reversion index was 72.3. Mechanism research showed that both TET and CTAB could arrest MCF-7/ADR cells at G1 phase; and besides PTX arrested cells at G2 phase. This nanocarrier might have important potential in clinical implications for co-delivery of multiple drugs to overcome MDR. PMID:25956050

  15. Synthesis of multi-functional large pore mesoporous silica nanoparticles as gene carriers

    NASA Astrophysics Data System (ADS)

    Hartono, Sandy B.; Yu, Meihua; Gu, Wenyi; Yang, Jie; Strounina, Ekaterina; Wang, Xiaolin; Qiao, Shizhang; Yu, Chengzhong


    The development of functional nanocarriers that can enhance the cellular delivery of a variety of nucleic acid agents is important in many biomedical applications such as siRNA therapy. We report the synthesis of large pore mesoporous silica nanoparticles (LPMSN) loaded with iron oxide and covalently modified by polyethyleneimine (denoted PEI-Fe-LPMSN) as carriers for gene delivery. The LPMSN have a particle size of ˜200 nm and a large pore size of 11 nm. The large pore size is essential for the formation of large iron oxide nanoparticles to increase the magnetic properties and the adsorption capacity of siRNA molecules. The magnetic property facilitates the cellular uptake of nanocarriers under an external magnetic field. PEI is covalently grafted on the silica surface to enhance the nanocarriers’ affinity against siRNA molecules and to improve gene silencing performance. The PEI-Fe-LPMSN delivered siRNA-PLK1 effectively into osteosarcoma cancer cells, leading to cell viability inhibition of 80%, higher compared to the 50% reduction when the same dose of siRNA was delivered by a commercial product, oligofectamine.

  16. Investigation of Hexagonal Mesoporous Silica-Supported Composites for Trace Moisture Adsorption.


    Li, Li; Tang, Nian; Wang, Yaxue; Cen, Wanglai; Liu, Jie; Zhou, Yongyan


    Moisture control is an important part of effective maintenance program for gas-insulated switchgear (GIS). Herein, hexagonal mesoporous silica (HMS) materials were synthesized by adopting dodecylamine as a structure directing agent, which was then employed as a host for supporting polyethylenimine (PEI) without further calcinations or extraction treatment. The physicochemical properties of the silica support and composites were characterized, and the moisture adsorption capacity of these composites was determined. The reserved template agents resulted in a dramatic improvement in moisture adsorption amount. Among them, 50PEI/DHMS showed the highest adsorption value. The enhanced adsorption could be attributed to the generated hydrogen bonding between amino groups and H2O molecules and the improved diffusion of moisture into the bulk networks of PEI polymers due to its better spatial dispersion imposed by the long alkyl chains of template agents, which was confirmed by thermogravimetry results and hydrogen efficiency analysis. Moreover, the maintained terminal amino groups of templates could also function as active sites for moisture adsorption. The results herein imply that the PEI/DHMS composites could be appealing materials for capturing moisture in GIS. PMID:26577389

  17. Physical properties of ordered mesoporous SBA-15 silica as immunological adjuvant

    NASA Astrophysics Data System (ADS)

    Mariano-Neto, F.; Matos, J. R.; Cides da Silva, L. C.; Carvalho, L. V.; Scaramuzzi, K.; Sant'Anna, O. A.; Oliveira, C. P.; Fantini, M. C. A.


    This work reports a detailed analysis of the ordered mesoporous SBA-15 silica synthesis procedure that provides a matrix with mean pore diameter around 10 nm. The encapsulation of bovine serum albumin (BSA) by four different methods allowed the determination of the best imbibition condition, which is keeping the mixture under rest and solvent evaporation. Simulation of the in situ SAXS scattered intensity of the BSA release in potassium buffer solution, gastrointestinal fluids revealed a slow evolution of BSA content, independent of the media. Proton induced x-ray emission results obtained in calcined mouse organs revealed that silica is only present in the spleen after 35 days and is completely eliminated from all mouse organs after 10 weeks. Biological studies showed that Santa Barbara Amorphous-15 is an effective adjuvant when compared to the traditional Al(OH)3, and is non-toxic to mice, rats, dogs and even cells, such as macrophages and dendritic cells. Recent studies showed that the immunological response is improved by enhancing the inflammatory response and the recruitment of immune competent cells to the site of injection as by the oral route and, most importantly, by increasing the number of phagocytes of a particulate antigen by antigen presenting cells. This research is under the scope of the International Patent WO 07030901, IN248654,ZA2008/02277, KR 1089400, MX297263, JP5091863, CN101287491B.

  18. TiO{sub 2} supported on rod-like mesoporous silica SBA-15: Preparation, characterization and photocatalytic behaviour

    SciTech Connect

    Li, Yanjuan; Li, Nan; Tu, Jinchun; Li, Xiaotian; Wang, Beibei; Chi, Yue; Liu, Darui; Yang, Dianfan


    Highlights: Black-Right-Pointing-Pointer Rod-like SBA-15 and normal SBA-15 were used to prepare TiO{sub 2}/SBA-15 composites. Black-Right-Pointing-Pointer TiO{sub 2}/SBA-15 composites were studied as catalysts for methyl orange photodegradation. Black-Right-Pointing-Pointer TiO{sub 2}/Rod-SBA-15 exhibited higher photocatalytic activity than TiO{sub 2}/Nor-SBA-15. Black-Right-Pointing-Pointer The higher catalytic activity was a result of the controlled morphology of SBA-15. -- Abstract: TiO{sub 2} nanoparticles have been successfully incorporated in the pores of mesoporous silica SBA-15 with different morphologies by a wet impregnation method. The composites were characterized by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), inductively coupled plasma (ICP) emission spectroscopy, transmission electron microscopy (TEM), N{sub 2}-sorption and UV-Vis diffuse reflectance spectroscopy. The photodegradation of methyl orange (MO) was used to study their photocatalytic property. It is indicated that the morphology of SBA-15 had a great influence on the photocatalytic activity of the composites. When TiO{sub 2}/SBA-15 composite was prepared by loading TiO{sub 2} nanoparticles on uniform rod-like SBA-15 of 1 {mu}m length, it showed higher photocatalytic degradation rate than that on less regular but much larger SBA-15 support. This difference was rationalized in terms of the homogeneously distributed and shorter channels of rod-like SBA-15, which favored mass transport and improved the efficient utilization of the pore surface.

  19. A Magnetically Separable, Highly Stable Enzyme System Based on Nanocomposites of Enzymes and Magnetic Nanoparticles Shipped in Hierarchically Ordered, Mesocellular, Mesoporous Silica

    SciTech Connect

    Kim, Jungbae; Lee, Jinwoo; Na, Hyon Bin; Kim, Byoung Chan; Youn, Jongkyu; Kwak, Ja Hun; Moon, Karam; Lee, Eunwoong; Kim, Jaeyun; Park, Jongnam; Dohnalkova, Alice; Park, Hyun-Gyu; Gu, Man Bock; Chang, Ho Nam; Grate, Jay W.; Hyeon, Taeghwan


    Enzymes are versatile nanoscale biocatalysts, and find increasing applications in many areas, including organic synthesis[1-3] and bioremediation.[4-5] However, the application of enzymes is often hampered by the short catalytic lifetime of enzymes and by the difficulty in recovery and recycling. To solve these problems, there have been a lot of efforts to develop effective enzyme immobilization techniques. Recent advances in nanotechnology provide more diverse materials and approaches for enzyme immobilization. For example, mesoporous materials offer potential advantages as a host of enzymes due to their well-controlled porosity and large surface area for the immobilization of enzymes.[6,7] On the other hand, it has been demonstrated that enzymes attached on magnetic iron oxide nanoparticles can be easily recovered using a magnet and recycled for iterative uses.[8] In this paper, we report the development of magnetically-separable and highly-stable enzyme system by the combined use of two different kinds of nanostructured materials: magnetic nanoparticles and mesoporous silica.

  20. An Interface Coassembly in Biliquid Phase: Toward Core-Shell Magnetic Mesoporous Silica Microspheres with Tunable Pore Size.


    Yue, Qin; Li, Jialuo; Luo, Wei; Zhang, Yu; Elzatahry, Ahmed A; Wang, Xiqing; Wang, Chun; Li, Wei; Cheng, Xiaowei; Alghamdi, Abdulaziz; Abdullah, Aboubakr M; Deng, Yonghui; Zhao, Dongyuan


    Core-shell magnetic mesoporous silica microspheres (Magn-MSMs) with tunable large mesopores in the shell are highly desired in biocatalysis, magnetic bioseparation, and enrichment. In this study, a shearing assisted interface coassembly in n-hexane/water biliquid systems is developed to synthesize uniform Magn-MSMs with magnetic core and mesoporous silica shell for an efficient size-selective biocatalysis. The synthesis features the rational control over the electrostatic interaction among cationic surfactant molecules, silicate oligomers, and Fe3O4@RF microspheres (RF: resorcinol formaldehyde) in the presence of shearing-regulated solubilization of n-hexane in surfactant micelles. Through this multicomponent interface coassembly, surfactant-silica mesostructured composite has been uniformly deposited on the Fe3O4@RF microspheres, and core-shell Magn-MSMs are obtained after removing the surfactant and n-hexane. The obtained Magn-MSMs possess excellent water dispersibility, uniform diameter (600 nm), large and tunable perpendicular mesopores (5.0-9.0 nm), high surface area (498-623 m(2)/g), large pore volume (0.91-0.98 cm(3)/g), and high magnetization (34.5-37.1 emu/g). By utilization of their large and open mesopores, Magn-MSMs with a pore size of about 9.0 nm have been demonstrated to be able to immobilize a large bioenzyme (trypsin with size of 4.0 nm) with a high loading capacity of ∼97 μg/mg via chemically binding. Magn-MSMs with immobilized trypsin exhibit an excellent convenient and size selective enzymolysis of low molecular proteins in the mixture of proteins of different sizes and a good recycling performance by using the magnetic separability of the microspheres. PMID:26186087

  1. Nanostructure-loaded mesoporous silica for controlled release of coumarin derivatives: a novel testing of the hyperthermia effect.


    Al-Kady, Ahmed S; Gaber, M; Hussein, Mohamed M; Ebeid, El-Zeiny M


    The synthesis of three types of mesoporous materials is reported: pure mesoporous silica (MCM-41), a nanocomposite of mesoporous silica with hydroxyapatite (MCM-41-HA) and mesoporous silica/gold nanorods nanocomposite (MCM-41-GNRs). The mesoporous materials were characterized by X-ray diffraction, N(2) adsorption isotherms, FTIR spectroscopy, transmission electron microscopy, and scanning electron microscopy. The samples were loaded with coumarin thiourea derivatives (I-IV) having functional groups of varying sizes and the in vitro release assays were monitored, and the release behavior was investigated as a function of soaking time in simulated body fluid. Two release stages were obtained in MCM-41, MCM-41-HA and MCM-41-GNRs loaded samples with the early release stages accounting for about 30% of loaded derivatives. These early release stages are characterized by Higuchi rate constant values nearly twice the values associated with the second release stages. The influence of substituent size on the release rate constants was explained in terms of sorption sites and hydrogen bonding with silanol groups on silicates. The release of coumarin derivatives loaded on MCM-41, MCM-41-HA and MCM-41-GNRs occurs over remarkably long time of the order of about 260 h with faster release rates in loaded MCM-41 and MCM-41-GNRs samples compared with MCM-41-HA ones. The role of hyperthermia effect in enhancing release rates was investigated by subjecting loaded MCM-41-GNRs to near infrared (NIR) radiation at 800 nm. This would be of significance in targeted drug release using hyperthermia effect. Unlike hydroxyl apatite, loading MCM-41 with gold nanorods does not affect the release kinetics. Only when these samples are irradiated with NIR photons, does the release occur with enhanced rates. This property could be valuable in selected targeting of drugs. PMID:20974253

  2. Catalytic ozonation of sulfosalicylic acid over manganese oxide supported on mesoporous ceria.


    Xing, Shengtao; Lu, Xiaoyang; Liu, Jia; Zhu, Lin; Ma, Zichuan; Wu, Yinsu


    Manganese oxide supported on mesoporous ceria was prepared and used as catalyst for catalytic ozonation of sulfosalicylic acid (SA). Characterization results indicated that the manganese oxide was mostly incorporated into the pores of ceria. The synthesized catalyst exhibited high activity and stability for the mineralization of SA in aqueous solution by ozone, and more than 95% of total organic carbon was removed in 30 min under various conditions. Mechanism studies indicated that SA was mainly degraded by ozone molecules, and hydroxyl radical reaction played an important role for the degradation of its ozonation products (small molecular organic acids). The manganese oxide in the pores of CeO2 improved the adsorption of small molecular organic acids and the generation of hydroxyl radicals from ozone decomposition, resulting in high TOC removal efficiency. PMID:26344143

  3. Immune response to functionalized mesoporous silica nanoparticles for targeted drug delivery

    NASA Astrophysics Data System (ADS)

    Heidegger, Simon; Gößl, Dorothée; Schmidt, Alexandra; Niedermayer, Stefan; Argyo, Christian; Endres, Stefan; Bein, Thomas; Bourquin, Carole


    Multifunctional mesoporous silica nanoparticles (MSN) have attracted substantial attention with regard to their high potential for targeted drug delivery. For future clinical applications it is crucial to address safety concerns and understand the potential immunotoxicity of these nanoparticles. In this study, we assess the biocompatibility and functionality of multifunctional MSN in freshly isolated, primary murine immune cells. We show that the functionalized silica nanoparticles are rapidly and efficiently taken up into the endosomal compartment by specialized antigen-presenting cells such as dendritic cells. The silica nanoparticles showed a favorable toxicity profile and did not affect the viability of primary immune cells from the spleen in relevant concentrations. Cargo-free MSN induced only very low immune responses in primary cells as determined by surface expression of activation markers and release of pro-inflammatory cytokines such as Interleukin-6, -12 and -1β. In contrast, when surface-functionalized MSN with a pH-responsive polymer capping were loaded with an immune-activating drug, the synthetic Toll-like receptor 7 agonist R848, a strong immune response was provoked. We thus demonstrate that MSN represent an efficient drug delivery vehicle to primary immune cells that is both non-toxic and non-inflammagenic, which is a prerequisite for the use of these particles in biomedical applications.Multifunctional mesoporous silica nanoparticles (MSN) have attracted substantial attention with regard to their high potential for targeted drug delivery. For future clinical applications it is crucial to address safety concerns and understand the potential immunotoxicity of these nanoparticles. In this study, we assess the biocompatibility and functionality of multifunctional MSN in freshly isolated, primary murine immune cells. We show that the functionalized silica nanoparticles are rapidly and efficiently taken up into the endosomal compartment by specialized

  4. Designed synthesis of aptamer-immobilized magnetic mesoporous silica/Au nanocomposites for highly selective enrichment and detection of insulin.


    Xiong, Ya; Deng, Chunhui; Zhang, Xiangmin; Yang, Pengyuan


    We designed and synthesized aptamer-immobilized magnetic mesoporous silica/Au nanocomposites (MMANs) for highly selective detection of unlabeled insulin in complex biological media using MALDI-TOF MS. The aptamer was easily anchored onto the gold nanoparticles in the mesochannels of MMANs with high capacity for highly efficient and specific enrichment of insulin. With the benefit from the size-exclusion effect of the mesoporous silica shell with a narrow pore size distribution (∼2.9 nm), insulin could be selectively detected despite interference from seven untargeted proteins with different size dimensions. This method exhibited an excellent response for insulin in the range 2-1000 ng mL(-1). Moreover, good recoveries in the detection of insulin in 20-fold diluted human serum were achieved. We anticipate that this novel method could be extended to other biomarkers of interest and potentially applied in disease diagnostics. PMID:25854412

  5. Sub-1-micron mesoporous silica particles functionalized with cyclodextrin derivative for rapid enantioseparations on ultra-high pressure liquid chromatography.


    Ai, Feng; Li, Laisheng; Ng, Siu-Choon; Tan, Timothy Thatt Yang


    Mesoporous silica particles of relatively uniform sub-1-micron size (0.6-0.9 μm) were successfully prepared by a modified synthesis strategy and applied in chiral separation in an ultra-high pressure liquid chromatography system. These particles were prepared via a ternary surfactant system (Pluronic P123, F127 and hexadecyltrimethyl-ammonium bromide) and subsequently derivatized with perphenylcarbamoylated-β-cyclodextrin moieties. The mesoporous silica particles, despite their submicron size, enabled low back-pressure operation on an ultra-high pressure liquid chromatography system at a maximum flow rate of 2 ml/min. In addition, the particles possessed high surface area (480 m(2)/g) and thus afforded high cyclodextrin derivative loading (32 μmol/g), demonstrating rapid enantioseparation and good resolution of 6 basic and neutral racemates. PMID:21030027

  6. Layer-by-layer engineering fluorescent polyelectrolyte coated mesoporous silica nanoparticles as pH-sensitive nanocarriers for controlled release

    NASA Astrophysics Data System (ADS)

    Du, Pengcheng; Zhao, Xubo; Zeng, Jin; Guo, Jinshan; Liu, Peng


    Fluorescent core/shell composite has been fabricated by the layer-by-layer (LbL) assembly of the fluorescein isothiocyanate modified chitosan (CS-FITC) and sodium alginate (AL) onto the carboxyl modified mesoporous silica nanoparticles (MSN-COOH), followed by PEGylation. It exhibits stability in high salt-concentration media and the pH responsive fluorescent feature can be used for cell imaging. Furthermore, the modified MSN cores can enhance the DOX loading capacity and the multifunctional polyelectrolyte shell can adjust the drug release upon the media pH, showing a low leakage quantity at the neutral environment but significantly enhanced release at lower pH media mimicking the tumor environments. Therefore, the biocompatible fluorescent polyelectrolyte coated mesoporous silica nanoparticles (MSN-LBL-PEG) offer promise for tumor therapy.

  7. Aerosol-assisted controlled packing of silica nanocolloids: templateless synthesis of mesoporous silicates with structural tunability and complexity.


    Min, Kyungmin; Choi, Chang Hyuck; Kim, Myoung Yeob; Choi, Minkee


    A template-free synthesis method for mesoporous and macro-/mesoporous hierarchically porous silicates with remarkable structural tunability and complexity is presented. SiO2 nanocolloids having diameters of 3.0-29 nm were prepared as a primary building block by using extended Stöber synthesis, and they were subsequently assembled by an aerosol-assisted drying. The silica pore structure can be rationally controlled depending on the initial diameter of SiO2 colloids and the aerosol-assembly temperature that determines the packing density of SiO2 colloids (i.e., amounts of packing defects) in the resultant materials. The present method could produce mesoporous silica spheres with remarkable pore-structural tunability (291 < BET surface area <807 m(2) g(-1), 0.42 < pore volume <0.92 cm(3) g(-1), 3.1 < pore size <26 nm). Hierarchically porous materials can also be synthesized by the evaporation-induced phase separation of solvent medium during the aerosol-assisted assembly of SiO2 colloids. By adding aluminum and Pt precursors into the SiO2 colloid suspensions before the aerosol-assisted assembly, mesoporous aluminosilicates supporting uniform Pt nanoclusters (∼2 nm) can also be synthesized. This indicates that the synthesis strategy can be used for the direct synthesis of functional silicate materials. PMID:25517201

  8. Synthesis and characterization of pharmaceutical surfactant templated mesoporous silica: Its application to controlled delivery of duloxetine

    SciTech Connect

    Mani, Ganesh; Pushparaj, Hemalatha; Peng, Mei Mei; Muthiahpillai, Palanichamy; Udhumansha, Ubaidulla; Jang, Hyun Tae


    Graphical abstract: - Highlights: • Usefulness of dual pharmaceutical surfactants in silica synthesis was evaluated. • Effects of concentration of secondary template (Tween-40) were studied. • Effects of fixed solvothermal condition on mesostructure formation were studied. • Duloxetine drug loading capability was studied. • Sustained release of duloxetine was evaluated. - Abstract: A new group of mesoporous silica nanoparticles (MSNs) were synthesized using combination pharmaceutical surfactants, Triton X-100 and Tween-40 as template and loaded with duloxetine hydrochloride (DX), for improving the sustained release of DX and patterns with high drug loading. Agglomerated spherical silica MSNs were synthesized by sol–gel and solvothermal methods. The calcined and drug loaded MSNs were characterized using X-ray diffraction (XRD), Braunner–Emmett–Teller (BET), thermogravimetric analysis (TGA), Fourier-transform infrared (FT-IR) spectroscopy, scanning electron microscopy (SEM), differential scanning calorimetry (DSC), diffuse reflectance ultraviolet–visible (DRS-UV–vis) spectroscopy. MSNs with high surface area and pore volume were selected and studied for their DX loading and release. The selected MSNs can accommodate a maximum of 34% DX within it. About 90% was released at 200 h and hence, the synthesized MSNs were capable of engulfing DX and sustain its release. Further form the Ritger and Peppas, Higuchi model for mechanism drug release from all the MSN matrices follows anomalous transport or Non-Fickian diffusion with the ‘r’ and ‘n’ value 0.9 and 0.45 < n < 1, respectively. So, from this study it could be concluded that the MSNs synthesized using pharmaceutical templates were better choice of reservoir for the controlled delivery of drug which requires sustained release.

  9. Templated synthesis of monodisperse mesoporous maghemite/silica microspheres for magnetic separation of genomic DNA

    NASA Astrophysics Data System (ADS)

    Chen, Feng; Shi, Ruobing; Xue, Yun; Chen, Lei; Wan, Qian-Hong


    A novel method is described for the preparation of superparamagnetic mesoporous maghemite (γ-Fe 2O 3)/silica (SiO 2) composite microspheres to allow rapid magnetic separation of DNA from biological samples. With magnetite (Fe 3O 4) and silica nanoparticles as starting materials, such microspheres were synthesized by the following two consecutive steps: (1) formation of monodispersed organic/inorganic hybrid microspheres through urea-formaldedyde (UF) polymerization and (2) removal of the organic template and phase transformation of Fe 3O 4 to γ-Fe 2O 3 by calcination at elevated temperatures. The as-synthesized particles obtained by heating at temperature 300 °C feature spherical shape and uniform particle size ( dparticle=1.72 μm), high saturation magnetization ( Ms=17.22 emu/g), superparamagnetism ( Mr/ Ms=0.023), high surface area ( SBET=240 m 2/g), and mesoporosity ( dpore=6.62 nm). The composite microsphere consists of interlocked amorphous SiO 2 nanoparticles, in which cubic γ-Fe 2O 3 nanocrystals are homogeneously dispersed and thermally stable against γ- to α-phase transformation at temperatures up to 600 °C. With the exposed iron oxide nanoparticles coated with a thin layer of silica shell, the magnetic microspheres were used as a solid-phase adsorbent for rapid extraction of genomic DNA from plant samples. The results show that the DNA templates isolated from pea and green pepper displayed single bands with molecular weights greater than 8 kb and A260/ A280 values of 1.60-1.72. The PCR amplification of a fragment encoding the endogenous chloroplast ndhB gene confirmed that the DNA templates obtained were inhibitor-free and amenable to sensitive amplification-based DNA technologies.

  10. Hydrophobic polydimethylsiloxane (PDMS) coating of mesoporous silica and its use as a preconcentrating agent of gas analytes.


    Park, Eun Ji; Cho, Youn Kyoung; Kim, Dae Han; Jeong, Myung-Geun; Kim, Yong Ho; Kim, Young Dok


    Mesoporous silica with mean pore size of ∼14 nm was coated by polydimethylsiloxane (PDMS) using a thermal deposition method. We showed that the inner walls of pores larger than ∼8 nm can be coated by thin layers of PDMS, and the surfaces consisting of PDMS-coated silica were superhydrophobic, with water contact angles close to 170°. We used the PDMS-coated silica as adsorbents of various gas-phase chemical warfare agent (CWA) simulants. PDMS-coated silica allowed molecular desorption of various CWA simulants even after exposure under highly humid conditions and, therefore, is applicable as an agent for the preconcentration of gas-phase analytes to enhance the sensitivities of various sensors. PMID:25102134

  11. Mesoporous silica/ionic liquid quasi-solid-state electrolytes and their application in lithium metal batteries

    NASA Astrophysics Data System (ADS)

    Li, Xiaowei; Zhang, Zhengxi; Yin, Kun; Yang, Li; Tachibana, Kazuhiro; Hirano, Shin-ichi


    In this work, the ordered mesoporous silica, SBA-15, is chosen as the matrix for the first time to prepare quasi-solid-state electrolytes (QSSEs) with an ionic liquid, LiTFSI salt and PVdF-HFP. The as-obtained QSSEs are evaluated by electrochemical methods. Lithium metal batteries containing these QSSEs exhibit high discharge capacity and good cycle performance at room temperature, indicating successful battery operation.

  12. Facile large-scale synthesis of brain-like mesoporous silica nanocomposites via a selective etching process.


    Chen, Yu; Wang, Qihua; Wang, Tingmei


    The core-shell structured mesoporous silica nanomaterials (MSNs) are experiencing rapid development in many applications such as heterogeneous catalysis, bio-imaging and drug delivery wherein a large pore volume is desirable. We develop a one-pot method for large-scale synthesis of brain-like mesoporous silica nanocomposites based on the reasonable change of the intrinsic nature of the -Si-O-Si- framework of silica nanoparticles together with a selective etching strategy. The as-synthesized products show good monodispersion and a large pore volume of 1.0 cm(3) g(-1). The novelty of this approach lies in the use of an inorganic-organic hybrid layer to assist the creation of large-pore morphology on the outermost shell thereby promoting efficient mass transfer or storage. Importantly, the method is reliable and grams of products can be easily prepared. The morphology on the outermost silica shell can be controlled by simply adjusting the VTES-to-TEOS molar ratio (VTES: triethoxyvinylsilane, TEOS: tetraethyl orthosilicate) as well as the etching time. The as-synthesized products exhibit fluorescence performance by incorporating rhodamine B isothiocyanate (RITC) covalently into the inner silica walls, which provide potential application in bioimaging. We also demonstrate the applications of as-synthesized large-pore structured nanocomposites in drug delivery systems and stimuli-responsive nanoreactors for heterogeneous catalysis. PMID:26394819

  13. Multifunctional Mesoporous and Nanostructured Catalysts: Exploring Novel Synthetic Methods, Properties and Applications

    NASA Astrophysics Data System (ADS)

    Das, Sayantani

    Novel multifunctional mesoporous and nanostructured catalysts containing two or more different types of judiciously chosen functional / catalytic groups were developed and their unique and cooperative catalytic activities in various useful organic reactions were explored. First, mesoporous silica material containing tertiary amine/silanol groups was synthesized by simple postgrafting synthetic method. The material was found to exhibit efficient cooperative acid/base bifunctional catalytic activity towards Michael addition reactions between trans-β-nitrostyrene and various active methylene compounds such as malononitrile, acetylacetone and dimethylmalonate. Besides serving as a solid base catalyst, such organoamine-functionalized mesoporous silica materials can be utilized as effective support materials for catalytically active organometallic complexes. This was demonstrated by immobilizing ethylenediamine onto mesoporous silica via postgrafting synthetic method and then complexing Fe(III) onto the supported ethylenediamine groups. This yielded a bifunctional Fe(III)/silanol-based heterogeneous catalyst that showed efficient catalytic activity towards epoxide ring opening reactions. Next, the potential of these types of organic-functionalized mesoporous silicas for immobilization of metallic nanoparticle catalysts was investigated. Specifically, mercaptopropyl-functionalized mesoporous silica was synthesized and the material was then supported with ultrasmall Aun nanoclusters. The catalytic properties of the resulting materials in styrene oxidation were studied. Furthermore, the effect of the removal of the thiol groups from around the surfaces of the gold nanoclusters on catalytic activities of the mesoporous silica-supported nanoparticles was investigated. As mesoporous silica have some limitations of crowding in their pores and poor mass transport for reactants when they are functionalized with larger groups such as nanoparticles, a new strategy was developed

  14. Multifunctional Gold-Mesoporous Silica Nanocomposites for Enhanced Two-Photon Imaging and Therapy of Cancer Cells

    PubMed Central

    Croissant, Jonas G.; Qi, Christian; Maynadier, Marie; Cattoën, Xavier; Wong Chi Man, Michel; Raehm, Laurence; Mongin, Olivier; Blanchard-Desce, Mireille; Garcia, Marcel; Gary-Bobo, Magali; Durand, Jean-Olivier


    Three dimensional sub-micron resolution has made two-photon nanomedicine a very promising medical tool for cancer treatment since current techniques cause significant side effects for lack of spatial selectivity. Two-photon-excited (TPE) photodynamic therapy (PDT) has been achieved via mesoporous nanoscaffolds, but the efficiency of the treatment could still be improved. Herein, we demonstrate the enhancement of the treatment efficiency via gold-mesoporous organosilica nanocomposites for TPE-PDT in cancer cells when compared to mesoporous organosilica particles. We performed the first comparative study of the influence of the shape and spatial position of gold nanoparticles (AuNPs) with mesoporous silica nanoparticles (MSN) functionalized with thiol groups and doped with a two-photon electron donor (2PS). The resulting multifunctional nanocarriers displayed TPE-fluorescence and were imaged inside cells. Furthermore, mesoporous organosilica NPs decorated gold nanospheres (AuNSs) induced 63 percent of selective killing on MCF-7 breast cancer cells. This study thus provides insights for the design of more effective multifunctional two-photon-sensitive nanocomposites via AuNPs for biomedical applications. PMID:26870736

  15. o-Vanillin functionalized mesoporous silica - coated magnetite nanoparticles for efficient removal of Pb(II) from water

    NASA Astrophysics Data System (ADS)

    Culita, Daniela C.; Simonescu, Claudia Maria; Patescu, Rodica-Elena; Dragne, Mioara; Stanica, Nicolae; Oprea, Ovidiu


    o-Vanillin functionalized mesoporous silica - coated magnetite (Fe3O4@MCM-41-N-oVan) was synthesized and fully characterized by X-ray diffraction, Fourier transform infrared spectroscopy, transmission electron microscopy, N2 adsorption-desorption technique and magnetic measurements. The capacity of Fe3O4@MCM-41-N-oVan to adsorb Pb(II) from aqueous solutions was evaluated in comparison with raw mesoporous silica - coated magnetite (Fe3O4@MCM-41) and amino - modified mesoporous silica coated magnetite (Fe3O4@MCM-41-NH2). The effect of adsorption process parameters such us pH, contact time, initial Pb(II) concentration was also investigated. The adsorption data were successfully fitted with the Langmuir model, exhibiting a maximum adsorption capacity of 155.71 mg/g at pH=4.4 and T=298 K. The results revealed that the adsorption rate was very high at the beginning of the adsorption process, 80-90% of the total amount of Pb(II) being removed within the first 60 min, depending on the initial concentration. The results of the present work suggest that Fe3O4@MCM-41-N-oVan is a suitable candidate for the separation of Pb(II) from contaminated water.

  16. Mesoporous silica sub-micron spheres as drug dissolution enhancers: Influence of drug and matrix chemistry on functionality and stability.


    Brigo, Laura; Scomparin, Elisa; Galuppo, Marco; Capurso, Giovanni; Ferlin, Maria Grazia; Bello, Valentina; Realdon, Nicola; Brusatin, Giovanna; Morpurgo, Margherita


    Mesoporous silica particles prepared through a simplified Stöber method and low temperature solvent promoted surfactant removal are evaluated as dissolution enhancers for poorly soluble compounds, using a powerful anticancer agent belonging to pyrroloquinolinones as a model for anticancer oral therapy, and anti-inflammatory ibuprofen as a reference compound. Mesoporous powders composed of either pure silica or silica modified with aminopropyl residues are produced. The influence of material composition and drug chemical properties on drug loading capability and dissolution enhancement are studied. The two types of particles display similar size, surface area, porosity, erodibility, drug loading capability and stability. An up to 50% w/w drug loading is reached, showing correlation between drug concentration in adsorption medium and content in the final powder. Upon immersion in simulating body fluids, immediate drug dissolution occurred, allowing acceptor solutions to reach concentrations equal to or greater than drug saturation limits. The matrix composition influenced drug solution maximal concentration, complementing the dissolution enhancement generated by a mesoporous structure. This effect was found to depend on both matrix and drug chemical properties allowing us to hypothesise general prediction behaviour rules. PMID:26652411

  17. Core-shell microcapsules of solid lipid nanoparticles and mesoporous silica for enhanced oral delivery of curcumin.


    Kim, Sanghoon; Diab, Roudayna; Joubert, Olivier; Canilho, Nadia; Pasc, Andreea


    Newly designed microcapsules (MC) combining a core of solid lipid nanoparticle (SLN) and a mesoporous silica shell have been developed and explored as oral delivery system of curcumin (CU). CU-loaded MC (MC-CU) are 2μm sized and have a mesoporous silica shell of 0.3μm thickness with a wormlike structure as characterized by small angle X-ray scattering (SAXS), nitrogen adsorption/desorption and transmission electron microscopy (TEM) measurements. It was found that SLN acts as reservoir of curcumin while the mesoporous shell insures the protection and the controlled release of the drug. MC-CU displayed a pH-dependent in vitro release profile with marked drug retention at pH 2.8. Neutral red uptake assay together with confocal laser scanning microscopy (CLSM) showed a good cell tolerance to MC-CU at relatively high concentration of inert materials. Besides, the cell-uptake test revealed that fluorescent-MC were well internalized into Caco-2 cells, confirming the possibility to use MC for gut cells targeting. These findings suggest that organic core-silica shell microcapsules are promising drug delivery systems with enhanced bioavailability for poorly soluble drugs. PMID:26752213

  18. Drug loaded and ethylcellulose coated mesoporous silica for controlled drug release prepared using a pilot scale fluid bed system.


    Hacene, Youcef Chakib; Singh, Abhishek; Van den Mooter, Guy


    The goal of this study was to test the feasibility to load non-ordered, non-spherical mesoporous silica with the model drug paracetamol, and subsequently coat the loaded particles using one single pilot scale fluid bed system equipped with a Wurster insert. Mesoporous silica particles (Davisil(®)) with a size ranging from 310 to 500μm and an average pore diameter of 15nm were loaded with paracetamol to 18.8% drug content. Subsequently, loaded cores were coated with ethylcellulose to obtain controlled drug release. Coating processing variables were varied following a full factorial design and their effect on drug release was assessed. Increasing coating solution feed rate and decreasing fluidizing air temperature were found to increase drug release rates. Increasing pore former level and decreasing coating level were found to increase drug release rates. The release medium's osmolality was varied using different sodium chloride concentrations, which was found to affect drug release rates. The results of this study clearly indicate the potential of non-ordered, non-spherical mesoporous silica as a reservoir carrier for the controlled release of drugs. Although non-spherical, we were able to reproducibly coat this carrier using a bottom spray fluid bed system. However, a major hurdle that needs to be tackled is the attrition the material suffers from during fluid bed processing. PMID:27107901

  19. Microwave-induced synthesis of highly dispersed gold nanoparticles within the pore channels of mesoporous silica

    SciTech Connect

    Gu Jinlou; Fan Wei; Shimojima, Atsushi; Okubo, Tatsuya


    Highly dispersed gold nanoparticles have been incorporated into the pore channels of SBA-15 mesoporous silica through a newly developed strategy assisted by microwave radiation (MR). The sizes of gold are effectively controlled attributed to the rapid and homogeneous nucleation, simultaneous propagation and termination of gold precursor by MR. Diol moieties with high dielectric and dielectric loss constants, and hence a high microwave activation, were firstly introduced to the pore channels of SBA-15 by a simple addition reaction between amino group and glycidiol and subsequently served as the reduction centers for gold nanoparticles. Extraction of the entrapped gold from the nanocomposite resulted in milligram quantities of gold nanoparticles with low dispersity. The successful assembly process of diol groups and formation of gold nanoparticles were monitored and tracked by solid-state NMR and UV-vis measurements. Characterization by small angle X-ray diffraction (XRD) and transmission electron microscopy (TEM) indicated that the incorporation of gold nanoparticles would not breakup the structural integrity and long-range periodicity of SBA-15. The gold nanoparticles had a narrow size distribution with diameters in the size range of 5-10 nm through TEM observation. The average particles size is 7.9 nm via calculation by the Scherrer formula and TEM measurements. Nitrogen adsorption and desorption isotherms gave further evidence that the employed method was efficient and gold nanoparticles were successfully incorporated into the pore channels of SBA-15. - Graphical abstract: A facile and novel strategy has been developed to incorporate gold nanoparticles into the pore channels of mesoporous SBA-15 assisted by microwave radiation (MR) with mild reaction condition and rapid reaction speed. Due to the rapid and homogeneous nucleation, simultaneous propagation and termination by MR, the size of gold nanoparticles are effectively controlled.

  20. Understanding the synthesis of mesoporous silica particles by evaporation induced self assembly

    NASA Astrophysics Data System (ADS)

    Rathod, Shailendra B.


    Evaporation-induced self-assembly (EISA) of amphiphilic molecules within aerosol droplets is an attractive method for synthesis of mesoporous silica particles. The aim of this research was to demonstrate synthetic methodologies to develop novel particle architectures using this technique, and to understand the influence of the competing dynamics within an evaporating droplet undergoing EISA on the particle morphology and mesostructure. Experiments were conducted to control particle characteristics. Particle size and distribution was varied by varying the size and distribution of starting droplets. The compressed gas atomizer, TSI 3076, gave a roughly micron-sized droplets with a polydisperse population, whereas the vibrating orifice aerosol generator (VOAG), TSI 3450, gave a highly monodisperse droplet population when orifices of diameters 10 mum and 20 mum were used. The mesopore size and mesostructure ordering were varied by employing amphiphiles of different geometry and by the use of 1,2,3-trimethylbenzene, a pore-swelling agent. The extent of ordering was influenced by factors that govern the rates of reactions of the silica precursors relative to the rates of amphiphile self-assembly. These factors included acid concentration, the alkyl group in the tetraalkoxysilane precursor, the time for which the sol was aged before droplet generation, and CTAB/Si ratio in the starting sol. Experiments and simulation studies were carried out for particles made using CTAB as the templating agent and TMB as a pore-swelling agent. Analysis of these experiments was used to get insight into the three main dynamic processes occurring inside these droplets: evaporation of the volatile species, amphiphile self-assembly and phase transformation, and hydrolysis and condensation reactions of the silica precursor species. Pore swelling was observed for particles made using the VOAG. Particles made using the 10 mum orifice retained their hexagonal mesostructure upon addition of TMB in

  1. Synthesis and catalytic properties of highly ordered mesostructured silica-pillared α-zirconium phosphate: Self-assembly via interlayered templating method

    NASA Astrophysics Data System (ADS)

    Mao, Huihui; Lu, Xinhao; Li, Mingshi; Yang, Jihe; Li, Baoshan


    We present a facile organic surfactant templating self-assembly method with suitable cationic surfactant method for silica-pillared α-ZrP with ordered interlayered mesoporous structure. The synthetic silica-pillared α-ZrP powders with interlayer spaces and interlayer pore sizes ranging from 3.0 to 3.7 nm and 1.4 to 2.1 nm by varying the molar ratio of surfactant/α-ZrP during self-assembly process. The structure and properties of the silica-pillared α-ZrP powders were characterized by using XRD, SEM/TEM, FT-IR, TPD and N2 adsorption-desorption isotherms systematically. A bilayers arrangement-molecular micelles1 phase transformation formation mechanism was proposed for the molecular assembly. The acylation reaction of fatty acid methyl esters (methyl stearate) with ethanolamine to form monoethanolamides was chosen as a probe reaction to evaluate the catalytic activity of the resulting microspherical silica-pillared α-ZrP materials, which showed high activity, with about 92.9% methyl stearate conversion at 393 K for 16 h. The enhanced performance in the reaction is determined by the large surface area, ordered pore size and the increased number of acidic sites in the silica-pillared α-ZrP powders.

  2. Cytotoxicity of various types of gold-mesoporous silica nanoparticles in human breast cancer cells

    PubMed Central

    Liu, Guomu; Li, Qiongshu; Ni, Weihua; Zhang, Nannan; Zheng, Xiao; Wang, Yingshuai; Shao, Dan; Tai, Guixiang


    Recently, gold nanoparticles (AuNPs) have shown promising biological applications due to their unique electronic and optical properties. However, the potential toxicity of AuNPs remains a major hurdle that impedes their use in clinical settings. Mesoporous silica is very suitable for the use as a coating material for AuNPs and might not only reduce the cytotoxicity of cetyltrimethylammonium bromide-coated AuNPs but might also facilitate the loading and delivery of drugs. Herein, three types of rod-like gold-mesoporous silica nanoparticles (termed bare AuNPs, core–shell Au@mSiO2NPs, and Janus Au@mSiO2NPs) were specially designed, and the effects of these AuNPs on cellular uptake, toxic behavior, and mechanism were then systematically studied. Our results indicate that bare AuNPs exerted higher toxicity than the Au@mSiO2NPs and that Janus Au@mSiO2NPs exhibited the lowest toxicity in human breast cancer MCF-7 cells, consistent with the endocytosis capacity of the nanoparticles, which followed the order, bare AuNPs > core–shell Au@mSiO2NPs > Janus Au@mSiO2NPs. More importantly, the AuNPs-induced apoptosis of MCF-7 cells exhibited features that were characteristic of intracellular reactive oxygen species (ROS) generation, activation of c-Jun-N-terminal kinase (JNK) phosphorylation, an enhanced Bax-to-Bcl-2 ratio, and loss of the mitochondrial membrane potential. Simultaneously, cytochrome c was released from mitochondria, and the caspase-3/9 cascade was activated. Moreover, both ROS scavenger (N-acetylcysteine) and JNK inhibitor (SP600125) partly blocked the induction of apoptosis in all AuNPs-treated cells. Taken together, these findings suggest that all AuNPs induce apoptosis through the ROS-/JNK-mediated mitochondrial pathway. Thus, Janus Au@mSiO2NPs exhibit the potential for applications in biomedicine, thus aiding the clinical translation of AuNPs. PMID:26491285

  3. Self-propelled micromotors based on Au-mesoporous silica nanorods

    NASA Astrophysics Data System (ADS)

    Wang, Ying-Shuai; Xia, Hong; Lv, Chao; Wang, Lei; Dong, Wen-Fei; Feng, Jing; Sun, Hong-Bo


    Here, a chemical powered micromotor from the assembly of Au-SiO2 nanorods is presented. This new micromotor can be propelled efficiently by hydrogen bubbles generated from a hydrolysis reaction of aqueous NaBH4 and KBH4 and by oxygen bubbles produced by decomposition of H2O2. The monodisperse Au nanoparticles in mesoporous silica particles could catalyze the decomposition of two different kinds of fuels and produce bubbles. High speeds of 80 μm s-1 and recycles of more than 30 times are achieved in both NaBH4 and H2O2 media. Locomotion and rolling forms of movement were found. The locomotion forms can be obtained in a larger proportion by patterning the Au-SiO2 nanorods and a PDMS membrane. These micromotors that use multiple fuel sources to power them offer a broader scope of preparation and show considerable promise for diverse applications of nanomotors in different chemical environments.Here, a chemical powered micromotor from the assembly of Au-SiO2 nanorods is presented. This new micromotor can be propelled efficiently by hydrogen bubbles generated from a hydrolysis reaction of aqueous NaBH4 and KBH4 and by oxygen bubbles produced by decomposition of H2O2. The monodisperse Au nanoparticles in mesoporous silica particles could catalyze the decomposition of two different kinds of fuels and produce bubbles. High speeds of 80 μm s-1 and recycles of more than 30 times are achieved in both NaBH4 and H2O2 media. Locomotion and rolling forms of movement were found. The locomotion forms can be obtained in a larger proportion by patterning the Au-SiO2 nanorods and a PDMS membrane. These micromotors that use multiple fuel sources to power them offer a broader scope of preparation and show considerable promise for diverse applications of nanomotors in different chemical environments. Electronic supplementary information (ESI) available: More electronic microscopy graphs, UV-Vis spectra and N2 adsorption isotherms. See DOI: 10.1039/c5nr02545a

  4. Targeted delivery of doxorubicin to mitochondria using mesoporous silica nanoparticle nanocarriers

    NASA Astrophysics Data System (ADS)

    Qu, Qiuyu; Ma, Xing; Zhao, Yanli


    A lot of investigations have been conducted using mesoporous silica nanoparticles (MSNPs) functionalized with different targeting ligands in order to deliver various hydrophobic and hydrophilic drugs to targeted cancer cells. However, the utilization of MSNPs to deliver drug molecules to targeted subcellular organelles has been rarely reported. In this work, we applied targeting ligand-conjugated MSNPs with an average diameter of 80 nm to deliver the anticancer drug doxorubicin (DOX) to mitochondria. Triphenoylphosphonium (TPP) was functionalized on MSNPs as a mitochondria targeting ligand. Mitochondria targeting efficiency was demonstrated in HeLa cells by a co-localization study of mitochondria and functionalized MSNPs as well as by fluorescence analysis in isolated mitochondria. In addition, enhanced cancer cell killing efficacy was achieved when using DOX-loaded and TPP-functionalized MSNPs for mitochondria-targeted delivery. Lowered adenosine triphosphate (ATP) production and decreased mitochondrial membrane potential were observed, demonstrating the mitochondria dysfunction caused by delivered DOX. The positive results indicate promising application potential of MSNPs in targeted subcellular drug delivery.A lot of investigations have been conducted using mesoporous silica nanoparticles (MSNPs) functionalized with different targeting ligands in order to deliver various hydrophobic and hydrophilic drugs to targeted cancer cells. However, the utilization of MSNPs to deliver drug molecules to targeted subcellular organelles has been rarely reported. In this work, we applied targeting ligand-conjugated MSNPs with an average diameter of 80 nm to deliver the anticancer drug doxorubicin (DOX) to mitochondria. Triphenoylphosphonium (TPP) was functionalized on MSNPs as a mitochondria targeting ligand. Mitochondria targeting efficiency was demonstrated in HeLa cells by a co-localization study of mitochondria and functionalized MSNPs as well as by fluorescence analysis

  5. Biosafety evaluations of well-dispersed mesoporous silica nanoparticles: towards in vivo-relevant conditions

    NASA Astrophysics Data System (ADS)

    Liu, Tsang-Pai; Wu, Si-Han; Chen, Yi-Ping; Chou, Chih-Ming; Chen, Chien-Tsu


    This study aimed to investigate how mesoporous silica nanoparticles (MSNs), especially focussing on their surface functional groups, interacted with Raw 264.7 macrophages, as well as with zebrafish embryos. Upon introducing nanoparticles into a biological milieu, adsorption of proteins and biomolecules onto the nanoparticle surface usually progresses rapidly. Nanoparticles bound with proteins can result in physiological and pathological changes, but the mechanisms remain to be elucidated. In order to evaluate how protein corona affected MSNs and the subsequent cellular immune responses, we experimented in both serum and serum-deprived conditions. Our findings indicated that the level of p-p38 was significantly elevated by the positively charged MSNs, whereas negatively charged MSNs resulted in marked ROS production. Most significantly, our experiments demonstrated that the presence of protein efficiently mitigated the potential nano-hazard. On the other hand, strongly positively charged MSNs caused 94% of the zebrafish embryos to die. In that case, the toxicity caused by the quaternary ammonium ligands on the surface of those nanoparticles was exerted in a dose-dependent manner. In summary, these fundamental studies here provide valuable insights into the design of better biocompatible nanomaterials in the future.This study aimed to investigate how mesoporous silica nanoparticles (MSNs), especially focussing on their surface functional groups, interacted with Raw 264.7 macrophages, as well as with zebrafish embryos. Upon introducing nanoparticles into a biological milieu, adsorption of proteins and biomolecules onto the nanoparticle surface usually progresses rapidly. Nanoparticles bound with proteins can result in physiological and pathological changes, but the mechanisms remain to be elucidated. In order to evaluate how protein corona affected MSNs and the subsequent cellular immune responses, we experimented in both serum and serum-deprived conditions. Our

  6. Spectroscopic Characterization of Structural Changes in Membrane Scaffold Proteins Entrapped within Mesoporous Silica Gel Monoliths.


    Zeno, Wade F; Hilt, Silvia; Risbud, Subhash H; Voss, John C; Longo, Marjorie L


    The changes in the orientation and conformation of three different membrane scaffold proteins (MSPs) upon entrapment in sol-gel-derived mesoporous silica monoliths were investigated. MSPs were examined in either a lipid-free or a lipid-bound conformation, where the proteins were associated with lipids to form nanolipoprotein particles (NLPs). NLPs are water-soluble, disk-shaped patches of a lipid bilayer that have amphiphilic MSPs shielding the hydrophobic lipid tails. The NLPs in this work had an average thickness of 5 nm and diameters of 9.2, 9.7, and 14.8 nm. We have previously demonstrated that NLPs are more suitable lipid-based structures for silica gel entrapment than liposomes because of their size compatibility with the mesoporous network (2-50 nm) and minimally altered structure after encapsulation. Here we further elaborate on that work by using a variety of spectroscopic techniques to elucidate whether or not different MSPs maintain their protein-lipid interactions after encapsulation. Fluorescence spectroscopy and quenching of the tryptophan residues with acrylamide, 5-DOXYL-stearic acid, and 16-DOXYL-stearic acid were used to determine the MSP orientation. We also utilized fluorescence anisotropy of tryptophans to measure the relative size of the NLPs and MSP aggregates after entrapment. Finally, circular dichroism spectroscopy was used to examine the secondary structure of the MSPs. Our results showed that, after entrapment, all of the lipid-bound MSPs maintained orientations that were minimally changed and indicative of association with lipids in NLPs. The tryptophan residues appeared to remain buried within the hydrophobic core of the lipid tails in the NLPs and appropriately spaced from the bilayer center. Also, after entrapment, lipid-bound MSPs maintained a high degree of α-helical content, a secondary structure associated with protein-lipid interactions. These findings demonstrate that NLPs are capable of serving as viable hosts for functional

  7. Synthesis, characterization, and catalytic properties of Ti-containing SBA-15 mesoporous materials

    NASA Astrophysics Data System (ADS)

    Dang, Phuong T.; Le, Hy G.; Hoang, Duc V.; Hoang, Yen; Dinh, Thang C.; Bui, Linh H.; Tran, Hoa T. K.; Nguyen, Phu H.; Vu, Tuan A.


    Titanium-containing SBA-15 mesoporous materials with Si/Ti molar ratios of 25, 50 and 100 (Ti-SBA-15) were successfully prepared by direct synthesized method using P123 as surfactant. The samples were characterized by XRD, BET, TEM and UV-Vis. It revealed at low Ti-loading (Si/Ti of 50-100), titanium was completely incorporated into SBA-15 framework, whereas at high Ti-loading (Si/Ti of 25) titanium was partially incorporated into SBA-15 framework, one part of Ti existed as extra-framework Ti (anatase phase). For comparison, Ti impregnated on Si-SBA-15 (Ti/SBA-15) was also prepared by postsynthesis method. In (*)this case, titanium was well dispersed onto the surface of SBA-15. The catalytic activities of Ti-SBA-15 with different Ti-content and Ti/SBA-15 samples were tested in the photocatalytic oxidation of red-phenol and in the photocatalytic reduction of Cr(VI) to Cr(III). The catalytic results showed that both the Ti-SBA-15 and Ti/SBA-15 solids are also the good catalysts for total photooxidation of red phenol. Especially, the tetrahedral coordinated titanium can oxidize red phenol much deeper than well dispersed titanium particles does. For photocatalytic reduction, the activities mainly depend on the number of Ti, not the state of Ti.

  8. Mesoporous silica nanoparticles as a breast cancer targeting contrast agent for ultrasound imaging

    NASA Astrophysics Data System (ADS)

    Milgroom, Andrew Carson

    Current clinical use of ultrasound for breast cancer diagnostics is strictly limited to a role as a supplementary detection method to other modalities, such as mammography or MRI. A major reason for ultrasound’s role as a secondary method is its inability to discern between cancerous and non-cancerous bodies of similar density, like dense calcifications or benign fibroadenomas. Its detection capabilities are further diminished by the variable density of the surrounding breast tissue with the progression of age. Preliminary studies suggest that mesoporous silica nanoparticles (MSNs) are a good candidate as an in situ contrast agent for ultrasound. By tagging the silica particle surface with the cancer-targeting antibody trastuzumab (Herceptin), suspect regions of interest can be better identified in real time with standard ultrasound equipment. Once the silica-antibody conjugate is injected into the bloodstream and enters the cancerous growth’s vasculature, the antibody arm will bind to HER2, a cell surface receptor known to be dysfunctional or overexpressed in certain types of breast cancer. As more particles aggregate at the cell surface, backscatter of the ultrasonic waves increases as a result of the higher porous silica concentration. This translates to an increased contrast around the lesion boundary. Tumor detection through ultrasound contrast enhancement provides a tremendous advantage over current cancer diagnostics because is it significantly cheaper and can be monitored in real time. Characterization of MCM-41 type MSNs suggests that these particles have sufficient stability and particle size distribution to penetrate through fenestrated tumor vasculature and accumulate in HER2+ breast cancer cells through the enhanced permeation and retention (EPR) effect. A study of acoustic properties showed that particle concentration is linearly correlated to image contrast in clinical frequency-range ultrasound, although less pronounced than typical microbubble

  9. Biomimetic Mn-Catalases Based on Dimeric Manganese Complexes in Mesoporous Silica for Potential Antioxidant Agent.


    Escriche-Tur, Luis; Corbella, Montserrat; Font-Bardia, Mercè; Castro, Isabel; Bonneviot, Laurent; Albela, Belén


    Two new structural and functional models of the Mn-catalase with formula [{Mn(III)(bpy)(H2O)}(μ-2-MeOC6H4CO2)2(μ-O){Mn(III)(bpy)(X)}]X, where X = NO3 (1) and ClO4 (2) and bpy = 2,2'-bipyridine, were synthesized and characterized by X-ray diffraction. In both cases, a water molecule and an X ion occupy the monodentate positions. The magnetic properties of these compounds reveal a weak antiferromagnetic behavior (2J = -2.2 cm(-1) for 1 and -0.7 cm(-1) for 2, using the spin Hamiltonian H = -2J S1·S2) and negative zero-field splitting parameter DMn (-4.6 cm(-1) and -3.0 cm(-1) for 1 and 2, respectively). This fact, together with the nearly orthogonal orientation of the Jahn-Teller axes of the Mn(III) ions explain the unusual shape of χMT versus T plot at low temperature. Compound 1 presents a better catalase activity than 2 in CH3CN-H2O media, probably due to a beneficial interaction of the NO3(-) ion with the Mn complex in solution. These compounds were successfully inserted inside two-dimensional hexagonal mesoporous silica (MCM-41 type) leading to the same hybrid material ([Mn2O]@SiO2), without the X group. The manganese complex occupies approximately half of the available pore volume, keeping the silica's hexagonal array intact. Magnetic measurements of [Mn2O]@SiO2 suggest that most of the dinuclear unit is preserved, as a non-negligible interaction between Mn ions is still observed. The X-ray photoelectron spectroscopy analysis of the Mn 3s peak confirms that Mn remains as Mn(III) inside the silica. The catalase activity study of material [Mn2O]@SiO2 reveals that the complex is more active inside the porous silica, probably due to the surface silanolate groups of the pore wall. Moreover, the new material shows catalase activity in water media, while the coordination compounds are not active. PMID:26484833

  10. Confinement of a bioinspired nonheme Fe(II) complex in 2D hexagonal mesoporous silica with metal site isolation.


    Jollet, Véronique; Albela, Belén; Sénéchal-David, Katell; Jégou, Pascale; Kolodziej, Emilie; Sainton, Joëlle; Bonneviot, Laurent; Banse, Frédéric


    A mixed amine pyridine polydentate Fe(II) complex was covalently tethered in hexagonal mesoporous silica of the MCM-41 type. Metal site isolation was generated using adsorbed tetramethylammonium cations acting as a patterned silanol protecting mask and trimethylsilylazane as a capping agent. Then, the amine/pyridine ligand bearing a tethering triethoxysilane group was either grafted to such a pretreated silica surface prior to or after complexation to Fe(II). These two synthetic routes, denoted as two-step and one-step, respectively, were also applied to fumed silica for comparison, except that the silanol groups were capped after tethering the metal unit. The coordination of the targeted complex was monitored using UV-visible spectrophotometry and, according to XPS, the best control was achieved inside the channels of the mesoporous silica for the two-step route. For the solid prepared according to the one-step route, tethering of the complex occurred mainly at the entrance of the channel. PMID:23824307

  11. Mesoporous silica nanoparticles as a compound delivery system in zebrafish embryos

    PubMed Central

    Sharif, Faiza; Porta, Fabiola; Meijer, Annemarie H; Kros, Alexander; Richardson, Michael K


    Silica nanoparticles can be efficiently employed as carriers for therapeutic drugs in vitro. Here, we use zebrafish embryos as a model organism to see whether mesoporous silica nanoparticles (MSNPs) can be incorporated to deliver compounds in vivo. We injected 35–40 nL (10 mg/mL) of custom-synthesized, fluorescently-tagged 200 nm MSNPs into the left flank, behind the yolk sac extension, of 2-day-old zebrafish embryos. We tracked the distribution and translocation of the MSNPs using confocal laser scanning microscopy. Some of the particles remained localized at the injection site, whereas others entered the bloodstream and were carried around the body. Embryo development and survival were not significantly affected by MSNP injection. Acridine orange staining revealed that MSNP injections did not induce significant cell death. We also studied cellular immune responses by means of lysC::DsRED2 transgenic embryos. MSNP-injected embryos showed infiltration of the injection site with neutrophils, similar to controls injected with buffer only. In the same embryos, counterstaining with L-plastin antibody for leukocytes revealed the same amount of cellular infiltration of the injection site in embryos injected with MSNPs or with buffer only. Next, we used MSNPs to deliver two recombinant cytokines (macrophage colony-stimulating factor and receptor for necrosis factor ligand) to zebrafish embryos. These proteins are known to activate cells involved in bone remodeling, and this can be detected with the marker tartrate-resistant acid phosphatase. Coinjection of these proteins loaded onto MSNPs produced a significant increase in the number of tartrate-resistant acid phosphatase-positive cells after 2–3 days of injection. Our results show that MSNPs can be used to deliver bioactive compounds into zebrafish larvae without producing higher mortality or gross evidence of teratogenicity. PMID:22605936