Science.gov

Sample records for molecules forming incomplete

  1. Algodystrophy: complex regional pain syndrome and incomplete forms

    PubMed Central

    Giannotti, Stefano; Bottai, Vanna; Dell’Osso, Giacomo; Bugelli, Giulia; Celli, Fabio; Cazzella, Niki; Guido, Giulio

    2016-01-01

    Summary The algodystrophy, also known as complex regional pain syndrome (CRPS), is a painful disease characterized by erythema, edema, functional impairment, sensory and vasomotor disturbance. The diagnosis of CRPS is based solely on clinical signs and symptoms, and for exclusion compared to other forms of chronic pain. There is not a specific diagnostic procedure; careful clinical evaluation and additional test should lead to an accurate diagnosis. There are similar forms of chronic pain known as bone marrow edema syndrome, in which is absent the history of trauma or triggering events and the skin dystrophic changes and vasomotor alterations. These incomplete forms are self-limited, and surgical treatment is generally not needed. It is still controversial, if these forms represent a distinct self-limiting entity or an incomplete variant of CRPS. In painful unexplained conditions such as frozen shoulder, post-operative stiff shoulder or painful knee prosthesis, the algodystrophy, especially in its incomplete forms, could represent the cause. PMID:27252736

  2. Identification and structural characterization of two incompletely processed forms of the fourth component of human complement.

    PubMed Central

    Chan, A C; Atkinson, J P

    1983-01-01

    Immunoprecipitates of human C4 from EDTA-plasma were incubated with [14C]methylamine and analyzed by sodium dodecyl sulfate (SDS)-polyacrylamide gel electrophoresis and fluorography. In addition to finding label in the alpha-chains of the secreted (C4s) and predominant plasma (C4p) forms of C4, two additional molecules with apparent molecular weights of approximately 168,000 (p168) and approximately 125,000 (p125) covalently incorporated methylamine, indicating the presence of an internal thioester bond. These two molecules were present at a concentration of approximately 5% of total plasma C4 and were not immunoprecipitated by antisera to C3 or alpha 2-macroglobulin. A human hepatoma-derived cell line (HepG2), in addition to synthesizing C4s and small quantities of the polypeptide precursor of C4 (pro-C4), was found to secrete p168 and p125 at concentrations of 14 +/- 4.8 and 21 +/- 9.2% (mean +/- SD), respectively, of total secreted C4. These molecules were not found intracellularly. Both molecules were present on reduced, but not nonreduced, SDS-polyacrylamide gels. Chido (C4B) and Rodgers' (C4A) alloantisera precipitated the C4A and C4B variants of pro-C4, p168, p125, and C4s. Both tryptic and Staphylococcus aureus V8 protease peptide analyses showed homology between p168 and the beta- and alpha-chains and between p125 and the alpha- and gamma-chains. Partial NH2-terminal sequencing revealed that the beta-chain was NH2-terminal in p168 and that the alpha-chain was NH2-terminal in p125. Taken together, these data indicate that p168 and p125 represent uncleaved beta-alpha- and alpha-gamma-fragments of pro-C4, respectively. Thus, in most individuals, plasma C4 consists of five structurally distinct molecules, the single polypeptide precursor (pro-C4), the three-subunit secreted (C4s) and predominant plasma (C4p) forms of C4, and two incompletely processed two-subunit molecules with uncleaved beta-alpha- (p168) or uncleaved alpha-gamma (p125)-subunits. In addition

  3. MDM2 regulates a novel form of incomplete neoplastic transformation of Theileria parva infected lymphocytes.

    PubMed

    Hayashida, Kyoko; Kajino, Kiichi; Hattori, Masakazu; Wallace, Maura; Morrison, Ivan; Greene, Mark I; Sugimoto, Chihiro

    2013-02-01

    Our efforts are concerned with identifying features of incomplete malignant transformation caused by non viral pathogens. Theileria parva (T. parva) is a tick-transmitted protozoan parasite that can cause a fatal lymphoproliferative disease in cattle. The T. parva-infected lymphocytes display a transformed phenotype and proliferate in culture media like the other tumor cells, however those cells will return to normal after antiprotozoal treatment reflecting the incomplete nature of transformation. To identify signaling pathways involved in this form of transformation of T. parva-infected cells, we screened a library of anticancer compounds. Among these, TIBC, a specific inhibitor of MDM2, markedly inhibited proliferation of T. parva-infected lymphocytes and promoted apoptosis. Therefore we analyzed MDM2 function in T. parva-infected cells. Several T. parva-infected cell lines showed increased expression level of MDM2 with alternatively spliced isoforms compared to the lymphoma cells or ConA blasts. In addition, buparvaquone affected MDM2 expression in T. parva transformed cells. Moreover, p53 protein accumulation and function were impaired in T. parva-infected cells after cisplatin induced DNA damage despite the increased p53 transcription level. Finally, the treatment of T. parva-infected cells with boronic-chalcone derivatives TIBC restored p53 protein accumulation and induced Bax expression. These results suggest that the overexpression of MDM2 is closely linked to the inhibition of p53-dependent apoptosis of T. parva-infected lymphocytes. Aberrant expression of host lymphocyte MDM2 induced by cytoplasmic existence of T. parva, directly and/or indirectly, is associated with aspects of this type of transformation of T. parva-infected lymphocytes. This form of transformation shares features of oncogene induced malignant phenotype acquisition.

  4. Towards a new paradigm of microscopic colitis: Incomplete and variant forms

    PubMed Central

    Guagnozzi, Danila; Landolfi, Stefania; Vicario, Maria

    2016-01-01

    Microscopic colitis (MC) is a chronic inflammatory bowel disease that has emerged in the last three decades as a leading cause of chronic watery diarrhoea. MC classically includes two main subtypes: lymphocytic colitis (LC) and collagenous colitis (CC). Other types of histopathological changes in the colonic mucosa have been described in patients with chronic diarrhoea, without fulfilling the conventional histopathological criteria for MC diagnosis. Whereas those unclassified alterations remained orphan for a long time, the use of the term incomplete MC (MCi) is nowadays universally accepted. However, it is still unresolved whether CC, LC and MCi should be considered as one clinical entity or if they represent three related conditions. In contrast to classical MC, the real epidemiological impact of MCi remains unknown, because only few epidemiological studies and case reports have been described. MCi presents clinical characteristics indistinguishable from complete MC with a good response to budesonide and cholestiramine. Although a number of medical treatments have been assayed in MC patients, currently, there is no causal treatment approach for MC and MCi, and only empirical strategies have been performed. Further studies are needed in order to identify their etiopathogenic mechanisms, and to better classify and treat MC. PMID:27784958

  5. Kinematic Slowing of Molecules Formed by Reactive Collisions

    SciTech Connect

    Liu Ningning; Loesch, Hansjuergen

    2007-03-09

    We report the generation of a beam of slow (translationally cold) KBr molecules formed by exoergic reactive collisions in counterpropagating beams of K atoms and HBr molecules. The intensity of the slow beam is estimated to 4x10{sup 11} s{sup -1} sr{sup -1}. The velocity distribution (density) peaks at 42.5 m/s corresponding to a formal temperature of 13 K. About 7% of the molecules move at velocities between 14.2 and 20 m/s and an estimated fraction of 7% is slower than 14.2 m/s.

  6. Correlation of mutant menin stability with clinical expression of multiple endocrine neoplasia type 1 and its incomplete forms.

    PubMed

    Shimazu, Satoko; Nagamura, Yuko; Yaguchi, Hiroko; Ohkura, Naganari; Tsukada, Toshihiko

    2011-11-01

    Germline mutations of the tumor suppressor gene MEN1 are found not only in typical multiple endocrine neoplasia type 1 (MEN1) but also in its incomplete forms such as familial isolated hyperparathyroidism (FIHP) and apparently sporadic parathyroid tumor (ASPT). No definitive genotype-phenotype correlation has been established between these clinical forms and MEN1 gene mutations. We previously demonstrated that mutant menin proteins associated with MEN1 are rapidly degraded by the ubiquitin-proteasome pathway. To examine whether the intracellular stability of mutant menin is correlated with clinical phenotypes, we developed a method of evaluating menin stability and examined 20 mutants associated with typical MEN1 (17 missense, two in-frame deletion, one nonsense) and 21 mutants associated with FIHP or ASPT (19 missense, two in-frame deletion). All tested mutants associated with typical MEN1 showed reduced stability. Some missense and in-frame deletion mutants (G28A, R171W, T197I, E255K, E274A, Y353del and E366D) associated with FIHP or ASPT were almost as stable as or only slightly less stable than wild-type menin, while others were as unstable as those associated with typical MEN1. Some stable mutants exhibited substantial biological activities when tested by JunD-dependent transactivation assay. These findings suggest that certain missense and in-frame mutations are fairly stable and retain intrinsic biological activity, and might be specifically associated with incomplete clinical phenotypes. The menin stability test will provide useful information for the management of patients carrying germline MEN1 mutations especially when they have missense or in-frame variants of ambiguous clinical significance.

  7. Tracking molecular resonance forms of donor–acceptor push–pull molecules by single-molecule conductance experiments

    PubMed Central

    Lissau, Henriette; Frisenda, Riccardo; Olsen, Stine T.; Jevric, Martyn; Parker, Christian R.; Kadziola, Anders; Hansen, Thorsten; van der Zant, Herre S. J.; Brøndsted Nielsen, Mogens; Mikkelsen, Kurt V.

    2015-01-01

    The ability of molecules to change colour on account of changes in solvent polarity is known as solvatochromism and used spectroscopically to characterize charge-transfer transitions in donor–acceptor molecules. Here we report that donor–acceptor-substituted molecular wires also exhibit distinct properties in single-molecule electronics under the influence of a bias voltage, but in absence of solvent. Two oligo(phenyleneethynylene) wires with donor–acceptor substitution on the central ring (cruciform-like) exhibit remarkably broad conductance peaks measured by the mechanically controlled break-junction technique with gold contacts, in contrast to the sharp peak of simpler molecules. From a theoretical analysis, we explain this by different degrees of charge delocalization and hence cross-conjugation at the central ring. Thus, small variations in the local environment promote the quinoid resonance form (off), the linearly conjugated (on) or any form in between. This shows how the conductance of donor–acceptor cruciforms is tuned by small changes in the environment. PMID:26667583

  8. Ray Calculations of Ocean Sound Channels Using a Pocket Programmable Calculator and Extended Forms of the Hirsch-Carter Mathematical Model with Tables of the Incomplete Beta Function.

    DTIC Science & Technology

    1978-10-01

    pocket programmable calculator on two Sargasso Sea profiles, one from the center of a cold ring eddy are given. Necessary tables of the incomplete beta-function and calculator programs are included in a supplement.

  9. Haldane State Formed by Oxygen Molecules Encapsulated in Single-Walled Carbon Nanotubes

    NASA Astrophysics Data System (ADS)

    Hagiwara, Masayuki; Ikeda, Masami; Kida, Takanori; Matsuda, Kazuyuki; Tadera, Shin; Kyakuno, Haruka; Yanagi, Kazuhiro; Maniwa, Yutaka; Okunishi, Kouichi

    2014-11-01

    We report on the results of X-ray diffraction (XRD), magnetic susceptibility, and high-field magnetization measurements of oxygen molecules, which are unique magnetic homonuclear diatomic molecules with spin-1, encapsulated in single-walled carbon nanotubes (SWCNTs) with diameters of about 0.8 nm. Antiferromagnetic interactions between neighboring oxygen molecules are expected in SWCNTs, resulting in the formation of a spin-1 one-dimensional Heisenberg antiferromagnet, known as a Haldane magnet. The XRD pattern can be predicted accurately by considering the expected oxygen molecule alignment. The temperature evolution of the magnetic susceptibility and the high-field magnetization curve are typical of those for a Haldane magnet with spin-1. The results indicate that the Haldane state has been realized in a nanospaced material for the first time. This provides an alternative to the conventional condensed matter approach to forming quantum spin systems.

  10. Complex organic molecules toward low-mass and high-mass star forming regions

    NASA Astrophysics Data System (ADS)

    Favre, C.; Ceccarelli, C.; Lefloch, B.; Bergin, E.; Carvajal, M.; Brouillet, N.; Despois, D.; Jørgensen, J.; Kleiner, I.

    2016-12-01

    One of the most important questions in molecular astrophysics is how, when, and where complex organic molecules, COMs (≥ 6 atoms) are formed. In the Interstellar-Earth connection context, could this have a bearing on the origin of life on Earth? Formation mechanisms of COMs, which include potentially prebiotic molecules, are still debated and may include grain-mantle and/or gas-phase chemistry. Understanding the mechanisms that lead to the interstellar molecular complexification, along with the involved physicochemical processes, is mandatory to answer the above questions. In that context, active researches are ongoing in theory, laboratory experiment, chemical modeling and observations. Thanks to recent progress in radioastronomy instrumentation for both single-dish and millimeter array (e.g. Herschel, NOEMA, ALMA), new results have been obtained. I will review some notable results on the detection of COMs, including prebiotic molecules, towards star forming regions.

  11. Models of fullerene molecules: Deliberately truncated face forms of icosahedral symmetry

    SciTech Connect

    Dilanyan, R.A.; Rybchenko, O.G.; Shekhtman, V.Sh.

    1994-01-01

    A method is proposed to describe fullerene molecules C{sub n} with the aid of noncrystallographic icosahedral m{bar 3}{bar 5} and 235 groups. It is shown that the truncation of face forms of icosahedral symmetry by a pentagonal dodecahedron yields the C{sub 60}, C{sub 80}, and C{sub 140} polyhedra. For these clusters, the radii of the spheres circumscribing the polyhedra, the numerical values of the coordinates of the atoms forming these molecules, and the parameters of the face-centered crystal (fcc) lattices formed by special packing of spheres were calculated. The X-ray diffraction patterns of the fullerene compounds C{sub 60}, C{sub 80}, and C{sub 140} were simulated. 4 refs., 2 figs., 2 tabs.

  12. Crystal chemistry of layered structures formed by linear rigid silyl-capped molecules.

    PubMed

    Lumpi, Daniel; Kautny, Paul; Stöger, Berthold; Fröhlich, Johannes

    2015-09-01

    The crystallization behavior of methylthio- or methylsulfonyl-containing spacer extended Z,Z-bis-ene-yne molecules capped with trimethylsilyl groups obtained by (tandem) thiophene ring fragmentation and of two non-spacer extended analogs were investigated. The rigid and linear molecules generally crystallized in layers whereby the flexibility of the layer interfaces formed by the silyl groups leads to a remarkably rich crystal chemistry. The molecules with benzene and thiophene spacers both crystallized with C2/c symmetry and can be considered as merotypes. Increasing the steric bulk of the core by introduction of ethylenedioxythiophene (EDOT) gave a structure incommensurately modulated in the [010] direction. Further increase of steric demand in the case of a dimethoxythiophene restored periodicity along [010] but resulted in a doubling of the c vector. Two different polytypes were observed, which feature geometrically different layer interfaces (non-OD, order-disorder, polytypes), one with a high stacking fault probability. Oxidation of the methylthio groups of the benzene-based molecule to methylsulfonyl groups led to three polymorphs (two temperature-dependent), which were analyzed by Hirshfeld surface d e/d i fingerprint plots. The analogously oxidized EDOT-based molecule crystallized as systematic twins owing to its OD polytypism. Shortening of the backbone by removal of the aryl core resulted in an enantiomorphic structure and a further shortening by removal of a methylthio-ene fragment again in a systematically twinned OD polytype.

  13. Photodissociation of organic molecules in star-forming regions. II. Acetic acid

    NASA Astrophysics Data System (ADS)

    Pilling, S.; Santos, A. C. F.; Boechat-Roberty, H. M.

    2006-04-01

    Fragments from organic molecule dissociation (such as reactive ions and radicals) can form interstellar complex molecules like amino acids. The goal of this work is to experimentally study photoionization and photodissociation processes of acetic acid (CH3COOH), a glycine (NH2CH2COOH) precursor molecule, by soft X-ray photons. The measurements were taken at the Brazilian Synchrotron Light Laboratory (LNLS), employing soft X-ray photons from a toroidal grating monochromator (TGM) beamline (100-310 eV). Mass spectra were obtained using the photoelectron photoion coincidence (PEPICO) method. Kinetic energy distribution and abundances for each ionic fragment have been obtained from the analysis of the corresponding peak shapes in the mass spectra. Absolute photoionization and photodissociation cross sections were also determined. We have found, among the channels leading to ionization, that only 4-6% of CH3COOH survive the strong ionization field. CH3CO^+, COOH+ and CH3+ ions are the main fragments, and the presence of the former may indicate that the production-destruction process of acetic acid in hot molecular cores (HMCs) could decrease the H2O abundance since the net result of this process converts H2O into OH + H^+. The COOH+ ion plays an important role in ion-molecule reactions to form large biomolecules like glycine.

  14. Millimeter and Submillimeter Studies of O(^1D) Insertion Reactions to Form Molecules of Astrophysical Interest

    NASA Astrophysics Data System (ADS)

    Hays, Brian; Wehres, Nadine; Deprince, Bridget Alligood; Roy, Althea A. M.; Laas, Jacob; Widicus Weaver, Susanna L.

    2015-06-01

    While both the number of detected interstellar molecules and their chemical complexity continue to increase, understanding of the processes leading to their formation is lacking. Our research group combines laboratory spectroscopy, observational astronomy, and astrochemical modeling for an interdisciplinary examination of the chemistry of star and planet formation. This talk will focus on our laboratory studies of O(^1D) insertion reactions with organic molecules to produce molecules of astrophysical interest. By employing these reactions in a supersonic expansion, we are able to produce interstellar organic reaction intermediates that are unstable under terrestrial conditions; we then probe the products using millimeter and submillimeter spectroscopy. We benchmarked this setup using the well-studied O(^1D) + methane reaction to form methanol. After optimizing methanol production, we moved on to study the O(^1D) + ethylene reaction to form vinyl alcohol (CH_2CHOH), and the O(^1D) + methyl amine reaction to form aminomethanol (NH_2CH_2OH). Vinyl alcohol measurements have now been extended up to 450 GHz, and the associated spectral analysis is complete. A possible detection of aminomethanol has also been made, and continued spectral studies and analysis are underway. We will present the results from these experiments and discuss future applications of these molecular and spectroscopic techniques.

  15. The First Detections of the Key Prebiotic Molecule PO in Star-forming Regions

    NASA Astrophysics Data System (ADS)

    Rivilla, V. M.; Fontani, F.; Beltrán, M. T.; Vasyunin, A.; Caselli, P.; Martín-Pintado, J.; Cesaroni, R.

    2016-08-01

    Phosphorus is a crucial element in biochemistry, in particular the P-O bond, which is key in the formation of the backbone of deoxyribonucleic acid. So far, PO has only been detected toward the envelope of evolved stars, but never toward star-forming regions. We report the first detection of PO toward two massive star-forming regions, W51 e1/e2 and W3(OH), using data from the IRAM 30 m telescope. PN has also been detected toward the two regions. The abundance ratio PO/PN is 1.8 and 3 for W51 and W3(OH), respectively. Our chemical model indicates that the two molecules are chemically related and are formed via gas-phase ion-molecule and neutral-neutral reactions during cold collapse. The molecules freeze out onto grains at the end of the collapse and desorb during the warm-up phase once the temperature reaches ˜35 K. Similar abundances of the two species are expected during a period of ˜5 × 104 yr at the early stages of the warm-up phase, when the temperature is in the range 35-90 K. The observed molecular abundances of 10-10 are predicted by the model if a relatively high initial abundance of 5 × 10-9 of depleted phosphorus is assumed.

  16. Translational vibrations between chains of hydrogen-bonded molecules in solid-state aspirin form I

    NASA Astrophysics Data System (ADS)

    Takahashi, Masae; Ishikawa, Yoichi

    2013-06-01

    We perform dispersion-corrected first-principles calculations, and far-infrared (terahertz) spectroscopic experiments at 4 K, to examine translational vibrations between chains of hydrogen-bonded molecules in solid-state aspirin form I. The calculated frequencies and relative intensities reproduce the observed spectrum to accuracy of 11 cm-1 or less. The stronger one of the two peaks assigned to the translational mode includes the stretching vibration of the weak hydrogen bond between the acetyl groups of a neighboring one-dimensional chain. The calculation of aspirin form II performed for comparison gives the stretching vibration of the weak hydrogen bond in one-dimensional chain.

  17. A secreted form of the human lymphocyte cell surface molecule CD8 arises from alternative splicing

    SciTech Connect

    Giblin, P.; Kavathas, P. ); Ledbetter, J.A. )

    1989-02-01

    The human lymphocyte differentiation antigen CD8 is encoded by a single gene that gives rise to a 33- to 34-kDa glycoprotein expressed on the cell surface as a dimer and in higher molecular mass forms. The authors demonstrate that the mRNA is alternatively spliced so that an exon encoding a transmembrane domain is deleted. This gives rise to a 30-kDa molecule that is secreted and exists primarily as a monomer. mRNA corresponding to both forms is present in peripheral blood lymphocytes, Con A-activated peripheral blood lymphocytes, and three CD8{sup +} T-cell lines, with the membrane form being the major species. However, differences in the ratio of mRNA for membrane CD8 and secreted CD8 exist. In addition, the splicing pattern observed differs from the pattern found for the mouse CD8 gene. This mRNA is also alternatively spliced, but an exon encoding a cytoplasmic region is deleted, giving rise to a cell surface molecule that differs in its cytoplasmic tail from the protein encoded by the longer mRNA. Neither protein is secreted. This is one of the first examples of a different splicing pattern between two homologous mouse and human genes giving rise to very different proteins. This represents one mechanism of generating diversity during speciation.

  18. Therapeutic genome mutagenesis using synthetic donor DNA and triplex-forming molecules.

    PubMed

    Reza, Faisal; Glazer, Peter M

    2015-01-01

    Genome mutagenesis can be achieved in a variety of ways, though a select few are suitable for therapeutic settings. Among them, the harnessing of intracellular homologous recombination affords the safety and efficacy profile suitable for such settings. Recombinagenic donor DNA and mutagenic triplex-forming molecules co-opt this natural recombination phenomenon to enable the specific, heritable editing and targeting of the genome. Editing the genome is achieved by designing the sequence-specific recombinagenic donor DNA to have base mismatches, insertions, and deletions that will be incorporated into the genome when it is used as a template for recombination. Targeting the genome is similarly achieved by designing the sequence-specific mutagenic triplex-forming molecules to further recruit the recombination machinery thereby upregulating its activity with the recombinagenic donor DNA. This combination of extracellularly introduced, designed synthetic molecules and intercellularly ubiquitous, evolved natural machinery enables the mutagenesis of chromosomes and engineering of whole genomes with great fidelity while limiting nonspecific interactions. Herein, we demonstrate the harnessing of recombinagenic donor DNA and mutagenic triplex-forming molecular technology for potential therapeutic applications. These demonstrations involve, among others, utilizing this technology to correct genes so that they become physiologically functional, to induce dormant yet functional genes in place of non-functional counterparts, to place induced genes under regulatory elements, and to disrupt genes to abrogate a cellular vulnerability. Ancillary demonstrations of the design and synthesis of this recombinagenic and mutagenic molecular technology as well as their delivery and assayed interaction with duplex DNA reveal a potent technological platform for engineering specific changes into the living genome.

  19. Microsolvation of anions by molecules forming CH··X- hydrogen bonds

    NASA Astrophysics Data System (ADS)

    Nepal, Binod; Scheiner, Steve

    2015-12-01

    Various anions were surrounded by n molecules of CF3H, which was used as a prototype CH donor solvent, and the structures and energies studied by M06-2X calculations with a 6-31+G∗∗ basis set. Anions considered included the halides F-, Cl-, Br- and I-, as well as those with multiple proton acceptor sites: CN-, NO3-, HCOO-, CH3COO-, HSO4-, H2PO4-, and anions with higher charges SO42-, HPO42- and PO43-. Well structured cages were formed and the average H-bond energy decreases steadily as the number of surrounding solvent molecules rises, even when n exceeds 6 and the CF3H molecules begin to interact with one another rather than with the central anion. Total binding energies are very nearly proportional to the magnitude of the negative charge on the anion. The free energy of complexation becomes more negative for larger n initially, but then reaches a minimum and begins to rise for larger values of n.

  20. Surface Molecules Released by Trypanosoma cruzi Metacyclic Forms Downregulate Host Cell Invasion

    PubMed Central

    Clemente, Tatiana Mordente; Cortez, Cristian; Novaes, Antônio da Silva; Yoshida, Nobuko

    2016-01-01

    Background The question whether metacylic trypomastigote (MT) forms of different T. cruzi strains differentially release surface molecules, and how they affect host cell invasion, remains to be fully clarified. We addressed that question using T. cruzi strains that differ widely in the ability to invade cells. Methodology/Principal Findings Metacyclic forms were incubated at 37°C for 1 h in complete D10 medium or in nutrient-deprived PBS containing Ca2+ and Mg2+ (PBS++). The conditioned medium (CM), collected after parasite centrifugation, was used for cell invasion assays and Western blot analysis, using monoclonal antibodies directed to gp82 and gp90, the MT surface molecules that promote and negatively regulate invasion, respectively. CM of poorly invasive G strain (G-CM) contained high amounts of gp90 and gp82, either in vesicles or as soluble molecules. CM of highly invasive CL strain (CL-CM) contained gp90 and gp82 at very low levels. HeLa cells were incubated for 1 h with CL strain MT in D10, in absence or in the presence of G-CM or CL-CM. Parasite invasion was significantly inhibited by G-CM, but not by CL-CM. As G strain MT invasion rate in D10 is very low, assays with this strain were performed in PBS++, which induces invasion-promoting lysosome-spreading. G-CM, but not CL-CM, significantly inhibited G strain internalization, effect that was counteracted by preincubating G-CM with an anti-gp90 monoclonal antibody or anti-gp82 polyclonal antibody that do not recognize live MT. G strain CM generated in PBS++ contained much lower amounts of gp90 and gp82 as compared to CM produced in D10, and exhibited lower inhibitory effect on host cell invasion. Conclusion/Significance Our data suggest that the surface molecules spontaneously released by MT impair parasite-host cell interaction, gp82 presumably competing with the molecule expressed on MT surface for the host cell receptor, and gp90 further contributing to down modulate invasion. PMID:27483135

  1. Formation of ethylene glycol and other complex organic molecules in star-forming regions

    NASA Astrophysics Data System (ADS)

    Rivilla, V. M.; Beltrán, M. T.; Cesaroni, R.; Fontani, F.; Codella, C.; Zhang, Q.

    2017-02-01

    Context. The detection of complex organic molecules related with prebiotic chemistry in star-forming regions allows us to investigate how the basic building blocks of life are formed. Aims: Ethylene glycol (CH2OH)2 is the simplest sugar alcohol and the reduced alcohol of the simplest sugar glycoladehyde (CH2OHCHO). We study the molecular abundance and spatial distribution of (CH2OH)2, CH2OHCHO and other chemically related complex organic species (CH3OCHO, CH3OCH3, and C2H5OH) towards the chemically rich massive star-forming region G31.41+0.31. Methods: We analyzed multiple single-dish (Green Bank Telescope and IRAM 30 m) and interferometric (Submillimeter Array) spectra towards G31.41+0.31, covering a range of frequencies from 45 to 258 GHz. We fitted the observed spectra with a local thermodynamic equilibrium (LTE) synthetic spectra, and obtained excitation temperatures and column densities. We compared our findings in G31.41+0.31 with the results found in other environments, including low- and high-mass star-forming regions, quiescent clouds and comets. Results: We report for the first time the presence of the aGg' conformer of (CH2OH)2 towards G31.41+0.31, detecting more than 30 unblended lines. We also detected multiple transitions of other complex organic molecules such as CH2OHCHO, CH3OCHO, CH3OCH3, and C2H5OH. The high angular resolution images show that the (CH2OH)2 emission is very compact, peaking towards the maximum of the 1.3 mm continuum. These observations suggest that low abundance complex organic molecules, like (CH2OH)2 or CH2OHCHO, are good probes of the gas located closer to the forming stars. Our analysis confirms that (CH2OH)2 is more abundant than CH2OHCHO in G31.41+0.31, as previously observed in other interstellar regions. Comparing different star-forming regions we find evidence of an increase of the (CH2OH)2/CH2OHCHO abundance ratio with the luminosity of the source. The CH3OCH3/CH3OCHO and (CH2OH)2/C2H5OH ratios are nearly constant with

  2. Probing non polar interstellar molecules through their protonated form: Detection of protonated cyanogen (NCCNH(+)).

    PubMed

    Agúndez, M; Cernicharo, J; de Vicente, P; Marcelino, N; Roueff, E; Fuente, A; Gerin, M; Guélin, M; Albo, C; Barcia, A; Barbas, L; Bolaño, R; Colomer, F; Diez, M C; Gallego, J D; Gómez-González, J; López-Fernández, I; López-Fernández, J A; López-Pérez, J A; Malo, I; Serna, J M; Tercero, F

    2015-07-01

    Cyanogen (NCCN) is the simplest member of the series of dicyanopolyynes. It has been hypothesized that this family of molecules can be important constituents of interstellar and circumstellar media, although the lack of a permanent electric dipole moment prevents its detection through radioastronomical techniques. Here we present the first solid evidence of the presence of cyanogen in interstellar clouds through the detection of its protonated form toward the cold dark clouds TMC-1 and L483. Protonated cyanogen (NCCNH(+)) has been identified through the J = 5 - 4 and J = 10 - 9 rotational transitions using the 40m radiotelescope of Yebes and the IRAM 30m telescope. We derive beam averaged column densities for NCCNH(+) of (8.6 ± 4.4) × 10(10) cm(-2) in TMC-1 and (3.9 ± 1.8) × 10(10) cm(-2) in L483, which translate to fairly low fractional abundances relative to H2, in the range (1-10) × 10(-12). The chemistry of protonated molecules in dark clouds is discussed, and it is found that, in general terms, the abundance ratio between the protonated and non protonated forms of a molecule increases with increasing proton affinity. Our chemical model predicts an abundance ratio NCCNH(+)/NCCN of ~ 10(-4), which implies that the abundance of cyanogen in dark clouds could be as high as (1-10) × 10(-8) relative to H2, i.e., comparable to that of other abundant nitriles such as HCN, HNC, and HC3N.

  3. Probing non polar interstellar molecules through their protonated form: Detection of protonated cyanogen (NCCNH+)★

    PubMed Central

    Agúndez, M.; Cernicharo, J.; de Vicente, P.; Marcelino, N.; Roueff, E.; Fuente, A.; Gerin, M.; Guélin, M.; Albo, C.; Barcia, A.; Barbas, L.; Bolaño, R.; Colomer, F.; Diez, M. C.; Gallego, J. D.; Gómez-González, J.; López-Fernández, I.; López-Fernández, J. A.; López-Pérez, J. A.; Malo, I.; Serna, J. M.; Tercero, F.

    2015-01-01

    Cyanogen (NCCN) is the simplest member of the series of dicyanopolyynes. It has been hypothesized that this family of molecules can be important constituents of interstellar and circumstellar media, although the lack of a permanent electric dipole moment prevents its detection through radioastronomical techniques. Here we present the first solid evidence of the presence of cyanogen in interstellar clouds through the detection of its protonated form toward the cold dark clouds TMC-1 and L483. Protonated cyanogen (NCCNH+) has been identified through the J = 5 – 4 and J = 10 – 9 rotational transitions using the 40m radiotelescope of Yebes and the IRAM 30m telescope. We derive beam averaged column densities for NCCNH+ of (8.6 ± 4.4) × 1010 cm−2 in TMC-1 and (3.9 ± 1.8) × 1010 cm−2 in L483, which translate to fairly low fractional abundances relative to H2, in the range (1-10) × 10−12. The chemistry of protonated molecules in dark clouds is discussed, and it is found that, in general terms, the abundance ratio between the protonated and non protonated forms of a molecule increases with increasing proton affinity. Our chemical model predicts an abundance ratio NCCNH+/NCCN of ~ 10−4, which implies that the abundance of cyanogen in dark clouds could be as high as (1-10) × 10−8 relative to H2, i.e., comparable to that of other abundant nitriles such as HCN, HNC, and HC3N. PMID:26543239

  4. The electrophoretically 'slow' and 'fast' forms of the alpha 2-macroglobulin molecule.

    PubMed Central

    Barrett, A J; Brown, M A; Sayers, C A

    1979-01-01

    alpha 2-Macroglobulin (alpha 2M) was isolated from human plasma by a four-step procedure: poly(ethylene glyco) fractionation, gel chromatography, euglobulin precipitation and immunoadsorption. No contaminants were detected in the final preparations by electrophoresis or immunoprecipitation. The protein ran as a single slow band in gel electrophoresis, and was designated 'S-alpha 2M'. S-alpha 2M bound about 2 mol of trypsin/mol. Treatment of S-alpha 2M with a proteinase or ammonium salts produced a form of the molecule more mobile in electrophoresis, and lacking proteinase-binding activity (F-alpha 2M). The electrophoretic mobility of the F-alpha 2M resulting from reaction with NH4+ salts was identical with that of proteinase complexes. We attribute the change in electrophoretic mobility of the alpha 2M to a conformation change, but there was no evidence of a change in pI or Strokes radius. Electrophoresis of S-alpha 2M in the presence of sodium dodecylsulphate gave results consistent with the view that the alpha 2M molecule is a tetramer of identical subunits, assembled as a non-covalent pair of disulphide-linked dimers. Some of the subunits seemed to be 'nicked' into two-thires-length and one-third-length chains, however. This was not apparent with F-alpha 2M produced by ammonium salts. F-alpha 2M produced by trypsin showed two new bands attributable to cleavage of the subunit polypeptide chain near the middle. Immunoassays of F-alpha 2M gave 'rockets' 12-29% lower than those with S-alpha 2M. The nature of the interactions between subunits in S-alpha 2M and F-alpha 2M was investigated by treating each form with glutaraldehyde before electrophoresis in the presence of sodium dodecyl sulphate. A much greater degree of cross-linking was observed with the F-alpha 2M, indicating that the subunits interact most closely in this form of the molecule. Exposure of S-alpha 2M to 3 M-urea or pH3 resulted in dissociation to the disulphide-bonded half-molecules; these did not

  5. Reasoning from Incomplete Knowledge.

    ERIC Educational Resources Information Center

    Collins, Allan M.; And Others

    People use a variety of plausible, but uncertain inferences to answer questions about which their knowledge is incomplete. Such inferential thinking and reasoning is being incorporated into the SCHOLAR computer-assisted instruction (CAI) system. Socratic tutorial techniques in CAI systems such as SCHOLAR are described, and examples of their…

  6. Phosphorus-bearing molecules in solar-type star-forming regions: first PO detection

    NASA Astrophysics Data System (ADS)

    Lefloch, Bertrand; Vastel, C.; Viti, S.; Jimenez-Serra, I.; Codella, C.; Podio, L.; Ceccarelli, C.; Mendoza, E.; Lepine, J. R. D.; Bachiller, R.

    2016-11-01

    As part of the Large Program Astrochemical Surveys At IRAM, we have used the IRAM 30 m telescope to lead a systematic search for the emission of rotational transitions of P-bearing species between 80 and 350 GHz towards L1157-B1, a shock position in the solar-type star-forming region L1157. We report the detection of several transitions of PN and, for the first time, of pre-biotic molecule PO. None of these species are detected towards the driving protostar of the outflow L1157-mm. Analysis of the line profiles shows that PN arises from the outflow cavity, where SiO, a strong shock tracer, is produced. Radiative transfer analysis yields an abundance of 2.5 × 10-9 and 0.9 × 10-9 for PO and PN, respectively. These results imply a strong depletion (≈100) of phosphorus in the quiescent cloud gas. Shock modelling shows that atomic N plays a major role in the chemistry of PO and PN. The relative abundance of PO and PN brings constraints both on the duration of the pre-shock phase, which has to be ˜106 yr, and on the shock parameters. The maximum temperature in the shock has to be larger than 4000 K, which implies a shock velocity of 40 km s-1.

  7. Nonchiral polar smectic liquid crystals formed by bent-core molecules: weak coupling regime

    NASA Astrophysics Data System (ADS)

    Kranjc, Tomaz

    2002-12-01

    The structure and dynamic properties of achiral polar smectic liquid crystals formed by bow shaped molecules is considered and described by two two-dimensional order parameters, \\vec P and \\vec ξ. The first, polarization order parameter, gives the average projection of the arrow vectors on the smectic layer planes. The second, tilt order parameter, gives the average magnitude and direction of the tilt. To study the possible liquid crystal structures and their properties, a discrete phenomenological model taking into account the competing interactions between the nearest-neighbor smectic layers is used. The free energy of the system is expressed as a sum over smectic layers with terms modeling the appropriate intralayer and interlayer interactions and written only in terms of the arrow and the string order parameters. The free energy is then minimized in order to obtain stable structures and deduce their optical properties. There exist solutions for the case of strong coupling between the polarization and the tilt order parameters arising from attractive intralayer van der Waals and from steric interactions. In this contribution, we focus our attention to the case of weak coupling between the two order parameters and investigate possible structures and related optical properties of the system.

  8. Angiogenesis mediated by soluble forms of E-selectin and vascular cell adhesion molecule-1

    NASA Astrophysics Data System (ADS)

    Koch, Alisa E.; Halloran, Margaret M.; Haskell, Catherine J.; Shah, Manisha R.; Polverini, Peter J.

    1995-08-01

    ENDOTHELIAL adhesion molecules facilitate the entry of leukocytes into inflamed tissues. This in turn promotes neovascularization, a process central to the progression of rheumatoid arthritis, tumour growth and wound repair1. Here we test the hypothesis that soluble endothelial adhesion molecules promote angiogenesis2á¤-4. Human recombinant soluble E-selectin and soluble vascular cell adhesion molecule-1 induced chemotaxis of human endothelial cells in vitro and were angiogenic in rat cornea. Soluble E-selectin acted on endothelial cells in part through a sialyl Lewis-X-dependent mechanism, while soluble vascular cell adhesion molecule-1 acted on endothelial cells in part through a very late antigen (VLA)-4 dependent mechanism. The chemotactic activity of rheumatoid synovial fluid for endothelial cells, and also its angiogenic activity, were blocked by antibodies to either soluble E-selectin or soluble vascular cell adhesion molecule-1. These results suggest a novel function for soluble endothelial adhesion molecules as mediators of angiogenesis.

  9. The dark side of crystal engineering: creating glasses from small symmetric molecules that form multiple hydrogen bonds.

    PubMed

    Lebel, Olivier; Maris, Thierry; Perron, Marie-Eve; Demers, Eric; Wuest, James D

    2006-08-16

    Glasses made from compounds of low molecular weight are useful materials with many attractive features, including well-defined compositions. At present, there are no reliable ways to identify molecules that will form long-lived glasses, and efforts to design them have tended to rely on crude principles, such as avoiding small, symmetric, and relatively inflexible molecules that engage in strong intermolecular association. We have found that it is possible to make glasses from such molecules by turning to the dark side of crystal engineering and by making small but carefully selected structural modifications specifically designed to thwart established patterns of crystallization.

  10. Closed-form equation of state for Lennard-Jones molecules based on perturbation theory

    SciTech Connect

    Bokis, C.P.; Donohue, M.D.

    1995-08-17

    A comparison of virial theory and perturbation theory for spherical molecules is presented. A new equation of state is derived. This new model has the exact second virial coefficient behavior, converges to the correct mean-field behavior at high densities, and successfully interpolates between these two limits. This new equation of state is applied to molecules that interact via the Lennard-Jones potential. Comparison is made with computer simulation results for the configurational energy, the compressibility factor, and the second virial coefficient of Lennard-Jones molecules. 25 refs., 7 figs.

  11. Review of crystalline structures of some selected homologous series of rod-like molecules capable of forming liquid crystalline phases.

    PubMed

    Zugenmaier, Peter

    2011-01-01

    The crystal structures of four homologous series of rod-like molecules are reviewed, two of which form hydrogen bonds and two with a symmetric chemical constitution. Many of the compounds investigated turn into liquid crystalline phases upon temperature increase. It is of valuable interest to know possible conformations and possible packing arrangements as prerequisites to model liquid crystalline structures. The hydrogen bonds of homologous series of pure 4-(ω-hydroxyalkyloxy)-4'-hydroxybiphenyl (HnHBP, n the alkyloxy tail length) are realized through head to tail arrangements of the hydroxyl groups and crystallize except one compound in chiral space groups without the molecules containing any asymmetric carbon. The hydrogen bonds of the homologous series of 4-substituted benzoic acids with various lengths of the tail provide dimers through strong polar bonding of adjacent carboxyl groups and thus provide the stiff part of a mesogenic unit prerequisite for liquid crystalline phases. The homologous series of dialkanoyloxybiphenyls (BP-n, n = 1, 19), of which nine compounds could be crystallized, show liquid crystalline behavior for longer alkane chain lengths, despite the high mobility of the alkane chain ends already detectable in the crystal phase. A single molecule, half a molecule or two half molecules form the asymmetric unit in a centrosymmetric space group. The homologous series of 1,4-terephthalidene-bis-N-(4'-n-alkylaniline) (TBAA-n) exhibit a large variety of packing arrangements in the crystalline state, with or without relying on the symmetry center within the molecules.

  12. Spectroscopy of Cold LiCa Molecules Formed on Helium Nanodroplets

    PubMed Central

    2013-01-01

    We report on the formation of mixed alkali–alkaline earth molecules (LiCa) on helium nanodroplets and present a comprehensive experimental and theoretical study of the ground and excited states of LiCa. Resonance enhanced multiphoton ionization time-of-flight (REMPI-TOF) spectroscopy and laser induced fluorescence (LIF) spectroscopy were used for the experimental investigation of LiCa from 15000 to 25500 cm–1. The 42Σ+ and 32Π states show a vibrational structure accompanied by distinct phonon wings, which allows us to determine molecular parameters as well as to study the interaction of the molecule with the helium droplet. Higher excited states (42Π, 52Σ+, 52Π, and 62Σ+) are not vibrationally resolved and vibronic transitions start to overlap. The experimental spectrum is well reproduced by high-level ab initio calculations. By using a multireference configuration interaction (MRCI) approach, we calculated the 19 lowest lying potential energy curves (PECs) of the LiCa molecule. On the basis of these calculations, we could identify previously unobserved transitions. Our results demonstrate that the helium droplet isolation approach is a powerful method for the characterization of tailor-made alkali–alkaline earth molecules. In this way, important contributions can be made to the search for optimal pathways toward the creation of ultracold alkali–alkaline earth ground state molecules from the corresponding atomic species. Furthermore, a test for PECs calculated by ab initio methods is provided. PMID:24028555

  13. Incomplete invention of drugs.

    PubMed

    Hisa, Tomoyuki

    2007-02-01

    Scientists seldom know the differences between "rejected invention", "non-invention", "incomplete invention", "invention yet to be completed" and "defective invention". The Japanese Supreme Court appointed me as a specialist member (Article 92-2, Code of Civil Procedure) of intellectual property division for medical and biological patents. Herein, I present scientists to the differences and which of them are patentable. In order to prevent oneself from being taken for granted for the scientists' noblesse oblige by clever business administrations, the scientists must know the borderline between patentable or non-patentable.

  14. Kinematic slowing and electrostatic guiding of KBr molecules formed by the reactive collision process: K + HBr --> KBr + H.

    PubMed

    Liu, Ning-Ning; Loesch, Hansjürgen

    2010-03-11

    We have generated a beam of translationally cold KBr molecules formed by exoergic reactive collisions in counterpropagating beams of K atoms and HBr molecules. The method relies on the extreme mass ratio of the products and the proper choice of the beam velocities (Liu, N.-N.; Loesch, H. J. Phys. Rev. Lett. 2007, 98, 10300). Here, we report the results of experiments on guiding the slow molecules from the site of their creation to the detector by a linear electrostatic quadrupole field. The device enhances the total intensity by a factor of 2.3 and the intensity at 14.2 m/s (1.4K) by an order of magnitude. The density velocity distributions, deduced directly from the observed time-of-flight profiles, peak at 20 m/s (2.9K). A numerical simulation of the guiding efficiency indicates that the polarization of the nascent molecules is first altered by a sudden change of the quantization axis from parallel to the initial relative velocity to parallel to the fringing field and thereafter follows adiabatically the local field as quantization axis. Drastic differences between the velocity and rotational state distributions of the molecules entering and leaving the energized quadrupole field are predicted. The counterpropagating beams can be used to continuously load an electrostatic trap. The equilibrium density of confined molecules is estimated to 1 x 10(7) cm(-3).

  15. A triclinic polymorph of benzanilide: disordered molecules form hydrogen-bonded chains.

    PubMed

    Bowes, Katharine F; Glidewell, Christopher; Low, John N; Skakle, Janet M S; Wardell, James L

    2003-01-01

    In the P-1 polymorph of benzanilide or N-phenylbenzamide, C(13)H(11)NO, the molecules are linked into simple C(4) chains by N-H...O hydrogen bonds. The molecules exhibit orientational disorder, but the donor and acceptor in a given hydrogen bond may occur, independently, in either the major or the minor orientation, such that all four possible N-H.O combinations have very similar geometries. The structure of this P-1 polymorph can be related to that of a previously reported C2/c polymorph.

  16. Halo Nucleic Molecules: Molecules Formed from at Least One Atom with a Halo Nucleus. Emphasis on 11,11Li_2 Along with Other Exotic Isotopologues.

    NASA Astrophysics Data System (ADS)

    Dattani, Nikesh S.; Welsh, Staszek

    2014-06-01

    Atoms whose nuclei have an exotic number of nucleons can have a `core nucleus' surrounded by a `halo' formed by a nucleon orbiting the core nucleus. For example, due to the two halo neutrons orbiting the core nucleus of 11Li, its nucleus has a cross section that is roughly the same size as that of 208Pb. Halo nucleic atoms have been studied extensively both in theory and in experiments, however halo nucleic molecules have not been studied in either. We first show, using HeH^+, BeH, and MgH as examples, that with measurements of any two isotopologues of a molecule, we can determine crucial properties of a third isotopologue well within spectroscopic accuracy. We then use the extremely precise empirical information available for the low-lying states of 6,6Li_2, 6,7Li_2 and 7,7Li_2 to predict potentials and various properties of the halo nucleic molecule 11,11Li_2, along with isotopologues containing 3Li, 4Li, 5Li, 8Li, 9Li, 10Li, and 12Li. We believe that our predictions of the ro-vibrational energies are reliable for experiments for the first detection of a halo nucleic molecule. R. J. Le Roy, N. S. Dattani, J. A. Coxon, A. J. Ross, P. Crozet, C. Linton, J. Chem. Phys. 131, 204309 (2009). N. S. Dattani, R. J. Le Roy, J. Mol. Spec. 268, 199-210 (2011). M. Semczuk, X. Li, W. Gunton, M. Haw, N. S. Dattani, J. Witz, A. Mills, D. J. Jones, K. W. Madison, Phys. Rev. A 87, 052505 (2013) W. Gunton, M. Semczuk, N. S. Dattani, K. W. Madison, Phys. Rev. A 88, 062510 (2013)

  17. Semantic Borders and Incomplete Understanding.

    PubMed

    Silva-Filho, Waldomiro J; Dazzani, Maria Virgínia

    2016-03-01

    In this article, we explore a fundamental issue of Cultural Psychology, that is our "capacity to make meaning", by investigating a thesis from contemporary philosophical semantics, namely, that there is a decisive relationship between language and rationality. Many philosophers think that for a person to be described as a rational agent he must understand the semantic content and meaning of the words he uses to express his intentional mental states, e.g., his beliefs and thoughts. Our argument seeks to investigate the thesis developed by Tyler Burge, according to which our mastery or understanding of the semantic content of the terms which form our beliefs and thoughts is an "incomplete understanding". To do this, we discuss, on the one hand, the general lines of anti-individualism or semantic externalism and, on the other, criticisms of the Burgean notion of incomplete understanding - one radical and the other moderate. We defend our understanding that the content of our beliefs must be described in the light of the limits and natural contingencies of our cognitive capacities and the normative nature of our rationality. At heart, anti-individualism leads us to think about the fact that we are social creatures, living in contingent situations, with important, but limited, cognitive capacities, and that we receive the main, and most important, portion of our knowledge simply from what others tell us. Finally, we conclude that this discussion may contribute to the current debate about the notion of borders.

  18. Largely Enhanced Single-molecule Fluorescence in Plasmonic Nanogaps formed by Hybrid Silver Nanostructures

    PubMed Central

    Zhang, Jian; Lakowicz, Joseph R.

    2013-01-01

    It has been suggested that narrow gaps between metallic nanostructures can be practical for producing large field enhancement. We design a hybrid silver nanostructure geometry in which fluorescent emitters are sandwiched between silver nanoparticles and silver island film (SIF). A desired number of polyelectrolyte layers are deposited on the SIF surface before the self-assembly of a second silver nanoparticle layer. Layer-by-layer configuration provides a well-defined dye position. It allows us to study the photophyical behaviors of fluorophores in the resulting gap at the single molecule level. The enhancement factor of a fluorophore located in the gap is much higher than those on silver surfaces alone and on glass. These effects may be used for increased detectability of single molecules bound to surfaces which contain metallic structures for either biophysical studies or high sensitivity assays. PMID:23373787

  19. ENAM Mutations with Incomplete Penetrance

    PubMed Central

    Seymen, F.; Lee, K.-E.; Koruyucu, M.; Gencay, K.; Bayram, M.; Tuna, E.B.; Lee, Z.H.; Kim, J.-W.

    2014-01-01

    Amelogenesis imperfecta (AI) is a genetic disease affecting tooth enamel formation. AI can be an isolated entity or a phenotype of syndromes. To date, more than 10 genes have been associated with various forms of AI. We have identified 2 unrelated Turkish families with hypoplastic AI and performed mutational analysis. Whole-exome sequencing identified 2 novel heterozygous nonsense mutations in the ENAM gene (c.454G>T p.Glu152* in family 1, c.358C>T p.Gln120* in family 2) in the probands. Affected individuals were heterozygous for the mutation in each family. Segregation analysis within each family revealed individuals with incomplete penetrance or extremely mild enamel phenotype, in spite of having the same mutation with the other affected individuals. We believe that these findings will broaden our understanding of the clinical phenotype of AI caused by ENAM mutations. PMID:25143514

  20. Cybotactic behavior in the de Vries smectic-A* liquid-crystal structure formed by a silicon-containing molecule.

    PubMed

    Ryu, Seong Ho; Shin, Tae Joo; Gong, Tao; Shen, Yongqiang; Korblova, Eva; Shao, Renfan; Walba, David M; Clark, Noel A; Yoon, Dong Ki

    2014-03-01

    We have identified a metastable liquid-crystal (LC) structure in the de Vries smectic-A* phase (de Vries Sm-A*) formed by silicon-containing molecules under certain boundary conditions. The phase transition with the metastable structure was observed in a LC droplet placed on a planar aligned substrate and LCs confined in the groove of a silicon microchannel. During the rapid cooling step, a batonnet structure was generated as an intermediate and metastable state prior to the transition that yielded the thermodynamically stable toric focal conic domains. This distinctive behavior was characterized using depolarized reflection light microscopy and grazing incidence x-ray diffraction techniques. We concluded that the silicon groups in the molecules that formed the de Vries phase induced the formation of layered clusters called cybotactic structures. This observation is relevant to an exploration of the physical properties of cybotactic de Vries phases and gives a hint as to their optoelectronic applications.

  1. Cybotactic behavior in the de Vries smectic-A* liquid-crystal structure formed by a silicon-containing molecule

    NASA Astrophysics Data System (ADS)

    Ryu, Seong Ho; Shin, Tae Joo; Gong, Tao; Shen, Yongqiang; Korblova, Eva; Shao, Renfan; Walba, David M.; Clark, Noel A.; Yoon, Dong Ki

    2014-03-01

    We have identified a metastable liquid-crystal (LC) structure in the de Vries smectic-A* phase (de Vries Sm-A*) formed by silicon-containing molecules under certain boundary conditions. The phase transition with the metastable structure was observed in a LC droplet placed on a planar aligned substrate and LCs confined in the groove of a silicon microchannel. During the rapid cooling step, a batonnet structure was generated as an intermediate and metastable state prior to the transition that yielded the thermodynamically stable toric focal conic domains. This distinctive behavior was characterized using depolarized reflection light microscopy and grazing incidence x-ray diffraction techniques. We concluded that the silicon groups in the molecules that formed the de Vries phase induced the formation of layered clusters called cybotactic structures. This observation is relevant to an exploration of the physical properties of cybotactic de Vries phases and gives a hint as to their optoelectronic applications.

  2. Properties of complexes formed by Na(+), Mg(2+), and Fe(2+) binding with benzene molecules.

    PubMed

    Kolakkandy, Sujitha; Pratihar, Subha; Aquino, Adelia J A; Wang, Hai; Hase, William L

    2014-10-09

    A theoretical investigation was performed to study cation-π interactions in complexes of benzene (Bz) with cations, that is, M(z+)(Bz)n for M(z+) = Na(+), Mg(2+), Fe(2+) and n = 1-3, using MP2 theory with the 6-31+G* and 6-311++G** basis sets and the DFT/(B3LYP and B3LYP-D)/6-311++G** methods. Binding energies and structures of the complexes are reported. The splitting between the quintet and single states of the Fe(2+) complexes was found to depend on the number of benzene molecules in the complex and the complex's structure. All of the M(z+)(Bz) complexes prefer a half-sandwich geometry. A geometry with the cation sandwiched between the two benzene rings was found for the M(z+)(Bz)2 complexes, with the benzene rings either in an eclipsed or staggered conformation. An approximate cyclic structure, with the cation at its center, was found for three benzene molecules interacting with the cation. The cation-benzene binding energy is substantial and equal to 22, 108, and 151 kcal/mol for the Na(+)(Bz), Mg(2+)(Bz), and Fe(2+)(Bz) complexes, respectively. The strength of the interaction of the cation with an individual benzene molecule decreases as the number of benzene molecules bound to the cation increases; for example, it is 108 kcal/mol for Mg(2+)(Bz), but only 71 kcal/mol for Mg(2+)(Bz)3. There is a range of values for the M(z+)(Bz)n intermolecular vibrational frequencies; for example, they are ∼230-360 and ∼10-330 cm(-1) for the Mg(2+)(Bz) and Mg(2+)(Bz)3 complexes, respectively. Binding of the cation to benzene both red and blue shifts the benzene vibrational frequencies. This shifting is larger for the Mg(2+) and Fe(2+) complexes, as compared to those for Na(+), as a result of the former's stronger cation-benzene binding. The present study is an initial step to understand the possible importance of cation-π interactions for polycyclic aromatic hydrocarbon aggregation processes during soot formation.

  3. Interaction of epitaxial silicene with overlayers formed by exposure to Al atoms and O2 molecules.

    PubMed

    Friedlein, R; Van Bui, H; Wiggers, F B; Yamada-Takamura, Y; Kovalgin, A Y; de Jong, M P

    2014-05-28

    As silicene is not chemically inert, the study and exploitation of its electronic properties outside of ultrahigh vacuum environments require the use of insulating capping layers. In order to understand if aluminum oxide might be a suitable encapsulation material, we used high-resolution synchrotron photoelectron spectroscopy to study the interactions of Al atoms and O2 molecules, as well as the combination of both, with epitaxial silicene on thin ZrB2(0001) films grown on Si(111). The deposition of Al atoms onto silicene, up to the coverage of about 0.4 Al per Si atoms, has little effect on the chemical state of the Si atoms. The silicene-terminated surface is also hardly affected by exposure to O2 gas, up to a dose of 4500 L. In contrast, when Al-covered silicene is exposed to the same dose, a large fraction of the Si atoms becomes oxidized. This is attributed to dissociative chemisorption of O2 molecules by Al atoms at the surface, producing reactive atomic oxygen species that cause the oxidation. It is concluded that aluminum oxide overlayers prepared in this fashion are not suitable for encapsulation since they do not prevent but actually enhance the degradation of silicene.

  4. Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.

    PubMed

    Poncet-Montange, Guillaume; Zhan, Yanai; Bardenhagen, Jennifer P; Petrocchi, Alessia; Leo, Elisabetta; Shi, Xi; Lee, Gilbert R; Leonard, Paul G; Geck Do, Mary K; Cardozo, Mario G; Andersen, Jannik N; Palmer, Wylie S; Jones, Philip; Ladbury, John E

    2015-03-01

    Preventing histone recognition by bromodomains emerges as an attractive therapeutic approach in cancer. Overexpression of ATAD2 (ATPase family AAA domain-containing 2 isoform A) in cancer cells is associated with poor prognosis making the bromodomain of ATAD2 a promising epigenetic therapeutic target. In the development of an in vitro assay and identification of small molecule ligands, we conducted structure-guided studies which revealed a conformationally flexible ATAD2 bromodomain. Structural studies on apo-, peptide-and small molecule-ATAD2 complexes (by co-crystallization) revealed that the bromodomain adopts a 'closed', histone-compatible conformation and a more 'open' ligand-compatible conformation of the binding site respectively. An unexpected conformational change of the conserved asparagine residue plays an important role in driving the peptide-binding conformation remodelling. We also identified dimethylisoxazole-containing ligands as ATAD2 binders which aided in the validation of the in vitro screen and in the analysis of these conformational studies.

  5. Theoretical study on substituent and solvent effects for nanocubes formed with gear-shaped amphiphile molecules.

    PubMed

    Mashiko, T; Hiraoka, S; Nagashima, U; Tachikawa, M

    2017-01-04

    Gear-shaped amphiphile molecules (1) recently synthesized by Hiraoka et al. self-assemble into a hexameric structure, nanocubes (16), in 25% aqueous methanol due to a solvophobic effect. Here we have carried out molecular dynamic simulations to elucidate the stability of these hexameric capsules (16 and 26) in water, 25% aqueous methanol, and methanol. In all solvents, the 16 nanocubes are maintained for all trajectories. On the other hand, 26 was found to collapse for one trajectory in water and seven trajectories in 25% aqueous methanol. In a pure methanol solvent, 26 was found to collapse for all trajectories. The number of collapsed trajectories of 26 increased with the amount of methanol in the solvent. We therefore focused on the structure of the π-π stacking between pyridyl groups and the CH-π interactions between the methyl and pyridyl groups within the nanocube. Our study clearly shows the role played by the methanol solvent molecules in the assembly of the nanocube in terms of the substituent and solvent effects at the molecular level, and that these substituent and solvent effects are important for the self-assembly of the nanocubes.

  6. Incomplete periacetabular acetabuloplasty

    PubMed Central

    2014-01-01

    Background Residual acetabular dysplasia is one of the most common complications after treatment for developmental dysplasia of the hip. The acetabular growth response after reduction of a dislocated hip varies. The options are to wait and add a redirectional osteotomy as a secondary procedure at an older age, or to perform a primary acetabuloplasty at the time of the open reduction to stimulate acetabular development. We present the early results of such a procedure—open reduction and an incomplete periacetabular acetabuloplasty—as a one-stop procedure for developmental dysplasia of the hip. Patients and methods We retrospectively reviewed the results obtained with 55 hips (in 48 patients, 43 of them girls) treated between September 2004 and February 2011. This cohort included late presentations and failures of nonoperative treatment and excluded unsuccessful previous surgical treatment (including closed reductions), neuromuscular disease, and other teratological conditions. Patients were treated once the ossific nucleus was present or when they reached one year of age. 31 cases were late presentations while 17 represented failures of nonoperative treatment. The mean age of the patients at surgery was 1.3 (0.6–2.6) years. The mean follow-up period was 4 (2–8) years. According to the IHDI classification, 1 was grade I, 9 were grade II, 13 were grade III, and 32 were grade IV. Results The mean acetabular index fell from 38 (23–49) preoperatively to 21 (10–27) at the last follow-up. There were no infections, nerve palsies, or graft extrusions. None of the cases required secondary surgery for residual acetabular dysplasia. 8 patients developed avascular necrosis (AVN) of grade II or more. The incidence of AVN was significantly associated with previous, failed nonoperative treatment. 1 patient developed coxa magna requiring shelf arthroplasty 4 years after the index procedure and 1 patient with lateral growth arrest required medial screw epiphysiodesis

  7. Single-molecule visualization of dynamic transitions of pore-forming peptides among multiple transmembrane positions

    PubMed Central

    Li, Ying; Qian, Zhenyu; Ma, Li; Hu, Shuxin; Nong, Daguan; Xu, Chunhua; Ye, Fangfu; Lu, Ying; Wei, Guanghong; Li, Ming

    2016-01-01

    Research on the dynamics of single-membrane proteins remains underdeveloped due to the lack of proper approaches that can probe in real time the protein's insertion depth in lipid bilayers. Here we report a single-molecule visualization method to track both vertical insertion and lateral diffusion of membrane proteins in supported lipid bilayers by exploiting the surface-induced fluorescence attenuation (SIFA) of fluorophores. The attenuation follows a d−4 dependency, where d is the fluorophore-to-surface distance. The method is validated by observing the antimicrobial peptide LL-37 to transfer among five transmembrane positions: the surface, the upper leaflet, the centre, the lower leaflet and the bottom of the lipid bilayer. These results demonstrate the power of SIFA to study protein-membrane interactions and provide unprecedented in-depth understanding of molecular mechanisms of the insertion and translocation of membrane proteins. PMID:27686409

  8. Recent results for electron scattering from biomolecules and molecules formed due to plasma treatment of biomass

    NASA Astrophysics Data System (ADS)

    Brunger, Michael

    2016-09-01

    We have been concentrating our recent experimental studies, for determining absolute cross sections, on both biomolecules (e.g. pyrimidine and benzoquinone) and molecules that result when biomass undergoes treatment by plasmas (e.g. phenol and furfural). All this work was supported and informed by computations from the Brazilian SMC groups and the Madrid IAM-SCAR group. A major rationale for these investigations was to provide cross section data for relevant modelling studies, and in this talk I will also present some results from those modelling studies. Possible further investigations will be canvassed in this presentation. Work done in conjunction with: D. B. Jones, L. Campbell, R. D. White, S. J. Buckman, M. A. P. Lima, M. C. A. Lopes, M. H. F. Bettega, M. T. do N. Varella, R. F. da Costa, G. García, P. Limão-Vieira, D. H. Madison, O. Ingólfsson and many other friends and colleagues.

  9. Bent LC molecules with a 60° central core that can form B7 and B2 phases (Presentation Recording)

    NASA Astrophysics Data System (ADS)

    Watanabe, Junji

    2015-10-01

    We synthesized small-angle bent-core liquid-crystalline (LC) molecules based on a 1,2-bis(phenylethylene) benzene central core, containing seven aromatic rings and alkoxy tails with carbon numbers of 12, 16 and 18. This ortho-bistolane central core offers a 60° bend angle. Irrespective of this unusually small angle, these molecules can form banana smectic phases with a ferroelectric B7-antiferroelectric B2 phase sequence upon cooling as clarified from the micoscopic, X-ray and opto-electric observations. This indicates that despite of the low bend angle of 60°, these are able to be still packed into a layer with the polar bent direction parallel to the layer like ordinal banana molecules. The present result is striking since it had been believed that banana phases can only be stabilized when the bending angle is in the range from 110-140°, providing additional insight into the nature of banana-shaped molecules.

  10. Study to explore the mechanism to form inclusion complexes of β-cyclodextrin with vitamin molecules

    PubMed Central

    Saha, Subhadeep; Roy, Aditi; Roy, Kanak; Roy, Mahendra Nath

    2016-01-01

    Host–guest inclusion complexes of β-cyclodextrin with two vitamins viz., nicotinic acid and ascorbic acid in aqueous medium have been explored by reliable spectroscopic, physicochemical and calorimetric methods as stabilizer, carrier and regulatory releaser of the guest molecules. Job’s plots have been drawn by UV-visible spectroscopy to confirm the 1:1 stoichiometry of the host-guest assembly. Stereo-chemical nature of the inclusion complexes has been explained by 2D NMR spectroscopy. Surface tension and conductivity studies further support the inclusion process. Association constants for the vitamin-β-CD inclusion complexes have been calculated by UV-visible spectroscopy using both Benesi–Hildebrand method and non-linear programme, while the thermodynamic parameters have been estimated with the help of van’t Hoff equation. Isothermal titration calorimetric studies have been performed to determine the stoichiometry, association constant and thermodynamic parameters with high accuracy. The outcomes reveal that there is a drop in ΔSo, which is overcome by higher negative value of ΔHo, making the overall inclusion process thermodynamically favorable. The association constant is found to be higher for ascorbic acid than that for nicotinic acid, which has been explained on the basis of their molecular structures. PMID:27762346

  11. Nanopore integrated with Au clusters formed under electron beam irradiation for single molecule analysis

    NASA Astrophysics Data System (ADS)

    Choi, Seong Soo; Park, Myoung Jin; Han, Chul Hee; Kim, Sung In; Yoo, Jung Ho; Park, Kyung Jin; Park, Nam Kyou; Kim, Yong-Sang

    2016-02-01

    Recently the single molecules such as protein and deoxyribonucleic acid (DNA) have been successfully characterized using a solidstate nanopore with an electrical detection technique. However, the optical plasmonic nanopore has yet to be fabricated. The optical detection technique can be better utilized as next generation ultrafast geneome sequencing devices due to the possible utilization of the current optical technique for genome sequencing. In this report, we have investigated the Au nanopore formation under the electron beam irradiation on an Au aperture. The circular-type nanoopening with ~ 5 nm diameter on the diffused membrane is fabricated by using 2 keV electron beam irradiation by using field emission scanning electron microscopy (FESEM). We found the Au cluster on the periphery of the drilled aperture under a 2 keV electron beam irradiation. Immediately right after electron beam irradiation, no Au cluster and no Au crystal lattice structure on the diffused plane are observed. However, after the sample was kept for ~ 6 months under a room environment, the Au clusters are found on the diffused membrane and the Au crystal lattice structures on the diffused membrane are also found using high resolution transmission electron microscopy. These phenomena can be attributed to Ostwald ripening. In addition, the Au nano-hole on the 40 nm thick Au membrane was also drilled by using 200 keV scanning transmission electron microscopy.

  12. Study to explore the mechanism to form inclusion complexes of β-cyclodextrin with vitamin molecules

    NASA Astrophysics Data System (ADS)

    Saha, Subhadeep; Roy, Aditi; Roy, Kanak; Roy, Mahendra Nath

    2016-10-01

    Host–guest inclusion complexes of β-cyclodextrin with two vitamins viz., nicotinic acid and ascorbic acid in aqueous medium have been explored by reliable spectroscopic, physicochemical and calorimetric methods as stabilizer, carrier and regulatory releaser of the guest molecules. Job’s plots have been drawn by UV-visible spectroscopy to confirm the 1:1 stoichiometry of the host-guest assembly. Stereo-chemical nature of the inclusion complexes has been explained by 2D NMR spectroscopy. Surface tension and conductivity studies further support the inclusion process. Association constants for the vitamin-β-CD inclusion complexes have been calculated by UV-visible spectroscopy using both Benesi–Hildebrand method and non-linear programme, while the thermodynamic parameters have been estimated with the help of van’t Hoff equation. Isothermal titration calorimetric studies have been performed to determine the stoichiometry, association constant and thermodynamic parameters with high accuracy. The outcomes reveal that there is a drop in ΔSo, which is overcome by higher negative value of ΔHo, making the overall inclusion process thermodynamically favorable. The association constant is found to be higher for ascorbic acid than that for nicotinic acid, which has been explained on the basis of their molecular structures.

  13. Intercellular adhesion molecule-1 (ICAM-1) deficiency protects mice against severe forms of experimentally induced colitis

    PubMed Central

    Bendjelloul, F; Malý, P; Mandys, V; Jirkovská, M; Prokešová, L; Tučková, L; Tlaskalová-Hogenová, H

    2000-01-01

    ICAM-1 (CD54), the ligand for LFA-1 and Mac-1, is up-regulated during inflammatory reaction on the activated vascular endothelium. To determine its role in intestinal inflammation, we induced acute experimental colitis in mice with a deleted ICAM-1 gene, by feeding them with 3% dextran sodium sulphate (DSS) in drinking water for 7 days. Chronic colitis was elicited by DSS similarly, followed by 2 weeks with water. In the acute phase of inflammation, ICAM-1-deficient mice exhibited a significantly lower mortality rate (5%) than control C57Bl/6J mice (35%). Control animals, but not the ICAM-1-deficient mice, exhibited diarrhoea and rectal bleeding. Histological examination of large-bowel samples evaluated the intensity of inflammatory changes, and type and extent of mucosal lesions. In the acute phase, 33.3% of samples from ICAM-1-deficient mice exhibited mucosal defects (flat and fissural ulcers), predominantly mild to moderate inflammatory infiltrate within the lamina propria mucosae and lower grades of mucosal lesions. Much stronger inflammatory changes were present in control animals, flat ulcers (sometimes multiple) and fissural ulcers being observed in 62.5% of samples. Mucosal inflammatory infiltrate was moderate to severe, typically with higher grades of mucosal lesions. In chronic colitis, smaller inflammatory changes were found in the large bowel. The two mouse strains differed, the chronic colitis being accompanied by an increased serum level of anti-epithelial IgA autoantibodies in C57Bl/6 control mice but not in ICAM-1-deficient mice. These findings provide direct evidence of the participation of ICAM-1 molecule in the development of experimentally induced intestinal inflammation. PMID:10606964

  14. Catalysis in the 3rd Dimension: How Organic Molecules May be Formed

    NASA Technical Reports Server (NTRS)

    Freund, Friedemann; DeVincenzi, D. (Technical Monitor)

    2001-01-01

    Catalysis is often little more than a word to phenomenologically describe the fact that a reaction follows a pat1 that leads to products of an unexpected kind or of unexpected yield. Low activation energy barriers for intermediates are recognized as the most likely cause why a system deviates from the thermodynamic pull towards minimizing its free energy and ends up in a metastable state. Seldom is the mechanism known. This i: particularly true for heterogeneous catalysis under hydrothermal conditions with minerals as catalysts. It is commonly assumed that catalytic action takes place across solid-fluid interfaces and that, on the atomic level, interfaces are just 2-dimensional contacts. This makes it difficult to understand, for instance, the assembly of long-chain carboxylic (fatty) acids. 3y studying single crystals that grew from a melt in the presence of H2O and CO2, we can show: (1) that numerals take up the fluid components into solid solution, (2) that some-thing happens converting them to -educedH and C, (3) that C atoms segregate into dislocations and tie C-C bonds. The products are medium-to-long chain Cn protomolecules, with some C-H attached, pre-assembled in the dislocations. Upon solvent extraction, these proto-molecules turn into carboxylic and dicarboxylic acids. This observation suggests that, in a very elementary step, catalysis under hydrothermal conditions leading to fatty acids involves the pre-assembly of Cn entities in the interface that is not 2-D but extends into the 3rd dimension, with dislocations as synthesis sites.

  15. A Survey of Large Molecules of Biological Interest toward Selected High Mass Star Forming Regions

    NASA Technical Reports Server (NTRS)

    Remijan, A.; Shiao, Y.-S.; Friedel, D. N.; Meier, D. S.; Snyder, L. E.

    2004-01-01

    We have surveyed three high mass Galactic star forming regions for interstellar methanol (CH3OH), formic acid (HCOOH), acetic acid (CH3COOH), methyl formate (HCOOCH3), methyl cyanide (CH3CN), and ethyl cyanide (CH3CH2CN) with the BIMA Array. From our observations, we have detected two new sources of interstellar HCOOH toward the hot core regions G19.61-0.23 and W75N. We have also made the first detections of CH3CH2CN and HCOOCH3 toward G19.61-0.23. The relative HCOOH/HCOOCH3 abundance ratio toward G19.61-0.23 is 0.18 which is comparable to the abundance ratios found by Liu and colleagues toward Sgr B2(N-LMH), Orion and W51(approximately 0.10). We have made the first detection of HCOOCH3 toward W75N. The relative HCOOH/HCOOCH3 abundance ratio toward W75N is 0.26 which is more than twice as large as the abundance ratios found by Liu and colleagues. Furthermore, the hot core regions around W75N show a chemical differentiation between the O and N cores similar to what is seen toward the Orion Hot Core and Compact Ridge and W3(OH) and W3(H2O). It is also apparent from our observations that the high mass star forming region G45.47+0.05 does not contain any compact hot molecular core and as a consequence its chemistry may be similar to cold dark clouds. Finally, the formation of CH3COOH appears to favor HMCs with well mixed N and O, despite the fact that CH3COOH does not contain a N atom. If proved to be true, this is an important constraint on CH3COOH formation and possibly other structurally similar biomolecules.

  16. Antibody nanoparticle dispersions formed with mixtures of crowding molecules retain activity and in vivo bioavailability.

    PubMed

    Miller, Maria A; Khan, Tarik A; Kaczorowski, Kevin J; Wilson, Brian K; Dinin, Aileen K; Borwankar, Ameya U; Rodrigues, Miguel A; Truskett, Thomas M; Johnston, Keith P; Maynard, Jennifer A

    2012-10-01

    Monoclonal antibodies continue to command a large market for treatment of a variety of diseases. In many cases, the doses required for therapeutic efficacy are large, limiting options for antibody delivery and administration. We report a novel formulation strategy based on dispersions of antibody nanoclusters that allows for subcutaneous injection of highly concentrated antibody (≈ 190 mg/mL). A solution of monoclonal antibody 1B7 was rapidly frozen and lyophilized using a novel spiral-wound in-situ freezing technology to generate amorphous particles. Upon gentle stirring, a translucent dispersion of approximately 430 nm protein clusters with low apparent viscosity (≈ 24 cp) formed rapidly in buffer containing the pharmaceutically acceptable crowding agents such as trehalose, polyethylene glycol, and n-methyl-2-pyrrolidone. Upon in vitro dilution of the dispersion, the nanoclusters rapidly reverted to monomeric protein with full activity, as monitored by dynamic light scattering and antigen binding. When administered to mice as an intravenous solution, subcutaneous solution, or subcutaneous dispersion at similar (4.6-7.3 mg/kg) or ultra-high dosages (51.6 mg/kg), the distribution and elimination kinetics were within error and the protein retained full activity. Overall, this method of generating high-concentration, low-viscosity dispersions of antibody nanoclusters could lead to improved administration and patient compliance, providing new opportunities for the biotechnology industry.

  17. Antibody nanoparticle dispersions formed with mixtures of crowding molecules retain activity and in vivo bioavailability

    PubMed Central

    Miller, Maria A.; Khan, Tarik A.; Kaczorowski, Kevin J.; Wilson, Brian K.; Dinin, Aileen K.; Borwankar, Ameya U.; Rodrigues, Miguel A.; Truskett, Thomas M.; Johnston, Keith P.; Maynard, Jennifer A.

    2013-01-01

    Monoclonal antibodies continue to command a large market for treatment of a variety of diseases. In many cases, the doses required for therapeutic efficacy are large, limiting options for antibody delivery and administration. We report a novel formulation strategy based on dispersions of antibody nanoclusters that allows for subcutaneous injection of highly concentrated antibody (~190 mg/ml). A solution of monoclonal antibody 1B7 was rapidly frozen and lyophilized using a novel spiral-wound in situ freezing technology (SWIFT) to generate amorphous particles. Upon gentle stirring, a translucent dispersion of ~430 nm protein clusters low apparent viscosity (~24 cp) formed rapidly in buffer containing the pharmaceutically acceptable crowding agents, trehalose, polyethylene glycol and n-methyl-2-pyrrolidone. Upon in vitro dilution of the dispersion, the nanoclusters rapidly reverted to monomeric protein with full activity, as monitored by dynamic light scattering and antigen binding. When administered to mice as an intravenous solution, subcutaneous solution or subcutaneous dispersion at similar (4.6-7.3 mg/kg) or ultra-high dosages (51.6 mg/kg), the distribution and elimination kinetics were within error and the protein retained full activity. Overall, this method of generating high-concentration, low-viscosity dispersions of antibody nanoclusters could lead to improved administration and patient compliance, providing new opportunities for the biotechnology industry. PMID:22777686

  18. A Global View of Molecule-forming Clouds in the Galaxy

    NASA Astrophysics Data System (ADS)

    Gibson, Steven J.; Bell, Aaron Christopher; Newton, Jonathan H.; Howard, Ward; Jolly, Christian; Spraggs, Mary; Hughes, James

    2015-08-01

    The gas in galactic disks occurs in a wide range of temperatures and densities, most of which are unsuitable for star formation. Somehow, diffuse atomic clouds are collected into colder, denser molecular clouds that can collapse under their own gravity. The molecular condensation process is not directly observable, but it most likely arises in cold, quiescent pockets of atomic hydrogen (HI) gas, which over time will form molecular hydrogen (H2) followed by more observable molecular species. We have mapped cold 21cm line HI self-absorption (HISA) over more than 90% of the Milky Way's disk at arcminute resolution with the International Galactic Plane Survey. To probe the formation of H2 clouds, we have made a detailed comparison of the IGPS HISA distribution with available 12CO J=1-0 line emission surveys. We find that few HISA features in the outer Galaxy have CO at the same position and velocity, while most inner-Galaxy HISA does have overlapping CO. But chance superpositions of unrelated HISA and CO at different distances are much more likely in the inner Galaxy, and if these are accounted for, the majority of inner-Galaxy HISA may also be CO-free. Standard equilibrium cloud models cannot explain very cold HI in many HISA features without molecular shielding, so these clouds may instead have significant CO-dark H2 to keep them cool. A significant number of these clouds are found downstream of spiral shocks where H2 formation might be expected, with CO formation taking somewhat longer. Support for this work was provided by the U.S. National Science Foundation, NASA, Western Kentucky University, and the Gatton Academy.

  19. Incompletely compacted equilibrated ordinary chondrites

    SciTech Connect

    Sasso, M.R.; Macke, R.J.; Boesenberg, J.S.; Britt, D.T.; Rovers, M.L.; Ebel, D.S.; Friedrich, J.M.

    2010-01-22

    We document the size distributions and locations of voids present within five highly porous equilibrated ordinary chondrites using high-resolution synchrotron X-ray microtomography ({mu}CT) and helium pycnometry. We found total porosities ranging from {approx}10 to 20% within these chondrites, and with {mu}CT we show that up to 64% of the void space is located within intergranular voids within the rock. Given the low (S1-S2) shock stages of the samples and the large voids between mineral grains, we conclude that these samples experienced unusually low amounts of compaction and shock loading throughout their entire post accretionary history. With Fe metal and FeS metal abundances and grain size distributions, we show that these chondrites formed naturally with greater than average porosities prior to parent body metamorphism. These materials were not 'fluffed' on their parent body by impact-related regolith gardening or events caused by seismic vibrations. Samples of all three chemical types of ordinary chondrites (LL, L, H) are represented in this study and we conclude that incomplete compaction is common within the asteroid belt.

  20. The analysis of incomplete data.

    NASA Technical Reports Server (NTRS)

    Hartley, H. O.; Hocking, R. R.

    1971-01-01

    In this paper, we attempt to provide a simple taxonomy for incomplete-data problems and at the same time develop unified methods of analysis. The emphasis is on techniques which are natural extensions of the complete-data analysis and which will handle rather general classes of incomplete-data problems as opposed to custom-made techniques for special problems. The principle of estimation is either maximum likelihood or is at least based on maximum likelihood.

  1. Advanced incomplete factorization algorithms for Stiltijes matrices

    SciTech Connect

    Il`in, V.P.

    1996-12-31

    The modern numerical methods for solving the linear algebraic systems Au = f with high order sparse matrices A, which arise in grid approximations of multidimensional boundary value problems, are based mainly on accelerated iterative processes with easily invertible preconditioning matrices presented in the form of approximate (incomplete) factorization of the original matrix A. We consider some recent algorithmic approaches, theoretical foundations, experimental data and open questions for incomplete factorization of Stiltijes matrices which are {open_quotes}the best{close_quotes} ones in the sense that they have the most advanced results. Special attention is given to solving the elliptic differential equations with strongly variable coefficients, singular perturbated diffusion-convection and parabolic equations.

  2. Endothelial cells proactively form microvilli-like membrane projections upon intercellular adhesion molecule 1 engagement of leukocyte LFA-1.

    PubMed

    Carman, Christopher V; Jun, Chang-Duk; Salas, Azucena; Springer, Timothy A

    2003-12-01

    Specific leukocyte/endothelial interactions are critical for immunity and inflammation, yet the molecular details of this interaction interface remain poorly understood. Thus, we investigated, with confocal microscopy, the distribution dynamics of the central adhesion molecules ICAM-1 and LFA-1 in this context. Monolayers of activated HUVECs stained with fluorescent anti-ICAM-1 Fabs or Chinese hamster ovary-K1 cells expressing ICAM-1-green fluorescent protein were allowed to bind LFA-1-bearing monocytes, neutrophils, or K562 LFA-1 transfectants. ICAM-1 was rapidly relocalized to newly formed microvilli-like membrane projections in response to binding LFA-1 on leukocytes. These ICAM-1-enriched projections encircled the leukocytes extending up their sides and clustered LFA-1 underneath into linear tracks. Projections formed independently of VCAM-1/very late Ag 4 interactions, shear, and proactive contributions from the LFA-1-bearing cells. In the ICAM-1-bearing endothelial cells, projections were enriched in actin but not microtubules, required intracellular calcium, and intact microfilament and microtubule cytoskeletons and were independent of Rho/Rho kinase signaling. Disruption of these projections with cytochalasin D, colchicine, or BAPTA-AM had no affect on firm adhesion. These data show that in response to LFA-1 engagement the endothelium proactively forms an ICAM-1-enriched cup-like structure that surrounds adherent leukocytes but is not important for firm adhesion. This finding leaves open a possible role in leukocyte transendothelial migration, which would be consistent with the geometry and kinetics of formation of the cup-like structure.

  3. Closely related form I ribulose bisphosphate carboxylase/oxygenase molecules that possess different CO2/O2 substrate specificities.

    PubMed

    Horken, K M; Tabita, F R

    1999-01-15

    The deduced primary sequence (cbbL and cbbS) of form I ribulose 1, 5-bisphosphate carboxylase/oxygenase (rubisco) from Bradyrhizobium japonicum places this enzyme within the Type IC subgroup of red-like rubisco enzymes. In addition, B. japonicum appears to organize most of the structural genes of the Calvin-Benson-Bassham (CBB) pathway in at least one major operon. Functional expression and characterization of the B. japonicum and Xanthobacter flavus enzymes from this group revealed that these molecules exhibit diverse kinetic properties despite their relatively high degree of sequence relatedness. Of prime importance was the fact that these closely related enzymes exhibited CO2 and O2 substrate specificities that varied from relatively low values [tau = (VcKo)/(VoKc) = 45] to values that approximated those obtained for higher plants (tau = 75). These results, combined with the metabolic and genetic versatility of the organisms from which these enzymes were derived, suggest a potential rich resource for future biological selection and structure-function studies aimed at elucidating structural features that govern key enzymological properties of rubisco.

  4. Involvement of pore-forming molecules in immune defense and development of the Mediterranean mussel (Mytilus galloprovincialis).

    PubMed

    Estévez-Calvar, Noelia; Romero, Alejandro; Figueras, Antonio; Novoa, Beatriz

    2011-10-01

    The membrane attack complex and perforin (MACPF) superfamily is one of the largest families of pore-forming molecules. Although MACPF proteins are able to destruct invading microbes, several MACPF proteins play roles in embryonic development, neural migration or tumor suppression. We describe two apextrin-like proteins (ApelB and ApelP) and one MACPF-domain-containing protein (Macp) in Mytilus galloprovincialis. The two apextrin-like proteins did not present any conserved domain. The Macp protein contained the membrane/attack complex domain and its signature motif. Gene expression during larval development was analyzed by RT-PCR. There was a stage-specific up-regulation of the three proteins, suggesting that they play a role in development. Apextrin-like proteins were highly expressed at blastula and trochophore stage, whereas Macp was expressed at veliger stage. RT-PCR revealed up-regulation of the three genes in tissues and hemocytes from adults treated with bacteria and pathogen-associated molecular patterns, suggesting that they may be involved in the immune response.

  5. Theoretical binding affinities and spectroscopy of complexes formed by cyclobis(paraquat- p-anthrancene) with some pharmaceutical molecules

    NASA Astrophysics Data System (ADS)

    Ren, Xin; Luo, Zhouyang; Du, Jinpei; Wu, Shi

    2010-05-01

    Theoretical investigation on the stabilities and spectroscopic properties of the complexes formed by cyciobis(paraquat- p-anthracene) with pharmaceutical molecules were performed using the semi-empirical PM3 and B3LYP/3-21G methods. Based on the B3LYP/3-21G optimized geometries, the energies of the complexes were calculated at B3LYP/6-31G( d) level. The binding energies of the complexes were computed after the correction of basis set superposition error (BSSE). The energy gaps of the complexes are decreased due to the formation of the hydrogen bonds. The stretching vibrations of the C-H bonds adjacent to the hydrogen bonds in the IR spectra of the complexes calculated with PM3 method are red-shifted compared with those of the host. The chemical shifts of α-C and β-C atoms in the complexes calculated at B3LYP/3-21G level are shifted downfield due to the formation of the hydrogen bonds and the electron-withdrawing effect of the nitrogen atoms. The aromaticities of the complexes are improved because of the enlargement of the conjugation system and the overlap of electron cloud based on the nuclear independent chemical shifts (NICS) calculated at B3LYP/3-21G level.

  6. The Behavior of Warm Molecules in Planet-forming Disks and CHESS: a Pathfinder UV Spectrograph for the LUVOIR Surveyor

    NASA Astrophysics Data System (ADS)

    Hoadley, Keri; France, Kevin

    2017-01-01

    Understanding the evolution of gas over the lifetime of protoplanetary disks provides us with important clues about how planet formation mechanisms drive the diversity of exoplanetary systems observed to date. In the first part of my talk, I will discuss how we use emission line observations of molecular hydrogen (H2) in the far-ultraviolet (far-UV) with the Cosmic Origins Spectrograph (COS) on the Hubble Space Telescope to study the warm molecular regions (a < 10 AU) of planet-forming disks. We compare the observations with analytic disk models that produce synthetic H2 profiles, and we statistically determine the disk representations that best replicate the data. I will discuss the results of our comparisons and how the modeled radial distributions of H2 in the disk help provide important constraints on the effective density of gas left in the inner disk of protoplanetary disks at various disk evolutionary stages. Finally, I will talk about follow-up studies that look to connect the warm, UV-pumped molecular populations of the inner disk to thermally-excited molecules observed in similar regions of the disk in the near- to mid-IR.In the second part of my talk, I will discuss the observational requirements in the UV and IR band passes to gain further insights into the behavior of the warm, gaseous protoplanetary disk, focusing specifically on a spectrograph concept for the next-generation LUVOIR Surveyor. I will discuss a testbed instrument, the Colorado High-resolution Echelle Stellar Spectrograph (CHESS), built as a demonstration of one component of the LUVOIR spectrograph and new technological improvements to UV optical components for the next generation of near- to far-UV astrophysical observatories. CHESS is a far-UV sounding rocket experiment designed to probe the warm and cool atoms and molecules near sites of recent star formation in the local interstellar medium. I will talk about the science goals, design, research and development (R&D) components, and

  7. The origins of life -- the 'protein interaction world' hypothesis: protein interactions were the first form of self-reproducing life and nucleic acids evolved later as memory molecules.

    PubMed

    Andras, Peter; Andras, Csaba

    2005-01-01

    The 'protein interaction world' (PIW) hypothesis of the origins of life assumes that life emerged as a self-reproducing and expanding system of protein interactions. In mainstream molecular biology, 'replication' refers to the material copying of molecules such as nucleic acids. However, PIW is conceptualized as an abstract communication system constituted by the interactions between proteins, in which 'replication' happens at the level of self-reproduction of these interactions between proteins. Densely concentrated peptide interaction systems may have reproduced and expanded as 'protocell' vesicles surrounded by lipid bi-layer membranes. Protocells led to the emergence of proto-RNA molecules of greater chemical stability which served as chemically differentiated 'memories' of peptide interaction states, thereby facilitating the reproduction and expansion of protocells. Simplification-driven expansion led to the selection of biotic amino acids and the reduction of the typical RNA alphabet to the four usual bases (A, C, G and U). Dense interactions between RNA molecules led to the emergence of the RNA interaction subsystem of the cell, and to the emergence of 'memories' of RNA interactions in the form of DNA molecules with greater chemical stability. The expansion of DNA molecule interactions led to the dense clustering and encapsulation of DNA molecules within the cell nucleus. RNA molecules therefore serve as memories of protein interactions and DNA molecules are memories of RNA interactions. We believe that the PIW hypothesis is more evolutionarily plausible than the mainstream RNA world hypothesis, and has greater explanatory power.

  8. Room temperature spectrally resolved single-molecule spectroscopy reveals new spectral forms and photophysical versatility of aequorea green fluorescent protein variants.

    PubMed

    Blum, Christian; Meixner, Alfred J; Subramaniam, Vinod

    2004-12-01

    It is known from ensemble spectroscopy at cryogenic temperatures that variants of the Aequorea green fluorescent protein (GFP) occur in interconvertible spectroscopically distinct forms which are obscured in ensemble room temperature spectroscopy. By analyzing the fluorescence of the GFP variants EYFP and EGFP by spectrally resolved single-molecule spectroscopy we were able to observe spectroscopically different forms of the proteins and to dynamically monitor transitions between these forms at room temperature. In addition to the predominant EYFP B-form we have observed the blue-shifted I-form thus far only seen at cryogenic temperatures and have followed transitions between these forms. Further we have identified for EYFP and for EGFP three more, so far unknown, forms with red-shifted fluorescence. Transitions between the predominant forms and the red-shifted forms show a dark time which indicates the existence of a nonfluorescent intermediate. The spectral position of the newly-identified red-shifted forms and their formation via a nonfluorescent intermediate hint that these states may account for the possible photoactivation observed in bulk experiments. The comparison of the single-protein spectra of the red-shifted EYFP and EGFP forms with single-molecule fluorescence spectra of DsRed suggest that these new forms possibly originate from an extended chromophoric pi-system analogous to the DsRed chromophore.

  9. Incomplete intestinal absorption of fructose.

    PubMed Central

    Kneepkens, C M; Vonk, R J; Fernandes, J

    1984-01-01

    Intestinal D-fructose absorption in 31 children was investigated using measurements of breath hydrogen. Twenty five children had no abdominal symptoms and six had functional bowel disorders. After ingestion of fructose (2 g/kg bodyweight), 22 children (71%) showed a breath hydrogen increase of more than 10 ppm over basal values, indicating incomplete absorption: the increase averaged 53 ppm, range 12 to 250 ppm. Four of these children experienced abdominal symptoms. Three of the six children with bowel disorders showed incomplete absorption. Seven children were tested again with an equal amount of glucose, and in three of them also of galactose, added to the fructose. The mean maximum breath hydrogen increases were 5 and 10 ppm, respectively, compared with 103 ppm after fructose alone. In one boy several tests were performed with various sugars; fructose was the only sugar incompletely absorbed, and the effect of glucose on fructose absorption was shown to be dependent on the amount added. It is concluded that children have a limited absorptive capacity for fructose. We speculate that the enhancing effect of glucose and galactose on fructose absorption may be due to activation of the fructose carrier. Apple juice in particular contains fructose in excess of glucose and could lead to abdominal symptoms in susceptible children. PMID:6476870

  10. Profile Likelihood and Incomplete Data.

    PubMed

    Zhang, Zhiwei

    2010-04-01

    According to the law of likelihood, statistical evidence is represented by likelihood functions and its strength measured by likelihood ratios. This point of view has led to a likelihood paradigm for interpreting statistical evidence, which carefully distinguishes evidence about a parameter from error probabilities and personal belief. Like other paradigms of statistics, the likelihood paradigm faces challenges when data are observed incompletely, due to non-response or censoring, for instance. Standard methods to generate likelihood functions in such circumstances generally require assumptions about the mechanism that governs the incomplete observation of data, assumptions that usually rely on external information and cannot be validated with the observed data. Without reliable external information, the use of untestable assumptions driven by convenience could potentially compromise the interpretability of the resulting likelihood as an objective representation of the observed evidence. This paper proposes a profile likelihood approach for representing and interpreting statistical evidence with incomplete data without imposing untestable assumptions. The proposed approach is based on partial identification and is illustrated with several statistical problems involving missing data or censored data. Numerical examples based on real data are presented to demonstrate the feasibility of the approach.

  11. Dynamics of water around the complex structures formed between the KH domains of far upstream element binding protein and single-stranded DNA molecules

    NASA Astrophysics Data System (ADS)

    Chakraborty, Kaushik; Bandyopadhyay, Sanjoy

    2015-07-01

    Single-stranded DNA (ss-DNA) binding proteins specifically bind to the single-stranded regions of the DNA and protect it from premature annealing, thereby stabilizing the DNA structure. We have carried out atomistic molecular dynamics simulations of the aqueous solutions of two DNA binding K homology (KH) domains (KH3 and KH4) of the far upstream element binding protein complexed with two short ss-DNA segments. Attempts have been made to explore the influence of the formation of such complex structures on the microscopic dynamics and hydrogen bond properties of the interfacial water molecules. It is found that the water molecules involved in bridging the ss-DNA segments and the protein domains form a highly constrained thin layer with extremely retarded mobility. These water molecules play important roles in freezing the conformational oscillations of the ss-DNA oligomers and thereby forming rigid complex structures. Further, it is demonstrated that the effect of complexation on the slow long-time relaxations of hydrogen bonds at the interface is correlated with hindered motions of the surrounding water molecules. Importantly, it is observed that the highly restricted motions of the water molecules bridging the protein and the DNA components in the complexed forms originate from more frequent hydrogen bond reformations.

  12. Dynamics of water around the complex structures formed between the KH domains of far upstream element binding protein and single-stranded DNA molecules.

    PubMed

    Chakraborty, Kaushik; Bandyopadhyay, Sanjoy

    2015-07-28

    Single-stranded DNA (ss-DNA) binding proteins specifically bind to the single-stranded regions of the DNA and protect it from premature annealing, thereby stabilizing the DNA structure. We have carried out atomistic molecular dynamics simulations of the aqueous solutions of two DNA binding K homology (KH) domains (KH3 and KH4) of the far upstream element binding protein complexed with two short ss-DNA segments. Attempts have been made to explore the influence of the formation of such complex structures on the microscopic dynamics and hydrogen bond properties of the interfacial water molecules. It is found that the water molecules involved in bridging the ss-DNA segments and the protein domains form a highly constrained thin layer with extremely retarded mobility. These water molecules play important roles in freezing the conformational oscillations of the ss-DNA oligomers and thereby forming rigid complex structures. Further, it is demonstrated that the effect of complexation on the slow long-time relaxations of hydrogen bonds at the interface is correlated with hindered motions of the surrounding water molecules. Importantly, it is observed that the highly restricted motions of the water molecules bridging the protein and the DNA components in the complexed forms originate from more frequent hydrogen bond reformations.

  13. Dynamics of water around the complex structures formed between the KH domains of far upstream element binding protein and single-stranded DNA molecules

    SciTech Connect

    Chakraborty, Kaushik; Bandyopadhyay, Sanjoy

    2015-07-28

    Single-stranded DNA (ss-DNA) binding proteins specifically bind to the single-stranded regions of the DNA and protect it from premature annealing, thereby stabilizing the DNA structure. We have carried out atomistic molecular dynamics simulations of the aqueous solutions of two DNA binding K homology (KH) domains (KH3 and KH4) of the far upstream element binding protein complexed with two short ss-DNA segments. Attempts have been made to explore the influence of the formation of such complex structures on the microscopic dynamics and hydrogen bond properties of the interfacial water molecules. It is found that the water molecules involved in bridging the ss-DNA segments and the protein domains form a highly constrained thin layer with extremely retarded mobility. These water molecules play important roles in freezing the conformational oscillations of the ss-DNA oligomers and thereby forming rigid complex structures. Further, it is demonstrated that the effect of complexation on the slow long-time relaxations of hydrogen bonds at the interface is correlated with hindered motions of the surrounding water molecules. Importantly, it is observed that the highly restricted motions of the water molecules bridging the protein and the DNA components in the complexed forms originate from more frequent hydrogen bond reformations.

  14. Item Calibration in Incomplete Testing Designs

    ERIC Educational Resources Information Center

    Eggen, Theo J. H. M.; Verhelst, Norman D.

    2011-01-01

    This study discusses the justifiability of item parameter estimation in incomplete testing designs in item response theory. Marginal maximum likelihood (MML) as well as conditional maximum likelihood (CML) procedures are considered in three commonly used incomplete designs: random incomplete, multistage testing and targeted testing designs.…

  15. Signal transducing molecules and glycosyl-phosphatidylinositol-linked proteins form a caveolin-rich insoluble complex in MDCK cells

    PubMed Central

    1993-01-01

    GPI-linked protein molecules become Triton-insoluble during polarized sorting to the apical cell surface of epithelial cells. These insoluble complexes, enriched in cholesterol, glycolipids, and GPI-linked proteins, have been isolated by flotation on sucrose density gradients and are thought to contain the putative GPI-sorting machinery. As the cellular origin and molecular protein components of this complex remain unknown, we have begun to characterize these low-density insoluble complexes isolated from MDCK cells. We find that these complexes, which represent 0.4-0.8% of the plasma membrane, ultrastructurally resemble caveolae and are over 150-fold enriched in a model GPI-anchored protein and caveolin, a caveolar marker protein. However, they exclude many other plasma membrane associated molecules and organelle-specific marker enzymes, suggesting that they represent microdomains of the plasma membrane. In addition to caveolin, these insoluble complexes contain a subset of hydrophobic plasma membrane proteins and cytoplasmically-oriented signaling molecules, including: (a) GTP- binding proteins--both small and heterotrimeric; (b) annex II--an apical calcium-regulated phospholipid binding protein with a demonstrated role in exocytic fusion events; (c) c-Yes--an apically localized member of the Src family of non-receptor type protein- tyrosine kinases; and (d) an unidentified serine-kinase activity. As we demonstrate that caveolin is both a transmembrane molecule and a major phospho-acceptor component of these complexes, we propose that caveolin could function as a transmembrane adaptor molecule that couples luminal GPI-linked proteins with cytoplasmically oriented signaling molecules during GPI-membrane trafficking or GPI-mediated signal transduction events. In addition, our results have implications for understanding v- Src transformation and the actions of cholera and pertussis toxins on hetero-trimeric G proteins. PMID:8349730

  16. Light-controlled ion channels formed by amphiphilic small molecules regulate ion conduction via cis-trans photoisomerization.

    PubMed

    Liu, Tao; Bao, Chunyan; Wang, Haiyan; Lin, Yao; Jia, Huijuan; Zhu, Linyong

    2013-11-11

    Light-regulated ion channel-transport across lipid bilayers was realized using structurally simple azobenzene-based amphiphilic small molecules. UV or visible irradiation triggers molecular photoisomerization, which induces structural and membrane affinity changes in self-assembled channels, thus resulting in light-regulated ion transmembrane transport.

  17. Mobius Molecules

    ERIC Educational Resources Information Center

    Eckert, J. M.

    1973-01-01

    Discusses formation of chemical molecules via Mobius strip intermediates, and concludes that many special physics-chemical properties of the fully closed circular form (1) of polyoma DNA are explainable by this topological feature. (CC)

  18. Detection of Quorum Sensing Signal Molecules and Identification of an Autoinducer Synthase Gene among Biofilm Forming Clinical Isolates of Acinetobacter spp.

    PubMed Central

    Anbazhagan, Deepa; Mansor, Marzida; Yan, Gracie Ong Siok; Md Yusof, Mohd Yasim; Hassan, Hamimah; Sekaran, Shamala Devi

    2012-01-01

    Background Quorum sensing is a term that describes an environmental sensing system that allows bacteria to monitor their own population density which contributes significantly to the size and development of the biofilm. Many gram negative bacteria use N-acyl-homoserine lactones as quorum sensing signal molecules. In this study, we sought to find out if the biofilm formation among clinical isolates of Acinetobacter spp. is under the control of autoinducing quorum sensing molecules. Methodology/Principal Findings Biofilm formation among clinical isolates of Acinetobacter spp. was assessed and the production of signal molecules were detected with Chromobacterium violaceum CV026 biosensor system. Characterisation of autoinducers was carried out by mass spectrometric analysis. We have also reported the identification of an autoinducer synthase gene, abaΙ among the isolates that produce quorum sensing signal molecules and have reported that the mutation in the abaI gene influences their biofilm forming capabilities. Using a microtitre-plate assay it was shown that 60% of the 50 Acinetobacter spp. isolates significantly formed biofilms. Further detection with the biosensor strain showed that some of these isolates produced long chain signal molecules. Mass spectrometric analysis revealed that five of these isolates produced N-decanoyl homoserine lactone and two isolates produced acyl-homoserine lactone with a chain length equal to C12. The abaΙ gene was identified and a tetracycline mutant of the abaΙ gene was created and the inhibition in biofilm formation in the mutant was shown. Conclusions/Significance These data are of great significance as the signal molecules aid in biofilm formation which in turn confer various properties of pathogenicity to the clinical isolates including drug resistance. The use of quorum sensing signal blockers to attenuate bacterial pathogenicity is therefore highly attractive, particularly with respect to the emergence of multi antibiotic

  19. Fluorescence Recovery after Photobleaching and Single-Molecule Tracking Measurements of Anisotropic Diffusion within Identical Regions of a Cylinder-Forming Diblock Copolymer Film.

    PubMed

    Tran-Ba, Khanh-Hoa; Higgins, Daniel A; Ito, Takashi

    2015-06-02

    This work demonstrates ensemble and single-molecule diffusion measurements within identical regions of a cylinder-forming polystyrene-poly(ethylene oxide) diblock copolymer (PS-b-PEO) film using fluorescence recovery after photobleaching (FRAP) and single-molecule tracking (SMT). A PS-b-PEO film (∼4 μm thick) with aligned cylindrical PEO microdomains containing 10 μM sulforhodamine B (SRB) was prepared by directional solvent-vapor penetration (SVP) of 1,4-dioxane. The ensemble diffusion behavior of SRB in the microdomains was assessed in FRAP studies of circular photobleached regions (∼7 μm in diameter). The SRB concentration was subsequently reduced by additional photobleaching, and the diffusion of individual SRB molecules was explored using SMT in the identical area (∼16 × 16 μm(2)). The FRAP data showed anisotropic fluorescence recovery, yielding the average microdomain orientation. The extent of fluorescence recovery observed (∼90%) demonstrated long-range microdomain connectivity, while the recovery time dependence provided an ensemble measurement of the SRB diffusion coefficient within the cylindrical microdomains. The SMT data exhibited one-dimensional diffusion of individual SRB molecules along the SVP direction across the entire film thickness, as consistent with the FRAP results. Importantly, the average of the single-molecule diffusion coefficients was close to the value obtained from FRAP in the identical area. In some cases, SMT offered smaller diffusion coefficients than FRAP, possibly due to contributions from SRB molecules confined within short PEO microdomains. The implementation of FRAP and SMT measurements in identical areas provides complementary information on molecular diffusion with minimal influence of sample heterogeneity, permitting direct comparison of ensemble and single-molecule diffusion behavior.

  20. A novel 1:1 canal inclusion network formed by deoxycholic acid dimers (bislactones) with benzene molecules: an x-ray study

    NASA Astrophysics Data System (ADS)

    Stanković, S.; Kálmán, A.; Argay, Gy.; Miljković, D.; Kuhajda, K.; Vicković, I.; Bruwo, M.; Ori, O.

    1990-04-01

    A novel canal inclusion network formed by 3α-hydroxy-5β-cholano-12α-24-bislactone (C 48H 74O 6) with benzene molecule (1:1) in a triclinic crystal lattice has been revealed by X-ray diffraction and 1H NMR spectroscopy. Crystal symmetry P1 with a=15.036(4), b=13.269(4), c=7.196(4) Å, α=78.16(2), β=73.42(2), γ=66.42(2) °, Z=1 (one pair of deoxycholic acid (DCA) dimer and benzene in the unit cell) and Dc=1.091 g cm -3. The structure was refined to R 0.082 for 3083 reflections. The DCA dimers separated by unit translations form infinite canals along the shortest axis c. These hydrophobic canals accommodate the benzene molecules separated by a distance of 4.55(2) Å. In accordance with the vigorous thermal motion of the ring atoms the benzene molecules are bound by weak dispersion forces to the host molecules. However, atom—atom potential calculations indicate that the position and orientation of the benzene ring in the void represent the energy minimum.

  1. SULFUR-BEARING MOLECULES IN MASSIVE STAR-FORMING REGIONS: OBSERVATIONS OF OCS, CS, H{sub 2}S, AND SO

    SciTech Connect

    Li, Juan; Wang, Junzhi; Zhu, Qingfeng; Zhang, Jiangshui; Li, Di

    2015-03-20

    We studied the sulfur chemistry of massive star-forming regions through single-dish submillimeter spectroscopy. OCS, O{sup 13}CS, {sup 13}CS, H{sub 2}S, and SO transitions were observed toward a sample of massive star-forming regions with embedded UCH ii or CH ii regions. These sources could be divided into H ii-hot core and H ii-only sources based on their CH{sub 3}CN emission. Our results show that the OCS line of thirteen sources is optically thick, with optical depth ranging from 5 to 16. Column densities of these molecules were computed under LTE conditions. CS column densities were also derived using its optically thin isotopologue {sup 13}CS. H{sub 2}S is likely to be the most abundant gas-phase sulfuretted molecule in hot massive cores. Both the column density and abundance of sulfur-bearing molecules decrease significantly from H ii-hot core to H ii-only sources. Ages derived from hot core models appear to be consistent with star formation theories, suggesting that abundance ratios of [CS]/[SO], [SO]/[OCS], and [OCS]/[CS] could be used as chemical clocks in massive star-forming regions.

  2. Quantum Stackelberg duopoly with incomplete information [rapid communication

    NASA Astrophysics Data System (ADS)

    Lo, C.-F.; Kiang, D.

    2005-10-01

    We investigate the quantum version of the Stackelberg duopoly with incomplete information, especially how the quantum entanglement affects the first-mover advantage in the classical form. It is found that while positive entanglement enhances the first-mover advantage beyond the classical limit, the advantage is dramatically suppressed by negative entanglement. Moreover, despite that positive quantum entanglement improves the first-mover's tolerance for the informational incompleteness, the quantum effect does not change the basic fact that Firm A's lack of complete information of Firm B's unit cost is eradicating the first-mover advantage.

  3. Interaction of epitaxial silicene with overlayers formed by exposure to Al atoms and O{sub 2} molecules

    SciTech Connect

    Friedlein, R.; Yamada-Takamura, Y.; Van Bui, H.; Wiggers, F. B.; Kovalgin, A. Y.; Jong, M. P. de

    2014-05-28

    As silicene is not chemically inert, the study and exploitation of its electronic properties outside of ultrahigh vacuum environments require the use of insulating capping layers. In order to understand if aluminum oxide might be a suitable encapsulation material, we used high-resolution synchrotron photoelectron spectroscopy to study the interactions of Al atoms and O{sub 2} molecules, as well as the combination of both, with epitaxial silicene on thin ZrB{sub 2}(0001) films grown on Si(111). The deposition of Al atoms onto silicene, up to the coverage of about 0.4 Al per Si atoms, has little effect on the chemical state of the Si atoms. The silicene-terminated surface is also hardly affected by exposure to O{sub 2} gas, up to a dose of 4500 L. In contrast, when Al-covered silicene is exposed to the same dose, a large fraction of the Si atoms becomes oxidized. This is attributed to dissociative chemisorption of O{sub 2} molecules by Al atoms at the surface, producing reactive atomic oxygen species that cause the oxidation. It is concluded that aluminum oxide overlayers prepared in this fashion are not suitable for encapsulation since they do not prevent but actually enhance the degradation of silicene.

  4. Aspects of Carbon Monoxide in Form of CO-Releasing Molecules Used in Cancer Treatment: More Light on the Way

    PubMed Central

    Kourti, Malamati; Jiang, Wen G.

    2017-01-01

    Carbon monoxide (CO) has always been recognised as a toxic gas, due to its higher affinity for haemoglobin than oxygen. However, biological studies have revealed an intriguing role for CO as an endogenous signalling molecule, a gasotransmitter. CO is demonstrated to exert many cellular activities including anti-inflammatory, antiapoptotic, and antiproliferative activities. In animal studies, CO gas administration can prevent tissues from hypoxia or ischemic-reperfusion injury. As a result, there are a plethora of reports dealing with the biological applications of CO and CO-releasing molecules (CORMs) in inflammatory and vascular diseases. CORMs have already been tested as a therapeutic agent in clinical trials. More recently, an increased interest has been drawn to CO's potential use as an anticancer agent. In this review, we will aim to give an overview of the research focused on the role of CO and CORMs in different types of cancer and expand to the recent development of the next generation CORMs for clinical application in cancer treatment. PMID:28286606

  5. A new prodrug form of Affibody molecules (pro-Affibody) is selectively activated by cancer-associated proteases.

    PubMed

    Sandersjöö, Lisa; Jonsson, Andreas; Löfblom, John

    2015-04-01

    Affinity proteins have advanced the field of targeted therapeutics due to their generally higher specificity compared to small molecular compounds. However, side effects caused by on-target binding in healthy tissues are still an issue. Here, we design and investigate a prodrug strategy for improving tissue specificity of Affibody molecules in future in vivo studies. The prodrug Affibody (pro-Affibody) against the HER2 receptor was constructed by fusing a HER2-specific Affibody (ZHER2) to an anti-idiotypic Affibody (anti-ZHER2). The linker was engineered to comprise a substrate peptide for the cancer-associated matrix metalloprotease 1 (MMP-1). The hypothesis was that the binding surface of ZHER2 would thereby be blocked from interacting with HER2 until the substrate peptide was specifically hydrolyzed by MMP-1. Binding should thereby only occur where MMP-1 is overexpressed, potentially decreasing on-target toxicities in normal tissues. The pro-Affibody was engineered to find a suitable linker and substrate peptide, and the different constructs were evaluated with a new bacterial display assay. HER2-binding of the pro-Affibody was efficiently masked and proteolytic activation of the best variant yielded over 1,000-fold increase in apparent binding affinity. Biosensor analysis revealed that blocking of the pro-Affibody primarily affected the association phase. In a cell-binding assay, the activated pro-Affibody targeted native HER2 on cancer cells as opposed to the non-activated pro-Affibody. We believe this prodrug approach with proteolytic activation is promising for improving tissue specificity in future in vivo targeting applications and can hopefully be extended to other Affibody molecules and similar affinity proteins as well.

  6. Soluble Forms of Intercellular and Vascular Cell Adhesion Molecules Independently Predict Progression to Type 2 Diabetes in Mexican American Families

    PubMed Central

    Kulkarni, Hemant; Mamtani, Manju; Peralta, Juan; Almeida, Marcio; Dyer, Thomas D.; Goring, Harald H.; Johnson, Matthew P.; Duggirala, Ravindranath; Mahaney, Michael C.; Olvera, Rene L.; Almasy, Laura; Glahn, David C.; Williams-Blangero, Sarah; Curran, Joanne E.; Blangero, John

    2016-01-01

    Objective While the role of type 2 diabetes (T2D) in inducing endothelial dysfunction is fairly well-established the etiological role of endothelial dysfunction in the onset of T2D is still a matter of debate. In the light of conflicting evidence in this regard, we conducted a prospective study to determine the association of circulating levels of soluble intercellular adhesion molecule 1 (sICAM-1) and soluble vessel cell adhesion molecule 1 (sVCAM-1) with incident T2D. Methods Data from this study came from 1,269 Mexican Americans of whom 821 initially T2D-free individuals were longitudinally followed up in the San Antonio Family Heart Study. These individuals were followed for 9752.95 person-years for development of T2D. Prospective association of sICAM-1 and sVCAM-1 with incident T2D was studied using Kaplan-Meier survival plots and mixed effects Cox proportional hazards modeling to account for relatedness among study participants. Incremental value of adhesion molecule biomarkers was studied using integrated discrimination improvement (IDI) and net reclassification improvement (NRI) indexes. Results Decreasing median values for serum concentrations of sICAM-1 and sVCAM-1 were observed in the following groups in this order: individuals with T2D at baseline, individuals who developed T2D during follow-up, individuals with prediabetes at baseline and normal glucose tolerant (NGT) individuals who remained T2D-free during follow-up. Top quartiles for sICAM-1 and sVCAM-1 were strongly and significantly associated with homeostatic model of assessment—insulin resistance (HOMA-IR). Mixed effects Cox proportional hazards modeling revealed that after correcting for important clinical confounders, high sICAM-1 and sVCAM-1 concentrations were associated with 2.52 and 1.99 times faster progression to T2D as compared to low concentrations, respectively. Individuals with high concentrations for both sICAM-1 and sVCAM-1 progressed to T2D 3.42 times faster than those with low

  7. Two-State or Non-Two-State? An Excess Spectroscopy-based Approach to Differentiate the Existing Forms of Molecules in Liquids Mixtures

    PubMed Central

    Zhou, Yu; Zheng, Yan-Zhen; Sun, Hai-Yuan; Deng, Geng; Yu, Zhi-Wu

    2015-01-01

    Characterization/identification of the clusters/associates in liquids has long been a challenging topic. In this paper, we report a method to identify molecules with two different existing forms in a binary liquid solution. In this so-called two-state situation, the excess infrared spectra of a vibration mode of the respective molecule will show identical band shape if the other component is transparent in the region. More conveniently, the positions of the positive peak, negative peak, and zero-value will be seen to be fixed with varying compositions of the binary system. In the case of non-two-state mixtures, for example the mere solvation of solute by solvent, those positions will be variable. The conclusions are supported/demonstrated by computational simulation and experiments on two binary systems, D2O−H2O and C6F5I−cyclo-C6H12. PMID:26542641

  8. Alternative splicing of micro-exons creates multiple forms of the insect cell adhesion molecule fasciclin I.

    PubMed

    McAllister, L; Rehm, E J; Goodman, G S; Zinn, K

    1992-03-01

    Fasciclin I is a homophilic cell adhesion molecule in insects that is dynamically expressed on a subset of axon pathways in the embryonic nervous system, and on a variety of other cells and tissues during development. The fasciclin I protein consists of four homologous 150 amino acid domains. In this article, we describe the complete sequence of the Drosophila fasciclin I (fasI) gene. The gene consists of 15 exons and is distributed over 14 kilobases of DNA. We examine the structure and temporal expression pattern of multiple fasciclin I mRNAs that differ in the lengths of their 3' untranslated regions. We also show that a highly conserved sequence at the end of the second domain can be altered by the addition of three or six amino acids that are encoded by two alternatively spliced 9 base pair (bp) micro-exons. In grasshopper fasciclin I mRNAs, there are 9 bp and 6 bp insertions at the same position. The first of these insertions is identical in sequence to the first fly micro-exon. The grasshopper insertions are not found together in the same mRNA, so grasshopper fasciclin I species differ by the addition of three or two extra amino acids to the second domain. The alternatively spliced mRNAs are differentially expressed during embryogenesis, and all three of them are present in nerve cord preparations. We suggest that the amino acids inserted by alternative micro-exon splicing may alter the binding specificity of fasciclin I.

  9. 32 CFR 651.44 - Incomplete information.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 32 National Defense 4 2013-07-01 2013-07-01 false Incomplete information. 651.44 Section 651.44 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) ENVIRONMENTAL QUALITY ENVIRONMENTAL ANALYSIS OF ARMY ACTIONS (AR 200-2) Environmental Impact Statement § 651.44 Incomplete...

  10. 32 CFR 651.44 - Incomplete information.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 32 National Defense 4 2014-07-01 2013-07-01 true Incomplete information. 651.44 Section 651.44 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) ENVIRONMENTAL QUALITY ENVIRONMENTAL ANALYSIS OF ARMY ACTIONS (AR 200-2) Environmental Impact Statement § 651.44 Incomplete...

  11. 32 CFR 651.44 - Incomplete information.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 32 National Defense 4 2012-07-01 2011-07-01 true Incomplete information. 651.44 Section 651.44 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) ENVIRONMENTAL QUALITY ENVIRONMENTAL ANALYSIS OF ARMY ACTIONS (AR 200-2) Environmental Impact Statement § 651.44 Incomplete...

  12. Cooperativity of dynamics of 18-crown-6 molecule forming one-dimensional chain in Cs2(18-crown-6)3[Ni(dmit)2]2.

    PubMed

    Ikeuchi, Satoaki; Miyazaki, Yuji; Takeda, Sadamu; Akutagawa, Tomoyuki; Nishihara, Sadafumi; Nakamura, Takayoshi; Saito, Kazuya

    2005-07-22

    Heat capacity of Cs2(18-crown-6)3[Ni(dmit)2]2 was measured by adiabatic calorimetry. A broad thermal anomaly was observed around 225 K. The entropy gain (about 52 J K(-1) mol(-1)) is much larger than that expected for twofold disordering of 18-crown-6 assumed in the previous structure analysis. The shape of thermal anomaly was qualitatively explained by a linear Ising model developed for cooperative disordering in polymers. The 18-crown-6 molecules forming a one-dimensional chain in the crystal are orientationally disordered with moderate cooperativity.

  13. Group contribution methodology based on the statistical associating fluid theory for heteronuclear molecules formed from Mie segments.

    PubMed

    Papaioannou, Vasileios; Lafitte, Thomas; Avendaño, Carlos; Adjiman, Claire S; Jackson, George; Müller, Erich A; Galindo, Amparo

    2014-02-07

    A generalization of the recent version of the statistical associating fluid theory for variable range Mie potentials [Lafitte et al., J. Chem. Phys. 139, 154504 (2013)] is formulated within the framework of a group contribution approach (SAFT-γ Mie). Molecules are represented as comprising distinct functional (chemical) groups based on a fused heteronuclear molecular model, where the interactions between segments are described with the Mie (generalized Lennard-Jonesium) potential of variable attractive and repulsive range. A key feature of the new theory is the accurate description of the monomeric group-group interactions by application of a high-temperature perturbation expansion up to third order. The capabilities of the SAFT-γ Mie approach are exemplified by studying the thermodynamic properties of two chemical families, the n-alkanes and the n-alkyl esters, by developing parameters for the methyl, methylene, and carboxylate functional groups (CH3, CH2, and COO). The approach is shown to describe accurately the fluid-phase behavior of the compounds considered with absolute average deviations of 1.20% and 0.42% for the vapor pressure and saturated liquid density, respectively, which represents a clear improvement over other existing SAFT-based group contribution approaches. The use of Mie potentials to describe the group-group interaction is shown to allow accurate simultaneous descriptions of the fluid-phase behavior and second-order thermodynamic derivative properties of the pure fluids based on a single set of group parameters. Furthermore, the application of the perturbation expansion to third order for the description of the reference monomeric fluid improves the predictions of the theory for the fluid-phase behavior of pure components in the near-critical region. The predictive capabilities of the approach stem from its formulation within a group-contribution formalism: predictions of the fluid-phase behavior and thermodynamic derivative properties of

  14. A comparative study of diastereomeric complexes formed by a prochiral substrate and three structurally analogous chiral molecules on Pt(111)

    NASA Astrophysics Data System (ADS)

    Lemay, Jean-Christian; Dong, Yi; Groves, Michael N.; Demers-Carpentier, Vincent; Goubert, Guillaume; Lafleur-Lambert, Raphaël; Boukouvalas, John; Hammer, Bjørk; McBreen, Peter H.

    2016-04-01

    A comparative study of chemisorbed bimolecular diastereomeric complexes formed by three structurally analogous chiral modifiers and a prochiral substrate on Pt(111) was performed using scanning tunneling microscopy (STM) and density functional theory (DFT) methods. The experiments determine, subject to a number of assumptions, the abundant binding configurations and whether the complexed substrate is organized into pro-S or pro-R states. The overall prochiral ratio (pr) estimated in this manner may be compared in each case to literature values for the enantiomeric ratio (er) observed in catalysis experiments. The experiments were performed using ketopantolactone as the substrate and (R)-1-(1-naphthyl)ethylamine, (R)-N-Methyl-1-(1-naphthyl)ethylamine and (R)-1-naphthyl-1,2-ethanediol as the structurally analogous chiral modifiers. The STM measurements were performed at room temperature to better mimic conditions under which the catalytic studies reported in the literature were performed. The results are discussed in terms of the stereochemical effects of subtle modifications of the structure of the chiral modifier.

  15. Nonallelic heterogeneity in autosomal dominant retinitis pigmentosa with incomplete penetrance

    SciTech Connect

    Kim, S.K.; Berson, E.L.; Dryja, T.P.

    1994-08-01

    Retinitis pigmentosa is a group of retinal diseases in which photoreceptor cells throughout the retina degenerate. Although there is considerable genetic heterogeneity (autosomal dominant, autosomal recessive, and X-linked forms exist), there is a possibility that some clinically defined subtypes of the disease may be the result of mutations at the same locus. One possible clinically defined subtype is that of autosomal dominant retinitis pigmentosa (ADRP) with incomplete penetrance. Whereas in most families with ADRP, carriers can be clearly identified because of visual loss, ophthalmological findings, or abnormal electroretinograms (ERGs), in occasional families some obligate carriers are asymptomatic and have normal or nearly normal ERGs even late in life. A recent paper reported the mapping of the diseases locus in one pedigree (designated adRP7) with ADRP with incomplete penetrance to chromosome 7p. To test the idea that ADRP with incomplete penetrance may be genetically homogeneous, we have evaluated whether a different family with incomplete penetrance also has a disease gene linked to the same region. 4 refs., 1 fig., 1 tab.

  16. 7 CFR 763.8 - Incomplete applications.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... days of receipt of an incomplete application, the Agency will provide the seller and buyer written notice of any additional information that must be provided. The seller or buyer, as applicable,...

  17. Reconstruction of Unilateral Incomplete Cryptophthalmos in Fraser Syndrome.

    PubMed

    Tran, Ann Q; Lee, Bradford W; Alameddine, Ramzi M; Korn, Bobby S; Kikkawa, Don O

    2015-03-25

    A full-term baby girl with Fraser syndrome was born with right incomplete cryptophthalmos. On examination, the globe was completely covered with skin with partially formed eyelids laterally. At 3 years of age, she underwent an evisceration with orbital implant and reconstruction of the eyelids and fornices using the pre-existing scleral remnant. Custom ocular prosthetic fitting was performed 5 weeks postoperatively. At 4 years follow up, she continued to successfully retain an ocular prosthesis.

  18. Toxicity of an α-pore-forming toxin depends on the assembly mechanism on the target membrane as revealed by single molecule imaging.

    PubMed

    Subburaj, Yamunadevi; Ros, Uris; Hermann, Eduard; Tong, Rudi; García-Sáez, Ana J

    2015-02-20

    α-Pore-forming toxins (α-PFTs) are ubiquitous defense tools that kill cells by opening pores in the target cell membrane. Despite their relevance in host/pathogen interactions, very little is known about the pore stoichiometry and assembly pathway leading to membrane permeabilization. Equinatoxin II (EqtII) is a model α-PFT from sea anemone that oligomerizes and forms pores in sphingomyelin-containing membranes. Here, we determined the spatiotemporal organization of EqtII in living cells by single molecule imaging. Surprisingly, we found that on the cell surface EqtII did not organize into a unique oligomeric form. Instead, it existed as a mixture of oligomeric species mostly including monomers, dimers, tetramers, and hexamers. Mathematical modeling based on our data supported a new model in which toxin clustering happened in seconds and proceeded via condensation of EqtII dimer units formed upon monomer association. Furthermore, altering the pathway of EqtII assembly strongly affected its toxic activity, which highlights the relevance of the assembly mechanism on toxicity.

  19. Toxicity of an α-Pore-forming Toxin Depends on the Assembly Mechanism on the Target Membrane as Revealed by Single Molecule Imaging*

    PubMed Central

    Subburaj, Yamunadevi; Ros, Uris; Hermann, Eduard; Tong, Rudi; García-Sáez, Ana J.

    2015-01-01

    α-Pore-forming toxins (α-PFTs) are ubiquitous defense tools that kill cells by opening pores in the target cell membrane. Despite their relevance in host/pathogen interactions, very little is known about the pore stoichiometry and assembly pathway leading to membrane permeabilization. Equinatoxin II (EqtII) is a model α-PFT from sea anemone that oligomerizes and forms pores in sphingomyelin-containing membranes. Here, we determined the spatiotemporal organization of EqtII in living cells by single molecule imaging. Surprisingly, we found that on the cell surface EqtII did not organize into a unique oligomeric form. Instead, it existed as a mixture of oligomeric species mostly including monomers, dimers, tetramers, and hexamers. Mathematical modeling based on our data supported a new model in which toxin clustering happened in seconds and proceeded via condensation of EqtII dimer units formed upon monomer association. Furthermore, altering the pathway of EqtII assembly strongly affected its toxic activity, which highlights the relevance of the assembly mechanism on toxicity. PMID:25525270

  20. Physics of Molecules

    NASA Astrophysics Data System (ADS)

    Williams, D.; Murdin, P.

    2000-11-01

    Many varieties of molecule have been detected in the Milky Way and in other galaxies. The processes by which these molecules are formed and destroyed are now broadly understood (see INTERSTELLAR CHEMISTRY). These molecules are important components of galaxies in two ways. Firstly, radiation emitted by molecules enables us to trace the presence of diffuse gas, to infer its physical properties and ...

  1. Incomplete rotational cooling in a 22-pole ion trap

    NASA Astrophysics Data System (ADS)

    Endres, E. S.; Egger, G.; Lee, S.; Lakhmanskaya, O.; Simpson, M.; Wester, R.

    2017-02-01

    Cryogenic 22-pole ion traps have found many applications in ion-molecule reaction kinetics and in high resolution molecular spectroscopy. For most of these applications it is important to know the translational and internal temperatures of the trapped ions. Here, we present detailed rotational state thermometry measurements over an extended temperature range for hydroxyl anions in He, HD, and H2. The measured rotational temperatures show a termination of the thermalisation with the buffer gas around 25 K, independent of mass ratio and confinement potential of the trap. Different possible explanations for this incomplete thermalisation are discussed, among them the thermalisation of the buffer gas, room temperature blackbody radiation or warm gas entering the trap, and heating due to energy transfer from rotationally excited hydrogen molecules.

  2. The mobility of single-file water molecules is governed by the number of H-bonds they may form with channel-lining residues

    PubMed Central

    Horner, Andreas; Zocher, Florian; Preiner, Johannes; Ollinger, Nicole; Siligan, Christine; Akimov, Sergey A.; Pohl, Peter

    2015-01-01

    Channel geometry governs the unitary osmotic water channel permeability, pf, according to classical hydrodynamics. Yet, pf varies by several orders of magnitude for membrane channels with a constriction zone that is one water molecule in width and four to eight molecules in length. We show that both the pf of those channels and the diffusion coefficient of the single-file waters within them are determined by the number NH of residues in the channel wall that may form a hydrogen bond with the single-file waters. The logarithmic dependence of water diffusivity on NH is in line with the multiplicity of binding options at higher NH densities. We obtained high-precision pf values by (i) having measured the abundance of the reconstituted aquaporins in the vesicular membrane via fluorescence correlation spectroscopy and via high-speed atomic force microscopy, and (ii) having acquired the vesicular water efflux from scattered light intensities via our new adaptation of the Rayleigh-Gans-Debye equation. PMID:26167541

  3. The dimeric form of HLA-G molecule is associated with the response of early rheumatoid arthritis (ERA) patients to methotrexate.

    PubMed

    Rizzo, Roberta; Farina, Ilaria; Bortolotti, Daria; Galuppi, Elisa; Padovan, Melissa; Di Luca, Dario; Govoni, Marcello

    2017-03-01

    A growing body of evidence indicates a possible involvement of HLA (human leukocyte antigen)-G antigens in rheumatoid arthritis (RA), mainly in the HLA-G dimeric isoform, the most active HLA-G form with the strongest immunosuppression, that showed an excellent anti-inflammatory effect in collagen-induced arthritis model mice. However, the relevance of HLA-G dimers in RA response to methotrexate (MTX) treatment is still unknown. We analyzed the HLA-G dimers' amount in plasma samples from early rheumatoid arthritis (ERA) patients before MTX therapy and evaluated the role of these molecules as biomarker of the different response to the treatment. Plasma sHLA-G levels were detected by ELISA, and HLA-G dimeric and monomeric forms were revealed by Western blot in 12 MTX responder (reaching DAS28 remission <2.6) and 8 MTX non-responder (DAS28 ≥5.1) patients before the therapy. The response to MTX was evaluated after 6 months of treatment. All ERA patients reaching remission showed higher plasma sHLA-G levels and the 78 kDa HLA-G dimeric form. Unresponsive ERA patients were characterized by lower plasma sHLA-G levels, and only one patient presented the 78 kDa HLA-G dimeric form (DAS28 5.1). Our preliminary results support the hypothesis that in ERA patients, sHLA-G and, in particular, the presence of the dimeric form in plasma samples before MTX therapy could be an a priori biomarker for the response to MTX treatment.

  4. Incomplete reactions in nanothermite composites

    NASA Astrophysics Data System (ADS)

    Jacob, Rohit J.; Ortiz-Montalvo, Diana L.; Overdeep, Kyle R.; Weihs, Timothy P.; Zachariah, Michael R.

    2017-02-01

    Exothermic reactions between oxophilic metals and transition/post transition metal-oxides have been well documented owing to their fast reaction time scales (≈10 μs). This article examines the extent of the reaction in nano-aluminum based thermite systems through a forensic inspection of the products formed during reaction. Three nanothermite systems (Al/CuO, Al/Bi2O3, and Al/WO3) were selected owing to their diverse combustion characteristics, thereby providing sufficient generality and breadth to the analysis. Microgram quantities of the sample were coated onto a fine platinum wire, which was resistively heated at high heating rates (≈105 K/s) to ignite the sample. The subsequent products were captured/quenched very rapidly (≈500 μs) in order to preserve the chemistry/morphology during initiation and subsequent reaction and were quantitatively analyzed using electron microscopy and focused ion beam cross-sectioning followed by energy dispersive X-ray spectroscopy. Elemental examination of the cross-section of the quenched particles shows that oxygen is predominantly localized in the regions containing aluminum, implying the occurrence of the redox reaction. The Al/CuO system, which has simultaneous gaseous oxygen release and ignition (TIgnition ≈ TOxygen Release), shows a substantially lower oxygen content within the product particles as opposed to Al/Bi2O3 and Al/WO3 thermites, which are postulated to undergo a condensed phase reaction (TIgnition ≪ TOxygen Release). An effective Al:O composition for the interior section was obtained for all the mixtures, with the smaller particles generally showing a higher oxygen content than the larger ones. The observed results were further corroborated with the reaction temperature, obtained using a high-speed spectro-pyrometer, and bomb calorimetry conducted on larger samples (≈15 mg). The results suggest that thermites that produce sufficient amounts of gaseous products generate smaller product particles and

  5. CIMGS: An incomplete orthogonal factorization preconditioner

    SciTech Connect

    Wang, X.; Bramley, R.; Gallivan, K.

    1994-12-31

    This paper introduces, analyzes, and tests a preconditioning method for conjugate gradient (CG) type iterative methods. The authors start by examining incomplete Gram-Schmidt factorization (IGS) methods in order to motivate the new preconditioner. They show that the IGS family is more stable than IC, and they successfully factor any full rank matrix. Furthermore, IGS preconditioners are at least as effective in accelerating convergence of CG type iterative methods as the incomplete Cholesky (IC) preconditioner. The drawback of IGS methods are their high cost of factorization. This motivates finding a new algorithm, CIMGS, which can generate the same factor in a more efficient way.

  6. Adaptive schemes for incomplete quantum process tomography

    SciTech Connect

    Teo, Yong Siah; Englert, Berthold-Georg; Rehacek, Jaroslav; Hradil, Zdenek

    2011-12-15

    We propose an iterative algorithm for incomplete quantum process tomography with the help of quantum state estimation. The algorithm, which is based on the combined principles of maximum likelihood and maximum entropy, yields a unique estimator for an unknown quantum process when one has less than a complete set of linearly independent measurement data to specify the quantum process uniquely. We apply this iterative algorithm adaptively in various situations and so optimize the amount of resources required to estimate a quantum process with incomplete data.

  7. Cochlear implant in incomplete partition type I.

    PubMed

    Berrettini, S; Forli, F; De Vito, A; Bruschini, L; Quaranta, N

    2013-02-01

    In this investigation, we report on 4 patients affected by incomplete partition type I submitted to cochlear implant at our institutions. Preoperative, surgical, mapping and follow-up issues as well as results in cases with this complex malformation are described. The cases reported in the present study confirm that cochlear implantation in patients with incomplete partition type I may be challenging for cochlear implant teams. The results are variable, but in many cases satisfactory, and are mainly related to the surgical placement of the electrode and residual neural nerve fibres. Moreover, in some cases the association of cochlear nerve abnormalities and other disabilities may significantly affect results.

  8. Characterization of a distinct population of circulating human non-adherent endothelial forming cells and their recruitment via intercellular adhesion molecule-3.

    PubMed

    Appleby, Sarah L; Cockshell, Michaelia P; Pippal, Jyotsna B; Thompson, Emma J; Barrett, Jeffrey M; Tooley, Katie; Sen, Shaundeep; Sun, Wai Yan; Grose, Randall; Nicholson, Ian; Levina, Vitalina; Cooke, Ira; Talbo, Gert; Lopez, Angel F; Bonder, Claudine S

    2012-01-01

    Circulating vascular progenitor cells contribute to the pathological vasculogenesis of cancer whilst on the other hand offer much promise in therapeutic revascularization in post-occlusion intervention in cardiovascular disease. However, their characterization has been hampered by the many variables to produce them as well as their described phenotypic and functional heterogeneity. Herein we have isolated, enriched for and then characterized a human umbilical cord blood derived CD133(+) population of non-adherent endothelial forming cells (naEFCs) which expressed the hematopoietic progenitor cell markers (CD133, CD34, CD117, CD90 and CD38) together with mature endothelial cell markers (VEGFR2, CD144 and CD31). These cells also expressed low levels of CD45 but did not express the lymphoid markers (CD3, CD4, CD8) or myeloid markers (CD11b and CD14) which distinguishes them from 'early' endothelial progenitor cells (EPCs). Functional studies demonstrated that these naEFCs (i) bound Ulex europaeus lectin, (ii) demonstrated acetylated-low density lipoprotein uptake, (iii) increased vascular cell adhesion molecule (VCAM-1) surface expression in response to tumor necrosis factor and (iv) in co-culture with mature endothelial cells increased the number of tubes, tubule branching and loops in a 3-dimensional in vitro matrix. More importantly, naEFCs placed in vivo generated new lumen containing vasculature lined by CD144 expressing human endothelial cells (ECs). Extensive genomic and proteomic analyses of the naEFCs showed that intercellular adhesion molecule (ICAM)-3 is expressed on their cell surface but not on mature endothelial cells. Furthermore, functional analysis demonstrated that ICAM-3 mediated the rolling and adhesive events of the naEFCs under shear stress. We suggest that the distinct population of naEFCs identified and characterized here represents a new valuable therapeutic target to control aberrant vasculogenesis.

  9. Characterization of a Distinct Population of Circulating Human Non-Adherent Endothelial Forming Cells and Their Recruitment via Intercellular Adhesion Molecule-3

    PubMed Central

    Thompson, Emma J.; Barrett, Jeffrey M.; Tooley, Katie; Sen, Shaundeep; Sun, Wai Yan; Grose, Randall; Nicholson, Ian; Levina, Vitalina; Cooke, Ira; Talbo, Gert; Lopez, Angel F.; Bonder, Claudine S.

    2012-01-01

    Circulating vascular progenitor cells contribute to the pathological vasculogenesis of cancer whilst on the other hand offer much promise in therapeutic revascularization in post-occlusion intervention in cardiovascular disease. However, their characterization has been hampered by the many variables to produce them as well as their described phenotypic and functional heterogeneity. Herein we have isolated, enriched for and then characterized a human umbilical cord blood derived CD133+ population of non-adherent endothelial forming cells (naEFCs) which expressed the hematopoietic progenitor cell markers (CD133, CD34, CD117, CD90 and CD38) together with mature endothelial cell markers (VEGFR2, CD144 and CD31). These cells also expressed low levels of CD45 but did not express the lymphoid markers (CD3, CD4, CD8) or myeloid markers (CD11b and CD14) which distinguishes them from ‘early’ endothelial progenitor cells (EPCs). Functional studies demonstrated that these naEFCs (i) bound Ulex europaeus lectin, (ii) demonstrated acetylated-low density lipoprotein uptake, (iii) increased vascular cell adhesion molecule (VCAM-1) surface expression in response to tumor necrosis factor and (iv) in co-culture with mature endothelial cells increased the number of tubes, tubule branching and loops in a 3-dimensional in vitro matrix. More importantly, naEFCs placed in vivo generated new lumen containing vasculature lined by CD144 expressing human endothelial cells (ECs). Extensive genomic and proteomic analyses of the naEFCs showed that intercellular adhesion molecule (ICAM)-3 is expressed on their cell surface but not on mature endothelial cells. Furthermore, functional analysis demonstrated that ICAM-3 mediated the rolling and adhesive events of the naEFCs under shear stress. We suggest that the distinct population of naEFCs identified and characterized here represents a new valuable therapeutic target to control aberrant vasculogenesis. PMID:23144795

  10. 32 CFR 651.44 - Incomplete information.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) ENVIRONMENTAL QUALITY ENVIRONMENTAL ANALYSIS OF ARMY ACTIONS (AR 200-2) Environmental Impact Statement § 651.44 Incomplete information. When the proposed action will have significant adverse effects on the human environment, and there...

  11. 40 CFR 725.33 - Incomplete submissions.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... ACT REPORTING REQUIREMENTS AND REVIEW PROCESSES FOR MICROORGANISMS Administrative Procedures § 725.33 Incomplete submissions. (a) A submission under this part is not complete, and the review period does not... attachments are not in English, except for published scientific literature. (4) The submitter does not...

  12. Higher Education's Grade for Data: "Incomplete"

    ERIC Educational Resources Information Center

    Hebel, Sara

    2008-01-01

    The latest national report card on higher education, as in the past, handed out a lot of "incompletes." Like the student who keeps forgetting to turn in that lab report, the grades can't be computed without all the data. There's a lot policy makers don't know about their states' higher-education performance, and the gaps in information limit the…

  13. Numerical evaluation of the incomplete airy functions and their application to high frequency scattering and diffraction

    NASA Technical Reports Server (NTRS)

    Constantinides, E. D.; Marhefka, R. J.

    1992-01-01

    The incomplete Airy integrals serve as canonical functions for the uniform ray optical solutions to several high frequency scattering and diffraction problems that involve a class of integrals characterized by two stationary points that are arbitrarily close to one another or to an integration endpoint. Integrals of such analytical properties describe transition region phenomena associated with composite shadow boundaries. An efficient and accurate method for computing the incomplete Airy functions would make the solutions to such problems useful for engineering purposes. Here, a convergent series solution form for the incomplete Airy functions is derived. Asymptotic expansions involving several terms were also developed and serve as large argument approximations. The combination of the series solution form with the asymptotic formulae provides for an efficient and accurate computation of the incomplete Airy functions. Validation of accuracy is accomplished using direct numerical integration data.

  14. Coincidence of Incomplete Pentalogy of Cantrell and Meningomyelocele in a Dizygotic Twin Pregnancy

    PubMed Central

    Timur, Hakan; Tokmak, Aytekin; Bayram, Hatice; Şükran Çakar, Esra; Danışman, Nuri

    2015-01-01

    Pentalogy of Cantrell is an extremely rare and lethal syndrome. Ectopia cordis is frequently found in fetuses with POC but not required for incomplete forms. Likewise, meningomyelocele is a relatively uncommon neural tube defect affecting central nervous system and associated with neurological problems. Herein, we presented a woman with dizygotic twin pregnancy having coincidence of incomplete POC and MMC in each individual fetus, which has never been reported previously. PMID:26421202

  15. Revealing the properties of defects formed by CH3NH2 molecules in organic-inorganic hybrid perovskite MAPbBr3

    NASA Astrophysics Data System (ADS)

    Wang, Ji; Zhang, Ao; Yan, Jun; Li, Dan; Chen, Yunlin

    2017-03-01

    The properties of defects in organic-inorganic hybrid perovskite are widely studied from the first-principles calculation. However, the defects of methylamine (methylamine = CH3NH2), which would be easily formed during the preparation of the organic-inorganic hybrid perovskite, are rarely investigated. Thermodynamic properties as well as defect states of methylamine embedded MAPbX3 (MA = methyl-ammonium = CH3NH3, X = Br, I) are studied based on first-principles calculations of density functional theory. It was found that there is a shallow defect level near the highest occupied molecular orbital, which induced by the interstitial methylamine defect in MAPbBr3, will lead to an increase of photoluminescence. The calculation results showed that interstitial defect states of methylamine may move deeper due to the interaction between methylamine molecules and methyl-ammonium cations. It was also showed that the interstitial methylamine defect is stable at room temperature, and the defect can be removed easily by annealing.

  16. Incomplete exponential sums and Diffie-Hellman triples

    NASA Astrophysics Data System (ADS)

    Banks, William D.; Friedlander, John B.; Konyagin, Sergei V.; Shparlinski, Igor E.

    2006-03-01

    Let p be a prime and vartheta an integer of order t in the multiplicative group modulo p. In this paper, we continue the study of the distribution of Diffie-Hellman triples (vartheta(x,) vartheta(y,) vartheta(xy) ) by considering the closely related problem of estimating exponential sums formed from linear combinations of the entries in such triples. We show that the techniques developed earlier for complete sums can be combined, modified and developed further to treat incomplete sums as well. Our bounds imply uniformity of distribution results for Diffie-Hellman triples as the pair (x,y) varies over small boxes.

  17. Methods for incomplete Bessel function evaluation

    NASA Astrophysics Data System (ADS)

    Harris, Frank E.; Fripiat, J. G.

    Presented here are detailed methods for evaluating the incomplete Bessel functions arising when Gaussian-type orbitals are used for systems periodic in one spatial dimension. The scheme is designed to yield these incomplete Bessel functions with an absolute accuracy of ±1 × 10-10, for the range of integer orders 0 ≤ n ≤ 12 [a range sufficient for a basis whose members have angular momenta of up to three units (s, p, d, or f atomic functions)]. To reach this accuracy level within acceptable computation times, new rational approximations were developed to compute the special functions involved, namely, the exponential integral E1(x) and the modified Bessel functions K0(x) and K1(x), to absolute accuracy ±1 × 10-15.

  18. Past incompleteness of a bouncing multiverse

    SciTech Connect

    Vilenkin, Alexander; Zhang, Jun E-mail: jun.zhang@tufts.edu

    2014-06-01

    According to classical GR, Anti-de Sitter (AdS) bubbles in the multiverse terminate in big crunch singularities. It has been conjectured, however, that the fundamental theory may resolve these singularities and replace them by nonsingular bounces. This may have important implications for the beginning of the multiverse. Geodesics in cosmological spacetimes are known to be past-incomplete, as long as the average expansion rate along the geodesic is positive, but it is not clear that the latter condition is satisfied if the geodesic repeatedly passes through crunching AdS bubbles. We investigate this issue in a simple multiverse model, where the spacetime consists of a patchwork of FRW regions. The conclusion is that the spacetime is still past-incomplete, even in the presence of AdS bounces.

  19. The undirected incomplete perfect phylogeny problem.

    PubMed

    Satya, Ravi Vijaya; Mukherjee, Amar

    2008-01-01

    The incomplete perfect phylogeny (IPP) problem and the incomplete perfect phylogeny haplotyping (IPPH) problem deal with constructing a phylogeny for a given set of haplotypes or genotypes with missing entries. The earlier approaches for both of these problems dealt with restricted versions of the problems, where the root is either available or can be trivially re-constructed from the data, or certain assumptions were made about the data. In this paper, we deal with the unrestricted versions of the problems, where the root of the phylogeny is neither available nor trivially recoverable from the data. Both IPP and IPPH problems have previously been proven to be NP-complete. Here, we present efficient enumerative algorithms that can handle practical instances of the problem. Empirical analysis on simulated data shows that the algorithms perform very well both in terms of speed and in terms accuracy of the recovered data.

  20. Stochastic approximation boosting for incomplete data problems.

    PubMed

    Sexton, Joseph; Laake, Petter

    2009-12-01

    Boosting is a powerful approach to fitting regression models. This article describes a boosting algorithm for likelihood-based estimation with incomplete data. The algorithm combines boosting with a variant of stochastic approximation that uses Markov chain Monte Carlo to deal with the missing data. Applications to fitting generalized linear and additive models with missing covariates are given. The method is applied to the Pima Indians Diabetes Data where over half of the cases contain missing values.

  1. Classification and data acquisition with incomplete data

    NASA Astrophysics Data System (ADS)

    Williams, David P.

    In remote-sensing applications, incomplete data can result when only a subset of sensors (e.g., radar, infrared, acoustic) are deployed at certain regions. The limitations of single sensor systems have spurred interest in employing multiple sensor modalities simultaneously. For example, in land mine detection tasks, different sensor modalities are better-suited to capture different aspects of the underlying physics of the mines. Synthetic aperture radar sensors may be better at detecting surface mines, while infrared sensors may be better at detecting buried mines. By employing multiple sensor modalities to address the detection task, the strengths of the disparate sensors can be exploited in a synergistic manner to improve performance beyond that which would be achievable with either single sensor alone. When multi-sensor approaches are employed, however, incomplete data can be manifested. If each sensor is located on a separate platform ( e.g., aircraft), each sensor may interrogate---and hence collect data over---only partially overlapping areas of land. As a result, some data points may be characterized by data (i.e., features) from only a subset of the possible sensors employed in the task. Equivalently, this scenario implies that some data points will be missing features. Increasing focus in the future on using---and fusing data from---multiple sensors will make such incomplete-data problems commonplace. In many applications involving incomplete data, it is possible to acquire the missing data at a cost. In multi-sensor remote-sensing applications, data is acquired by deploying sensors to data points. Acquiring data is usually an expensive, time-consuming task, a fact that necessitates an intelligent data acquisition process. Incomplete data is not limited to remote-sensing applications, but rather, can arise in virtually any data set. In this dissertation, we address the general problem of classification when faced with incomplete data. We also address the

  2. Essays on incomplete contracts in regulatory activities

    NASA Astrophysics Data System (ADS)

    Saavedra, Eduardo Humberto

    This dissertation consists of three essays. The first essay, The Hold-Up Problem in Public Infrastructure Franchising, characterizes the equilibria of the investment decisions in public infrastructure franchising under incomplete contracting and ex-post renegotiation. The parties (government and a firm) are unable to credibly commit to the contracted investment plan, so that a second step investment is renegotiated by the parties at the revision stage. As expected, the possibility of renegotiation affects initial non-verifiable investments. The main conclusion of this essay is that not only underinvestment but also overinvestment in infrastructure may arise in equilibrium, compared to the complete contracting case. The second essay, Alternative Institutional Arrangements in Network Utilities: An Incomplete Contracting Approach, presents a theoretical assessment of the efficiency implications of privatizing natural monopolies which are vertically related to potential competitive firms. Based on the incomplete contracts and asymmetric information paradigm. I develop a model that analyzes the relative advantages of different institutional arrangements---alternative ownership and market structures in the industry--- in terms of their allocative and productive efficiencies. The main policy conclusion of this essay is that both ownership and the existence of conglomerates in network industries matter. Among other conclusions, this essay provides an economic rationale for a mixed economy in which the network is public and vertical separation of the industry when the natural monopoly is under private ownership. The last essay, Opportunistic Behavior and Legal Disputes in the Chilean Electricity Sector, analyzes post-contractual disputes in this newly privatized industry. It discusses the presumption that opportunistic behavior and disputes arise due to inadequate market design, ambiguous regulation, and institutional weaknesses. This chapter also assesses the presumption

  3. Incomplete figure perception and invisible masking.

    PubMed

    Chikhman, Valery; Shelepin, Yuri; Foreman, Nigel; Merkuljev, Aleksey; Pronin, Sergey

    2006-01-01

    The Gollin test (measuring recognition thresholds for fragmented line drawings of everyday objects and animals) has traditionally been regarded as a test of incomplete figure perception or 'closure', though there is a debate about how such closure is achieved. Here, figural incompleteness is considered to be the result of masking, such that absence of contour elements of a fragmented figure is the result of the influence of an 'invisible' mask. It is as though the figure is partly obscured by a mask having parameters identical to those of the background. This mask is 'invisible' only consciously, but for the early stages of visual processing it is real and has properties of multiplicative noise. Incomplete Gollin figures were modeled as the figure covered by the mask with randomly distributed transparent and opaque patches. We adjusted the statistical characteristics of the contour image and empty noise patches and processed those using spatial and spatial-frequency measures. Across 73 figures, despite inter-subject variability, mean recognition threshold was always approximately 15% of total contour in naive observers. Recognition worsened with increasing spectral similarity between the figure and the 'invisible' mask. Near threshold, the spectrum of the fragmented image was equally similar to that of the 'invisible' mask and complete image. The correlation between spectral parameters of figures at threshold and complete figures was greatest for figures that were most easily recognised. Across test sessions, thresholds reduced when either figure or mask parameters were familiar. We argue that recognition thresholds for Gollin stimuli in part reflect the extraction of signal from noise.

  4. Dynamic pattern matcher using incomplete data

    NASA Technical Reports Server (NTRS)

    Johnson, Gordon G. (Inventor); Wang, Lui (Inventor)

    1993-01-01

    This invention relates generally to pattern matching systems, and more particularly to a method for dynamically adapting the system to enhance the effectiveness of a pattern match. Apparatus and methods for calculating the similarity between patterns are known. There is considerable interest, however, in the storage and retrieval of data, particularly, when the search is called or initiated by incomplete information. For many search algorithms, a query initiating a data search requires exact information, and the data file is searched for an exact match. Inability to find an exact match thus results in a failure of the system or method.

  5. Incomplete Dirac reduction of constrained Hamiltonian systems

    SciTech Connect

    Chandre, C.

    2015-10-15

    First-class constraints constitute a potential obstacle to the computation of a Poisson bracket in Dirac’s theory of constrained Hamiltonian systems. Using the pseudoinverse instead of the inverse of the matrix defined by the Poisson brackets between the constraints, we show that a Dirac–Poisson bracket can be constructed, even if it corresponds to an incomplete reduction of the original Hamiltonian system. The uniqueness of Dirac brackets is discussed. The relevance of this procedure for infinite dimensional Hamiltonian systems is exemplified.

  6. Catalytic combustion with incompletely vaporized residual fuel

    NASA Technical Reports Server (NTRS)

    Rosfjord, T. J.

    1981-01-01

    Catalytic combustion of fuel lean mixtures of incompletely vaporized residual fuel and air was investigated. The 7.6 cm diameter, graded cell reactor was constructed from zirconia spinel substrate and catalyzed with a noble metal catalyst. Streams of luminous particles exited the rector as a result of fuel deposition and carbonization on the substrate. Similar results were obtained with blends of No. 6 and No. 2 oil. Blends of shale residual oil and No. 2 oil resulted in stable operation. In shale oil blends the combustor performance degraded with a reduced degree of fuel vaporization. In tests performed with No. 2 oil a similar effect was observed.

  7. 49 CFR 529.4 - Requirements for incomplete automobile manufacturers.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 49 Transportation 6 2010-10-01 2010-10-01 false Requirements for incomplete automobile... AUTOMOBILES § 529.4 Requirements for incomplete automobile manufacturers. (a) Except as provided in paragraph (c) of this section, §§ 529.5 and 529.6, each incomplete automobile manufacturer is considered,...

  8. 49 CFR 529.4 - Requirements for incomplete automobile manufacturers.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 49 Transportation 6 2014-10-01 2014-10-01 false Requirements for incomplete automobile... AUTOMOBILES § 529.4 Requirements for incomplete automobile manufacturers. (a) Except as provided in paragraph (c) of this section, §§ 529.5 and 529.6, each incomplete automobile manufacturer is considered,...

  9. 49 CFR 529.4 - Requirements for incomplete automobile manufacturers.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 49 Transportation 6 2011-10-01 2011-10-01 false Requirements for incomplete automobile... AUTOMOBILES § 529.4 Requirements for incomplete automobile manufacturers. (a) Except as provided in paragraph (c) of this section, §§ 529.5 and 529.6, each incomplete automobile manufacturer is considered,...

  10. 49 CFR 529.4 - Requirements for incomplete automobile manufacturers.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 49 Transportation 6 2012-10-01 2012-10-01 false Requirements for incomplete automobile... AUTOMOBILES § 529.4 Requirements for incomplete automobile manufacturers. (a) Except as provided in paragraph (c) of this section, §§ 529.5 and 529.6, each incomplete automobile manufacturer is considered,...

  11. 49 CFR 529.4 - Requirements for incomplete automobile manufacturers.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 49 Transportation 6 2013-10-01 2013-10-01 false Requirements for incomplete automobile... AUTOMOBILES § 529.4 Requirements for incomplete automobile manufacturers. (a) Except as provided in paragraph (c) of this section, §§ 529.5 and 529.6, each incomplete automobile manufacturer is considered,...

  12. Rate-dependent incompleteness of earthquake catalogs

    NASA Astrophysics Data System (ADS)

    Hainzl, Sebastian

    2016-04-01

    Important information about the earthquake generation process can be gained from instrumental earthquake catalogs, but this requires complete recordings to avoid biased results. The local completeness magnitude Mc is known to depend on general conditions such as the seismographic network and the environmental noise, which generally limit the possibility to detect small events. The detectability can be additionally reduced by an earthquake-induced increase of the noise-level leading to short-term variations of Mc, which cannot be resolved by traditional methods relying on the analysis of the frequency-magnitude distribution. Based on simple assumptions, I propose a new method to estimate such temporal excursions of Mc solely based on the estimation of the earthquake rate resulting in a high temporal resolution of Mc. The approach is shown to be in agreement with the apparent decrease of the estimated Gutenberg-Richter b-value in high-activity phases of recorded data sets and the observed incompleteness periods after mainshocks. Furthermore, an algorithm to estimate temporal changes of Mc is introduced and applied to empirical aftershock and swarm sequences from California and central Europe, indicating that observed b-value fluctuations are often related to rate-dependent incompleteness of the earthquake catalogs.

  13. Robust pulmonary lobe segmentation against incomplete fissures

    NASA Astrophysics Data System (ADS)

    Gu, Suicheng; Zheng, Qingfeng; Siegfried, Jill; Pu, Jiantao

    2012-03-01

    As important anatomical landmarks of the human lung, accurate lobe segmentation may be useful for characterizing specific lung diseases (e.g., inflammatory, granulomatous, and neoplastic diseases). A number of investigations showed that pulmonary fissures were often incomplete in image depiction, thereby leading to the computerized identification of individual lobes a challenging task. Our purpose is to develop a fully automated algorithm for accurate identification of individual lobes regardless of the integrity of pulmonary fissures. The underlying idea of the developed lobe segmentation scheme is to use piecewise planes to approximate the detected fissures. After a rotation and a global smoothing, a number of small planes were fitted using local fissures points. The local surfaces are finally combined for lobe segmentation using a quadratic B-spline weighting strategy to assure that the segmentation is smooth. The performance of the developed scheme was assessed by comparing with a manually created reference standard on a dataset of 30 lung CT examinations. These examinations covered a number of lung diseases and were selected from a large chronic obstructive pulmonary disease (COPD) dataset. The results indicate that our scheme of lobe segmentation is efficient and accurate against incomplete fissures.

  14. Social Interactions under Incomplete Information: Games, Equilibria, and Expectations

    NASA Astrophysics Data System (ADS)

    Yang, Chao

    Interactions under Incomplete Information", is an application of the first chapter to censored outcomes, corresponding to the situation when agents" behaviors are subjected to some binding restrictions. In an interesting empirical analysis for property tax rates set by North Carolina municipal governments, it is found that there is a significant positive correlation among near-by municipalities. Additionally, some private information about its own residents is used by a municipal government to predict others' tax rates, which enriches current empirical work about tax competition. The third chapter, "Social Interactions under Incomplete Information with Multiple Equilibria", extends the first chapter by investigating effective estimation methods when the condition for a unique equilibrium may not be satisfied. With multiple equilibria, the previous model is incomplete due to the unobservable equilibrium selection. Neither conventional likelihoods nor moment conditions can be used to estimate parameters without further specifications. Although there are some solutions to this issue in the current literature, they are based on strong assumptions such as agents with the same observable characteristics play the same strategy. This paper relaxes those assumptions and extends the all-solution method used to estimate discrete choice games to a setting with both discrete and continuous choices, bounded and unbounded outcomes, and a general form of incomplete information, where the existence of a pure strategy equilibrium has been an open question for a long time. By the use of differential topology and functional analysis, it is found that when all exogenous characteristics are public information, there are a finite number of equilibria. With privately known exogenous characteristics, the equilbria can be represented by a compact set in a Banach space and be approximated by a finite set. As a result, a finite-state probability mass function can be used to specify a probability measure

  15. A spectroscopic experimental and computer-assisted empirical model for the production and energetics of excited oxygen molecules formed by atom recombination on shuttle tile surfaces

    NASA Technical Reports Server (NTRS)

    Owan, D. A.

    1981-01-01

    A visible emission spectroscopic method was developed. The amounts of excited singlet and triplet oxygen molecules produced by recombination on the Space Shuttle Orbiter thermal protective tiles at elevated temperatures are determined. Rate constants and energetics of the extremely exothermic reaction are evaluated in terms of a chemical and mathematical model. Implications for potential contribution to Shuttle surface reentry heating fluxes are outlined.

  16. Series expansions for the incomplete Lipschitz-Hankel integral Je 0(a, z)

    NASA Astrophysics Data System (ADS)

    Mechaik, Mehdi M.; Dvorak, Steven L.

    1995-09-01

    Bessel series expansions are derived for the incomplete Lipschitz-Hankel integralJe0(a, z). These expansions are obtained by using contour integration techniques to evaluate the inverse Laplace transform representation for Je0(a, z). It is shown that one of the expansions can be used as a convergent series expansion for one definition of the branch cut and as an asymptotic expansion if the branch cut is chosen differently. The effects of the branch cuts are demonstrated by plotting the terms in the series for interesting special cases. The Laplace transform technique used in this paper simplifies the derivation of the series expansions, provides information about the resulting branch cuts, yields integral representations for Je0(a, z), and allows the series expansions to be extended to complex values of z. These series expansions can be used together with the expansions for Ye0(a, z), which are obtained in a separate paper, to compute numerous other special functions, encountered in electromagnetic applications. These include: incomplete Lipschitz-Hankel integrals of the Hankel and modified Bessel form, incomplete cylindrical functions of Poisson form (incomplete Bessel, Struve, Hankel, and Macdonald functions), and incomplete Weber integrals (Lommel functions of two variables).

  17. Bereavement: an incomplete rite of passage.

    PubMed

    Hunter, Jennifer

    A bereavement ritual observed during anthropological fieldwork in Peru gives basis to this article which asserts that bereavement has become an incomplete rite of passage. The article reviews the role of ritual and rites of passage, examines other anthropologic examples of death and bereavement rituals, and identifies the lack of post-funeral ritual for many bereaved individuals in the United States. While funerary rituals which end with the funeral and burial of the dead are helpful in providing immediate structure for the bereaved, they are not congruent with the long-term emotional needs and reconstruction of meaning within grief. The author acknowledges value of both private ritual and reunions of the community of mourners, and recommends that bereavement counselors and/or the funeral industry offer to help bereaved construct a "ritual of remembrance and new meaning" after time has allowed them to move along in meaning reconstruction processes of making sense, finding benefits, and identity change.

  18. Shape reconstruction methods with incomplete data

    NASA Astrophysics Data System (ADS)

    Nakahata, K.; Kitahara, M.

    2000-05-01

    Linearized inverse scattering methods are applied to the shape reconstruction of defects in elastic solids. The linearized methods are based on the Born approximation in the low frequency range and the Kirchhoff approximation in the high frequency range. The experimental measurement is performed to collect the scattering data from defects. The processed data from the measurement are fed into the linearized methods and the shape of the defect is reconstructed by two linearized methods. The importance of scattering data in the low frequency range is pointed out not only for Born inversion but also for Kirchhoff inversion. In the ultrasonic measurement for the real structure, the access points of the sensor may be limited to one side of the structural surfaces and a part of the surface. From the viewpoint of application, the incomplete scattering data are used as inputs for the shape reconstruction methods and the effect of the sensing points are discussed.

  19. Inflaton dark matter from incomplete decay

    NASA Astrophysics Data System (ADS)

    Bastero-Gil, Mar; Cerezo, Rafael; Rosa, João G.

    2016-05-01

    We show that the decay of the inflaton field may be incomplete, while nevertheless successfully reheating the Universe and leaving a stable remnant that accounts for the present dark matter abundance. We note, in particular, that since the mass of the inflaton decay products is field dependent, one can construct models, endowed with an appropriate discrete symmetry, where inflaton decay is kinematically forbidden at late times and only occurs during the initial stages of field oscillations after inflation. We show that this is sufficient to ensure the transition to a radiation-dominated era and that inflaton particles typically thermalize in the process. They eventually decouple and freeze out, yielding a thermal dark matter relic. We discuss possible implementations of this generic mechanism within consistent cosmological and particle physics scenarios, for both single-field and hybrid inflation.

  20. Regulatory perspective on incomplete control rod insertions

    SciTech Connect

    Chatterton, M.

    1997-01-01

    The incomplete control rod insertions experienced at South Texas Unit 1 and Wolf Creek are of safety concern to the NRC staff because they represent potential precursors to loss of shutdown margin. Even before it was determined if these events were caused by the control rods or by the fuel there was an apparent correlation of the problem with high burnup fuel. It was determined that there was also a correlation between high burnup and high drag forces as well as with rod drop time histories and lack of rod recoil. The NRC staff initial actions were aimed at getting a perspective on the magnitude of the problem as far as the number of plants and the amount of fuel that could be involved, as well as the safety significance in terms of shutdown margin. As tests have been performed and data has been analyzed the focus has shifted more toward understanding the problem and the ways to eliminate it. At this time the staff`s understanding of the phenomena is that it was a combination of factors including burnup, power history and temperature. The problem appears to be very sensitive to these factors, the interaction of which is not clearly understood. The model developed by Westinghouse provides a possible explanation but there is not sufficient data to establish confidence levels and sensitivity studies involving the key parameters have not been done. While several fixes to the problem have been discussed, no definitive fixes have been proposed. Without complete understanding of the phenomena, or fixes that clearly eliminate the problem the safety concern remains. The safety significance depends on the amount of shutdown margin lost due to incomplete insertion of the control rods. Were the control rods to stick high in the core, the reactor could not be shutdown by the control rods and other means such as emergency boration would be required.

  1. Dynamical properties of nimodipine molecules confined in SBA-15 matrix

    NASA Astrophysics Data System (ADS)

    Kiwilsza, A.; Pajzderska, A.; Mielcarek, J.; Jenczyk, J.; Wąsicki, J.

    2016-08-01

    The paper reports results of 13C and 1H ssNMR for nimodipine confined in mesopores of SBA-15 for the samples (i) containing nimodipine molecules inside and on the external surface of silica, (ii) containing nimodipine only inside pores forming an incomplete monolayer on the surface (iii) for bulk nimodipine. The measurements permitted comparison of the dynamics of nimodipine bulk and confined in pores. The confined nimodipine is in an amorphous state and has additional degrees of rotational freedom with respect to the bulk one. The height of the energy barrier related to the rotation of methyl groups in confined nimodipine is lower than in bulk nimodipine. The higher mobility of nimodipine molecules confined in silica pores can explain the higher release rate of nimodipine from silica matrix than dissolution rate of bulk drug.

  2. Classification with Incomplete Data Using Dirichlet Process Priors

    PubMed Central

    Wang, Chunping; Liao, Xuejun; Carin, Lawrence; Dunson, David B.

    2013-01-01

    A non-parametric hierarchical Bayesian framework is developed for designing a classifier, based on a mixture of simple (linear) classifiers. Each simple classifier is termed a local “expert”, and the number of experts and their construction are manifested via a Dirichlet process formulation. The simple form of the “experts” allows analytical handling of incomplete data. The model is extended to allow simultaneous design of classifiers on multiple data sets, termed multi-task learning, with this also performed non-parametrically via the Dirichlet process. Fast inference is performed using variational Bayesian (VB) analysis, and example results are presented for several data sets. We also perform inference via Gibbs sampling, to which we compare the VB results. PMID:23990757

  3. New functional form of the dependence of rotational and centrifugal distortional parameters of the water molecule on the bending vibration v2

    NASA Astrophysics Data System (ADS)

    Starikov, V. I.; Tyuterev, Vl. G.

    1982-10-01

    A regularity is found for the anomalous behavior of the rotational and centrifugal distortion parameters of the water molecule in the bending states (0 v20). This regularity is described by simple nonpolynomial formulae which are used to calculate Watson's parameters A, Δ K, Δ KJ, δK, HK, HKJ, hK, LK, LKKJ, and lK for the states (010), (020), (030), and (040). The calculated v2 behavior of these parameters is in agreement with the experimental one.

  4. Molecule nanoweaver

    DOEpatents

    Gerald, II; Rex E.; Klingler, Robert J.; Rathke, Jerome W.; Diaz, Rocio; Vukovic, Lela

    2009-03-10

    A method, apparatus, and system for constructing uniform macroscopic films with tailored geometric assemblies of molecules on the nanometer scale. The method, apparatus, and system include providing starting molecules of selected character, applying one or more force fields to the molecules to cause them to order and condense with NMR spectra and images being used to monitor progress in creating the desired geometrical assembly and functionality of molecules that comprise the films.

  5. Structure of Freund's complete and incomplete adjuvants

    PubMed Central

    Dvorak, Ann M.; Dvorak, H. F.

    1974-01-01

    Emulsions of complete (CFA) and incomplete (IFA) Freund's adjuvants were examined in the light and electron microscopes, and the resulting morphological findings were correlated with the effectiveness of the emulsions as immunological adjuvants. Thick (viscous) emulsions of both IFA and CFA consisted of highly stable, three-dimensional meshworks composed of interconnecting strands of antigen-containing water droplets interspersed in oil phase. Included mycobacteria were confined to this meshwork and were coated with an adherent surface layer of water droplets. Thin Freund's adjuvants were less stable, relatively coarse emulsions, but even in such preparations mycobacteria showed a striking affinity for the surface of water droplets when these contained low concentrations of antigens such as human serum albumin (HSA). The characteristic adjuvant effect of CFA was observed only when associations between mycobacteria and water droplets took place. Thus, no adjuvant effect occurred with oil-in-water (o/w) emulsions, nor when antigen and mycobacteria-in-oil were injected into separate foot pads. Further, a good adjuvant effect was observed even with thin emulsions when mycobacteria-water droplet associations were abundant. These morphological and immunological data suggest that CFA is a device for bringing extrinsic, water-soluble antigens into intimate, stable contact with myco-bacteria, thereby conferring on them the ability to elicit an immunological response qualitatively similar to that induced by mycobacteria-in-oil to the intrinsic antigen, tuberculin. ImagesFIG. 1FIG. 2FIG. 3FIG. 4FIG. 5 PMID:4605156

  6. The Treatment of the Incompletely Descended Testis

    PubMed Central

    Wilson, D. S. Poole

    1939-01-01

    (1) Under three years of age the diagnosis of the incompletely descended testis is uncertain. (2) The policy of awaiting spontaneous descent may be pursued until 10 years of age but, unless the testis lies in the superior scrotal position, this policy should not be persisted in thereafter. (3) Hormonal therapy may be employed before operative treatment as a means of determining testes which will descend spontaneously. It should only be used in the prepuberty period. (4) Operative treatment may be safely carried out at any age after 3 years and should be completed before puberty. The optimum period is between 8 and 11 years. The Bevan operation may be successful when the testis is very mobile but the most consistent results are obtained by the septal transposition or Keetley-Torek operations. ImagesFig. 1Fig. 2Fig. 3Fig. 4Fig. 5Fig. 8Fig. 9Fig. 10Fig. 13Fig. 14Fig. 15Fig. 16Fig. 18Fig. 19Fig. 20Fig. 21Fig. 22 PMID:19991991

  7. Analyzing incomplete longitudinal clinical trial data.

    PubMed

    Molenberghs, Geert; Thijs, Herbert; Jansen, Ivy; Beunckens, Caroline; Kenward, Michael G; Mallinckrodt, Craig; Carroll, Raymond J

    2004-07-01

    Using standard missing data taxonomy, due to Rubin and co-workers, and simple algebraic derivations, it is argued that some simple but commonly used methods to handle incomplete longitudinal clinical trial data, such as complete case analyses and methods based on last observation carried forward, require restrictive assumptions and stand on a weaker theoretical foundation than likelihood-based methods developed under the missing at random (MAR) framework. Given the availability of flexible software for analyzing longitudinal sequences of unequal length, implementation of likelihood-based MAR analyses is not limited by computational considerations. While such analyses are valid under the comparatively weak assumption of MAR, the possibility of data missing not at random (MNAR) is difficult to rule out. It is argued, however, that MNAR analyses are, themselves, surrounded with problems and therefore, rather than ignoring MNAR analyses altogether or blindly shifting to them, their optimal place is within sensitivity analysis. The concepts developed here are illustrated using data from three clinical trials, where it is shown that the analysis method may have an impact on the conclusions of the study.

  8. Deep community detection in topologically incomplete networks

    NASA Astrophysics Data System (ADS)

    Xin, Xin; Wang, Chaokun; Ying, Xiang; Wang, Boyang

    2017-03-01

    In this paper, we consider the problem of detecting communities in topologically incomplete networks (TIN), which are usually observed from real-world networks and where some edges are missing. Existing approaches to community detection always consider the input network as connected. However, more or less, even nearly all, edges are missing in real-world applications, e.g. the protein-protein interaction networks. Clearly, it is a big challenge to effectively detect communities in these observed TIN. At first, we bring forward a simple but useful method to address the problem. Then, we design a structured deep convolutional neural network (CNN) model to better detect communities in TIN. By gradually removing edges of the real-world networks, we show the effectiveness and robustness of our structured deep model on a variety of real-world networks. Moreover, we find that the appropriate choice of hop counts can improve the performance of our deep model in some degree. Finally, experimental results conducted on synthetic data sets also show the good performance of our proposed deep CNN model.

  9. WILLIAM SEAL REJECTING AN INCOMPLETE OR IMPROPERLY SET BEARDSLEY AND ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    WILLIAM SEAL REJECTING AN INCOMPLETE OR IMPROPERLY SET BEARDSLEY AND PIPER ROTOMOLD CORMATIC CORE. - Southern Ductile Casting Company, Core Making, 2217 Carolina Avenue, Bessemer, Jefferson County, AL

  10. Surface structure of SiC formed by C60 molecules on a Si(001)-2×1 surface at 800 °C

    NASA Astrophysics Data System (ADS)

    Cheng, C.-P.; Huang, J.-W.; Pi, T.-W.; Lee, H.-H.

    2006-06-01

    Formation of silicon carbide upon deposition of C60 onto Si(001) at an elevated temperature of 800 °C was studied via synchrotron-radiation photoemission and low electron energy diffraction. The molecules are completely decomposed upon hitting on the hot surface, giving rise to a well-order 2×1 pattern. The C 1s and Si 2p core-level spectra, and valence-band spectra indicate characteristics of a Si-terminated β-SiC(001) 2×1 film. Two surface components corresponding to the terminated and ad-dimer Si atoms are well resolved in the Si 2p cores. By the spectral area ratio of both components, the adlayer atoms cover half of the surface, which agrees with the missing-row structure model [W. Lu et al., Phys. Rev. Lett. 81, 2292 (1998)].

  11. Single-molecule magnet behaviour in a tetranuclear Dy(III) complex formed from a novel tetrazine-centered hydrazone Schiff base ligand.

    PubMed

    Lacelle, T; Brunet, G; Pialat, A; Holmberg, R J; Lan, Y; Gabidullin, B; Korobkov, I; Wernsdorfer, W; Murugesu, M

    2017-02-21

    Two analogous tetranuclear lanthanide complexes have been synthesized with the general formula [Ln4(vht)4(MeOH)8](NO3)4·aMeOH·bH2O, where H2vht = (3,6-bis(vanillidenehydrazinyl)-1,2,4,5-tetrazine) and Ln = Dy(III) (1), Gd(III) (2). These complexes are characterized by several techniques; including single-crystal X-ray diffraction, SQUID magnetometry and single-crystal micro-SQUID hysteresis loop measurements. Elucidation of the crystal structure of the complexes shows that the lanthanide ions are bridged by a tetrazine ring, a rare bridging moiety for lanthanide ions. Magnetic studies reveal that both 1 and 2 exhibit weak ferromagnetic exchange interactions between Ln ions, and 1 displaying Single-Molecule Magnet (SMM) behaviour with a magnetisation reversal barrier of Ueff = 158 K (τ0 = 1.06 × 10(-7) s).

  12. Formation of Ultracold Molecules

    SciTech Connect

    Cote, Robin

    2016-01-28

    Advances in our ability to slow down and cool atoms and molecules to ultracold temperatures have paved the way to a revolution in basic research on molecules. Ultracold molecules are sensitive of very weak interactions, even when separated by large distances, which allow studies of the effect of those interactions on the behavior of molecules. In this program, we have explored ways to form ultracold molecules starting from pairs of atoms that have already reached the ultracold regime. We devised methods that enhance the efficiency of ultracold molecule production, for example by tuning external magnetic fields and using appropriate laser excitations. We also investigates the properties of those ultracold molecules, especially their de-excitation into stable molecules. We studied the possibility of creating new classes of ultra-long range molecules, named macrodimers, thousand times more extended than regular molecules. Again, such objects are possible because ultra low temperatures prevent their breakup by collision. Finally, we carried out calculations on how chemical reactions are affected and modified at ultracold temperatures. Normally, reactions become less effective as the temperature decreases, but at ultracold temperatures, they can become very effective. We studied this counter-intuitive behavior for benchmark chemical reactions involving molecular hydrogen.

  13. Sulfur-bearing molecules observed in the massive star-forming regions, DR21(OH) and G33.92+0.11

    NASA Astrophysics Data System (ADS)

    Minh, Y. C.

    2016-07-01

    Recent high sensitive and high angular resolution observations are providing unprecedented amount of chemical data, especially, on the massive star-forming regions. It will greatly extend our understandings on the complicated star formation process, if we can digest those huge amount of information. We discuss here on the properties of the sulfurbearing species observed with high angular resolutions toward two massive star-forming regions, DR21(OH) and G33.92+0.11. H2S may not exist as a solid form in the grain mantles, but OCS is believed to be one of major solid sulfur species, as suggested before. In addition, the bipolar-like outflow of the H2CS emission observed in DR21(OH) may suggest that H2CS is also one of solid sulfur species on the grain mantles. Depending on the chemical environment, the competition between hydrogenation and oxidization on the grain surface may lead to formation of specific solid forms to dominate, which could be either H2CS or OCS. SO and SO2 are often observed to be associated with ionized gas, such as the UC HII regions. These species seem to be formed in the high temperature turbulent gas in a later stage of star formation after the hot core phase. Fractional abundances of these sulfur-bearing species appear to be consistent to a certain extent in several star-forming regions. The physical and chemical evolution of massive star formation seems to pass through very similar stages in most star-forming regions. Consequently, it may indicate that there exists a consistent and coherent pattern of processes experienced by the massive star formation, in spite of the large variations in small scale locational differences.

  14. The bond-forming reactions of atomic dications with neutral molecules: formation of ArNH+ and ArN+ from collisions of Ar2+ with NH3.

    PubMed

    Lambert, Natalie; Kearney, Dominic; Kaltsoyannis, Nikolas; Price, Stephen D

    2004-03-24

    An experimental and computational study has been performed to investigate the bond-forming reactivity between Ar(2+) and NH(3). Experimentally, we detect two previously unobserved bond-forming reactions between Ar(2+) and NH(3) forming ArN(+) and ArNH(+). This is the first experimental observation of a triatomic product ion (ArNH(+)) following a chemical reaction of a rare gas dication with a neutral. The intensity of ArNH(+) was found to decrease with increasing collision energy, with a corresponding increase in the intensity of ArN(+), indicating that ArN(+) is formed by the dissociation of ArNH(+). Key features on the potential energy surface for the reaction were calculated quantum chemically using CASSCF and MRCI methods. The calculated reaction mechanism, which takes place on a singlet surface, involves the initial formation of an Ar-N bond to give Ar-NH(3)(2+). This complexation is followed by proton loss via a transition state, and then loss of the two remaining hydrogen atoms in two subsequent activationless steps to give the products (3)ArN(+) + H(+) + 2H. This calculated pathway supports the sequential formation of ArN(+) from ArNH(+), as suggested by the experimental data. The calculations also indicate that no bond-forming pathway exists on the ground triplet surface for this system.

  15. Emission spectrometric arcing procedure with minimal effect of chemical form of sample. [performed on refractory metal matrix composites

    NASA Technical Reports Server (NTRS)

    Gordon, W. A.

    1975-01-01

    Matrix effects related to the chemical form of analyzed materials were studied. An arc in argon was used which was buffered with silver chloride. The effect of chemical form was minimal for a variety of metals, oxides, and carbides representing the most refractory compounds and thermally stable metal-containing molecules. Only four of the most refractory materials known showed significant emission depressions due to incomplete volatilization in the arc system. These results are discussed in terms of vapor pressures of the solid materials placed on the anodes and dissociation reactions of the molecules in the gaseous environment.

  16. Auditory Compensation for Head Rotation Is Incomplete

    PubMed Central

    2016-01-01

    Hearing is confronted by a similar problem to vision when the observer moves. The image motion that is created remains ambiguous until the observer knows the velocity of eye and/or head. One way the visual system solves this problem is to use motor commands, proprioception, and vestibular information. These “extraretinal signals” compensate for self-movement, converting image motion into head-centered coordinates, although not always perfectly. We investigated whether the auditory system also transforms coordinates by examining the degree of compensation for head rotation when judging a moving sound. Real-time recordings of head motion were used to change the “movement gain” relating head movement to source movement across a loudspeaker array. We then determined psychophysically the gain that corresponded to a perceptually stationary source. Experiment 1 showed that the gain was small and positive for a wide range of trained head speeds. Hence, listeners perceived a stationary source as moving slightly opposite to the head rotation, in much the same way that observers see stationary visual objects move against a smooth pursuit eye movement. Experiment 2 showed the degree of compensation remained the same for sounds presented at different azimuths, although the precision of performance declined when the sound was eccentric. We discuss two possible explanations for incomplete compensation, one based on differences in the accuracy of signals encoding image motion and self-movement and one concerning statistical optimization that sacrifices accuracy for precision. We then consider the degree to which such explanations can be applied to auditory motion perception in moving listeners. PMID:27841453

  17. Mind Molecules

    PubMed Central

    Snyder, Solomon H.

    2011-01-01

    Scientific styles vary tremendously. For me, research is largely about the unfettered pursuit of novel ideas and experiments that can test multiple ideas in a day, not a year, an approach that I learned from my mentor Julius “Julie” Axelrod. This focus on creative conceptualizations has been my métier since working in the summers during medical school at the National Institutes of Health, during my two years in the Axelrod laboratory, and throughout my forty-five years at Johns Hopkins University School of Medicine. Equally important has been the “high” that emerges from brainstorming with my students. Nothing can compare with the eureka moments when, together, we sense new insights and, better yet, when high-risk, high-payoff experiments succeed. Although I have studied many different questions over the years, a common theme emerges: simple biochemical approaches to understanding molecular messengers, usually small molecules. Equally important has been identifying, purifying, and cloning the messengers' relevant biosynthetic, degradative, or target proteins, at all times seeking potential therapeutic relevance in the form of drugs. In the interests of brevity, this Reflections article is highly selective, and, with a few exceptions, literature citations are only of findings of our laboratory that illustrate notable themes. PMID:21543333

  18. 40 CFR 86.085-20 - Incomplete vehicles, classification.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... and Heavy-Duty Engines, and for 1985 and Later Model Year New Gasoline Fueled, Natural Gas-Fueled, Liquefied Petroleum Gas-Fueled and Methanol-Fueled Heavy-Duty Vehicles § 86.085-20 Incomplete vehicles... 40 Protection of Environment 19 2014-07-01 2014-07-01 false Incomplete vehicles,...

  19. Calculating Balanced Incomplete Block Design for Educational Assessments.

    ERIC Educational Resources Information Center

    van der Linden, Wim J.; Carlson, James E.

    A popular design in large-scale educational assessments is the balanced incomplete block design. The design assumes that the item pool is split into a set of blocks of items that are assigned to assessment booklets. This paper shows how the technique of 0-1 linear programming can be used to calculate a balanced incomplete block design. Several…

  20. Loss of Information in Estimating Item Parameters in Incomplete Designs

    ERIC Educational Resources Information Center

    Eggen, Theo J. H. M.; Verelst, Norman D.

    2006-01-01

    In this paper, the efficiency of conditional maximum likelihood (CML) and marginal maximum likelihood (MML) estimation of the item parameters of the Rasch model in incomplete designs is investigated. The use of the concept of F-information (Eggen, 2000) is generalized to incomplete testing designs. The scaled determinant of the F-information…

  1. 49 CFR 630.6 - Late and incomplete reports.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 49 Transportation 7 2012-10-01 2012-10-01 false Late and incomplete reports. 630.6 Section 630.6 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL TRANSIT ADMINISTRATION, DEPARTMENT OF TRANSPORTATION NATIONAL TRANSIT DATABASE § 630.6 Late and incomplete reports. (a) Late...

  2. 49 CFR 630.6 - Late and incomplete reports.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 49 Transportation 7 2013-10-01 2013-10-01 false Late and incomplete reports. 630.6 Section 630.6 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL TRANSIT ADMINISTRATION, DEPARTMENT OF TRANSPORTATION NATIONAL TRANSIT DATABASE § 630.6 Late and incomplete reports. (a) Late...

  3. 49 CFR 630.6 - Late and incomplete reports.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 49 Transportation 7 2011-10-01 2011-10-01 false Late and incomplete reports. 630.6 Section 630.6 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL TRANSIT ADMINISTRATION, DEPARTMENT OF TRANSPORTATION NATIONAL TRANSIT DATABASE § 630.6 Late and incomplete reports. (a) Late...

  4. 49 CFR 630.6 - Late and incomplete reports.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 49 Transportation 7 2014-10-01 2014-10-01 false Late and incomplete reports. 630.6 Section 630.6 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL TRANSIT ADMINISTRATION, DEPARTMENT OF TRANSPORTATION NATIONAL TRANSIT DATABASE § 630.6 Late and incomplete reports. (a) Late...

  5. Treatment of Intravenous Leiomyomatosis with Cardiac Extension following Incomplete Resection

    PubMed Central

    Doyle, Mathew P.; Li, Annette; Villanueva, Claudia I.; Peeceeyen, Sheen C. S.; Cooper, Michael G.; Hanel, Kevin C.; Fermanis, Gary G.; Robertson, Greg

    2015-01-01

    Aim. Intravenous leiomyomatosis (IVL) with cardiac extension (CE) is a rare variant of benign uterine leiomyoma. Incomplete resection has a recurrence rate of over 30%. Different hormonal treatments have been described following incomplete resection; however no standard therapy currently exists. We review the literature for medical treatments options following incomplete resection of IVL with CE. Methods. Electronic databases were searched for all studies reporting IVL with CE. These studies were then searched for reports of patients with inoperable or incomplete resection and any further medical treatments. Our database was searched for patients with medical therapy following incomplete resection of IVL with CE and their results were included. Results. All studies were either case reports or case series. Five literature reviews confirm that surgery is the only treatment to achieve cure. The uses of progesterone, estrogen modulation, gonadotropin-releasing hormone antagonism, and aromatase inhibition have been described following incomplete resection. Currently no studies have reviewed the outcomes of these treatments. Conclusions. Complete surgical resection is the only means of cure for IVL with CE, while multiple hormonal therapies have been used with varying results following incomplete resection. Aromatase inhibitors are the only reported treatment to prevent tumor progression or recurrence in patients with incompletely resected IVL with CE. PMID:26783463

  6. Single-molecule tracking studies of flow-induced microdomain alignment in cylinder-forming polystyrene-poly(ethylene oxide) diblock copolymer films.

    PubMed

    Tran-Ba, Khanh-Hoa; Higgins, Daniel A; Ito, Takashi

    2014-09-25

    Flow-based approaches are promising routes to preparation of aligned block copolymer microdomains within confined spaces. An in-depth characterization of such nanoscale morphologies within macroscopically nonuniform materials under ambient conditions is, however, often challenging. In this study, single-molecule tracking (SMT) methods were employed to probe the flow-induced alignment of cylindrical microdomains (ca. 22 nm in diameter) in polystyrene-poly(ethylene oxide) diblock copolymer (PS-b-PEO) films. Films of micrometer-scale thicknesses were prepared by overlaying a benzene solution droplet on a glass coverslip with a rectangular glass plate, followed by solvent evaporation under a nitrogen atmosphere. The microdomain alignment was quantitatively assessed from SMT data exhibiting the diffusional motions of individual sulforhodamine B fluorescent probes that preferentially partitioned into cylindrical PEO microdomains. Better overall microdomain orientation along the flow direction was observed near the substrate interface in films prepared at a higher flow rate, suggesting that the microdomain alignment was primarily induced by shear flow. The SMT data also revealed the presence of micrometer-scale grains consisting of highly ordered microdomains with coherent orientation. The results of this study provide insights into shear-based preparation of aligned cylindrical microdomains in block copolymer films from solutions within confined spaces.

  7. Surface species formed by the adsorption and dissociation of water molecules on Ru(0001) surface containing a small coverage of carbon atoms studied by scanning tunneling microscopy

    SciTech Connect

    Dept of Materials Science and Engineering UCB; Dept of Applied Science and Technology, UCB; Institut de Ciencia de Materials de Barcelona, Barcelona, Spain; Instituto de Ciencia de Materiales de Madrid, Madrid, Spain; Department of Mechanical Engineering, Yale University; Salmeron, Miquel; Shimizu, Tomoko K.; Mugarza, Aitor; Cerda, Jorge I.; Heyde, Markus; Qi, Yabing; Schwarz, Udo D.; Ogletree, D. Frank; Salmeron, Miquel

    2008-04-26

    The adsorption and dissociation of water on a Ru(0001) surface containing a small amount ({le} 3 %) of carbon impurities was studied by scanning tunneling microscopy (STM). Various surface species are formed depending on the temperature. These include molecular H{sub 2}O, H{sub 2}O-C complexes, H, O, OH and CH. Clusters of either pure H{sub 2}O or mixed H{sub 2}O-OH species are also formed. Each of these species produces a characteristic contrast in the STM images and can be identified by experiment and by ab initio total energy calculations coupled with STM image simulations. Manipulation of individual species via excitation of vibrational modes with the tunneling electrons has been used as supporting evidence.

  8. Improved small molecule drug release from in situ forming poly(lactic-co-glycolic acid) scaffolds incorporating poly(β-amino ester) and hydroxyapatite microparticles.

    PubMed

    Fisher, Paul D; Palomino, Pablo; Milbrandt, Todd A; Hilt, J Zach; Puleo, David A

    2014-01-01

    In situ forming implants are an attractive choice for controlled drug release into a fixed location. Currently, rapidly solidifying solvent exchange systems suffer from a high initial burst, and sustained release behavior is tied to polymer precipitation and degradation rate. The present studies investigated addition of hydroxyapatite (HA) and drug-loaded poly(β-amino ester) (PBAE) microparticles to in situ forming poly(lactic-co-glycolic acid) (PLGA)-based systems to prolong release and reduce burst. PBAEs were synthesized, imbibed with simvastatin (osteogenic) or clodronate (anti-resorptive), and then ground into microparticles. Microparticles were mixed with or without HA into a PLGA solution, and the mixture was injected into buffer, leading to precipitation and creating solid scaffolds with embedded HA and PBAE microparticles. Simvastatin release was prolonged through 30 days, and burst release was reduced from 81 to 39% when loaded into PBAE microparticles. Clodronate burst was reduced from 49 to 32% after addition of HA filler, but release kinetics were unaffected after loading into PBAE microparticles. Scaffold dry mass remained unchanged through day 15, with a pronounced increase in degradation rate after day 30, while wet scaffolds experienced a mass increase through day 25 due to swelling. Porosity and pore size changed throughout degradation, likely due to a combination of swelling and degradation. The system offers improved release kinetics, multiple release profiles, and rapid solidification compared to traditional in situ forming implants.

  9. Improved small molecule drug release from in situ forming poly(lactic-co-glycolic acid) scaffolds incorporating poly(β-amino ester) and hydroxyapatite microparticles

    PubMed Central

    Fisher, Paul D.; Palomino, Pablo; Milbrandt, Todd A.; Hilt, J. Zach; Puleo, David A.

    2014-01-01

    In situ forming implants are an attractive choice for controlled drug release into a fixed location. Currently, rapidly solidifying solvent exchange systems suffer from a high initial burst, and sustained release behavior is tied to polymer precipitation and degradation rate. The present studies investigated addition of hydroxyapatite (HA) and drug-loaded poly(β-amino ester) (PBAE) microparticles to in situ forming poly(lactic-co-glycolic acid) (PLGA)–based systems to prolong release and reduce burst. PBAEs were synthesized, imbibed with simvastatin (osteogenic) or clodronate (anti-resorptive), and then ground into microparticles. Microparticles were mixed with or without HA into a PLGA solution, and the mixture was injected into buffer, leading to precipitation and creating solid scaffolds with embedded HA and PBAE microparticles. Simvastatin release was prolonged through 30 days, and burst release was reduced from 81% to 39% when loaded into PBAE microparticles. Clodronate burst was reduced from 49% to 32% after addition of HA filler, but release kinetics were unaffected after loading into PBAE microparticles. Scaffold dry mass remained unchanged through day 15, with a pronounced increase in degradation rate after day 30, while wet scaffolds experienced a mass increase through day 25 due to swelling. Porosity and pore size changed throughout degradation, likely due to a combination of swelling and degradation. The system offers improved release kinetics, multiple release profiles, and rapid solidification compared to traditional in situ forming implants. PMID:24903524

  10. Proteolytic cleavage of chemerin protein is necessary for activation to the active form, Chem157S, which functions as a signaling molecule in glioblastoma.

    PubMed

    Yamaguchi, Yasuto; Du, Xiao-Yan; Zhao, Lei; Morser, John; Leung, Lawrence L K

    2011-11-11

    Chemerin is a chemoattractant involved in innate and adaptive immunity as well as an adipokine implicated in adipocyte differentiation. Chemerin circulates as an inactive precursor in blood whose bioactivity is closely regulated through proteolytic processing at its C terminus. We developed methodology for production of different recombinant chemerin isoforms (chem163S, chem157S, and chem155A) which allowed us to obtain large quantities of these proteins with purity of >95%. Chem158K was generated from chem163S by plasmin cleavage. Characterization by mass spectrometry and Edman degradation demonstrated that both the N and C termini were correct for each isoform. Ca(2+) mobilization assays showed that the EC(50) values for chem163S and chem158K were 54.2 ± 19.9 nm and 65.2 ± 13.2 nm, respectively, whereas chem157S had a ∼50-fold higher potency with an EC(50) of 1.2 ± 0.7 nm. Chem155A had no agonist activity and weak antagonist activity, causing a 50% reduction of chem157S activity at a molar ratio of 100:1. Similar results were obtained in a chemotaxis assay. Because chem158K is the dominant form in cerebrospinal fluid from patients with glioblastoma (GBM), we examined the significance of chemerin in GBM biology. In silico analysis showed chemerin mRNA was significantly increased in tissue from grade III and IV gliomas. Furthermore, U-87 MG cells, a human GBM line, express the chemerin receptors, chemokine-like receptor 1 and chemokine receptor-like 2, and chem157S triggered Ca(2+) flux. This study emphasized the necessity of appropriate C-terminal proteolytic processing to generate the likely physiologic form of active chemerin, chem157S, and suggested a possible role in malignant GBM.

  11. The topology of integrable systems with incomplete fields

    SciTech Connect

    Aleshkin, K R

    2014-09-30

    Liouville's theorem holds for Hamiltonian systems with complete Hamiltonian fields which possess a complete involutive system of first integrals; such systems are called Liouville-integrable. In this paper integrable systems with incomplete Hamiltonian fields are investigated. It is shown that Liouville's theorem remains valid in the case of a single incomplete field, while if the number of incomplete fields is greater, a certain analogue of the theorem holds. An integrable system on the algebra sl(3) is taken as an example. Bibliography: 11 titles.

  12. Double Incomplete Internal Biliary Fistula: Coexisting Cholecystogastric and Cholecystoduodenal Fistula

    PubMed Central

    Beksac, Kemal; Erkan, Arman; Kaynaroglu, Volkan

    2016-01-01

    Internal biliary fistula is a rare complication of a common surgical disease, cholelithiasis. It is seen in 0.74% of all biliary tract surgeries and is thought to be a result of repeated inflammatory periods of the gallbladder. In this report we present a case of incomplete cholecystogastric and cholecystoduodenal fistulae in a single patient missed by ultrasonography and endoscopic retrograde cholangiopancreatography and diagnosed intraoperatively. In the literature there is only one report of an incomplete cholecystogastric fistula. To our knowledge this is the first case of double incomplete internal biliary fistulae. PMID:26904348

  13. Interstellar Molecules

    ERIC Educational Resources Information Center

    Solomon, Philip M.

    1973-01-01

    Radioastronomy reveals that clouds between the stars, once believed to consist of simple atoms, contain molecules as complex as seven atoms and may be the most massive objects in our Galaxy. (Author/DF)

  14. Modeling Molecules

    NASA Technical Reports Server (NTRS)

    2000-01-01

    The molecule modeling method known as Multibody Order (N) Dynamics, or MBO(N)D, was developed by Moldyn, Inc. at Goddard Space Flight Center through funding provided by the SBIR program. The software can model the dynamics of molecules through technology which stimulates low-frequency molecular motions and properties, such as movements among a molecule's constituent parts. With MBO(N)D, a molecule is substructured into a set of interconnected rigid and flexible bodies. These bodies replace the computation burden of mapping individual atoms. Moldyn's technology cuts computation time while increasing accuracy. The MBO(N)D technology is available as Insight II 97.0 from Molecular Simulations, Inc. Currently the technology is used to account for forces on spacecraft parts and to perform molecular analyses for pharmaceutical purposes. It permits the solution of molecular dynamics problems on a moderate workstation, as opposed to on a supercomputer.

  15. Plant development, auxin, and the subsystem incompleteness theorem.

    PubMed

    Niklas, Karl J; Kutschera, Ulrich

    2012-01-01

    Plant morphogenesis (the process whereby form develops) requires signal cross-talking among all levels of organization to coordinate the operation of metabolic and genomic subsystems operating in a larger network of subsystems. Each subsystem can be rendered as a logic circuit supervising the operation of one or more signal-activated system. This approach simplifies complex morphogenetic phenomena and allows for their aggregation into diagrams of progressively larger networks. This technique is illustrated here by rendering two logic circuits and signal-activated subsystems, one for auxin (IAA) polar/lateral intercellular transport and another for IAA-mediated cell wall loosening. For each of these phenomena, a circuit/subsystem diagram highlights missing components (either in the logic circuit or in the subsystem it supervises) that must be identified experimentally if each of these basic plant phenomena is to be fully understood. We also illustrate the "subsystem incompleteness theorem," which states that no subsystem is operationally self-sufficient. Indeed, a whole-organism perspective is required to understand even the most simple morphogenetic process, because, when isolated, every biological signal-activated subsystem is morphogenetically ineffective.

  16. Enumerating molecules.

    SciTech Connect

    Visco, Donald Patrick, Jr.; Faulon, Jean-Loup Michel; Roe, Diana C.

    2004-04-01

    This report is a comprehensive review of the field of molecular enumeration from early isomer counting theories to evolutionary algorithms that design molecules in silico. The core of the review is a detail account on how molecules are counted, enumerated, and sampled. The practical applications of molecular enumeration are also reviewed for chemical information, structure elucidation, molecular design, and combinatorial library design purposes. This review is to appear as a chapter in Reviews in Computational Chemistry volume 21 edited by Kenny B. Lipkowitz.

  17. X-ray mapping in heterocyclic design: 17. Crystal and molecular structures of the 'molecule of the month'; and its hydrogenated form

    SciTech Connect

    Rybakov, V. B. Alekseev, R. S.; Kurkin, A. V.; Yurovskaya, M. A.

    2011-01-15

    The structures of 2,8-dimethyl-5-[2-(6-methylpyridin-3-yl)ethyl]-2,3,4,4a,5, 9b-hexahydro1H-pyrido[4,3-b]indole trihydrobromide (I) (a = 12.865(4) Angstrom-Sign , b = 14.281(3) Angstrom-Sign , c = 13.553(3) Angstrom-Sign , Z = 4, sp. gr. Pna2{sub 1}) and 2,8-dimethyl-5-[2-(6-methylpyridin-3-yl)ethyl]-2,3,4,5-tetrahydro-1H-pyrido [4,3-b]indole dihydrobromide (II) (a = 13.9704(14) Angstrom-Sign , b = 14.4447(15) Angstrom-Sign , c = 10.7819(12) Angstrom-Sign , {beta} = 107.58(1) Degree-Sign , Z = 4, sp. gr. P2{sub 1}/c) were studied by single-crystal X-ray diffraction. The structures were solved by direct methods and refined by the full-matrix least-squares method with anisotropic displacement parameters to the R factors of 0.0603 and 0.0446, respectively. All Br{sup -} anions form hydrogen bonds with protonated nitrogen atoms. The synthesis and physicochemical parameters of these two compounds are reported.

  18. [Age and aging as incomplete architecture of human ontogenesis].

    PubMed

    Baltes, P B

    1999-12-01

    The focus is on the basic biological-genetic and social-cultural architecture of human development across the life span. The starting point is the frame provided by past evolutionary forces. A first conclusion is that for modern times and the relative brevity of the time windows involved in modernity, further change in human functioning is primarily dependent on the evolution of new cultural forms of knowledge rather than evolution-based changes in the human genome. A second conclusion concerns the general architecture of the life course. Three governing lifespan developmental principles coexist. First, because long-term evolutionary selection evince a negative age correlation, genome-based plasticity and biological potential decrease with age. Second, for growth aspects of human development to extend further into the life span, culture-based resources are required at ever increasing levels. Third, because of age-related losses in biological plasticity and negative effects associated with some principles of learning (e.g., negative transfer), the efficiency of culture is reduced as lifespan development unfolds. Joint application of these principles suggests that the lifespan architecture becomes more and more incomplete with age. Three examples are given to illustrate the implications of the lifespan architecture outlined. The first is a general theory of development involving the orchestration of three component processes and their age-related dynamics: Selection, optimization, and compensation. The second example is theory and research on lifespan intelligence that distinguishes between the biology-based mechanics and culture-based pragmatics of intelligence and specifies distinct age gradients for the two categories of intellectual functioning. The third example considers the goal of evolving a positive biological and cultural scenario for the last phase of life (fourth age). Because of the general lifespan architecture outlined, this objective becomes

  19. Incomplete and transitory decrease of glycolysis

    PubMed Central

    Schoors, Sandra; Cantelmo, Anna Rita; Georgiadou, Maria; Stapor, Peter; Wang, Xingwu; Quaegebeur, Annelies; Cauwenberghs, Sandra; Wong, Brian W; Bifari, Francesco; Decimo, Ilaria; Schoonjans, Luc; De Bock, Katrien; Dewerchin, Mieke; Carmeliet, Peter

    2014-01-01

    During vessel sprouting, a migratory endothelial tip cell guides the sprout, while proliferating stalk cells elongate the branch. Tip and stalk cell phenotypes are not genetically predetermined fates, but are dynamically interchangeable to ensure that the fittest endothelial cell (EC) leads the vessel sprout. ECs increase glycolysis when forming new blood vessels. Genetic deficiency of the glycolytic activator PFKFB3 in ECs reduces vascular sprouting by impairing migration of tip cells and proliferation of stalk cells. PFKFB3-driven glycolysis promotes the tip cell phenotype during vessel sprouting, since PFKFB3 overexpression overrules the pro-stalk activity of Notch signaling. Furthermore, PFKFB3-deficient ECs cannot compete with wild-type neighbors to form new blood vessels in chimeric mosaic mice. In addition, pharmacological PFKFB3 blockade reduces pathological angiogenesis with modest systemic effects, likely because it decreases glycolysis only partially and transiently. PMID:24335389

  20. Time-dependent solutions for a stochastic model of gene expression with molecule production in the form of a compound Poisson process

    NASA Astrophysics Data System (ADS)

    Jedrak, Jakub; Ochab-Marcinek, Anna

    2016-09-01

    We study a stochastic model of gene expression, in which protein production has a form of random bursts whose size distribution is arbitrary, whereas protein decay is a first-order reaction. We find exact analytical expressions for the time evolution of the cumulant-generating function for the most general case when both the burst size probability distribution and the model parameters depend on time in an arbitrary (e.g., oscillatory) manner, and for arbitrary initial conditions. We show that in the case of periodic external activation and constant protein degradation rate, the response of the gene is analogous to the resistor-capacitor low-pass filter, where slow oscillations of the external driving have a greater effect on gene expression than the fast ones. We also demonstrate that the n th cumulant of the protein number distribution depends on the n th moment of the burst size distribution. We use these results to show that different measures of noise (coefficient of variation, Fano factor, fractional change of variance) may vary in time in a different manner. Therefore, any biological hypothesis of evolutionary optimization based on the nonmonotonic dependence of a chosen measure of noise on time must justify why it assumes that biological evolution quantifies noise in that particular way. Finally, we show that not only for exponentially distributed burst sizes but also for a wider class of burst size distributions (e.g., Dirac delta and gamma) the control of gene expression level by burst frequency modulation gives rise to proportional scaling of variance of the protein number distribution to its mean, whereas the control by amplitude modulation implies proportionality of protein number variance to the mean squared.

  1. Efficient and accurate computation of the incomplete Airy functions

    NASA Technical Reports Server (NTRS)

    Constantinides, E. D.; Marhefka, R. J.

    1993-01-01

    The incomplete Airy integrals serve as canonical functions for the uniform ray optical solutions to several high-frequency scattering and diffraction problems that involve a class of integrals characterized by two stationary points that are arbitrarily close to one another or to an integration endpoint. Integrals with such analytical properties describe transition region phenomena associated with composite shadow boundaries. An efficient and accurate method for computing the incomplete Airy functions would make the solutions to such problems useful for engineering purposes. In this paper a convergent series solution for the incomplete Airy functions is derived. Asymptotic expansions involving several terms are also developed and serve as large argument approximations. The combination of the series solution with the asymptotic formulae provides for an efficient and accurate computation of the incomplete Airy functions. Validation of accuracy is accomplished using direct numerical integration data.

  2. Constructivism and empiricism: An incomplete divorce

    NASA Astrophysics Data System (ADS)

    Matthews, Michael R.

    1992-12-01

    The paper outlines the significant influence of constructivism in contemporary science and mathematics education, and emphasises the central role that epistemology plays in constructivist theory and practice. It is claimed that despite the anti-empiricism of much constructivist writing, in most forms its epistemology is nevertheless firmly empiricist. In particular it is subject-centered and experience-based. It is argued that its relativist, if not skeptical conclusions, only follow given these empiricist assumptions. Further it is suggested that such assumptions belong to Aristotelian science, and were effectively overthrown with the modern science of Galileo and Newton. Thus constructivism cannot provide understanding of post-Aristotelian science.

  3. Incomplete Relaxation between Beats after Myocardial Hypoxia and Ischemia

    PubMed Central

    Weisfeldt, Myron L.; Armstrong, Paul; Scully, Hugh E.; Sanders, Charles A.; Daggett, Willard M.

    1974-01-01

    Recovery from hypoxia has been shown to prolong cardiac muscle contraction, particularly the relaxation phase. The present studies were designed to examine whether incomplete relaxation between beats can result from this prolongation of contraction and relaxation in isolated muscle after hypoxia and in the canine heart after both hypoxia and acute ischemia. The relationship between heart rate and the extent of incomplete relaxation is emphasized in view of the known enhancement of the velocity of contraction caused by increasing heart rate. The extent of incomplete relaxation during 10-s periods of pacing at increasing rates was examined before and after hypoxia in isometric cat right ventricular papillary muscle (12-120 beats/min) and in the canine isovolumic left ventricle (120-180 beats/min). Incomplete relaxation was quantified by measuring the difference between the lowest diastolic tension or pressure during pacing and the true resting tension or pressure determined by interruption of pacing at each rate. In eight cat papillary muscles (29°C), there was significantly greater incomplete relaxation 5 min after hypoxia at rates of 96 and 120 beats/min (P < 0.02 vs. before hypoxia). In seven canine isovolumic left ventricles, recovery from hypoxia and higher heart rates also resulted in incomplete relaxation. Incomplete relaxation before hypoxia at a rate of 180 beats/min was 0.8±0.5 cm H2O and at 5 min of recovery from hypoxia was 12.6±3.5 cm H2O (P < 0.01). 12 hearts were subjected to a 1.5-3-min period of acute ischemia and fibrillation. There was significant incomplete relaxation at a rate of 140 beats/min for 5 min after defibrillation and reperfusion. These data indicate that incomplete relaxation is an important determinant of diastolic hemodynamics during recovery from ischemia or hypoxia. The extent of incomplete relaxation appears to be a function of the rate of normalization of the velocity of relaxation and tension development after ischemia or

  4. Ultra-cold molecule production.

    SciTech Connect

    Ramirez-Serrano, Jamie; Chandler, David W.; Strecker, Kevin; Rahn, Larry A.

    2005-12-01

    The production of Ultra-cold molecules is a goal of many laboratories through out the world. Here we are pursuing a unique technique that utilizes the kinematics of atomic and molecular collisions to achieve the goal of producing substantial numbers of sub Kelvin molecules confined in a trap. Here a trap is defined as an apparatus that spatially localizes, in a known location in the laboratory, a sample of molecules whose temperature is below one degree absolute Kelvin. Further, the storage time for the molecules must be sufficient to measure and possibly further cool the molecules. We utilize a technique unique to Sandia to form cold molecules from near mass degenerate collisions between atoms and molecules. This report describes the progress we have made using this novel technique and the further progress towards trapping molecules we have cooled.

  5. Fiber-mesh photonic molecule

    NASA Astrophysics Data System (ADS)

    Mishra, Subodha; Satpathy, Sashi

    2008-03-01

    Analogous to the photonic crystal, we introduce the concept of a fiber-mesh photonic molecule made up of optical fibers and study its transmission characteristics. We consider a specific example of a photonic molecule, inspired by the well-known C60 molecule, with the arms of the molecule formed out of single-moded optical fibers. The transmittance consists of sharp peaks determined by the pole structure of the scattering matrix in the complex energy plane. A molecule can be designed to control the positions and the widths of the transmission peaks, opening up the possibility of building new photonic devices such as high quality band-pass filters.

  6. A statistical approach for distinguishing hybridization and incomplete lineage sorting.

    PubMed

    Joly, Simon; McLenachan, Patricia A; Lockhart, Peter J

    2009-08-01

    The extent and evolutionary significance of hybridization is difficult to evaluate because of the difficulty in distinguishing hybridization from incomplete lineage sorting. Here we present a novel parametric approach for statistically distinguishing hybridization from incomplete lineage sorting based on minimum genetic distances of a nonrecombining locus. It is based on the idea that the expected minimum genetic distance between sequences from two species is smaller for some hybridization events than for incomplete lineage sorting scenarios. When applied to empirical data sets, distributions can be generated for the minimum interspecies distances expected under incomplete lineage sorting using coalescent simulations. If the observed distance between sequences from two species is smaller than its predicted distribution, incomplete lineage sorting can be rejected and hybridization inferred. We demonstrate the power of the method using simulations and illustrate its application on New Zealand alpine buttercups (Ranunculus). The method is robust and complements existing approaches. Thus it should allow biologists to assess with greater accuracy the importance of hybridization in evolution.

  7. Incomplete caries removal: a systematic review and meta-analysis.

    PubMed

    Schwendicke, F; Dörfer, C E; Paris, S

    2013-04-01

    Increasing numbers of clinical trials have demonstrated the benefits of incomplete caries removal, in particular in the treatment of deep caries. This study systematically reviewed randomized controlled trials investigating one- or two-step incomplete compared with complete caries removal. Studies treating primary and permanent teeth with primary caries lesions requiring a restoration were analyzed. The following primary and secondary outcomes were investigated: risk of pulpal exposure, post-operative pulpal symptoms, overall failure, and caries progression. Electronic databases were screened for studies from 1967 to 2012. Cross-referencing was used to identify further articles. Odds ratios (OR) as effect estimates were calculated in a random-effects model. From 364 screened articles, 10 studies representing 1,257 patients were included. Meta-analysis showed risk reduction for both pulpal exposure (OR [95% CI] 0.31 [0.19-0.49]) and pulpal symptoms (OR 0.58 [0.31-1.10]) for teeth treated with one- or two-step incomplete excavation. Risk of failure seemed to be similar for both complete and incomplete excavation, but data for this outcome were of limited quality and inconclusive (OR 0.97 [0.64-1.46]). Based on reviewed studies, incomplete caries removal seems advantageous compared with complete excavation, especially in proximity to the pulp. However, evidence levels are currently insufficient for definitive conclusions because of high risk of bias within studies.

  8. Handling incomplete smoking history data in survival analysis.

    PubMed

    Furukawa, Kyoji; Preston, Dale L; Misumi, Munechika; Cullings, Harry M

    2014-10-26

    While data are unavoidably missing or incomplete in most observational studies, consequences of mishandling such incompleteness in analysis are often overlooked. When time-varying information is collected irregularly and infrequently over a long period, even precisely obtained data may implicitly involve substantial incompleteness. Motivated by an analysis to quantitatively evaluate the effects of smoking and radiation on lung cancer risks among Japanese atomic-bomb survivors, we provide a unique application of multiple imputation to incompletely observed smoking histories under the assumption of missing at random. Predicting missing values for the age of smoking initiation and, given initiation, smoking intensity and cessation age, analyses can be based on complete, though partially imputed, smoking histories. A simulation study shows that multiple imputation appropriately conditioned on the outcome and other relevant variables can produce consistent estimates when data are missing at random. Our approach is particularly appealing in large cohort studies where a considerable amount of time-varying information is incomplete under a mechanism depending in a complex manner on other variables. In application to the motivating example, this approach is expected to reduce estimation bias that might be unavoidable in naive analyses, while keeping efficiency by retaining known information.

  9. Incomplete fuzzy data processing systems using artificial neural network

    NASA Technical Reports Server (NTRS)

    Patyra, Marek J.

    1992-01-01

    In this paper, the implementation of a fuzzy data processing system using an artificial neural network (ANN) is discussed. The binary representation of fuzzy data is assumed, where the universe of discourse is decartelized into n equal intervals. The value of a membership function is represented by a binary number. It is proposed that incomplete fuzzy data processing be performed in two stages. The first stage performs the 'retrieval' of incomplete fuzzy data, and the second stage performs the desired operation on the retrieval data. The method of incomplete fuzzy data retrieval is proposed based on the linear approximation of missing values of the membership function. The ANN implementation of the proposed system is presented. The system was computationally verified and showed a relatively small total error.

  10. A comparison of incomplete-data methods for categorical data.

    PubMed

    van der Palm, Daniël W; van der Ark, L Andries; Vermunt, Jeroen K

    2016-04-01

    We studied four methods for handling incomplete categorical data in statistical modeling: (1) maximum likelihood estimation of the statistical model with incomplete data, (2) multiple imputation using a loglinear model, (3) multiple imputation using a latent class model, (4) and multivariate imputation by chained equations. Each method has advantages and disadvantages, and it is unknown which method should be recommended to practitioners. We reviewed the merits of each method and investigated their effect on the bias and stability of parameter estimates and bias of the standard errors. We found that multiple imputation using a latent class model with many latent classes was the most promising method for handling incomplete categorical data, especially when the number of variables used in the imputation model is large.

  11. A Novel Method to Assess Incompleteness of Mammography Reports

    PubMed Central

    Gimenez, Francisco J.; Wu, Yirong; Burnside, Elizabeth S.; Rubin, Daniel L.

    2014-01-01

    Mammography has been shown to improve outcomes of women with breast cancer, but it is subject to inter-reader variability. One well-documented source of such variability is in the content of mammography reports. The mammography report is of crucial importance, since it documents the radiologist’s imaging observations, interpretation of those observations in terms of likelihood of malignancy, and suggested patient management. In this paper, we define an incompleteness score to measure how incomplete the information content is in the mammography report and provide an algorithm to calculate this metric. We then show that the incompleteness score can be used to predict errors in interpretation. This method has 82.6% accuracy at predicting errors in interpretation and can possibly reduce total diagnostic errors by up to 21.7%. Such a method can easily be modified to suit other domains that depend on quality reporting. PMID:25954448

  12. A novel method to assess incompleteness of mammography reports.

    PubMed

    Gimenez, Francisco J; Wu, Yirong; Burnside, Elizabeth S; Rubin, Daniel L

    2014-01-01

    Mammography has been shown to improve outcomes of women with breast cancer, but it is subject to inter-reader variability. One well-documented source of such variability is in the content of mammography reports. The mammography report is of crucial importance, since it documents the radiologist's imaging observations, interpretation of those observations in terms of likelihood of malignancy, and suggested patient management. In this paper, we define an incompleteness score to measure how incomplete the information content is in the mammography report and provide an algorithm to calculate this metric. We then show that the incompleteness score can be used to predict errors in interpretation. This method has 82.6% accuracy at predicting errors in interpretation and can possibly reduce total diagnostic errors by up to 21.7%. Such a method can easily be modified to suit other domains that depend on quality reporting.

  13. SOME CODES WHICH ARE INVARIENT UNDER A DOUBLY-TRANSITIVE PERMUTATION GROUP AND THEIR CONNECTION WITH BALANCED INCOMPLETE BLOCK DESIGNS

    DTIC Science & Technology

    If a binary code is invariant under a doubly-transitive permutation group, then the set of all code words of weight j forms a balanced incomplete...codes are properly arranged, and if the first digit is omitted, then all Reed-Muller codes are cyclic.

  14. Incomplete use of condoms: the importance of sexual arousal.

    PubMed

    Graham, Cynthia A; Crosby, Richard A; Milhausen, Robin R; Sanders, Stephanie A; Yarber, William L

    2011-10-01

    The purpose of this study was to identify associations between incomplete condom use (not using condoms from start to finish of sex) and sexual arousal variables. A convenience sample of heterosexual men (n = 761) completed a web-based questionnaire. Men who scored higher on sexual arousability were more likely to put a condom on after sex had begun (AOR = 1.58). Men who reported difficulty reaching orgasm were more likely to report removing condoms before sex was over (AOR = 2.08). These findings suggest that sexual arousal may be an important, and under-studied, factor associated with incomplete use of condoms.

  15. Incomplete and False Identification Distributions: Group Screening Models.

    DTIC Science & Technology

    1981-05-01

    AD-AO99 310 MARYLAND LUN1V COLLEGE PARK F/6 12/1 INCOMPLETE AND FALSE IDENTIFICATION DISTRIBUTIONS: GROUP SCREEN--ETC(U) MAY 8l S KOTZ. N L JOHNSON...present paper, we extend some of these results to the case of screeningw’mpling schemes. KeyWords and Phrases: group screening; binomial distribution...Johnson and Kotz (1981a). la) Incomplete identification. Consider a sample of size n without replacement from a lot of size N conforming X defective (or

  16. Enzyme molecules as nanomotors.

    PubMed

    Sengupta, Samudra; Dey, Krishna K; Muddana, Hari S; Tabouillot, Tristan; Ibele, Michael E; Butler, Peter J; Sen, Ayusman

    2013-01-30

    Using fluorescence correlation spectroscopy, we show that the diffusive movements of catalase enzyme molecules increase in the presence of the substrate, hydrogen peroxide, in a concentration-dependent manner. Employing a microfluidic device to generate a substrate concentration gradient, we show that both catalase and urease enzyme molecules spread toward areas of higher substrate concentration, a form of chemotaxis at the molecular scale. Using glucose oxidase and glucose to generate a hydrogen peroxide gradient, we induce the migration of catalase toward glucose oxidase, thereby showing that chemically interconnected enzymes can be drawn together.

  17. Identification of classical anaphylatoxin as the des-Arg form of the C5a molecule: Evidence of a modulator role for the oligosaccharide unit in human des-Arg74-C5a

    PubMed Central

    Gerard, Craig; Hugli, Tony E.

    1981-01-01

    A functionally active and potentially lethal fragment of the fifth component of complement (C5) is generated during complement activation in serum from animals of various species. This factor, termed the “classical” anaphylatoxin, was isolated from porcine serum and was identified chemically as the des-Arg derivative of the well-characterized C5a molecule. Unlike the C3a and C4a anaphylatoxins, porcine C5a does not require the COOH-terminal arginyl residue for spasmogenic activity. Further degradation of porcine des-Arg74-C5a by carboxypeptidase Y removed glycine-73 and leucine-72 and decreased the intrinsic spasmogenic activity by >90%. Hence, we conclude that, although the arginyl residue is not essential, the COOH-terminal sequence Leu-Gly-Arg contributes structural information that accounts for >90% of C5a activity. Human des-Arg74-C5a, like its porcine counterpart, has instrinsic anaphylatoxin activity; however, higher concentrations were needed to contract the guinea pig ileal tissue (i.e., 1 μM for human des-Arg74-C5a versus 1 nM for porcine des-Arg74-C5a). Furthermore, the des-Arg form of human C5a was only 0.1% as active as porcine des-Arg74-C5a for enhancing vascular permeability in guinea pig skin. In addition to these biological differences, numerous chemical differences exist between the human and porcine des-Arg74-C5a molecules, the most prominent feature being an oligosaccharide entity associated uniquely with the human C5a. When the oligosaccharide unit of human des-Arg74-C5a was removed by glycosidases, leaving a single glucosamine residue attached to the side chain of asparagine-64, activity was enhanced. The human des-Arg74-C5a molecule devoid of the complex oligosaccharide unit exhibited 10-fold stronger spasmogenic activity and 20- to 50-fold greater permeability-enhancing activity than did human des-Arg74-C5a containing the oligosaccharide. Consequently, the oligosaccharide associated with human C5a modulates or suppresses potentially

  18. Augmented multisensory feedback enhances locomotor adaptation in humans with incomplete spinal cord injury.

    PubMed

    Yen, Sheng-Che; Landry, Jill M; Wu, Ming

    2014-06-01

    Different forms of augmented feedback may engage different motor learning pathways, but it is unclear how these pathways interact with each other, especially in patients with incomplete spinal cord injury (SCI). The purpose of this study was to test whether augmented multisensory feedback could enhance aftereffects following short term locomotor training (i.e., adaptation) in patients with incomplete SCI. A total of 10 subjects with incomplete SCI were recruited to perform locomotor adaptation. Three types of augmented feedback were provided during the adaptation: (a) computerized visual cues showing the actual and target stride length (augmented visual feedback); (b) a swing resistance applied to the leg (augmented proprioceptive feedback); (c) a combination of the visual cues and resistance (augmented multisensory feedback). The results showed that subjects' stride length increased in all conditions following the adaptation, but the increase was greater and retained longer in the multisensory feedback condition. The multisensory feedback provided in this study may engage both explicit and implicit learning pathways during the adaptation and in turn enhance the aftereffect. The results implied that multisensory feedback may be used as an adjunctive approach to enhance gait recovery in humans with SCI.

  19. Inference and sample size calculation for clinical trials with incomplete observations of paired binary outcomes.

    PubMed

    Zhang, Song; Cao, Jing; Ahn, Chul

    2017-02-20

    We investigate the estimation of intervention effect and sample size determination for experiments where subjects are supposed to contribute paired binary outcomes with some incomplete observations. We propose a hybrid estimator to appropriately account for the mixed nature of observed data: paired outcomes from those who contribute complete pairs of observations and unpaired outcomes from those who contribute either pre-intervention or post-intervention outcomes. We theoretically prove that if incomplete data are evenly distributed between the pre-intervention and post-intervention periods, the proposed estimator will always be more efficient than the traditional estimator. A numerical research shows that when the distribution of incomplete data is unbalanced, the proposed estimator will be superior when there is moderate-to-strong positive within-subject correlation. We further derive a closed-form sample size formula to help researchers determine how many subjects need to be enrolled in such studies. Simulation results suggest that the calculated sample size maintains the empirical power and type I error under various design configurations. We demonstrate the proposed method using a real application example. Copyright © 2016 John Wiley & Sons, Ltd.

  20. MOLECULES IN {eta} CARINAE

    SciTech Connect

    Loinard, Laurent; Menten, Karl M.; Guesten, Rolf; Zapata, Luis A.; Rodriguez, Luis F.

    2012-04-10

    We report the detection toward {eta} Carinae of six new molecules, CO, CN, HCO{sup +}, HCN, HNC, and N{sub 2}H{sup +}, and of two of their less abundant isotopic counterparts, {sup 13}CO and H{sup 13}CN. The line profiles are moderately broad ({approx}100 km s{sup -1}), indicating that the emission originates in the dense, possibly clumpy, central arcsecond of the Homunculus Nebula. Contrary to previous claims, CO and HCO{sup +} do not appear to be underabundant in {eta} Carinae. On the other hand, molecules containing nitrogen or the {sup 13}C isotope of carbon are overabundant by about one order of magnitude. This demonstrates that, together with the dust responsible for the dimming of {eta} Carinae following the Great Eruption, the molecules detected here must have formed in situ out of CNO-processed stellar material.

  1. Endodontic and restorative management of incompletely fractured molar teeth.

    PubMed

    Gutmann, J L; Rakusin, H

    1994-11-01

    The treatment of fractured teeth poses significant problems for the practitioner. However, once the treatment planning decision has been made to attempt to retain the tooth, various practical regimens are available to effect this goal. This paper addresses the specific use of glass ionomer in the restorative management of incompletely, vertically fractured molar teeth integrated with specific root canal treatment techniques.

  2. Robustness of shape descriptors to incomplete contour representations.

    PubMed

    Ghosh, Anarta; Petkov, Nicolai

    2005-11-01

    With inspiration from psychophysical researches of the human visual system, we propose a novel aspect and a method for performance evaluation of contour-based shape recognition algorithms regarding their robustness to incompleteness of contours. We use complete contour representations of objects as a reference (training) set. Incomplete contour representations of the same objects are used as a test set. The performance of an algorithm is reported using the recognition rate as a function of the percentage of contour retained. We call this evaluation procedure the ICR test. We consider three types of contour incompleteness, viz. segment-wise contour deletion, occlusion, and random pixel depletion. As an illustration, the robustness of two shape recognition algorithms to contour incompleteness is evaluated. These algorithms use a shape context and a distance multiset as local shape descriptors. Qualitatively, both algorithms mimic human visual perception in the sense that recognition performance monotonously increases with the degree of completeness and that they perform best in the case of random depletion and worst in the case of occluded contours. The distance multiset method performs better than the shape context method in this test framework.

  3. 19 CFR 122.74 - Incomplete (pro forma) manifest.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 19 Customs Duties 1 2011-04-01 2011-04-01 false Incomplete (pro forma) manifest. 122.74 Section 122.74 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT...; Electronic Manifest Requirements for Passengers, Crew Members, and Non-Crew Members Onboard...

  4. Computer Simulation of Incomplete-Data Interpretation Exercise.

    ERIC Educational Resources Information Center

    Robertson, Douglas Frederick

    1987-01-01

    Described is a computer simulation that was used to help general education students enrolled in a large introductory geology course. The purpose of the simulation is to learn to interpret incomplete data. Students design a plan to collect bathymetric data for an area of the ocean. Procedures used by the students and instructor are included.…

  5. Gender under Incomplete Acquisition: Heritage Speakers' Knowledge of Noun Categorization

    ERIC Educational Resources Information Center

    Polinsky, Maria

    2008-01-01

    The author discusses a study of gender assignment (noun categorization) in heritage Russian and presents issues in the methodology of heritage language study. To anticipate the conclusions of this article, the gender assignment data presented argue for the systematicity of what emerges under incomplete acquisition. The system is different from its…

  6. Root cause of incomplete control rod insertions at Westinghouse reactors

    SciTech Connect

    Ray, S.

    1997-01-01

    Within the past year, incomplete RCCA insertions have been observed on high burnup fuel assemblies at two Westinghouse PWRs. Initial tests at the Wolf Creek site indicated that the direct cause of the incomplete insertions observed at Wolf Creek was excessive fuel assembly thimble tube distortion. Westinghouse committed to the NRC to perform a root cause analysis by the end of August, 1996. The root cause analysis process used by Westinghouse included testing at ten sites to obtain drag, growth and other characteristics of high burnup fuel assemblies. It also included testing at the Westinghouse hot cell of two of the Wolf Creek incomplete insertion assemblies. A mechanical model was developed to calculate the response of fuel assemblies when subjected to compressive loads. Detailed manufacturing reviews were conducted to determine if this was a manufacturing related issue. In addition, a review of available worldwide experience was performed. Based on the above, it was concluded that the thimble tube distortion observed on the Wolf Creek incomplete insertion assemblies was caused by unusual fuel assembly growth over and above what would typically be expected as a result of irradiation exposure. It was determined that the unusual growth component is a combination of growth due to oxide accumulation and accelerated growth, and would only be expected in high temperature plants on fuel assemblies that see long residence times and high power duties.

  7. Limit Pricing with Incomplete Information: Answers to Frequently Asked Questions

    ERIC Educational Resources Information Center

    Sorenson, Timothy L.

    2004-01-01

    Strategic pricing is an important and exciting topic in industrial organization and the economics of strategy. A wide range of texts use what has become a standard version of the Milgrom and Roberts (1982a) limit-pricing model to convey the essential ideas of strategic pricing under incomplete information. In addition to providing a formal, but…

  8. An Interactive Approach to Analyzing Incomplete Multivariate Data.

    ERIC Educational Resources Information Center

    Raymond, Mark R.

    This paper examines some of the problems that arise when conducting multivariate analyses with incomplete data. The literature on the effectiveness of several missing data procedures (MDP) is summarized. The most widely used MDPs are: (1) listwise deletion; (2) pairwise deletion; (3) variable mean; (4) correlational methods. No MDP should be used…

  9. 40 CFR 86.085-20 - Incomplete vehicles, classification.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Incomplete vehicles, classification... PROGRAMS (CONTINUED) CONTROL OF EMISSIONS FROM NEW AND IN-USE HIGHWAY VEHICLES AND ENGINES General Provisions for Emission Regulations for 1977 and Later Model Year New Light-Duty Vehicles, Light-Duty...

  10. Impact of the putative cancer stem cell markers and growth factor receptor expression on the sensitivity of ovarian cancer cells to treatment with various forms of small molecule tyrosine kinase inhibitors and cytotoxic drugs

    PubMed Central

    Puvanenthiran, Soozana; Essapen, Sharadah; Seddon, Alan M.; Modjtahedi, Helmout

    2016-01-01

    Increased expression and activation of human epidermal growth factor receptor (EGFR) and HER-2 have been reported in numerous cancers. The aim of this study was to determine the sensitivity of a large panel of human ovarian cancer cell lines (OCCLs) to treatment with various forms of small molecule tyrosine kinase inhibitors (TKIs) and cytotoxic drugs. The aim was to see if there was any association between the protein expression of various biomarkers including three putative ovarian cancer stem cell (CSC) markers (CD24, CD44, CD117/c-Kit), P-glycoprotein (P-gp), and HER family members and response to treatment with these agents. The sensitivity of 10 ovarian tumour cell lines to the treatment with various forms of HER TKIs (gefitinib, erlotinib, lapatinib, sapitinib, afatinib, canertinib, neratinib), as well as other TKIs (dasatinib, imatinib, NVP-AEW541, crizotinib) and cytotoxic agents (paclitaxel, cisplatin and doxorubicin), as single agents or in combination, was determined by SRB assay. The effect on these agents on the cell cycle distribution, and downstream signaling molecules and tumour migration were determined using flow cytometry, western blotting, and the IncuCyte Clear View cell migration assay respectively. Of the HER inhibitors, the irreversible pan-TKIs (canertinib, neratinib and afatinib) were the most effective TKIs for inhibiting the growth of all ovarian cancer cells, and for blocking the phosphorylation of EGFR, HER-2, AKT and MAPK in SKOV3 cells. Interestingly, while the majority of cancer cells were highly sensitive to treatment with dasatinib, they were relatively resistant to treatment with imatinib (i.e., IC50 >10 μM). Of the cytotoxic agents, paclitaxel was the most effective for inhibiting the growth of OCCLs, and of various combinations of these drugs, only treatment with a combination of NVP-AEW541 and paclitaxel produced a synergistic or additive anti-proliferative effect in all three cell lines examined (i.e., SKOV3, Caov3, ES2

  11. Disentangling DNA molecules.

    PubMed

    Vologodskii, Alexander

    2016-09-01

    The widespread circular form of DNA molecules inside cells creates very serious topological problems during replication. Due to the helical structure of the double helix the parental strands of circular DNA form a link of very high order, and yet they have to be unlinked before the cell division. DNA topoisomerases, the enzymes that catalyze passing of one DNA segment through another, solve this problem in principle. However, it is very difficult to remove all entanglements between the replicated DNA molecules due to huge length of DNA comparing to the cell size. One strategy that nature uses to overcome this problem is to create the topoisomerases that can dramatically reduce the fraction of linked circular DNA molecules relative to the corresponding fraction at thermodynamic equilibrium. This striking property of the enzymes means that the enzymes that interact with DNA only locally can access their topology, a global property of circular DNA molecules. This review considers the experimental studies of the phenomenon and analyzes the theoretical models that have been suggested in attempts to explain it. We describe here how various models of enzyme action can be investigated computationally. There is no doubt at the moment that we understand basic principles governing enzyme action. Still, there are essential quantitative discrepancies between the experimental data and the theoretical predictions. We consider how these discrepancies can be overcome.

  12. Disentangling DNA molecules

    NASA Astrophysics Data System (ADS)

    Vologodskii, Alexander

    2016-09-01

    The widespread circular form of DNA molecules inside cells creates very serious topological problems during replication. Due to the helical structure of the double helix the parental strands of circular DNA form a link of very high order, and yet they have to be unlinked before the cell division. DNA topoisomerases, the enzymes that catalyze passing of one DNA segment through another, solve this problem in principle. However, it is very difficult to remove all entanglements between the replicated DNA molecules due to huge length of DNA comparing to the cell size. One strategy that nature uses to overcome this problem is to create the topoisomerases that can dramatically reduce the fraction of linked circular DNA molecules relative to the corresponding fraction at thermodynamic equilibrium. This striking property of the enzymes means that the enzymes that interact with DNA only locally can access their topology, a global property of circular DNA molecules. This review considers the experimental studies of the phenomenon and analyzes the theoretical models that have been suggested in attempts to explain it. We describe here how various models of enzyme action can be investigated computationally. There is no doubt at the moment that we understand basic principles governing enzyme action. Still, there are essential quantitative discrepancies between the experimental data and the theoretical predictions. We consider how these discrepancies can be overcome.

  13. Electrorheological crystallization of proteins and other molecules

    DOEpatents

    Craig, George D.; Rupp, Bernhard

    1996-01-01

    An electrorheological crystalline mass of a molecule is formed by dispersing the molecule in a dispersion fluid and subjecting the molecule dispersion to a uniform electrical field for a period of time during which time an electrorheological crystalline mass is formed. Molecules that may be used to form an electrorheological crystalline mass include any organic or inorganic molecule which has a permanent dipole and/or which is capable of becoming an induced dipole in the presence of an electric field. The molecules used to form the electrorheological crystalline mass are preferably macromolecules, such as biomolecules, such as proteins, nucleic acids, carbohydrates, lipoproteins and viruses. Molecules are crystallized by a method in which an electric field is maintained for a period of time after the electrorheological crystalline mass has formed during which time at least some of the molecules making up the electrorheological crystalline mass form a crystal lattice. The three dimensional structure of a molecule is determined by a method in which an electrorheological crystalline mass of the molecule is formed, an x-ray diffraction pattern of the electrorheological crystalline mass is obtained and the three dimensional structure of the molecule is calculated from the x-ray diffraction pattern.

  14. Electrorheological crystallization of proteins and other molecules

    DOEpatents

    Craig, G.D.; Rupp, B.

    1996-06-11

    An electrorheological crystalline mass of a molecule is formed by dispersing the molecule in a dispersion fluid and subjecting the molecule dispersion to a uniform electrical field for a period of time during which time an electrorheological crystalline mass is formed. Molecules that may be used to form an electrorheological crystalline mass include any organic or inorganic molecule which has a permanent dipole and/or which is capable of becoming an induced dipole in the presence of an electric field. The molecules used to form the electrorheological crystalline mass are preferably macromolecules, such as biomolecules, such as proteins, nucleic acids, carbohydrates, lipoproteins and viruses. Molecules are crystallized by a method in which an electric field is maintained for a period of time after the electrorheological crystalline mass has formed during which time at least some of the molecules making up the electrorheological crystalline mass form a crystal lattice. The three dimensional structure of a molecule is determined by a method in which an electrorheological crystalline mass of the molecule is formed, an X-ray diffraction pattern of the electrorheological crystalline mass is obtained and the three dimensional structure of the molecule is calculated from the X-ray diffraction pattern. 4 figs.

  15. Characterization of a surface membrane molecule expressed by natural killer cells in most inbred mouse strains: monoclonal antibody C9.1 identifies an allelic form of the 2B4 antigen

    PubMed Central

    Kubota, K; Katoh, H; Muguruma, K; Koyama, K

    1999-01-01

    A newly generated monoclonal antibody (mAb C9.1) described in this study identifies a surface membrane molecule that is involved in the lytic programme of activated natural killer (NK) cells. This conclusion is based on the facts that, first, this antigen was expressed on the vast majority of surface immunoglobulin (sIg)− CD3− CD4− CD8− spleen lymphocytes, albeit it was also present on minor subsets of sIg+ B (≈7%) and CD3+ T (≈2%) lymphocytes; second, that all splenic NK activity was contained within the C9.1+ cell population, and was almost totally abolished by treatment of spleen cells with mAb C9.1 and complement; third, that mAb C9.1 was capable of increasing interleukin-2-cultured and in vivo polyinosinic:polycytidylic acid-activated, NK cell-mediated, antibody-redirected lysis, but not freshly isolated NK cell-mediated killing. Furthermore, the strain distribution of the C9.1 antigen was shown to be antithetical to that of the 2B4 antigen already described as a molecule associated with major histocompatibility complex-unrestricted killing mediated by activated NK cells. The gene encoding C9.1 antigen was linked to the Akp1 isozyme locus on chromosome 1 close to the 2B4 gene. Although C9.1 and 2B4 were monomeric glycoproteins of 78 000 MW and 66 000 MW, respectively, removal of N-linked sugars from both antigens by endoglycosidase F yielded identical protein backbones of 38 000 MW. Thus, all of these results suggest that mAb C9.1 recognizes an allelic form of the 2B4 antigen. However, the detection of mAb C9.1-reactive antigen on a minor subset of B cells may suggest a possible reactivity of mAb C9.1 with some product of other members of the 2B4 family genes. PMID:10233732

  16. Reticulate evolution and incomplete lineage sorting among the ponderosa pines.

    PubMed

    Willyard, Ann; Cronn, Richard; Liston, Aaron

    2009-08-01

    Interspecific gene flow via hybridization may play a major role in evolution by creating reticulate rather than hierarchical lineages in plant species. Occasional diploid pine hybrids indicate the potential for introgression, but reticulation is hard to detect because ancestral polymorphism is still shared across many groups of pine species. Nucleotide sequences for 53 accessions from 17 species in subsection Ponderosae (Pinus) provide evidence for reticulate evolution. Two discordant patterns among independent low-copy nuclear gene trees and a chloroplast haplotype are better explained by introgression than incomplete lineage sorting or other causes of incongruence. Conflicting resolution of three monophyletic Pinus coulteri accessions is best explained by ancient introgression followed by a genetic bottleneck. More recent hybridization transferred a chloroplast from P. jeffreyi to a sympatric P. washoensis individual. We conclude that incomplete lineage sorting could account for other examples of non-monophyly, and caution against any analysis based on single-accession or single-locus sampling in Pinus.

  17. Incomplete Stevens-Johnson syndrome secondary to atypical pneumonia.

    PubMed

    Ramasamy, Anantharaman; Patel, Chiraush; Conlon, Christopher

    2011-10-04

    Steven-Johnson syndrome is a common condition characterised by erythematous target lesions on the skin and involvement of the oral mucosa, genitals and conjunctivae. It has been documented as one of the extra-pulmonary manifestations of Mycoplasma pneumoniae infection. Recently, there has been several documentation of an incomplete presentation of this syndrome - without the typical rash but with mucosal, conjunctival and genital involvement. Our case illustrates that the incomplete Steven-Johnson syndrome may present with oral mucosal and conjunctival involvement alone without skin or genital involvement. This important clinical diagnosis should not be missed due to its atypical presentation. Treatment of Steven-Johnson syndrome remains supportive along with treating the underlying infection if recognised.

  18. Investigations on the Incompletely Developed Plane Diagonal-Tension Field

    NASA Technical Reports Server (NTRS)

    Kuhn, Paul

    1940-01-01

    This report presents the results of an investigation on the incompletely developed diagonal-tension field. Actual diagonal-tension beams work in an intermediate stage between pure shear and pure diagonal tension; the theory developed by wagner for diagonal tension is not directly applicable. The first part of the paper reviews the most essential items of the theory of pure diagonal tension as well as previous attempts to formulate a theory of incomplete diagonal tension. The second part of the paper describes strain measurement made by the N. A. C. A. to obtain the necessary coefficients for the proposed theory. The third part of the paper discusses the stress analysis of diagonal-tension beams by means of the proposed theory.

  19. Survey incompleteness and the evolution of the QSO luminosity function

    NASA Technical Reports Server (NTRS)

    Majewski, Steven R.; Munn, Jeffrey A.; Kron, Richard G.; Bershady, Matthew A.; Smetanka, John J.; Koo, David C.

    1993-01-01

    We concentrate on a type of QSO survey which depends on selecting QSO candidates based on combinations of colors. Since QSO's have emission lines and power-law continua, they are expected to yield broadband colors unlike those of stellar photospheres. Previously, the fraction of QSO's expected to be hiding (unselected) within the locus of stellar (U-J, J-F) colors was estimated at about 15 percent. We have now verified that the KK88 survey is at least 11 percent incomplete, but have determined that it may be as much as 34 percent incomplete. The 'missing' QSO's are expected to be predominantly at z less than or = 2.2. We have studied the proper motion and variability properties of all stellar objects with J less than or = 22.5 or F less than or = 21.5 in the SA 57 field which has previously been surveyed with a multicolor QSO search by KK88.

  20. Α Markov model for longitudinal studies with incomplete dichotomous outcomes.

    PubMed

    Efthimiou, Orestis; Welton, Nicky; Samara, Myrto; Leucht, Stefan; Salanti, Georgia

    2017-03-01

    Missing outcome data constitute a serious threat to the validity and precision of inferences from randomized controlled trials. In this paper, we propose the use of a multistate Markov model for the analysis of incomplete individual patient data for a dichotomous outcome reported over a period of time. The model accounts for patients dropping out of the study and also for patients relapsing. The time of each observation is accounted for, and the model allows the estimation of time-dependent relative treatment effects. We apply our methods to data from a study comparing the effectiveness of 2 pharmacological treatments for schizophrenia. The model jointly estimates the relative efficacy and the dropout rate and also allows for a wide range of clinically interesting inferences to be made. Assumptions about the missingness mechanism and the unobserved outcomes of patients dropping out can be incorporated into the analysis. The presented method constitutes a viable candidate for analyzing longitudinal, incomplete binary data.

  1. Α Markov model for longitudinal studies with incomplete dichotomous outcomes

    PubMed Central

    Welton, Nicky; Samara, Myrto; Leucht, Stefan; Salanti, Georgia

    2016-01-01

    Missing outcome data constitute a serious threat to the validity and precision of inferences from randomized controlled trials. In this paper, we propose the use of a multistate Markov model for the analysis of incomplete individual patient data for a dichotomous outcome reported over a period of time. The model accounts for patients dropping out of the study and also for patients relapsing. The time of each observation is accounted for, and the model allows the estimation of time‐dependent relative treatment effects. We apply our methods to data from a study comparing the effectiveness of 2 pharmacological treatments for schizophrenia. The model jointly estimates the relative efficacy and the dropout rate and also allows for a wide range of clinically interesting inferences to be made. Assumptions about the missingness mechanism and the unobserved outcomes of patients dropping out can be incorporated into the analysis. The presented method constitutes a viable candidate for analyzing longitudinal, incomplete binary data. PMID:27917593

  2. Noise effects on conflicting interest quantum games with incomplete information

    NASA Astrophysics Data System (ADS)

    Situ, Haozhen; Huang, Zhiming; Zhang, Cai

    2016-09-01

    Noise effects can be harmful to quantum information systems. In the present paper, we study noise effects in the context of quantum games with incomplete information, which have more complicated structure than quantum games with complete information. The effects of several paradigmatic noises on three newly proposed conflicting interest quantum games with incomplete information are studied using numerical optimization method. Intuitively noises will bring down the payoffs. However, we find that in some situations the outcome of the games under the influence of noise effects are counter-intuitive. Sometimes stronger noise may lead to higher payoffs. Some properties of the game, like quantum advantage, fairness and equilibrium, are invulnerable to some kinds of noises.

  3. Bayesian Inference of Natural Rankings in Incomplete Competition Networks

    NASA Astrophysics Data System (ADS)

    Park, Juyong; Yook, Soon-Hyung

    2014-08-01

    Competition between a complex system's constituents and a corresponding reward mechanism based on it have profound influence on the functioning, stability, and evolution of the system. But determining the dominance hierarchy or ranking among the constituent parts from the strongest to the weakest - essential in determining reward and penalty - is frequently an ambiguous task due to the incomplete (partially filled) nature of competition networks. Here we introduce the ``Natural Ranking,'' an unambiguous ranking method applicable to a round robin tournament, and formulate an analytical model based on the Bayesian formula for inferring the expected mean and error of the natural ranking of nodes from an incomplete network. We investigate its potential and uses in resolving important issues of ranking by applying it to real-world competition networks.

  4. Einstein's Boxes: Incompleteness of Quantum Mechanics Without a Separation Principle

    NASA Astrophysics Data System (ADS)

    Held, Carsten

    2015-09-01

    Einstein made several attempts to argue for the incompleteness of quantum mechanics (QM), not all of them using a separation principle. One unpublished example, the box parable, has received increased attention in the recent literature. Though the example is tailor-made for applying a separation principle and Einstein indeed applies one, he begins his discussion without it. An analysis of this first part of the parable naturally leads to an argument for incompleteness not involving a separation principle. I discuss the argument and its systematic import. Though it should be kept in mind that the argument is not the one Einstein intends, I show how it suggests itself and leads to a conflict between QM's completeness and a physical principle more fundamental than the separation principle, i.e. a principle saying that QM should deliver probabilities for physical systems possessing properties at definite times.

  5. Contributions to the theory of incomplete tension bay

    NASA Technical Reports Server (NTRS)

    Schapitz, E

    1937-01-01

    The present report offers an approximate theory for the stress and deformation condition after buckling of the skin in reinforced panels and shells loaded in simple shear and compression and under combined stresses. The theory presents a unified scheme for stresses of these types. It is based upon the concept of a nonuniform stress distribution in the metal panel and its marked power of resistance against compressive stresses ("incomplete" tension bay).

  6. Distributed control systems with incomplete and uncertain information

    NASA Astrophysics Data System (ADS)

    Tang, Jingpeng

    Scientific and engineering advances in wireless communication, sensors, propulsion, and other areas are rapidly making it possible to develop unmanned air vehicles (UAVs) with sophisticated capabilities. UAVs have come to the forefront as tools for airborne reconnaissance to search for, detect, and destroy enemy targets in relatively complex environments. They potentially reduce risk to human life, are cost effective, and are superior to manned aircraft for certain types of missions. It is desirable for UAVs to have a high level of intelligent autonomy to carry out mission tasks with little external supervision and control. This raises important issues involving tradeoffs between centralized control and the associated potential to optimize mission plans, and decentralized control with great robustness and the potential to adapt to changing conditions. UAV capabilities have been extended several ways through armament (e.g., Hellfire missiles on Predator UAVs), increased endurance and altitude (e.g., Global Hawk), and greater autonomy. Some known barriers to full-scale implementation of UAVs are increased communication and control requirements as well as increased platform and system complexity. One of the key problems is how UAV systems can handle incomplete and uncertain information in dynamic environments. Especially when the system is composed of heterogeneous and distributed UAVs, the overall system complexity is increased under such conditions. Presented through the use of published papers, this dissertation lays the groundwork for the study of methodologies for handling incomplete and uncertain information for distributed control systems. An agent-based simulation framework is built to investigate mathematical approaches (optimization) and emergent intelligence approaches. The first paper provides a mathematical approach for systems of UAVs to handle incomplete and uncertain information. The second paper describes an emergent intelligence approach for UAVs

  7. Radiopaque Tagging Masks Caries Lesions following Incomplete Excavation in vitro.

    PubMed

    Schwendicke, F; Meyer-Lueckel, H; Schulz, M; Dörfer, C E; Paris, S

    2014-06-01

    One-step incomplete excavation seals caries-affected dentin under a restoration and appears to be advantageous in the treatment of deep lesions. However, it is impossible to discriminate radiographically between intentionally left, arrested lesions and overlooked or active lesions. This diagnostic uncertainty decreases the acceptance of minimally invasive excavation and might lead to unnecessary re-treatment of incompletely excavated teeth. Radiopaque tagging of sealed lesions might mask arrested lesions and assist in discrimination from progressing lesions. Therefore, we microradiographically screened 4 substances (SnCl2, AgNO3, CsF, CsCH3COO) for their effect on artificial lesions. Since water-dissolved tin chloride (SnCl2×Aq) was found to stably mask artificial lesions, we then investigated its radiographic effects on progressing lesions. Natural lesions were incompletely excavated and radiopaque tagging performed. Grey-value differences (△GV) between sound and carious dentin were determined and radiographs assessed by 20 dentists. While radiographic effects of SnCl2×Aq were stable for non-progressing lesions, they significantly decreased during a second demineralization (p < .001, t test). For natural lesions, tagging with SnCl2×Aq significantly reduced △GV (p < .001, Wilcoxon). Tagged lesions were detected significantly less often than untagged lesions (p < .001). SnCl2×Aq was suitable to mask caries-affected dentin and discriminate between arrested and progressing lesions in vitro. Radiopaque tagging could resolve diagnostic uncertainties associated with incomplete excavation.

  8. Simulated data supporting inbreeding rate estimates from incomplete pedigrees

    USGS Publications Warehouse

    Miller, Mark P.

    2017-01-01

    This data release includes:(1) The data from simulations used to illustrate the behavior of inbreeding rate estimators. Estimating inbreeding rates is particularly difficult for natural populations because parentage information for many individuals may be incomplete. Our analyses illustrate the behavior of a newly-described inbreeding rate estimator that outperforms previously described approaches in the scientific literature.(2) Python source code ("analytical expressions", "computer simulations", and "empricial data set") that can be used to analyze these data.

  9. 3D ultrasound image segmentation using multiple incomplete feature sets

    NASA Astrophysics Data System (ADS)

    Fan, Liexiang; Herrington, David M.; Santago, Peter, II

    1999-05-01

    We use three features, the intensity, texture and motion to obtain robust results for segmentation of intracoronary ultrasound images. Using a parameterized equation to describe the lumen-plaque and media-adventitia boundaries, we formulate the segmentation as a parameter estimation through a cost functional based on the posterior probability, which can handle the incompleteness of the features in ultrasound images by employing outlier detection.

  10. Determination of the upper and lower limits of the mechanistic stoichiometry of incompletely coupled fluxes. Stoichiometry of incompletely coupled reactions.

    PubMed

    Beavis, A D; Lehninger, A L

    1986-07-15

    A rationale is formulated for the design of experiments to determine the upper and lower limits of the mechanistic stoichiometry of any two incompletely coupled fluxes J1 and J2. Incomplete coupling results when there is a branch at some point in the sequence of reactions or processes coupling the two fluxes. The upper limit of the mechanistic stoichiometry is given by the minimum value of dJ2/dJ1 obtained when the fluxes are systematically varied by changes in steps after the branch point. The lower limit is given by the maximum value of dJ2/dJ1 obtained when the fluxes are varied by changes in steps prior to the branch point. The rationale for determining these limits is developed from both a simple kinetic model and from a linear nonequilibrium thermodynamic treatment of coupled fluxes, using the mechanistic approach [Westerhoff, H. V. & van Dam, K. (1979) Curr. Top. Bioenerg. 9, 1-62]. The phenomenological stoichiometry, the flux ratio at level flow and the affinity ratio at static head of incompletely coupled fluxes are defined in terms of mechanistic conductances and their relationship to the mechanistic stoichiometry is discussed. From the rationale developed, experimental approaches to determine the mechanistic stoichiometry of mitochondrial oxidative phosphorylation are outlined. The principles employed do not require knowledge of the pathway or the rate of transmembrane leaks or slippage and may also be applied to analysis of the stoichiometry of other incompletely coupled systems, including vectorial H+/O and K+/O translocation coupled to mitochondrial electron transport.

  11. High school incompletion and childhood maltreatment among street-involved young people in Vancouver, Canada.

    PubMed

    Barker, Brittany; Kerr, Thomas; Dong, Huiru; Wood, Evan; DeBeck, Kora

    2017-03-01

    While the link between educational attainment and future health and wellness is well understood, little investigation has considered the potential impacts of distinct forms of childhood maltreatment on high school completion. In the present study, the relationship between five categories of childhood maltreatment (physical, emotional, and sexual abuse, and physical and emotional neglect) and completion of high school education were examined using the Childhood Trauma Questionnaire (CTQ). From September 2005 to May 2013, data were collected for the At-Risk Youth Study (ARYS), a cohort of street-involved young people who use illicit drugs in Vancouver, Canada. We used logistic regression to examine the relationship between childhood maltreatment and high school completion, while controlling for a range of potential confounding variables. Specifically, five separate models for each category of maltreatment and two combined models were employed to examine the relative associations between, and cumulative impact of, different forms of childhood maltreatment and educational attainment. Among 974 young people, 737 (76%) reported not completing high school. In separate multivariable analyses physical abuse, emotional abuse, physical neglect, and emotional neglect remained positively and independently associated with an incomplete high school education. In a combined multivariable model with all forms of childhood maltreatment considered together, emotional abuse (adjusted odds ratio = 2.08; 95% confidence interval: 1.51-2.86) was the only form of maltreatment that remained significantly associated with an incomplete high school education. The cumulative impact assessment indicated a moderate dose-dependent trend where the greater the number of different forms of childhood maltreatment the greater the risk of not completing a high school education. These findings point to the need for trauma-informed interventions to improve educational attainment among vulnerable young

  12. Bibliographic review and new measurements of the integrated cross sections of 8 molecules (H2O, CO, CO2, CH3OH, NH3, CH4, HCOOH and H2CO) in the solid form at 25K

    NASA Astrophysics Data System (ADS)

    Michaelle, B.; Nicolas, F.; Yves, B.; Hervé, C.; Antoine, J.; Claire, G. Marie

    2014-04-01

    Infrared spectra from ISO and Spitzer telescopes revealed the presence of several molecules in the solid phase such as H2O, CO, CO2, CH3OH, NH3, CH4, HCOOH and H2CO in the environment of some Young Stellar Objects (YSOs) ([1], [2], [3], [4]. To quantify the column density of those molecules, the knowledge of some spectroscopic parameters, especially the integrated cross section A (cm.molecule-1) is required. For some molecules, inconsistencies on the values of spectroscopic parameters can be found in the literature. The purpose of this study is to compare all the values found in the literature with the ones that we have measured recently in order to propose more convincing values.

  13. Analytical Solution for Reactive Solute Transport Considering Incomplete Mixing

    NASA Astrophysics Data System (ADS)

    Bellin, A.; Chiogna, G.

    2013-12-01

    The laboratory experiments of Gramling et al. (2002) showed that incomplete mixing at the pore scale exerts a significant impact on transport of reactive solutes and that assuming complete mixing leads to overestimation of product concentration in bimolecular reactions. We consider here the family of equilibrium reactions for which the concentration of the reactants and the product can be expressed as a function of the mixing ratio, the concentration of a fictitious non reactive solute. For this type of reactions we propose, in agreement with previous studies, to model the effect of incomplete mixing at scales smaller than the Darcy scale assuming that the mixing ratio is distributed within an REV according to a Beta distribution. We compute the parameters of the Beta model by imposing that the mean concentration is equal to the value that the concentration assumes at the continuum Darcy scale, while the variance decays with time as a power law. We show that our model reproduces the concentration profiles of the reaction product measured in the Gramling et al. (2002) experiments using the transport parameters obtained from conservative experiments and an instantaneous reaction kinetic. The results are obtained applying analytical solutions both for conservative and for reactive solute transport, thereby providing a method to handle the effect of incomplete mixing on multispecies reactive solute transport, which is simpler than other previously developed methods. Gramling, C. M., C. F. Harvey, and L. C. Meigs (2002), Reactive transport in porous media: A comparison of model prediction with laboratory visualization, Environ. Sci. Technol., 36(11), 2508-2514.

  14. A Supernodal Approach to Incomplete LU Factorization with Partial Pivoting

    SciTech Connect

    Li, Xiaoye Sherry; Shao, Meiyue

    2009-06-25

    We present a new supernode-based incomplete LU factorization method to construct a preconditioner for solving sparse linear systems with iterative methods. The new algorithm is primarily based on the ILUTP approach by Saad, and we incorporate a number of techniques to improve the robustness and performance of the traditional ILUTP method. These include the new dropping strategies that accommodate the use of supernodal structures in the factored matrix. We present numerical experiments to demonstrate that our new method is competitive with the other ILU approaches and is well suited for today's high performance architectures.

  15. Bayesian model updating using incomplete modal data without mode matching

    NASA Astrophysics Data System (ADS)

    Sun, Hao; Büyüköztürk, Oral

    2016-04-01

    This study investigates a new probabilistic strategy for model updating using incomplete modal data. A hierarchical Bayesian inference is employed to model the updating problem. A Markov chain Monte Carlo technique with adaptive random-work steps is used to draw parameter samples for uncertainty quantification. Mode matching between measured and predicted modal quantities is not required through model reduction. We employ an iterated improved reduced system technique for model reduction. The reduced model retains the dynamic features as close as possible to those of the model before reduction. The proposed algorithm is finally validated by an experimental example.

  16. Conditioning Analysis of Incomplete Cholesky Factorizations with Orthogonal Dropping

    SciTech Connect

    Napov, Artem

    2013-08-01

    The analysis of preconditioners based on incomplete Cholesky factorization in which the neglected (dropped) components are orthogonal to the approximations being kept is presented. General estimate for the condition number of the preconditioned system is given which only depends on the accuracy of individual approximations. The estimate is further improved if, for instance, only the newly computed rows of the factor are modified during each approximation step. In this latter case it is further shown to be sharp. The analysis is illustrated with some existing factorizations in the context of discretized elliptic partial differential equations.

  17. Incomplete block factorization preconditioning for indefinite elliptic problems

    SciTech Connect

    Guo, Chun-Hua

    1996-12-31

    The application of the finite difference method to approximate the solution of an indefinite elliptic problem produces a linear system whose coefficient matrix is block tridiagonal and symmetric indefinite. Such a linear system can be solved efficiently by a conjugate residual method, particularly when combined with a good preconditioner. We show that specific incomplete block factorization exists for the indefinite matrix if the mesh size is reasonably small. And this factorization can serve as an efficient preconditioner. Some efforts are made to estimate the eigenvalues of the preconditioned matrix. Numerical results are also given.

  18. Incompletely-Condensed Fluorinated Silsesquioxane: Synthesis and Crystal Structure

    DTIC Science & Technology

    2011-11-29

    other provision of law, no person shall be subject to any penalty for failing to comply with a collection of information if it does not display a ...ABSTRACT A recently developed sub-class of POSS, fluorinated polyhedral oligomeric silsesquioxane (F-POSS), consists of a Si-O core with a periphery of...incompletely-condensed silsesquioxane, (CF3(CF2)7CH2CH2)8Si8O11(OH)2, has been synthesized via a multi-step synthesis (52% yield). The structure was

  19. A computer program for estimation from incomplete multinomial data

    NASA Technical Reports Server (NTRS)

    Credeur, K. R.

    1978-01-01

    Coding is given for maximum likelihood and Bayesian estimation of the vector p of multinomial cell probabilities from incomplete data. Also included is coding to calculate and approximate elements of the posterior mean and covariance matrices. The program is written in FORTRAN 4 language for the Control Data CYBER 170 series digital computer system with network operating system (NOS) 1.1. The program requires approximately 44000 octal locations of core storage. A typical case requires from 72 seconds to 92 seconds on CYBER 175 depending on the value of the prior parameter.

  20. Incomplete block SSOR preconditionings for high order discretizations

    SciTech Connect

    Kolotilina, L.

    1994-12-31

    This paper considers the solution of linear algebraic systems Ax = b resulting from the p-version of the Finite Element Method (FEM) using PCG iterations. Contrary to the h-version, the p-version ensures the desired accuracy of a discretization not by refining an original finite element mesh but by introducing higher degree polynomials as additional basis functions which permits to reduce the size of the resulting linear system as compared with the h-version. The suggested preconditionings are the so-called Incomplete Block SSOR (IBSSOR) preconditionings.

  1. Chronic incomplete atrioventricular block induced by radiofrequency catheter ablation

    SciTech Connect

    Huang, S.K.; Bharati, S.; Graham, A.R.; Gorman, G.; Lev, M. )

    1989-10-01

    To determine if catheter ablation of the atrioventricular (AV) junction with radiofrequency energy can induce chronic incomplete (first- and second-degree) AV block to avoid the need for a permanent pacemaker, 20 closed-chest dogs were studied. Group 1 (10 dogs) received radiofrequency energy (750 kHz) with a fixed power setting (5 or 10 W) while increasing the pulse duration from 10 to 50 seconds for each application. Group 2 (10 dogs) received energy with a fixed pulse duration (20 or 30 seconds) while increasing the power setting from 5 to 10 W or from 10 to 20 W during each energy delivery. Radiofrequency energy was delivered between a chest-patch electrode and the distal electrode of a regular 7F tripolar His bundle catheter. For each application, the energy delivery was interrupted when (1) the PR interval prolonged (greater than 50%) or (2) second-degree or complete AV block occurred and persisted up to 5 seconds. The ablation procedure ended when there was (1) persistent PR prolongation (greater than 50%) or persistent second-degree AV block (lasting greater than 30 minutes) after ablation, (2) occurrence of two consecutive transient (less than 1 minute) complete AV blocks after each energy delivery, or (3) complete AV block (lasting greater than 2 minutes) after ablation. Of seven dogs in group 1 and five dogs in group 2 in which incomplete AV block was achieved 1 hour after the procedure, six in group 1 and five in group 2 remained in incomplete AV block 2-3 months after ablation. One dog in group 1 progressed into complete AV block. Of the remaining three dogs in group 1 and five dogs in group 2 in which complete AV block was initially achieved 1 hour after ablation, two in group 1 and four in group 2 continued to have complete AV block, whereas one in each group had AV conduction returned to incomplete at 1-2 months of follow-up.

  2. Uniform Asymptotic Expansion for the Incomplete Beta Function

    NASA Astrophysics Data System (ADS)

    Nemes, Gergő; Olde Daalhuis, Adri B.

    2016-10-01

    In [Temme N.M., Special functions. An introduction to the classical functions of mathematical physics, A Wiley-Interscience Publication, John Wiley & Sons, Inc., New York, 1996, Section 11.3.3.1] a uniform asymptotic expansion for the incomplete beta function was derived. It was not obvious from those results that the expansion is actually an asymptotic expansion. We derive a remainder estimate that clearly shows that the result indeed has an asymptotic property, and we also give a recurrence relation for the coefficients.

  3. Incomplete optical shielding in cold sodium atom traps

    SciTech Connect

    Yurovsky, Vladimir; Ben-Reuven, Abraham

    1997-01-05

    A simple two-channel model, based on the semiclassical Landau-Zener (LZ) approximation, with averaging over angle-dependent exponents, is proposed as a fast means for accounting for the incomplete optical shielding of collisions, as observed in recent experiments conducted by Weiner and co-workers on ultracold sodium-atom traps, and its dependence on the laser polarization. The model yields a reasonably good agreement with the recent quantum close-coupling calculations of Julienne and co-workers. The remaining discrepancy between both theories and the data is qualitatively attributed to a partial overlap of the collision ranges at which loss processes and optical shielding occur.

  4. Dynamic Financial Constraints: Distinguishing Mechanism Design from Exogenously Incomplete Regimes*

    PubMed Central

    Karaivanov, Alexander; Townsend, Robert M.

    2014-01-01

    We formulate and solve a range of dynamic models of constrained credit/insurance that allow for moral hazard and limited commitment. We compare them to full insurance and exogenously incomplete financial regimes (autarky, saving only, borrowing and lending in a single asset). We develop computational methods based on mechanism design, linear programming, and maximum likelihood to estimate, compare, and statistically test these alternative dynamic models with financial/information constraints. Our methods can use both cross-sectional and panel data and allow for measurement error and unobserved heterogeneity. We estimate the models using data on Thai households running small businesses from two separate samples. We find that in the rural sample, the exogenously incomplete saving only and borrowing regimes provide the best fit using data on consumption, business assets, investment, and income. Family and other networks help consumption smoothing there, as in a moral hazard constrained regime. In contrast, in urban areas, we find mechanism design financial/information regimes that are decidedly less constrained, with the moral hazard model fitting best combined business and consumption data. We perform numerous robustness checks in both the Thai data and in Monte Carlo simulations and compare our maximum likelihood criterion with results from other metrics and data not used in the estimation. A prototypical counterfactual policy evaluation exercise using the estimation results is also featured. PMID:25246710

  5. An information propagation model considering incomplete reading behavior in microblog

    NASA Astrophysics Data System (ADS)

    Su, Qiang; Huang, Jiajia; Zhao, Xiande

    2015-02-01

    Microblog is one of the most popular communication channels on the Internet, and has already become the third largest source of news and public opinions in China. Although researchers have studied the information propagation in microblog using the epidemic models, previous studies have not considered the incomplete reading behavior among microblog users. Therefore, the model cannot fit the real situations well. In this paper, we proposed an improved model entitled Microblog-Susceptible-Infected-Removed (Mb-SIR) for information propagation by explicitly considering the user's incomplete reading behavior. We also tested the effectiveness of the model using real data from Sina Microblog. We demonstrate that the new proposed model is more accurate in describing the information propagation in microblog. In addition, we also investigate the effects of the critical model parameters, e.g., reading rate, spreading rate, and removed rate through numerical simulations. The simulation results show that, compared with other parameters, reading rate plays the most influential role in the information propagation performance in microblog.

  6. Observable Priors: Limiting Biases in Estimated Parameters for Incomplete Orbits

    NASA Astrophysics Data System (ADS)

    Kosmo, Kelly; Martinez, Gregory; Hees, Aurelien; Witzel, Gunther; Ghez, Andrea M.; Do, Tuan; Sitarski, Breann; Chu, Devin; Dehghanfar, Arezu

    2017-01-01

    Over twenty years of monitoring stellar orbits at the Galactic center has provided an unprecedented opportunity to study the physics and astrophysics of the supermassive black hole (SMBH) at the center of the Milky Way Galaxy. In order to constrain the mass of and distance to the black hole, and to evaluate its gravitational influence on orbiting bodies, we use Bayesian statistics to infer black hole and stellar orbital parameters from astrometric and radial velocity measurements of stars orbiting the central SMBH. Unfortunately, most of the short period stars in the Galactic center have periods much longer than our twenty year time baseline of observations, resulting in incomplete orbital phase coverage--potentially biasing fitted parameters. Using the Bayesian statistical framework, we evaluate biases in the black hole and orbital parameters of stars with varying phase coverage, using various prior models to fit the data. We present evidence that incomplete phase coverage of an orbit causes prior assumptions to bias statistical quantities, and propose a solution to reduce these biases for orbits with low phase coverage. The explored solution assumes uniformity in the observables rather than in the inferred model parameters, as is the current standard method of orbit fitting. Of the cases tested, priors that assume uniform astrometric and radial velocity observables reduce the biases in the estimated parameters. The proposed method will not only improve orbital estimates of stars orbiting the central SMBH, but can also be extended to other orbiting bodies with low phase coverage such as visual binaries and exoplanets.

  7. Topological effects of data incompleteness of gene regulatory networks

    PubMed Central

    2012-01-01

    Background The topological analysis of biological networks has been a prolific topic in network science during the last decade. A persistent problem with this approach is the inherent uncertainty and noisy nature of the data. One of the cases in which this situation is more marked is that of transcriptional regulatory networks (TRNs) in bacteria. The datasets are incomplete because regulatory pathways associated to a relevant fraction of bacterial genes remain unknown. Furthermore, direction, strengths and signs of the links are sometimes unknown or simply overlooked. Finally, the experimental approaches to infer the regulations are highly heterogeneous, in a way that induces the appearance of systematic experimental-topological correlations. And yet, the quality of the available data increases constantly. Results In this work we capitalize on these advances to point out the influence of data (in)completeness and quality on some classical results on topological analysis of TRNs, specially regarding modularity at different levels. Conclusions In doing so, we identify the most relevant factors affecting the validity of previous findings, highlighting important caveats to future prokaryotic TRNs topological analysis. PMID:22920968

  8. Incomplete oxidation of ethylenediaminetetraacetic acid in chemical oxygen demand analysis.

    PubMed

    Anderson, James E; Mueller, Sherry A; Kim, Byung R

    2007-09-01

    Ethylenediaminetetraacetic acid (EDTA) was found to incompletely oxidize in chemical oxygen demand (COD) analysis, leading to incorrect COD values for water samples containing relatively large amounts of EDTA. The degree of oxidation depended on the oxidant used, its concentration, and the length of digestion. The COD concentrations measured using COD vials with a potassium dichromate concentration of 0.10 N (after dilution by sample and sulfuric acid) were near theoretical oxygen demand values. However, COD measured with dichromate concentrations of 0.010 N and 0.0022 N were 30 to 40% lower than theoretical oxygen demand values. Similarly, lower COD values were observed with manganic sulfate as oxidant at 0.011 N. Extended digestion yielded somewhat higher COD values, suggesting incomplete and slower oxidation of EDTA, as a result of lower oxidant concentrations. For wastewater in which EDTA is a large fraction of COD, accurate COD measurement may not be achieved with methods using dichromate concentrations less than 0.1 N.

  9. Analysis of recurrent event data with incomplete observation gaps.

    PubMed

    Kim, Yang-Jin; Jhun, Myoungshic

    2008-03-30

    In analysis of recurrent event data, recurrent events are not completely experienced when the terminating event occurs before the end of a study. To make valid inference of recurrent events, several methods have been suggested for accommodating the terminating event (Statist. Med. 1997; 16:911-924; Biometrics 2000; 56:554-562). In this paper, our interest is to consider a particular situation, where intermittent dropouts result in observation gaps during which no recurrent events are observed. In this situation, risk status varies over time and the usual definition of risk variable is not applicable. In particular, we consider the case when information on the observation gap is incomplete, that is, the starting time of intermittent dropout is known but the terminating time is not available. This incomplete information is modeled in terms of an interval-censored mechanism. Our proposed method is applied to the study of the Young Traffic Offenders Program on conviction rates, wherein a certain proportion of subjects experienced suspensions with intermittent dropouts during the study.

  10. Cannabinoids induce incomplete maturation of cultured human leukemia cells

    SciTech Connect

    Murison, G.; Chubb, C.B.H.; Maeda, S.; Gemmell, M.A.; Huberman, E.

    1987-08-01

    Monocyte maturation markers were induced in cultured human myeloblastic ML-2 leukemia cells after treatment for 1-6 days with 0.03-30 ..mu..M ..delta../sup 9/-tetrahydrocannabinol (THC), the major psychoactive component of marijuana. After a 2-day or longer treatment, 2- to 5-fold increases were found in the percentages of cells exhibiting reactivity with either the murine OKM1 monoclonal antibody of the Leu-M5 monoclonal antibody, staining positively for nonspecific esterase activity, and displaying a promonocyte morphology. The increases in these differentiation markers after treatment with 0.03-1 ..mu..M THC were dose dependent. At this dose range, THC did not cause an inhibition of cell growth. The THC-induced cell maturation was also characterized by specific changes in the patterns of newly synthesized proteins. The THC-induced differentiation did not, however, result in cells with a highly developed mature monocyte phenotype. However, treatment of these incompletely matured cells with either phorbol 12-myristate 13-acetate of 1..cap alpha..,25-dihydroxycholecalciferol, which are inducers of differentiation in myeloid leukemia cells (including ML-2 cells), produced cells with a mature monocyte morphology. The ML-2 cell system described here may be a useful tool for deciphering critical biochemical events that lead to the cannabinoid-induced incomplete cell differentiation of ML-2 cells and other related cell types. Findings obtained from this system may have important implications for studies of cannabinoid effects on normal human bone-marrow progenitor cells.

  11. Semiparametric pseudoscore for regression with multidimensional but incompletely observed regressor.

    PubMed

    Hu, Zonghui; Qin, Jing; Follmann, Dean

    2017-02-16

    We study the regression fβ (Y|X,Z), where Y is the response, Z∈Rd is a vector of fully observed regressors and X is the regressor with incomplete observation. To handle missing data, maximum likelihood estimation via expectation-maximisation (EM) is the most efficient but is sensitive to the specification of the distribution of X. Under a missing at random assumption, we propose an EM-type estimation via a semiparametric pseudoscore. Like in EM, we derive the conditional expectation of the score function given Y and Z, or the mean score, over the incompletely observed units under a postulated distribution of X. Instead of directly using the 'mean score' in estimating equation, we use it as a working index to construct the semiparametric pseudoscore via nonparametric regression. Introduction of semiparametric pseudoscore into the EM framework reduces sensitivity to the specified distribution of X. It also avoids the curse of dimensionality when Z is multidimensional. The resulting regression estimator is more than doubly robust: it is consistent if either the pattern of missingness in X is correctly specified or the working index is appropriately, but not necessarily correctly, specified. It attains optimal efficiency when both conditions are satisfied. Numerical performance is explored by Monte Carlo simulations and a study on treating hepatitis C patients with HIV coinfection. Published 2017. This article is a U.S. Government work and is in the public domain in the USA.

  12. Photonic Molecule Lasers Revisited

    NASA Astrophysics Data System (ADS)

    Gagnon, Denis; Dumont, Joey; Déziel, Jean-Luc; Dubé, Louis J.

    2014-05-01

    Photonic molecules (PMs) formed by coupling two or more optical resonators are ideal candidates for the fabrication of integrated microlasers, photonic molecule lasers. Whereas most calculations on PM lasers have been based on cold-cavity (passive) modes, i.e. quasi-bound states, a recently formulated steady-state ab initio laser theory (SALT) offers the possibility to take into account the spectral properties of the underlying gain transition, its position and linewidth, as well as incorporating an arbitrary pump profile. We will combine two theoretical approaches to characterize the lasing properties of PM lasers: for two-dimensional systems, the generalized Lorenz-Mie theory will obtain the resonant modes of the coupled molecules in an active medium described by SALT. Not only is then the theoretical description more complete, the use of an active medium provides additional parameters to control, engineer and harness the lasing properties of PM lasers for ultra-low threshold and directional single-mode emission. We will extend our recent study and present new results for a number of promising geometries. The authors acknowledge financial support from NSERC (Canada) and the CERC in Photonic Innovations of Y. Messaddeq.

  13. Gradual molecular evolution of a sex determination switch through incomplete penetrance of femaleness.

    PubMed

    Beye, Martin; Seelmann, Christine; Gempe, Tanja; Hasselmann, Martin; Vekemans, Xavier; Fondrk, M Kim; Page, Robert E

    2013-12-16

    Some genes regulate phenotypes that are either present or absent. They are often important regulators of developmental switches and are involved in morphological evolution. We have little understanding of the molecular mechanisms by which these absence/presence gene functions have evolved, because the phenotype and fitness of molecular intermediate forms are unknown. Here, we studied the sex-determining switch of 14 natural sequence variants of the csd gene among 76 genotypes of the honeybee (Apis mellifera). Heterozygous genotypes (different specificities) of the csd gene determine femaleness, while hemizygous genotypes (single specificity) determine maleness. Homozygous genotypes of the csd gene (same specificity) are lethal. We found that at least five amino acid differences and length variation between Csd specificities in the specifying domain (PSD) were sufficient to regularly induce femaleness. We estimated that, on average, six pairwise amino acid differences evolved under positive selection. We also identified a natural evolutionary intermediate that showed only three amino acid length differences in the PSD relative to its parental allele. This genotype showed an intermediate fitness because it implemented lethality regularly and induced femaleness infrequently (i.e., incomplete penetrance). We suggest incomplete penetrance as a mechanism through which new molecular switches can gradually and adaptively evolve.

  14. Incomplete vertical integration in the health care industry: pseudomarkets and pseudopolicies.

    PubMed

    Evans, R G

    1983-07-01

    Most economic relationships are either arm's-length exchange transactions, each party seeking his or her own interest, or command structures, such as a firm or public agency, integrating joint efforts toward a common goal. The health care industry, however, displays a pattern of incomplete vertical integration--relationships which are neither truly arm's-length nor completely hierarchical. The doctor-patient relationship is archetypical. Physicians appear to sell services in private markets; yet they reach through the exchange process to direct the consumer-patient's utilization decisions, implicity undertaking to act in the patient's interest, and thus integrate forward. But they also integrate backward to control the public regulatory process--self-government--and some forms of insurance. The health care systems of different countries--Canada, the United Kingdom, and the United States--can be interpreted as different patterns of incomplete integration among five basic classes of transactors: consumer-patients, first-line providers, second-line providers, insurers, and governments. Each system of linkage has characteristic strengths and weaknesses. Nowhere, however, do we find a predominance of arm's-length market relationships. Where they exist, markets in health care are usually pseudomarkets dominated by one side of the transaction. The rhetoric of market relationships serves principally to obscure political struggles over shifting patterns of integration.

  15. Confidence-interval construction for rate ratio in matched-pair studies with incomplete data.

    PubMed

    Li, Hui-Qiong; Chan, Ivan S F; Tang, Man-Lai; Tian, Guo-Liang; Tang, Nian-Sheng

    2014-01-01

    Matched-pair design is often used in clinical trials to increase the efficiency of establishing equivalence between two treatments with binary outcomes. In this article, we consider such a design based on rate ratio in the presence of incomplete data. The rate ratio is one of the most frequently used indices in comparing efficiency of two treatments in clinical trials. In this article, we propose 10 confidence-interval estimators for the rate ratio in incomplete matched-pair designs. A hybrid method that recovers variance estimates required for the rate ratio from the confidence limits for single proportions is proposed. It is noteworthy that confidence intervals based on this hybrid method have closed-form solution. The performance of the proposed confidence intervals is evaluated with respect to their exact coverage probability, expected confidence interval width, and distal and mesial noncoverage probability. The results show that the hybrid Agresti-Coull confidence interval based on Fieller's theorem performs satisfactorily for small to moderate sample sizes. Two real examples from clinical trials are used to illustrate the proposed confidence intervals.

  16. Single Molecule Electronics and Devices

    PubMed Central

    Tsutsui, Makusu; Taniguchi, Masateru

    2012-01-01

    The manufacture of integrated circuits with single-molecule building blocks is a goal of molecular electronics. While research in the past has been limited to bulk experiments on self-assembled monolayers, advances in technology have now enabled us to fabricate single-molecule junctions. This has led to significant progress in understanding electron transport in molecular systems at the single-molecule level and the concomitant emergence of new device concepts. Here, we review recent developments in this field. We summarize the methods currently used to form metal-molecule-metal structures and some single-molecule techniques essential for characterizing molecular junctions such as inelastic electron tunnelling spectroscopy. We then highlight several important achievements, including demonstration of single-molecule diodes, transistors, and switches that make use of electrical, photo, and mechanical stimulation to control the electron transport. We also discuss intriguing issues to be addressed further in the future such as heat and thermoelectric transport in an individual molecule. PMID:22969345

  17. Spectral ordering techniques for incomplete LU preconditoners for CG methods

    NASA Technical Reports Server (NTRS)

    Clift, Simon S.; Simon, Horst D.; Tang, Wei-Pai

    1995-01-01

    The effectiveness of an incomplete LU (ILU) factorization as a preconditioner for the conjugate gradient method can be highly dependent on the ordering of the matrix rows during its creation. Detailed justification for two heuristics commonly used in matrix ordering for anisotropic problems is given. The bandwidth reduction and weak connection following heuristics are implemented through an ordering method based on eigenvector computations. This spectral ordering is shown to be a good representation of the heuristics. Analysis and test cases in two and three dimensional diffusion problems demonstrate when ordering is important, and when an ILU decomposition will be ordering insensitive. The applicability of the heuristics is thus evaluated and placed on a more rigorous footing.

  18. A Coupled Approach for Structural Damage Detection with Incomplete Measurements

    NASA Technical Reports Server (NTRS)

    James, George; Cao, Timothy; Kaouk, Mo; Zimmerman, David

    2013-01-01

    This historical work couples model order reduction, damage detection, dynamic residual/mode shape expansion, and damage extent estimation to overcome the incomplete measurements problem by using an appropriate undamaged structural model. A contribution of this work is the development of a process to estimate the full dynamic residuals using the columns of a spring connectivity matrix obtained by disassembling the structural stiffness matrix. Another contribution is the extension of an eigenvector filtering procedure to produce full-order mode shapes that more closely match the measured active partition of the mode shapes using a set of modified Ritz vectors. The full dynamic residuals and full mode shapes are used as inputs to the minimum rank perturbation theory to provide an estimate of damage location and extent. The issues associated with this process are also discussed as drivers of near-term development activities to understand and improve this approach.

  19. The value of incomplete mouse models of Alzheimer's disease.

    PubMed

    Radde, Rebecca; Duma, Cecilia; Goedert, Michel; Jucker, Mathias

    2008-03-01

    To study Alzheimer's disease (AD), a variety of mouse models has been generated through the overexpression of the amyloid precursor protein and/or the presenilins harboring one or several mutations found in familial AD. With aging, these mice develop several lesions similar to those of AD, including diffuse and neuritic amyloid deposits, cerebral amyloid angiopathy, dystrophic neurites and synapses, and amyloid-associated neuroinflammation. Other characteristics of AD, such as neurofibrillary tangles and nerve cell loss, are not satisfactorily reproduced in these models. Mouse models that recapitulate only specific aspects of AD pathogenesis are of great advantage when deciphering the complexity of the disease and can contribute substantially to diagnostic and therapeutic innovations. Incomplete mouse models have been key to the development of Abeta42-targeted therapies, as well as to the current understanding of the interrelationship between cerebral beta-amyloidosis and tau neurofibrillary lesions, and are currently being used to develop novel diagnostic agents for in vivo imaging.

  20. Multirate control with incomplete information over Profibus-DP network

    NASA Astrophysics Data System (ADS)

    Salt, J.; Casanova, V.; Cuenca, A.; Pizá, R.

    2014-07-01

    When a process field bus-decentralized peripherals (Profibus-DP) network is used in an industrial environment, a deterministic behaviour is usually claimed. However, due to some concerns such as bandwidth limitations, lack of synchronisation among different clocks and existence of time-varying delays, a more complex problem must be faced. This problem implies the transmission of irregular and, even, random sequences of incomplete information. The main consequence of this issue is the appearance of different sampling periods at different network devices. In this paper, this aspect is checked by means of a detailed Profibus-DP timescale study. In addition, in order to deal with the different periods, a delay-dependent dual-rate proportional-integral-derivative control is introduced. Stability for the proposed control system is analysed in terms of linear matrix inequalities.

  1. Iterative reconstruction of images from incomplete spectral data

    NASA Astrophysics Data System (ADS)

    Rhebergen, Jan B.; van den Berg, Peter M.; Habashy, Tarek M.

    1997-06-01

    In various branches of engineering and science, one is confronted with measurements resulting in incomplete spectral data. The problem of the reconstruction of an image from such a data set can be formulated in terms of an integral equation of the first kind. Consequently, this equation can be converted into an equivalent integral equation of the second kind which can be solved by a Neumann-type iterative method. It is shown that this Neumann expansion is an error-reducing method and that it is equivalent to the Papoulis - Gerchberg algorithm for band-limited signal extrapolation. The integral equation can also be solved by employing a conjugate gradient iterative scheme. Again, convergence of this scheme is demonstrated. Finally a number of illustrative numerical examples are presented and discussed.

  2. Traumatic vertebral artery dissection presenting with incomplete congruous homonymous quadrantanopia

    PubMed Central

    2010-01-01

    Background To describe a rare presentation of vertebral artery dissection (VAD) as a small but congruous incomplete homonymous hemianopia demonstrating use of visual field testing in the diagnosis. Case presentation A 30 year old woman had been unwell for 4 months with difficulty focusing, vertigo, dizziness and a feeling of falling to the right. A small but congruous right inferior homonymous quadrantanopia was found on examination leading to further investigation that uncovered a vertebral artery dissection and multiple posterior circulation infarctions including a left occipital stroke matching the field defect. Conclusions We describe an atypical case of VAD presenting with a small congruous quadrantanopia. This is a rare but significant condition that predisposes to multiple thromboembolic infarction that may be easily misdiagnosed and a high index of suspicion is required to make the diagnosis. PMID:20482837

  3. Incomplete Lineage Sorting Is Common in Extant Gibbon Genera

    PubMed Central

    Luca, Francesca; Carbone, Lucia; Mootnick, Alan R.; de Jong, Pieter J.; Di Rienzo, Anna

    2013-01-01

    We sequenced reduced representation libraries by means of Illumina technology to generate over 1.5 Mb of orthologous sequence from a representative of each of the four extant gibbon genera (Nomascus, Hylobates, Symphalangus, and Hoolock). We used these data to assess the evolutionary relationships between the genera by evaluating the likelihoods of all possible bifurcating trees involving the four taxa. Our analyses provide weak support for a tree with Nomascus and Hylobates as sister taxa and with Hoolock and Symphalangus as sister taxa, though bootstrap resampling suggests that other phylogenetic scenarios are also possible. This uncertainty is due to short internal branch lengths and extensive incomplete lineage sorting across taxa. The true phylogenetic relationships among gibbon genera will likely require a more extensive whole-genome sequence analysis. PMID:23341974

  4. Absolute magnitude calibration using trigonometric parallax - Incomplete, spectroscopic samples

    NASA Technical Reports Server (NTRS)

    Ratnatunga, Kavan U.; Casertano, Stefano

    1991-01-01

    A new numerical algorithm is used to calibrate the absolute magnitude of spectroscopically selected stars from their observed trigonometric parallax. This procedure, based on maximum-likelihood estimation, can retrieve unbiased estimates of the intrinsic absolute magnitude and its dispersion even from incomplete samples suffering from selection biases in apparent magnitude and color. It can also make full use of low accuracy and negative parallaxes and incorporate censorship on reported parallax values. Accurate error estimates are derived for each of the fitted parameters. The algorithm allows an a posteriori check of whether the fitted model gives a good representation of the observations. The procedure is described in general and applied to both real and simulated data.

  5. Corrected profile likelihood confidence interval for binomial paired incomplete data.

    PubMed

    Pradhan, Vivek; Menon, Sandeep; Das, Ujjwal

    2013-01-01

    Clinical trials often use paired binomial data as their clinical endpoint. The confidence interval is frequently used to estimate the treatment performance. Tang et al. (2009) have proposed exact and approximate unconditional methods for constructing a confidence interval in the presence of incomplete paired binary data. The approach proposed by Tang et al. can be overly conservative with large expected confidence interval width (ECIW) in some situations. We propose a profile likelihood-based method with a Jeffreys' prior correction to construct the confidence interval. This approach generates confidence interval with a much better coverage probability and shorter ECIWs. The performances of the method along with the corrections are demonstrated through extensive simulation. Finally, three real world data sets are analyzed by all the methods. Statistical Analysis System (SAS) codes to execute the profile likelihood-based methods are also presented.

  6. Pericardio-Amniotic Shunting for Incomplete Pentalogy of Cantrell.

    PubMed

    Engels, Alexander C; Debeer, Anne; Russo, Francesca M; Aertsen, Michael; Aerts, Katleen; Miserez, Marc; Deprest, Jan; Lewi, Liesbeth; Devlieger, Roland

    2017-01-01

    A 27-year-old woman, gravida 2, para 0, presented with an incomplete Pentalogy of Cantrell with an omphalocele, diaphragmatic hernia, and a pericardial defect at 32 weeks' gestation. A large pericardial effusion compressed the lungs and had led to a reduced lung growth with an observed-to-expected total lung volume of 28% as measured by MRI. The effusion disappeared completely after the insertion of a pericardio-amniotic shunt at 33 weeks. After birth, the newborn showed no signs of pulmonary hypoplasia and underwent a surgical correction of the defect. Protracted wound healing and a difficult withdrawal from opioids complicated the neonatal period. The child was discharged on postnatal day 105 in good condition. This case demonstrates that in case of Pentalogy of Cantrell with large pericardial effusion, the perinatal outcome might be improved by pericardio-amniotic shunting.

  7. A flexible acquisition cycle for incompletely defined fieldbus protocols.

    PubMed

    Gaitan, Vasile-Gheorghita; Gaitan, Nicoleta-Cristina; Ungurean, Ioan

    2014-05-01

    Real time data-acquisition from fieldbuses strongly depends on the network type and protocol used. Currently, there is an impressive number of fieldbuses, some of them are completely defined and others are incompletely defined. In those from the second category, the time variable, the main element in real-time data acquisition, does not appear explicitly. Examples include protocols such as Modbus ASCII/RTU, M-bus, ASCII character-based, and so on. This paper defines a flexible acquisition cycle based on the Master-Slave architecture that can be implemented on a Master station, called a Base Station Gateway (BSG). The BSG can add a timestamp for temporal location of data. It also presents a possible extension for the Modbus protocol, developed as simple and low cost solution based on existing hardware.

  8. Quantum Tomography from Incomplete Data via MaxEnt Principle

    NASA Astrophysics Data System (ADS)

    Bužek, Vladimír

    We show how the maximum entropy (MaxEnt) principle can be efficiently used for a reconstruction of states of quantum systems from incomplete tomographic data. This MaxEnt reconstruction scheme can be in specific cases several orders of magnitude more efficient than the standard inverse Radon transformation or the reconstruction via direct sampling using pattern functions. We apply the MaxEnt algorithm for a reconstruction of motional quantum states of neutral atoms. As an example we analyze the experimental data obtained by the group of C. Salomon at the ENS in Paris and we reconstruct Wigner functions of motional quantum states of Cs atoms trapped in an optical lattice. We also reconstruct Wigner functions of a cavity field based on a measurement of the parity operator. We analyze in detail experimental data obtained by the group of S. Haroche at the ENS in Paris.

  9. Incomplete lineage sorting is common in extant gibbon genera.

    PubMed

    Wall, Jeffrey D; Kim, Sung K; Luca, Francesca; Carbone, Lucia; Mootnick, Alan R; de Jong, Pieter J; Di Rienzo, Anna

    2013-01-01

    We sequenced reduced representation libraries by means of Illumina technology to generate over 1.5 Mb of orthologous sequence from a representative of each of the four extant gibbon genera (Nomascus, Hylobates, Symphalangus, and Hoolock). We used these data to assess the evolutionary relationships between the genera by evaluating the likelihoods of all possible bifurcating trees involving the four taxa. Our analyses provide weak support for a tree with Nomascus and Hylobates as sister taxa and with Hoolock and Symphalangus as sister taxa, though bootstrap resampling suggests that other phylogenetic scenarios are also possible. This uncertainty is due to short internal branch lengths and extensive incomplete lineage sorting across taxa. The true phylogenetic relationships among gibbon genera will likely require a more extensive whole-genome sequence analysis.

  10. Missing... presumed at random: cost-analysis of incomplete data.

    PubMed

    Briggs, Andrew; Clark, Taane; Wolstenholme, Jane; Clarke, Philip

    2003-05-01

    When collecting patient-level resource use data for statistical analysis, for some patients and in some categories of resource use, the required count will not be observed. Although this problem must arise in most reported economic evaluations containing patient-level data, it is rare for authors to detail how the problem was overcome. Statistical packages may default to handling missing data through a so-called 'complete case analysis', while some recent cost-analyses have appeared to favour an 'available case' approach. Both of these methods are problematic: complete case analysis is inefficient and is likely to be biased; available case analysis, by employing different numbers of observations for each resource use item, generates severe problems for standard statistical inference. Instead we explore imputation methods for generating 'replacement' values for missing data that will permit complete case analysis using the whole data set and we illustrate these methods using two data sets that had incomplete resource use information.

  11. Analysis of incomplete longitudinal binary data using multiple imputation.

    PubMed

    Li, Xiaoming; Mehrotra, Devan V; Barnard, John

    2006-06-30

    We propose a propensity score-based multiple imputation (MI) method to tackle incomplete missing data resulting from drop-outs and/or intermittent skipped visits in longitudinal clinical trials with binary responses. The estimation and inferential properties of the proposed method are contrasted via simulation with those of the commonly used complete-case (CC) and generalized estimating equations (GEE) methods. Three key results are noted. First, if data are missing completely at random, MI can be notably more efficient than the CC and GEE methods. Second, with small samples, GEE often fails due to 'convergence problems', but MI is free of that problem. Finally, if the data are missing at random, while the CC and GEE methods yield results with moderate to large bias, MI generally yields results with negligible bias. A numerical example with real data is provided for illustration.

  12. Effects of incomplete mixing on chemical reactions under flow heterogeneities.

    NASA Astrophysics Data System (ADS)

    Perez, Lazaro; Hidalgo, Juan J.; Dentz, Marco

    2016-04-01

    Evaluation of the mixing process in aquifers is of primary importance when assessing attenuation of pollutants. In aquifers different hydraulic and chemical properties can increase mixing and spreading of the transported species. Mixing processes control biogeochemical transformations such as precipitation/dissolution reactions or degradation reactions that are fast compared to mass transfer processes. Reactions are local phenomena that fluctuate at the pore scale, but predictions are often made at much larger scales. However, aquifer heterogeities are found at all scales and generates flow heterogeneities which creates complex concentration distributions that enhances mixing. In order to assess the impact of spatial flow heterogeneities at pore scale we study concentration profiles, gradients and reaction rates using a random walk particle tracking (RWPT) method and kernel density estimators to reconstruct concentrations and gradients in two setups. First, we focus on a irreversible bimolecular reaction A+B → C under homogeneous flow to distinguish phenomena of incomplete mixing of reactants from finite-size sampling effects. Second, we analise a fast reversible bimolecular chemical reaction A+B rightleftharpoons C in a laminar Poiseuille flow reactor to determine the difference between local and global reaction rates caused by the incomplete mixing under flow heterogeneities. Simulation results for the first setup differ from the analytical solution of the continuum scale advection-dispersion-reaction equation studied by Gramling et al. (2002), which results in an overstimation quantity of reaction product (C). In the second setup, results show that actual reaction rates are bigger than the obtained from artificially mixing the system by averaging the concentration vertically. - LITERATURE Gramling, C. M.,Harvey, C. F., Meigs, and L. C., (2002). Reactive transport in porous media: A comparison of model prediction with laboratory visualization, Environ. Sci

  13. IMPORTANT BUT INCOMPLETE: PLAN B AS AN AVENUE FOR POST-ASSAULT CARE

    PubMed Central

    Munro, Michelle L.; Martyn, Kristy K.; Campbell, Rebecca; Graham-Bermann, Sandra; Seng, Julia S.

    2016-01-01

    Many survivors of rape do not seek post-assault care. The recent change in status of emergency contraception (EC), such as Plan B, to an over-the-counter (OTC) product may be further changing post-assault care-seeking. This descriptive study will quantify OTC EC use in the post-assault period and elicit survivors’ desires for care. Data were collected from women purchasing OTC EC at university pharmacies (n=55) and students in an undergraduate university class (n=165). Quantitative results indicate annual prevalence rates of post-assault OTC EC use as 5.4%-7.3%. Qualitative analyses indicate OTC EC is an important but incomplete form of post-assault care. Future work should focus on intervention development to provide all OTC EC users with information about post-assault resources to prevent long-term sequelae. PMID:27293493

  14. Incomplete oedipism and chronic suicidality in psychotic depression with paranoid delusions related to eyes

    PubMed Central

    Pompili, Maurizio; Lester, David; Tatarelli, Roberto; Girardi, Paolo

    2006-01-01

    Self-enucleation or oedipism is a term used to describe self-inflicted enucleation. It is a rare form of self-mutilation, found mainly in acutely psychotic patients. We propose the term incomplete oedipism to describe patients who deliberately and severely mutilate their eyes without proper enucleation. We report the case of a 32-year-old male patient with a five-year history of psychotic depression accompanied by paranoid delusions centered around his belief that his neighbors criticized him and stared at him. A central feature of his clinical picture was an eye injury that the patient had caused by pouring molten lead into his right eye during a period of deep hopelessness and suicidality when the patient could not resolve his anhedonia and social isolation. Pharmacotherapy and psychotherapy dramatically improved his disorder. PMID:17118200

  15. Incomplete cytokinesis/binucleation in mammals: The powerful system of hepatocytes.

    PubMed

    Fortier, M; Celton-Morizur, S; Desdouets, C

    2017-01-01

    Polyploidy, the state of having greater than a diploid DNA content (tetraploid, octoploid, etc.) is a characteristic feature of mammalian hepatocytes and accompanies late fetal development and postnatal maturation of the liver. During the weaning period, diploid hepatocytes can engage either into normal cell division cycle giving rise to two diploid hepatocytes or follow a scheduled division program characterized by incomplete cytokinesis. In that case, diploid hepatocytes undergo mitosis, but do not form a contractile ring. Indeed, cleavage-plane specification is never established, because of the deficiencies of actin cytoskeleton reorganization. Furthermore, microtubules fail both to contact the cortex and to deliver their molecular signal, preventing localization and activation of RhoA. Therefore, cytokinesis aborts and a binucleate tetraploid liver cell is generated, which subsequently plays a pivotal role in liver progressive polyploidization. In this chapter, we describe detailed protocols to monitor hepatocyte proliferation and cytokinesis process by in situ and dynamic ex vivo approaches.

  16. Dihydrino molecule identification

    SciTech Connect

    Mills, R.L.; Good, W.R. ); Shaubach, R.M. )

    1994-01-01

    Three sets of heat production and [open quotes]ash[close quotes] identification data are presented. An exothermic reaction is reported wherein the electrons of hydrogen and deuterium atoms are stimulated to relax to quantized potential energy levels below that of the [open quotes]ground state[close quotes] via electrochemical reactants K[sup +] and K[sup +]; Pd[sup 2+] and Li[sup +]; or Pd and O[sub 2] of redox energy resonant with the energy hole that stimulates this transition. Calorimetry of pulsed current and continuous electrolysis of aqueous potassium carbonate (K[sup +]/K[sup +] electrocatalytic couple) at a nickel cathode were performed. The excess output power of 41 W exceeded by a factor >8 the total input power given by the product of the electrolysis voltage and current. The product of the exothermic reaction is atoms having electrons of energy below the ground state, which are predicted to form molecules. The predicted molecules were identified by their lack of reactivity with oxygen, by separation from molecular deuterium by cryofiltration, and by mass spectroscopic analysis. 15 refs., 12 figs., 9 tabs.

  17. A hierarchical nest survival model integrating incomplete temporally varying covariates

    PubMed Central

    Converse, Sarah J; Royle, J Andrew; Adler, Peter H; Urbanek, Richard P; Barzen, Jeb A

    2013-01-01

    Nest success is a critical determinant of the dynamics of avian populations, and nest survival modeling has played a key role in advancing avian ecology and management. Beginning with the development of daily nest survival models, and proceeding through subsequent extensions, the capacity for modeling the effects of hypothesized factors on nest survival has expanded greatly. We extend nest survival models further by introducing an approach to deal with incompletely observed, temporally varying covariates using a hierarchical model. Hierarchical modeling offers a way to separate process and observational components of demographic models to obtain estimates of the parameters of primary interest, and to evaluate structural effects of ecological and management interest. We built a hierarchical model for daily nest survival to analyze nest data from reintroduced whooping cranes (Grus americana) in the Eastern Migratory Population. This reintroduction effort has been beset by poor reproduction, apparently due primarily to nest abandonment by breeding birds. We used the model to assess support for the hypothesis that nest abandonment is caused by harassment from biting insects. We obtained indices of blood-feeding insect populations based on the spatially interpolated counts of insects captured in carbon dioxide traps. However, insect trapping was not conducted daily, and so we had incomplete information on a temporally variable covariate of interest. We therefore supplemented our nest survival model with a parallel model for estimating the values of the missing insect covariates. We used Bayesian model selection to identify the best predictors of daily nest survival. Our results suggest that the black fly Simulium annulus may be negatively affecting nest survival of reintroduced whooping cranes, with decreasing nest survival as abundance of S. annulus increases. The modeling framework we have developed will be applied in the future to a larger data set to evaluate the

  18. A hierarchical nest survival model integrating incomplete temporally varying covariates.

    PubMed

    Converse, Sarah J; Royle, J Andrew; Adler, Peter H; Urbanek, Richard P; Barzen, Jeb A

    2013-11-01

    Nest success is a critical determinant of the dynamics of avian populations, and nest survival modeling has played a key role in advancing avian ecology and management. Beginning with the development of daily nest survival models, and proceeding through subsequent extensions, the capacity for modeling the effects of hypothesized factors on nest survival has expanded greatly. We extend nest survival models further by introducing an approach to deal with incompletely observed, temporally varying covariates using a hierarchical model. Hierarchical modeling offers a way to separate process and observational components of demographic models to obtain estimates of the parameters of primary interest, and to evaluate structural effects of ecological and management interest. We built a hierarchical model for daily nest survival to analyze nest data from reintroduced whooping cranes (Grus americana) in the Eastern Migratory Population. This reintroduction effort has been beset by poor reproduction, apparently due primarily to nest abandonment by breeding birds. We used the model to assess support for the hypothesis that nest abandonment is caused by harassment from biting insects. We obtained indices of blood-feeding insect populations based on the spatially interpolated counts of insects captured in carbon dioxide traps. However, insect trapping was not conducted daily, and so we had incomplete information on a temporally variable covariate of interest. We therefore supplemented our nest survival model with a parallel model for estimating the values of the missing insect covariates. We used Bayesian model selection to identify the best predictors of daily nest survival. Our results suggest that the black fly Simulium annulus may be negatively affecting nest survival of reintroduced whooping cranes, with decreasing nest survival as abundance of S. annulus increases. The modeling framework we have developed will be applied in the future to a larger data set to evaluate the

  19. A hierarchical nest survival model integrating incomplete temporally varying covariates

    USGS Publications Warehouse

    Converse, Sarah J.; Royle, J. Andrew; Adler, Peter H.; Urbanek, Richard P.; Barzan, Jeb A.

    2013-01-01

    Nest success is a critical determinant of the dynamics of avian populations, and nest survival modeling has played a key role in advancing avian ecology and management. Beginning with the development of daily nest survival models, and proceeding through subsequent extensions, the capacity for modeling the effects of hypothesized factors on nest survival has expanded greatly. We extend nest survival models further by introducing an approach to deal with incompletely observed, temporally varying covariates using a hierarchical model. Hierarchical modeling offers a way to separate process and observational components of demographic models to obtain estimates of the parameters of primary interest, and to evaluate structural effects of ecological and management interest. We built a hierarchical model for daily nest survival to analyze nest data from reintroduced whooping cranes (Grus americana) in the Eastern Migratory Population. This reintroduction effort has been beset by poor reproduction, apparently due primarily to nest abandonment by breeding birds. We used the model to assess support for the hypothesis that nest abandonment is caused by harassment from biting insects. We obtained indices of blood-feeding insect populations based on the spatially interpolated counts of insects captured in carbon dioxide traps. However, insect trapping was not conducted daily, and so we had incomplete information on a temporally variable covariate of interest. We therefore supplemented our nest survival model with a parallel model for estimating the values of the missing insect covariates. We used Bayesian model selection to identify the best predictors of daily nest survival. Our results suggest that the black fly Simulium annulus may be negatively affecting nest survival of reintroduced whooping cranes, with decreasing nest survival as abundance of S. annulus increases. The modeling framework we have developed will be applied in the future to a larger data set to evaluate the

  20. Probabilistic Seismic Hazard Assessment from Incomplete and Uncertain Data

    NASA Astrophysics Data System (ADS)

    Smit, Ansie; Kijko, Andrzej

    2016-04-01

    A question that frequently arises with seismic hazard assessment is why are our assessments so poor? Often the answer is that in many cases the standard applied methodologies do not take into account the nature of seismic event catalogs. In reality these catalogues are incomplete with uncertain magnitude estimates and a significant discrepancy between the empirical data and applied occurrence model. Most probabilistic seismic hazard analysis procedures require knowledge of at least three seismic source parameters: the mean seismic activity rate λ, the Gutenberg-Richter b-value, and the area-characteristic (seismogenic source) maximum possible earthquake magnitude Mmax. In almost all currently used seismic hazard assessment procedures utilizing these three parameters, it's explicitly assumed that all three remain constant over a specified time and space. However, closer examination of most earthquake catalogues indicates that there are significant spatial and temporal variations in the seismic activity rate λ as well as the Gutenberg-Richter b-value. In the proposed methodology the maximum likelihood estimation of these earthquake hazard parameters takes into account the incompleteness of catalogues, uncertainty in the earthquake magnitude determination as well as the uncertainty associated with the applied earthquake occurrence models. The uncertainty in the earthquake occurrence models are introduced by assuming that both, the mean, seismic activity rate λ and the b-value of Gutenberg-Richter are random variables, each described by the Gamma distribution. The approach results in the extension of the classic frequency-magnitude Gutenberg-Richter relation and the Poisson distribution of number of earthquakes, with their compounded counterparts. The proposed procedure is applied in the estimation of the seismic parameters for the area of Ceres-Tulbagh, South Africa, which experienced the strongest earthquake in the country's recorded history. In this example it is

  1. Molecules in the Spotlight

    SciTech Connect

    Cryan, James

    2010-01-26

    SLAC has just unveiled the world's first X-ray laser, the LCLS. This machine produces pulses of X-rays that are ten billion times brighter than those from conventional sources. One of the goals of this machine is to make movies of chemical reactions, including reactions necessary for life and reactions that might power new energy technologies. This public lecture will show the first results from the LCLS. As a first target, we have chosen nitrogen gas, the main component of the air we breathe. Using the unprecedented power of the LCLS X-rays as a blasting torch, we have created new forms of this molecule and with unique electronic arrangements. Please share with us the first insights from this new technology.

  2. Soluble forms of NCAM and F3 neuronal cell adhesion molecules promote Schwann cell migration: identification of protein tyrosine phosphatases zeta/beta as the putative F3 receptors on Schwann cells.

    PubMed

    Thomaidou, D; Coquillat, D; Meintanis, S; Noda, M; Rougon, G; Matsas, R

    2001-08-01

    Neural cell adhesion molecule (NCAM) and F3 are both axonal adhesion molecules which display homophilic (NCAM) or heterophilic (NCAM, F3) binding activities and participate in bidirectional exchange of information between neurones and glial cells. Engineered Fc chimeric molecules are fusion proteins that contain the extracellular part of NCAM or F3 and the Fc region of human IgG1. Here, we investigated the effect of NCAM-Fc and F3-Fc chimeras on Schwann cell (SC) migration. Binding sites were identified at the surface of cultured SCs by chimera coated fluorospheres. The functional effect of NCAM-Fc and F3-Fc binding was studied in two different SC migration models. In the first, migration is monitored at specific time intervals inside a 1-mm gap produced in a monolayer culture of SCs. In the second, SCs from a dorsal root ganglion explant migrate on a sciatic nerve cryosection. In both systems addition of the chimeras significantly increased the extent of SC migration and this effect could be prevented by the corresponding anti-NCAM or anti-F3 blocking antibodies. Furthermore, antiproteoglycan-type protein tyrosine phosphatase zeta/beta (RPTPzeta/beta) antibodies identified the presence of RPTPzeta/beta on SCs and prevented the enhancing effect of soluble F3 on SC motility by 95%. The F3-Fc coated Sepharose beads precipitated RPTPzeta/beta from SC lysates. Altogether these data point to RPTPzeta/beta is the putative F3 receptor on SCs. These results identify F3 and NCAM receptors on SC as potential mediators of signalling occurring between axons and glial cells during peripheral nerve development and regeneration.

  3. Spectral Regularization Algorithms for Learning Large Incomplete Matrices.

    PubMed

    Mazumder, Rahul; Hastie, Trevor; Tibshirani, Robert

    2010-03-01

    We use convex relaxation techniques to provide a sequence of regularized low-rank solutions for large-scale matrix completion problems. Using the nuclear norm as a regularizer, we provide a simple and very efficient convex algorithm for minimizing the reconstruction error subject to a bound on the nuclear norm. Our algorithm Soft-Impute iteratively replaces the missing elements with those obtained from a soft-thresholded SVD. With warm starts this allows us to efficiently compute an entire regularization path of solutions on a grid of values of the regularization parameter. The computationally intensive part of our algorithm is in computing a low-rank SVD of a dense matrix. Exploiting the problem structure, we show that the task can be performed with a complexity linear in the matrix dimensions. Our semidefinite-programming algorithm is readily scalable to large matrices: for example it can obtain a rank-80 approximation of a 10(6) × 10(6) incomplete matrix with 10(5) observed entries in 2.5 hours, and can fit a rank 40 approximation to the full Netflix training set in 6.6 hours. Our methods show very good performance both in training and test error when compared to other competitive state-of-the art techniques.

  4. Piriformis syndrome in an incomplete paraplegic patient: a case report

    PubMed Central

    Misirlioglu, TO; Palamar, D; Akgun, K

    2015-01-01

    Study design: Single case report. Objectives: We present an incomplete paraplegic patient with lower back and hip pain, diagnosed and treated as the piriformis syndrome (PS). Setting: University hospital, Turkey. Case: A 62-year-old woman with T3 paraplegia of American Spinal Injury Association Impairment Scale grade D presented with lower back and right hip pain accompanied by pain and numbness radiating to her right leg. After detailed anamnesis and physical examination, she was pre-diagnosed as having PS. The marked relief of pain following the ultrasound-guided piriformis muscle injection of 4 cc of lidocaine 2%+1 cc of betametazone confirmed the diagnosis. Conclusion: Although the compressive neuropathies and musculoskeletal injuries of the upper limb leading to neuropathic and musculoskeletal pain in persons with spinal cord injury (SCI) are well described in literature, there is limited information regarding those of lower limbs. To the best of our knowledge, this is the first reported case of PS in a patient with SCI. PS should be kept in mind as a pain generator, especially in active and ambulatory SCI patients. PMID:28053713

  5. Learning with incomplete information and the mathematical structure behind it.

    PubMed

    Kühn, Reimer; Stamatescu, Ion-Olimpiu

    2007-07-01

    We investigate the problem of learning with incomplete information as exemplified by learning with delayed reinforcement. We study a two phase learning scenario in which a phase of Hebbian associative learning based on momentary internal representations is supplemented by an 'unlearning' phase depending on a graded reinforcement signal. The reinforcement signal quantifies the success-rate globally for a number of learning steps in phase one, and 'unlearning' is indiscriminate with respect to associations learnt in that phase. Learning according to this model is studied via simulations and analytically within a student-teacher scenario for both single layer networks and, for a committee machine. Success and speed of learning depend on the ratio lambda of the learning rates used for the associative Hebbian learning phase and for the unlearning-correction in response to the reinforcement signal, respectively. Asymptotically perfect generalization is possible only, if this ratio exceeds a critical value lambda( c ), in which case the generalization error exhibits a power law decay with the number of examples seen by the student, with an exponent that depends in a non-universal manner on the parameter lambda. We find these features to be robust against a wide spectrum of modifications of microscopic modelling details. Two illustrative applications-one of a robot learning to navigate a field containing obstacles, and the problem of identifying a specific component in a collection of stimuli-are also provided.

  6. Incomplete restoration of homeostatic shear stress within arteriovenous fistulae.

    PubMed

    McGah, Patrick M; Leotta, Daniel F; Beach, Kirk W; Eugene Zierler, R; Aliseda, Alberto

    2013-01-01

    Arteriovenous fistulae are surgically created to provide adequate access for dialysis patients suffering from end-stage renal disease. It has long been hypothesized that the rapid blood vessel remodeling occurring after fistula creation is, in part, a process to restore the mechanical stresses to some preferred level, i.e., mechanical homeostasis. We present computational hemodynamic simulations in four patient-specific models of mature arteriovenous fistulae reconstructed from 3D ultrasound scans. Our results suggest that these mature fistulae have remodeled to return to ''normal'' shear stresses away from the anastomoses: about 1.0 Pa in the outflow veins and about 2.5 Pa in the inflow arteries. Large parts of the anastomoses were found to be under very high shear stresses >15 Pa, over most of the cardiac cycle. These results suggest that the remodeling process works toward restoring mechanical homeostasis in the fistulae, but that the process is limited or incomplete, even in mature fistulae, as evidenced by the elevated shear at or near the anastomoses. Based on the long term clinical viability of these dialysis accesses, we hypothesize that the elevated nonhomeostatic shear stresses in some portions of the vessels were not detrimental to fistula patency.

  7. General Relativity Theory - Well Proven and Also Incomplete: Further Arguments

    NASA Astrophysics Data System (ADS)

    Brandes, Jürgen

    In the former article "General Relativity Theory - well proven and also incomplete?" with a few arguments it was proven that general relativity (GRT) makes contradictory predictions about the total energy of a particle resting in the gravitational field. With a few further arguments it was proven that this contradiction is resolved by expanding general relativity. General relativity is contradictious in energy questions since on one side the total energy of a particle resting in the gravitational field is lower than its rest mass (there is energy needed to pull out the particle from the gravitational field) while on the other side it is equal to its rest mass (this is a consequence of the equivalence principle). In the following article these considerations are generalized to a moving particle. A particle moving in the gravitational field has a total energy less than its rest mass times the relativistic γ-factor since there is energy needed to pull the particle out without changing its velocity. On the other side total energy of a moving particle is equal to its rest mass times the relativistic γ-factor (this is a consequence of the equivalence principle, too). This contradiction is resolved by expanding general relativity in the same manner as above. The other fact: Though it is not the aim of the author to reject general relativity but to expand it, he is treated as some uncritical anti-relativist - since the start of his considerations and meanwhile for more than 20 years.

  8. Quantum Correlations from the Conditional Statistics of Incomplete Data.

    PubMed

    Sperling, J; Bartley, T J; Donati, G; Barbieri, M; Jin, X-M; Datta, A; Vogel, W; Walmsley, I A

    2016-08-19

    We study, in theory and experiment, the quantum properties of correlated light fields measured with click-counting detectors providing incomplete information on the photon statistics. We establish a correlation parameter for the conditional statistics, and we derive the corresponding nonclassicality criteria for detecting conditional quantum correlations. Classical bounds for Pearson's correlation parameter are formulated that allow us, once they are violated, to determine nonclassical correlations via the joint statistics. On the one hand, we demonstrate nonclassical correlations in terms of the joint click statistics of light produced by a parametric down-conversion source. On the other hand, we verify quantum correlations of a heralded, split single-photon state via the conditional click statistics together with a generalization to higher-order moments. We discuss the performance of the presented nonclassicality criteria to successfully discern joint and conditional quantum correlations. Remarkably, our results are obtained without making any assumptions on the response function, quantum efficiency, and dark-count rate of photodetectors.

  9. Topology and incompleteness for 2+1-dimensional cosmological spacetimes

    NASA Astrophysics Data System (ADS)

    Fajman, David

    2016-12-01

    We study the long-time behavior of the Einstein flow coupled to matter on 2-dimensional surfaces. We consider massless matter models such as collisionless matter composed of massless particles, massless scalar fields and radiation fluids and show that the maximal globally hyperbolic development of homogeneous and isotropic initial data on the 2-sphere is geodesically incomplete in both time directions, i.e. the spacetime recollapses. This behavior also holds for open sets of initial data. In particular, we construct classes of recollapsing 2+1-dimensional spacetimes with spherical spatial topology which provide evidence for a closed universe recollapse conjecture for massless matter models in 2+1 dimensions. Furthermore, we construct solutions with toroidal and higher genus topology for the massless matter fields, which in both cases are future complete. The spacetimes with toroidal topology are 2+1-dimensional analogies of the Einstein-de Sitter model. In addition, we point out a general relation between the energy-momentum tensor and the Kretschmann scalar in 2+1 dimensions and use it to infer strong cosmic censorship for all these models. In view of this relation, we also recall corresponding models containing massive particles, constructed in a previous work and determine the nature of their initial singularities. We conclude that the global structure of non-vacuum cosmological spacetimes in 2+1 dimensions is determined by the mass of particles and—in the homogeneous and isotropic setting studied here—verifies strong cosmic censorship.

  10. Synesthesia in twins: incomplete concordance in monozygotes suggests extragenic factors.

    PubMed

    Bosley, Hannah G; Eagleman, David M

    2015-06-01

    Colored-sequence synesthesia (CSS) is a neurological condition in which sequential stimuli such as letters, numbers, or days of the week trigger simultaneous, involuntary color perception. Although the condition appears to run in families and several studies have sought a genetic link, the genetic contribution to synesthesia remains unclear. We conducted the first comparative twin study of CSS and found that CSS has a pairwise concordance of 73.9% in monozygotic twins, and a pairwise concordance of 36.4% in dizygotic twins. In line with previous studies, our results suggest a heritable element of synesthesia. However, consonant with the findings of previous single-pair case studies, our large sample size verifies that synesthesia is not completely conferred by genetics; if it were, monozygotic twins should have 100% concordance. These findings implicate a genetic mechanism of CSS that may work differently than previously thought: collectively, our data suggest that synesthesia is a heritable condition with incomplete penetrance that is substantially influenced by epigenetic and environmental factors.

  11. Quantum Correlations from the Conditional Statistics of Incomplete Data

    NASA Astrophysics Data System (ADS)

    Sperling, J.; Bartley, T. J.; Donati, G.; Barbieri, M.; Jin, X.-M.; Datta, A.; Vogel, W.; Walmsley, I. A.

    2016-08-01

    We study, in theory and experiment, the quantum properties of correlated light fields measured with click-counting detectors providing incomplete information on the photon statistics. We establish a correlation parameter for the conditional statistics, and we derive the corresponding nonclassicality criteria for detecting conditional quantum correlations. Classical bounds for Pearson's correlation parameter are formulated that allow us, once they are violated, to determine nonclassical correlations via the joint statistics. On the one hand, we demonstrate nonclassical correlations in terms of the joint click statistics of light produced by a parametric down-conversion source. On the other hand, we verify quantum correlations of a heralded, split single-photon state via the conditional click statistics together with a generalization to higher-order moments. We discuss the performance of the presented nonclassicality criteria to successfully discern joint and conditional quantum correlations. Remarkably, our results are obtained without making any assumptions on the response function, quantum efficiency, and dark-count rate of photodetectors.

  12. Projectile - Mass asymmetry systematics for low energy incomplete fusion

    NASA Astrophysics Data System (ADS)

    Singh, Pushpendra P.; Yadav, Abhishek; Sharma, Vijay R.; Sharma, Manoj K.; Kumar, Pawan; Sahoo, Rudra N.; Kumar, R.; Singh, R. P.; Muralithar, S.; Singh, B. P.; Bhowmik, R. K.; Prasad, R.

    2015-06-01

    In the present work, low energy incomplete fusion (ICF) in which only a part of projectile fuses with target nucleus has been investigated in terms of various entrance channel parameters. The ICF strength function has been extracted from the analysis of experimental excitation functions (EFs) measured for different projectile-target combinations from near- to well above- barrier energies in 12C,16O(from 1.02Vb to 1.64Vb)+169Tm systems. Experimental EFs have been analysed in the framework statistical model code PACE4 based on the idea of equilibrated compound nucleus decay. It has been found that the value of ICF fraction (FICF) increases with incident projectile energy. A substantial fraction of ICF (FICF ≈ 7 %) has been accounted even at energy as low as ≈ 7.5% above the barrier (at relative velocity νrel ≈0.027) in 12C+169Tm system, and FICF ≈ 10 % at νrel ≈0.014 in 16O+169Tm system. The probability of ICF is discussed in light of the Morgenstern's mass-asymmetry systematics. The value of FICF for 16O+169Tm systems is found to be 18.3 % higher than that observed for 12C+169Tm systems. Present results together with the re-analysis of existing data for nearby systems conclusively demonstrate strong competition of ICF with CF even at slightly above barrier energies, and strong projectile dependence that seems to supplement the Morgenstern's systematics.

  13. Pathlength scaling in graphs with incomplete navigational information

    NASA Astrophysics Data System (ADS)

    Lee, Sang Hoon; Holme, Petter

    2011-10-01

    The graph-navigability problem concerns how one can find as short paths as possible between a pair of vertices, given an incomplete picture of a graph. We study the navigability of graphs where the vertices are tagged by a number (between 1 and the total number of vertices) in a way to aid navigation. This information is too little to ensure errorfree navigation but enough, as we will show, for the agents to do significantly better than a random walk. In our setup, given a graph, we first assign information to the vertices that agents can utilize for their navigation. To evaluate the navigation, we calculate the average distance traveled over random pairs of source and target and different graph realizations. We show that this type of embedding can be made quite efficiently; the more information is embedded, the more efficient it gets. We also investigate the embedded navigational information in a standard graph layout algorithm and find that although this information does not make algorithms as efficient as the above-mentioned schemes, it is significantly helpful.

  14. A multiple imputation strategy for incomplete longitudinal data.

    PubMed

    Landrum, M B; Becker, M P

    Longitudinal studies are commonly used to study processes of change. Because data are collected over time, missing data are pervasive in longitudinal studies, and complete ascertainment of all variables is rare. In this paper a new imputation strategy for completing longitudinal data sets is proposed. The proposed methodology makes use of shrinkage estimators for pooling information across geographic entities, and of model averaging for pooling predictions across different statistical models. Bayes factors are used to compute weights (probabilities) for a set of models considered to be reasonable for at least some of the units for which imputations must be produced, imputations are produced by draws from the predictive distributions of the missing data, and multiple imputations are used to better reflect selected sources of uncertainty in the imputation process. The imputation strategy is developed within the context of an application to completing incomplete longitudinal variables in the so-called Area Resource File. The proposed procedure is compared with several other imputation procedures in terms of inferences derived with the imputations, and the proposed methodology is demonstrated to provide valid estimates of model parameters when the completed data are analysed. Extensions to other missing data problems in longitudinal studies are straightforward so long as the missing data mechanism can be assumed to be ignorable.

  15. Incomplete water securitization in coupled hydro-human production sytems

    NASA Astrophysics Data System (ADS)

    van den Boom, B.; Pande, S.

    2012-04-01

    Due to the dynamics, the externalities and the contingencies involved in managing local water resource for production, the water allocation at basin-level is a subtle balance between laws of nature (gravity; flux) and laws of economics (price; productivity). We study this balance by looking at inter-temporal basin-level water resource allocations in which subbasins enjoy a certain degree of autonomy. Each subbasin is represented as an economic agent i, following a gravity ordering with i=1 representing the most upstream area and i=I the downstream boundary. The water allocation is modeled as a decentralized equilibrium in a coupled conceptual hydro-human production system. Agents i=1,2,...,I in the basin produce a composite good according to a technology that requires water as a main input and that is specific to the subbasin. Agent i manages her use Xi and her storage Si, conceptualizing surface and subsurface water, of water with the purpose of maximizing the utility derived from consumption Ci of the composite good, where Ci is a scalar and Xi and Si are vectors which are composed of one element for each time period and for each contingency. A natural way to consume the good would be to absorb the own production. Yet, the agent may have two more option, namely, she might get a social transfer from other agents or she could use an income from trading water securities with her contiguous neighbors. To study these options, we compare water allocations (Ci, Xi, Si) all i=1,2,...,I for three different settings. We look at allocations without water securitization (water autarky equilibrium EA) first. Next, we describe the imaginary case of full securitization (contingent water markets equilibrium ECM) and, in between, we study limited securitization (incomplete water security equilibrium EWS). We show that allocations under contingent water markets ECM are efficient in the sense that, for the prevailing production technologies, no other allocation exists that is at

  16. Training-Specific Neural Plasticity in Spinal Reflexes after Incomplete Spinal Cord Injury

    PubMed Central

    Patrick, Susan K.; Roy, Francois D.; Gorassini, Monica A.

    2016-01-01

    The neural plasticity of spinal reflexes after two contrasting forms of walking training was determined in individuals with chronic, motor-incomplete spinal cord injury (SCI). Endurance Training involved treadmill walking for as long as possible, and Precision Training involved walking precisely over obstacles and onto targets overground. Twenty participants started either Endurance or Precision Training for 2 months and then crossed over after a 2-month rest period to the other form of training for 2 months. Measures were taken before and after each phase of training and rest. The cutaneomuscular reflex (CMR) during walking was evoked in the soleus (SOL) and tibialis anterior muscles by stimulating the posterior tibial nerve at the ankle. Clonus was estimated from the EMG power in the SOL during unperturbed walking. The inhibitory component of the SOL CMR was enhanced after Endurance but not Precision Training. Clonus did not change after either form of training. Participants with lower reflex excitability tended to be better walkers (i.e., faster walking speeds) prior to training, and the reduction in clonus was significantly correlated with the improvement in walking speed and distance. Thus, reflex excitability responded in a training-specific way, with the reduction in reflex excitability related to improvements in walking function. Trial registration number is NCT01765153. PMID:27725887

  17. Autonomous DNA-Molecule Computing

    NASA Astrophysics Data System (ADS)

    Komiya, Ken; Rose, John A.; Yamamura, Masayuki

    DNA molecules autonomously change their forms from the single strand to the double helix by specific binding between complementary sequences according to the Watson-Crick base pairing rule. This paring rule allows us to control connections among molecules and to construct various structures by sequence design. Further, the motion of constructed structures can also be designed by considering sequential bindings. Recently, the feasibility to utilize the programmed DNA structural change for information processing was studied. In the present paper, we report an efficient synthetic chain reaction based on autonomous binding of DNA to realize a computing system, which enable us to implement computational intelligence in vitro.

  18. Axonal and dendritic density field estimation from incomplete single-slice neuronal reconstructions

    PubMed Central

    van Pelt, Jaap; van Ooyen, Arjen; Uylings, Harry B. M.

    2014-01-01

    Neuronal information processing in cortical networks critically depends on the organization of synaptic connectivity. Synaptic connections can form when axons and dendrites come in close proximity of each other. The spatial innervation of neuronal arborizations can be described by their axonal and dendritic density fields. Recently we showed that potential locations of synapses between neurons can be estimated from their overlapping axonal and dendritic density fields. However, deriving density fields from single-slice neuronal reconstructions is hampered by incompleteness because of cut branches. Here, we describe a method for recovering the lost axonal and dendritic mass. This so-called completion method is based on an estimation of the mass inside the slice and an extrapolation to the space outside the slice, assuming axial symmetry in the mass distribution. We validated the method using a set of neurons generated with our NETMORPH simulator. The model-generated neurons were artificially sliced and subsequently recovered by the completion method. Depending on slice thickness and arbor extent, branches that have lost their outside parents (orphan branches) may occur inside the slice. Not connected anymore to the contiguous structure of the sliced neuron, orphan branches result in an underestimation of neurite mass. For 300 μm thick slices, however, the validation showed a full recovery of dendritic and an almost full recovery of axonal mass. The completion method was applied to three experimental data sets of reconstructed rat cortical L2/3 pyramidal neurons. The results showed that in 300 μm thick slices intracortical axons lost about 50% and dendrites about 16% of their mass. The completion method can be applied to single-slice reconstructions as long as axial symmetry can be assumed in the mass distribution. This opens up the possibility of using incomplete neuronal reconstructions from open-access data bases to determine population mean mass density fields

  19. The effect of H2O gas on volatilities of planet-forming major elements. I - Experimental determination of thermodynamic properties of Ca-, Al-, and Si-hydroxide gas molecules and its application to the solar nebula

    NASA Technical Reports Server (NTRS)

    Hashimoto, Akihiko

    1992-01-01

    The vapor pressures of Ca(OH)2(g), Al(OH)3(g), and Si(OH)4(g) molecules in equilibrium with solid calcium-, aluminum, and silicon-oxides, respectively, were determined, and were used to derive the heats of formation and entropies of these species, which are expected to be abundant under the currently postulated physical conditions in the primordial solar nebula. These data, in conjunction with thermodynamic data from literature, were used to calculate the relative abundances of M, MO(x), and M(OH)n gas species and relative volatilities of Fe, Mg, Si, Ca, and Al for ranges of temperature, total pressure, and H/O abundance ratio corresponding to the plausible ranges of physical conditions in the solar nebula. The results are used to explain how Ca and Al could have evaporated from Ca,Al-rich inclusions in carbonaceous chondrites, while Si, Mg, and Fe condensed onto them during the preaccretion alteration of CAIs.

  20. Single molecule spectroscopic characterization of a far-red fluorescent protein (HcRed) from the Anthozoa coral Heteractis crispa

    NASA Astrophysics Data System (ADS)

    Cotlet, Mircea; Habuchi, Satoshi; Whitier, Jennifer E.; Werner, James H.; De Schryver, Frans C.; Hofkens, Johan; Goodwin, Peter M.

    2006-02-01

    We report on the photophysical properties of a far-red intrinsic fluorescent protein by means of single molecule and ensemble spectroscopic methods. The green fluorescent protein (GFP) from Aequorea victoria is a popular fluorescent marker with genetically encoded fluorescence and which can be fused to any biological structure without affecting its function. GFP and its variants provide emission colors from blue to yellowish green. Red intrinsic fluorescent proteins from Anthozoa species represent a recent addition to the emission color palette provided by GFPs. Red intrinsic fluorescent markers are on high demand in protein-protein interaction studies based on fluorescence-resonance energy transfer or in multicolor tracking studies or in cellular investigations where autofluorescence possesses a problem. Here we address the photophysical properties of a far-red fluorescent protein (HcRed), a mutant engineered from a chromoprotein cloned from the sea anemone Heteractis crispa, by using a combination of ensemble and single molecule spectroscopic methods. We show evidence for the presence of HcRed protein as an oligomer and for incomplete maturation of its chromophore. Incomplete maturation results in the presence of an immature (yellow) species absorbing/fluorescing at 490/530-nm. This yellow chromophore is involved in a fast resonance-energy transfer with the mature (purple) chromophore. The mature chromophore of HcRed is found to adopt two conformations, a Transoriented form absorbing and 565-nm and non-fluorescent in solution and a Cis-oriented form absorbing at 590-nm and emitting at 645-nm. These two forms co-exist in solution in thermal equilibrium. Excitation-power dependence fluorescence correlation spectroscopy of HcRed shows evidence for singlet-triplet transitions in the microseconds time scale and for cis-trans isomerization occurring in a time scale of tens of microseconds. Single molecule fluorescence data recorded from immobilized HcRed proteins, all

  1. Learning with incomplete information in the committee machine.

    PubMed

    Bergmann, Urs M; Kühn, Reimer; Stamatescu, Ion-Olimpiu

    2009-12-01

    We study the problem of learning with incomplete information in a student-teacher setup for the committee machine. The learning algorithm combines unsupervised Hebbian learning of a series of associations with a delayed reinforcement step, in which the set of previously learnt associations is partly and indiscriminately unlearnt, to an extent that depends on the success rate of the student on these previously learnt associations. The relevant learning parameter lambda represents the strength of Hebbian learning. A coarse-grained analysis of the system yields a set of differential equations for overlaps of student and teacher weight vectors, whose solutions provide a complete description of the learning behavior. It reveals complicated dynamics showing that perfect generalization can be obtained if the learning parameter exceeds a threshold lambda ( c ), and if the initial value of the overlap between student and teacher weights is non-zero. In case of convergence, the generalization error exhibits a power law decay as a function of the number of examples used in training, with an exponent that depends on the parameter lambda. An investigation of the system flow in a subspace with broken permutation symmetry between hidden units reveals a bifurcation point lambda* above which perfect generalization does not depend on initial conditions. Finally, we demonstrate that cases of a complexity mismatch between student and teacher are optimally resolved in the sense that an over-complex student can emulate a less complex teacher rule, while an under-complex student reaches a state which realizes the minimal generalization error compatible with the complexity mismatch.

  2. Potential associations between chronic whiplash and incomplete spinal cord injury

    PubMed Central

    Smith, AC; Parrish, TB; Hoggarth, MA; McPherson, JG; Tysseling, VM; Wasielewski, M; Kim, HE; Hornby, TG; Elliott, JM

    2015-01-01

    Study Design: This research utilized a cross-sectional design with control group inclusion. Objectives: Preliminary evidence suggests that a portion of the patient population with chronic whiplash may have sustained spinal cord damage. Our hypothesis is that in some cases of chronic whiplash-associated disorders (WAD), observed muscle weakness in the legs will be associated with local signs of a partial spinal cord injury of the cervical spine. Setting: University based laboratory in Chicago, IL, USA. Methods: Five participants with chronic WAD were compared with five gender/age/height/weight/body mass index (BMI) control participants. For a secondary investigation, the chronic WAD group was compared with five unmatched participants with motor incomplete spinal cord injury (iSCI). Spinal cord motor tract integrity was assessed using magnetization transfer imaging. Muscle fat infiltration (MFI) was quantified using fat/water separation magnetic resonance imaging. Central volitional muscle activation of the plantarflexors was assessed using a burst superimposition technique. Results: We found reduced spinal cord motor tract integrity, increased MFI of the neck and lower extremity muscles and significantly impaired voluntary plantarflexor muscle activation in five participants with chronic WAD. The lower extremity structural changes and volitional weakness in chronic WAD were comparable to participants with iSCI. Conclusion: The results support the position that a subset of the chronic whiplash population may have sustained partial damage to the spinal cord. Sponsorship: NIH R01HD079076-01A1, NIH T32 HD057845 and the Foundation for Physical Therapy Promotion of Doctoral Studies program. PMID:27630770

  3. Exploring Massive Incomplete Lineage Sorting in Arctoids (Laurasiatheria, Carnivora).

    PubMed

    Doronina, Liliya; Churakov, Gennady; Shi, Jingjing; Brosius, Jürgen; Baertsch, Robert; Clawson, Hiram; Schmitz, Jürgen

    2015-12-01

    Freed from the competition of large raptors, Paleocene carnivores could expand their newly acquired habitats in search of prey. Such changing conditions might have led to their successful distribution and rapid radiation. Today, molecular evolutionary biologists are faced, however, with the consequences of such accelerated adaptive radiations, because they led to sequential speciation more rapidly than phylogenetic markers could be fixed. The repercussions being that current genealogies based on such markers are incongruent with species trees.Our aim was to explore such conflicting phylogenetic zones of evolution during the early arctoid radiation, especially to distinguish diagnostic from misleading phylogenetic signals, and to examine other carnivore-related speciation events. We applied a combination of high-throughput computational strategies to screen carnivore and related genomes in silico for randomly inserted retroposed elements that we then used to identify inconsistent phylogenetic patterns in the Arctoidea group, which is well known for phylogenetic discordances.Our combined retrophylogenomic and in vitro wet lab approach detected hundreds of carnivore-specific insertions, many of them confirming well-established splits or identifying and solving conflicting species distributions. Our systematic genome-wide screens for Long INterspersed Elements detected homoplasy-free markers with insertion-specific truncation points that we used to distinguish phylogenetically informative markers from conflicting signals. The results were independently confirmed by phylogenetic diagnostic Short INterspersed Elements. As statistical analysis ruled out ancestral hybridization, these doubly verified but still conflicting patterns were statistically determined to be genomic remnants from a time of ancestral incomplete lineage sorting that especially accompanied large parts of Arctoidea evolution.

  4. Multiple imputation for an incomplete covariate that is a ratio.

    PubMed

    Morris, Tim P; White, Ian R; Royston, Patrick; Seaman, Shaun R; Wood, Angela M

    2014-01-15

    We are concerned with multiple imputation of the ratio of two variables, which is to be used as a covariate in a regression analysis. If the numerator and denominator are not missing simultaneously, it seems sensible to make use of the observed variable in the imputation model. One such strategy is to impute missing values for the numerator and denominator, or the log-transformed numerator and denominator, and then calculate the ratio of interest; we call this 'passive' imputation. Alternatively, missing ratio values might be imputed directly, with or without the numerator and/or the denominator in the imputation model; we call this 'active' imputation. In two motivating datasets, one involving body mass index as a covariate and the other involving the ratio of total to high-density lipoprotein cholesterol, we assess the sensitivity of results to the choice of imputation model and, as an alternative, explore fully Bayesian joint models for the outcome and incomplete ratio. Fully Bayesian approaches using Winbugs were unusable in both datasets because of computational problems. In our first dataset, multiple imputation results are similar regardless of the imputation model; in the second, results are sensitive to the choice of imputation model. Sensitivity depends strongly on the coefficient of variation of the ratio's denominator. A simulation study demonstrates that passive imputation without transformation is risky because it can lead to downward bias when the coefficient of variation of the ratio's denominator is larger than about 0.1. Active imputation or passive imputation after log-transformation is preferable.

  5. Accounting for Incomplete Species Detection in Fish Community Monitoring

    SciTech Connect

    McManamay, Ryan A; Orth, Dr. Donald J; Jager, Yetta

    2013-01-01

    Riverine fish assemblages are heterogeneous and very difficult to characterize with a one-size-fits-all approach to sampling. Furthermore, detecting changes in fish assemblages over time requires accounting for variation in sampling designs. We present a modeling approach that permits heterogeneous sampling by accounting for site and sampling covariates (including method) in a model-based framework for estimation (versus a sampling-based framework). We snorkeled during three surveys and electrofished during a single survey in suite of delineated habitats stratified by reach types. We developed single-species occupancy models to determine covariates influencing patch occupancy and species detection probabilities whereas community occupancy models estimated species richness in light of incomplete detections. For most species, information-theoretic criteria showed higher support for models that included patch size and reach as covariates of occupancy. In addition, models including patch size and sampling method as covariates of detection probabilities also had higher support. Detection probability estimates for snorkeling surveys were higher for larger non-benthic species whereas electrofishing was more effective at detecting smaller benthic species. The number of sites and sampling occasions required to accurately estimate occupancy varied among fish species. For rare benthic species, our results suggested that higher number of occasions, and especially the addition of electrofishing, may be required to improve detection probabilities and obtain accurate occupancy estimates. Community models suggested that richness was 41% higher than the number of species actually observed and the addition of an electrofishing survey increased estimated richness by 13%. These results can be useful to future fish assemblage monitoring efforts by informing sampling designs, such as site selection (e.g. stratifying based on patch size) and determining effort required (e.g. number of

  6. Structural Analysis of H2-Db Class I Molecules Containing Two Different Allelic Forms of the type 1 Diabetes Susceptibility Factor beta-2 Microglobulin: Implications for the Mechanism Underlying Viriations in Antigen Presentation

    SciTech Connect

    Roden,M.; Brims, D.; Fedorov, A.; DiLorenzo, T.; Almo, S.; Nathenson, s.; Anovitz, L.; Wesolowski, D.

    2006-01-01

    Beta-2 microglobulin ({beta}2m) is a member of the immunoglobulin-like domain superfamily that is an essential structural subunit of the MHC class I (MHC-I) molecule. {beta}2m was previously identified as a susceptibility factor for the development of type 1 diabetes (T1D) in NOD mice, whereby transgenic expression of the {beta}2m{sup a} variant, but not the {beta}2mb variant, restored diabetes susceptibility to normally resistant NOD.{beta}2m{sup null} mice. Here we report the crystal structures and thermodynamic stabilities of the NOD MHC-I molecule H2-D{sup b} containing these two variants. Our results reveal subtle differences in the structures of the {beta}2m variants, namely in minor loop shifts and in variations in the hydrogen bonding networks at the interfaces between the components of the ternary complex. We also demonstrate that the thermodynamic stabilities of the {beta}2m variants in isolation differ. However, the conformation of the peptide in the MHC cleft is unchanged in {beta}2m allelic Db complexes, as are the TCR recognition surfaces. Thus, despite modest structural differences between allelic complexes, the evidence indicates that D{sup b} peptide presentation of the representative peptide is unchanged in the context of either {beta}2m allelic variant. These data suggest that other mechanisms, such as differential association of MHC-I in multiprotein complexes, are likely responsible for the effect of {beta}2m on T1D development.

  7. 43 CFR 30.113 - What will OHA do if it receives an incomplete probate file?

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... incomplete probate file? 30.113 Section 30.113 Public Lands: Interior Office of the Secretary of the Interior INDIAN PROBATE HEARINGS PROCEDURES Commencement of Probate Proceedings § 30.113 What will OHA do if it receives an incomplete probate file? If OHA determines that the probate file received from the agency...

  8. 43 CFR 30.113 - What will OHA do if it receives an incomplete probate file?

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... incomplete probate file? 30.113 Section 30.113 Public Lands: Interior Office of the Secretary of the Interior INDIAN PROBATE HEARINGS PROCEDURES Commencement of Probate Proceedings § 30.113 What will OHA do if it receives an incomplete probate file? If OHA determines that the probate file received from the agency...

  9. 43 CFR 30.113 - What will OHA do if it receives an incomplete probate file?

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... incomplete probate file? 30.113 Section 30.113 Public Lands: Interior Office of the Secretary of the Interior INDIAN PROBATE HEARINGS PROCEDURES Commencement of Probate Proceedings § 30.113 What will OHA do if it receives an incomplete probate file? If OHA determines that the probate file received from the agency...

  10. 43 CFR 30.113 - What will OHA do if it receives an incomplete probate file?

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... incomplete probate file? 30.113 Section 30.113 Public Lands: Interior Office of the Secretary of the Interior INDIAN PROBATE HEARINGS PROCEDURES Commencement of Probate Proceedings § 30.113 What will OHA do if it receives an incomplete probate file? If OHA determines that the probate file received from the agency...

  11. 43 CFR 30.113 - What will OHA do if it receives an incomplete probate file?

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... incomplete probate file? 30.113 Section 30.113 Public Lands: Interior Office of the Secretary of the Interior INDIAN PROBATE HEARINGS PROCEDURES Commencement of Probate Proceedings § 30.113 What will OHA do if it receives an incomplete probate file? If OHA determines that the probate file received from the agency...

  12. Do You See What I See? Infants' Reasoning about Others' Incomplete Perceptions

    ERIC Educational Resources Information Center

    Luo, Yuyan; Beck, Whitney

    2010-01-01

    Twelve-month-olds realize that when an agent cannot see an object, her incomplete perceptions still guide her goal-directed actions. What would happen if the agent had incomplete perceptions because she could see only one part of the object, for example one side of a screen? In the present research, 16-month-olds were first shown an agent who…

  13. On Testing the Equality of Proportions in the Paired Case with Incomplete Data.

    ERIC Educational Resources Information Center

    Ekbohm, Gunnar

    1982-01-01

    The problem of testing two correlated proportions with incomplete data is considered by means of Monte Carlo simulations studies. A test proposed in this paper, which can be regarded as a generalization of McNemar's test, is recommended in all cases with incomplete data and not too small samples. (Author)

  14. 36 CFR 223.230 - Bid restriction on resale of incomplete contracts, permits, or other instruments.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... § 223.230 Bid restriction on resale of incomplete contracts, permits, or other instruments. In any... 36 Parks, Forests, and Public Property 2 2014-07-01 2014-07-01 false Bid restriction on resale of incomplete contracts, permits, or other instruments. 223.230 Section 223.230 Parks, Forests, and...

  15. 36 CFR 223.230 - Bid restriction on resale of incomplete contracts, permits, or other instruments.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... § 223.230 Bid restriction on resale of incomplete contracts, permits, or other instruments. In any... 36 Parks, Forests, and Public Property 2 2012-07-01 2012-07-01 false Bid restriction on resale of incomplete contracts, permits, or other instruments. 223.230 Section 223.230 Parks, Forests, and...

  16. 36 CFR 223.230 - Bid restriction on resale of incomplete contracts, permits, or other instruments.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... Special Forest Products Advertisement and Bids § 223.230 Bid restriction on resale of incomplete contracts... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bid restriction on resale of incomplete contracts, permits, or other instruments. 223.230 Section 223.230 Parks, Forests, and...

  17. Transport of some strong incompletely dissociated acids through anion-exchange membrane.

    PubMed

    Palatý, Zdenek; Záková, Alena

    2003-12-01

    Nitric and sulfuric acids belong among strong incompletely dissociated acids, so that in the description of their transport through an ion-exchange membrane, ionic equilibria have to be taken into account. The paper presents the determination of ionic mobilities and diffusivity of nondissociated form of these acids. For that purpose, data on the dialysis experiments with nitric and sulfuric acids in a batch mixed cell with an anion-exchange membrane NEOSEPTA-AFN, which have been completed by those on the membrane conductivity, have been used. The dependencies of the ionic mobilities and the diffusivity of nondissociated form of nitric acid upon the acid concentration in the membrane have been approximated by second degree polynomials. Their coefficients have been determined by numerical integration of the partial differential equation describing the concentration fields of the acids in the membrane and liquid films on both sides of the membrane, followed by an optimizing procedure. The model used is based on the Nernst-Planck electrodiffusion equation. Using all the experimental data obtained at various acid concentrations and rotational speeds of the stirrers, it has been found that ionic mobility is strongly affected by the acid concentration in the membrane and decreases in the series H(3)O(+), SO(2-)(4), NO(-)(3), HSO(-)(4).

  18. Second virial coefficients for chain molecules

    SciTech Connect

    Bokis, C.P.; Donohue, M.D. . Dept. of Chemical Engineering); Hall, C.K. . Dept. of Chemical Engineering)

    1994-01-01

    The importance of having accurate second virial coefficients in phase equilibrium calculations, especially for the calculation of dew points, is discussed. The square-well potentials results in a simple but inaccurate equation for the second virial coefficient for small, spherical molecules such as argon. Here, the authors present a new equation for the second virial coefficient of both spherical molecules and chain molecules which is written in a form similar to that for the square-well potential. This new equation is accurate in comparison to Monte Carlo simulation data on second virial coefficients for square-well chain molecules and with second virial coefficients obtained from experiments on n-alkanes.

  19. Production and Trapping of Ultracold Polar Molecules

    SciTech Connect

    David, DeMille

    2015-04-21

    We report a set of experiments aimed at the production and trapping of ultracold polar molecules. We begin with samples of laser-cooled and trapped Rb and Cs atoms, and bind them together to form polar RbCs molecules. The binding is accomplished via photoassociation, which uses a laser to catalyze the sticking process. We report results from investigation of a new pathway for photoassociation that can produce molecules in their absolute ground state of vibrational and rotational motion. We also report preliminary observations of collisions between these ground-state molecules and co-trapped atoms.

  20. The Arrangement of Information in DNA Molecules

    PubMed Central

    Thomas, Charles A.

    1966-01-01

    The anatomy of DNA molecules isolated from mature bacteriophage is reviewed. These molecules are linear, duplex DNA consisting mainly of uninterrupted polynucleotide chains. Certain phage (T5 and PB) contain four specifically located interruptions. While the nucleotide sequence of most of these molecules is unique (T5, T3, T7, λ), some are circular permutations of each other (T2, T4, P22). Partial degradation of these DNA molecules by exonuclease III predisposes some of them to form circles upon annealing, but indicating they are terminally redundant. PMID:5967428

  1. Giant molecules composed of polar molecules and atoms in mixed dimensions

    NASA Astrophysics Data System (ADS)

    Qi, Ran; Tan, Shina

    2014-05-01

    Two or three polar molecules, confined to one or two dimensions, can form stable bound states with a single atom living in three dimensions, if the molecule and the atom can interact resonantly such that their mixed dimensional scattering length is large. We call these bound states ``giant molecules'' since it's a molecule composed of smaller molecules and atoms. We study their properties using techniques including exact numerical solution, exact qunatum diffusion Monte Carlo (QMC), Born-Oppenheimer approximation (BOA), and semiclassical approximation. These bound states have a hierarchical structure reminiscent of the celestial systems.

  2. An Incomplete-Data Quasi-likelihood Approach to Haplotype-Based Genetic Association Studies on Related Individuals.

    PubMed

    Wang, Zuoheng; McPeek, Mary Sara

    2009-09-01

    We propose an incomplete-data, quasi-likelihood framework, for estimation and score tests, which accommodates both dependent and partially-observed data. The motivation comes from genetic association studies, where we address the problems of estimating haplotype frequencies and testing association between a disease and haplotypes of multiple tightly-linked genetic markers, using case-control samples containing related individuals. We consider a more general setting in which the complete data are dependent with marginal distributions following a generalized linear model. We form a vector Z whose elements are conditional expectations of the elements of the complete-data vector, given selected functions of the incomplete data. Assuming that the covariance matrix of Z is available, we form an optimal linear estimating function based on Z, which we solve by an iterative method. This approach addresses key difficulties in the haplotype frequency estimation and testing problems in related individuals: (1) dependence that is known but can be complicated; (2) data that are incomplete for structural reasons, as well as possibly missing, with different amounts of information for different observations; (3) the need for computational speed in order to analyze large numbers of markers; (4) a well-established null model, but an alternative model that is unknown and is problematic to fully specify in related individuals. For haplotype analysis, we give sufficient conditions for consistency and asymptotic normality of the estimator and asymptotic χ(2) null distribution of the score test. We apply the method to test for association of haplotypes with alcoholism in the GAW 14 COGA data set.

  3. Influence of incomplete fusion on complete fusion: Observation of a large incomplete fusion fraction at E {approx_equal}5-7 MeV/nucleon

    SciTech Connect

    Singh, Pushpendra P.; Singh, B. P.; Sharma, Manoj Kumar; Unnati,; Singh, Devendra P.; Prasad, R.; Kumar, Rakesh; Golda, K. S.

    2008-01-15

    Experiments have been carried out to explore the reaction dynamics leading to incomplete fusion of heavy ions at moderate excitation energies. Excitation functions for {sup 168}Lu{sup m}, {sup 167}Lu, {sup 167}Yb, {sup 166}Tm, {sup 179}Re, {sup 177}Re, {sup 177}W, {sup 178}Ta, and {sup 177}Hf radio-nuclides populated via complete and/or incomplete fusion of {sup 16}O with {sup 159}Tb and {sup 169}Tm have been studied over the wide projectile energy range E{sub proj}{approx_equal}75-95 MeV. Recoil-catcher technique followed by off-line {gamma}-spectrometry has been employed in the present measurements. Experimental data have been compared with the predictions of theoretical model code PACE2. The experimentally measured production cross sections of {alpha}-emitting channels were found to be larger as compared to the theoretical model predictions and may be attributed to incomplete fusion at these energies. During the analysis of experimental data, incomplete fusion has been found to be competing with complete fusion. As such, an attempt has been made to estimate the incomplete fusion fraction for both the systems, and has been found to be sensitive for projectile energy and mass asymmetry of interacting partners.

  4. Medical treatments for incomplete miscarriage (less than 24 weeks)

    PubMed Central

    Neilson, James P; Gyte, Gillian ML; Hickey, Martha; Vazquez, Juan C; Dou, Lixia

    2014-01-01

    Background Miscarriage occurs in 10% to 15% of pregnancies. The traditional treatment, after miscarriage, has been to perform surgery to remove any remaining pregnancy tissues in the uterus. However, it has been suggested that drug-based medical treatments, or expectant care (no treatment), may also be effective, safe and acceptable. Objectives To assess the effectiveness, safety and acceptability of any medical treatment for early incomplete miscarriage (before 24 weeks). Search methods We searched the Cochrane Pregnancy and Childbirth Group’s Trials Register (September 2009) and reference lists of retrieved papers. We updated this search on 23 July 2012 and added the results to the awaiting classification section of the review. Selection criteria Randomised controlled trials comparing medical treatment with expectant care or surgery. Quasi-randomised trials were excluded. Data collection and analysis Two authors independently assessed the studies for inclusion, assessed risk of bias and carried out data extraction. Data entry was checked. Main results Fifteen studies (2750 women) were included, there were no studies on women over 13 weeks’ gestation. Studies addressed a number of comparisons and data are therefore limited. Three trials compared misoprostol treatment (all vaginally administered) with expectant care. There was no significant difference in complete miscarriage (average risk ratio (RR) 1.23, 95% confidence interval (CI) 0.72 to 2.10; two studies, 150 women), or in the need for surgical evacuation (average RR 0.62, 95% CI 0.17 to 2.26; two studies, 308 women). There were few data on ‘deaths or serious complications’. Nine studies involving 1766 women addressed the comparison of misoprostol (four oral, four vaginal, one vaginal + oral) with surgical evacuation. There was no statistically significant difference in complete miscarriage (average RR 0.96, 95% CI 0.92 to 1.00, eight studies, 1377 women) with success rate high for both methods

  5. Atmospheric trace molecule spectroscopy

    NASA Technical Reports Server (NTRS)

    Farmer, C. B.

    1982-01-01

    The Spacelab investigation entitled Atmospheric Trace Molecule Spectroscopy (ATMOS) is designed to obtain fundamental information related to the chemistry and physics of the Earth's upper atmosphere using the techniques of infrared absorption spectroscopy. There are two principal objectives to be met. The first is the determination, on a global scale, of the compositional structure of the upper atmosphere and its spatial variability. The establishment of this variability represents the first step toward determining the characteristic residence times for the upper atmospheric constituents; the magnitudes of their sources and sinks; and, ultimately, an understanding of their effects on the stability of the stratosphere. The second objective is to provide the high-resolution, calibrated spectral information which is essential for the detailed design of advanced instrumentation for subsequent global monitoring of specific species found to be critical to atmospheric stability. This information will be disseminated in the form of a three dimensional atlas of solar absorption spectra obtained over a range of latitudes, longitudes, and altitudes.

  6. Estimation from incomplete multinomial data. Ph.D. Thesis - Harvard Univ.

    NASA Technical Reports Server (NTRS)

    Credeur, K. R.

    1978-01-01

    The vector of multinomial cell probabilities was estimated from incomplete data, incomplete in that it contains partially classified observations. Each such partially classified observation was observed to fall in one of two or more selected categories but was not classified further into a single category. The data were assumed to be incomplete at random. The estimation criterion was minimization of risk for quadratic loss. The estimators were the classical maximum likelihood estimate, the Bayesian posterior mode, and the posterior mean. An approximation was developed for the posterior mean. The Dirichlet, the conjugate prior for the multinomial distribution, was assumed for the prior distribution.

  7. Isomer ratio measurements as a probe of the dynamics of breakup and incomplete fusion

    SciTech Connect

    Gasques, L. R.; Dasgupta, M.; Hinde, D. J.; Peatey, T.; Diaz-Torres, A.; Newton, J. O.

    2006-12-15

    The incomplete fusion mechanism following breakup of {sup 6,7}Li and {sup 9}Be projectiles incident on targets of {sup 209}Bi and {sup 208}Pb is investigated through isomer ratio measurements for the {sup 212}At and {sup 211}Po products. The phenomenological analysis presented in this paper indicates that incomplete fusion brings relatively more angular momentum into the system than equivalent reactions with a direct beam of the fused fragment. This is attributed to the trajectories of breakup fragments. Calculations with a 3D classical trajectory model support this. Isomer ratio measurements for incomplete fusion reactions can provide a test of new theoretical models of breakup and fusion.

  8. Physically sound parameterization of incomplete ionization in aluminum-doped silicon

    NASA Astrophysics Data System (ADS)

    Steinkemper, Heiko; Altermatt, Pietro P.; Hermle, Martin

    2016-12-01

    Incomplete ionization is an important issue when modeling silicon devices featuring aluminum-doped p+ (Al-p+) regions. Aluminum has a rather deep state in the band gap compared to boron or phosphorus, causing strong incomplete ionization. In this paper, we considerably improve our recent parameterization [Steinkemper et al., J. Appl. Phys. 117, 074504 (2015)]. On the one hand, we found a fundamental criterion to further reduce the number of free parameters in our fitting procedure. And on the other hand, we address a mistake in the original publication of the incomplete ionization formalism in Altermatt et al., J. Appl. Phys. 100, 113715 (2006).

  9. [Endothelial cell adhesion molecules].

    PubMed

    Ivanov, A N; Norkin, I A; Puchin'ian, D M; Shirokov, V Iu; Zhdanova, O Iu

    2014-01-01

    The review presents current data concerning the functional role of endothelial cell adhesion molecules belonging to different structural families: integrins, selectins, cadherins, and the immunoglobulin super-family. In this manuscript the regulatory mechanisms and factors of adhesion molecules expression and distribution on the surface of endothelial cells are discussed. The data presented reveal the importance of adhesion molecules in the regulation of structural and functional state of endothelial cells in normal conditions and in pathology. Particular attention is paid to the importance of these molecules in the processes of physiological and pathological angiogenesis, regulation of permeability of the endothelial barrier and cell transmigration.

  10. Molecular forms of peptide histidine isoleucine-like immunoreactivity in the gastrointestinal tract. Nonequimolar levels of peptide histidine isoleucine and vasoactive intestinal peptide in the stomach explained by the presence of a big peptide histidine isoleucine-like molecule.

    PubMed

    Yiangou, Y; Christofides, N D; Blank, M A; Yanaihara, N; Tatemoto, K; Bishop, A E; Polak, J M; Bloom, S R

    1985-09-01

    Regional specific antibodies and chromatography were used to analyze the distributions and molecular forms of peptide histidine isoleucine (PHI) and vasoactive intestinal peptide (VIP) in the porcine intestine. Both peptides were present along the entire length of the intestine, the highest concentrations occurring in the colon. Concentrations of PHI immunoreactivity, measured with three different antisera, and VIP immunoreactivity were approximately equal in all parts of the gastrointestinal tract except in the stomach. In the stomach, the concentration of PHI immunoreactivity, measured with the N-terminally directed antibody R8403, although equal to the corresponding VIP concentration, was two to four times higher than the PHI immunoreactivity detected with the two C-terminally directed PHI antisera T33 and T41. Chromatographic analysis on Sephadex G-50 superfine of gastric extracts revealed only one VIP immunoreactive peak that eluted in the same position as the porcine VIP standard, at Kav 0.53. A PHI immunoreactive peak was also detected with the C-terminally directed PHI antisera in the same position as porcine PHI standard. However, with the N-terminally directed PHI antiserum R8403, an additional PHI immunoreactive peak was detected in gastric extracts constituting the predominant form present, and this peak eluted earlier at Kav 0.37. The PHI immunoreactive material that eluted earlier was present in the rest of the intestine in only small amounts. As VIP and PHI are believed to be derived from a common precursor, it is suggested that in the stomach the posttranslational enzymic processing of the precursor is different from that in the other parts of the intestine.

  11. IRON-60 HETEROGENEITY AND INCOMPLETE ISOTOPE MIXING IN THE EARLY SOLAR SYSTEM

    SciTech Connect

    Quitte, Ghylaine; Markowski, Agnes; Latkoczy, Christopher; Gabriel, Aron; Pack, Andreas

    2010-09-10

    Short-lived radionuclides (e.g., {sup 26}Al, {sup 53}Mn, {sup 60}Fe, {sup 182}Hf) are widely used to refine the chronology of the early solar system. They provide chronological information, however, only if they were homogeneously distributed in the source region of the objects under scrutiny at the time of their formation. With the high level of precision now achieved on isotopic measurements, very short time intervals can in principle be resolved and a precise evaluation of the initial homogeneity degree becomes increasingly crucial. High-precision nickel isotope data for differentiated meteorites (angrites, ureilites) and chondritic (CB) components allow us to test the initial distribution of radioactive {sup 60}Fe and stable Ni isotopes. Although these meteorites appear to have formed nearly contemporaneously, they yield variable initial {sup 60}Fe/{sup 56}Fe ratios. Besides, the CB metal nodules and ureilite silicates show nucleosynthetic anomalies. The new data presented here do not confirm the recently inferred late injection of {sup 60}Fe into the protoplanetary disk. Instead, live {sup 60}Fe was present, but heterogeneously distributed, from the start of the solar system, revealing an incomplete mixing of material from various nucleosynthetic sources and restricting the use of the {sup 60}Fe-{sup 60}Ni system as a chronometer.

  12. Hybridization experiments indicate incomplete reproductive isolating mechanism between Fasciola hepatica and Fasciola gigantica.

    PubMed

    Itagaki, T; Ichinomiya, M; Fukuda, K; Fusyuku, S; Carmona, C

    2011-09-01

    Experiments on hybridization between Fasciola hepatica and Fasciola gigantica were carried out to clarify whether a reproductive isolating mechanism appears between the two Fasciola species. Molecular evidence for hybridization was based on the DNA sequence of the internal transcribed spacer 1 (ITS1) region in nuclear ribosomal DNA, which differs between the species. The results suggested that there were not pre-mating but post-mating isolating mechanisms between the two species. However, viable adults of the hybrids F1 and F2 were produced from both parental F. hepatica and F. gigantica. The hybrids inherited phenotypic characteristics such as ratio of body length and width and infectivity to rats from parental Fasciola hepatica and F. gigantica. These findings suggest that reproductive isolation is incomplete between Fasciola hepatica and F. gigantica. Adults of the hybrids F1 and F2 were completely different in mode of reproduction from aspermic Fasciola forms that occur in Asia and seem to be offspring originated from hybridization between F. hepatica and F. gigantica and to reproduce parthenogenetically.

  13. Transforming incomplete fault tree to Ishikawa diagram as an alternative method for technology transfer

    NASA Astrophysics Data System (ADS)

    Batzias, Dimitris F.

    2012-12-01

    Fault Tree Analysis (FTA) can be used for technology transfer when the relevant problem (called 'top even' in FTA) is solved in a technology centre and the results are diffused to interested parties (usually Small Medium Enterprises - SMEs) that have not the proper equipment and the required know-how to solve the problem by their own. Nevertheless, there is a significant drawback in this procedure: the information usually provided by the SMEs to the technology centre, about production conditions and corresponding quality characteristics of the product, and (sometimes) the relevant expertise in the Knowledge Base of this centre may be inadequate to form a complete fault tree. Since such cases are quite frequent in practice, we have developed a methodology for transforming incomplete fault tree to Ishikawa diagram, which is more flexible and less strict in establishing causal chains, because it uses a surface phenomenological level with a limited number of categories of faults. On the other hand, such an Ishikawa diagram can be extended to simulate a fault tree as relevant knowledge increases. An implementation of this transformation, referring to anodization of aluminium, is presented.

  14. Efficient Algorithms for Bayesian Network Parameter Learning from Incomplete Data

    DTIC Science & Technology

    2015-07-01

    theoretical analyses of missing data problems, which utilize a graphical representa- tion, called the missingness graph. In the case of MCAR and MAR ...missing at random assumption ( MAR ), but also for a broad class of data that is not MAR . Their analysis is based on a graphical representation for...data. For the cases of both MCAR and MAR data, where the missingness graph need not be explicit, we start by deriving the closed-form parameter

  15. Planning With Incomplete Knowledge for the Composition of Web Services

    DTIC Science & Technology

    2005-08-01

    tedious. Locating the services with required specifics and coordinating the flow between these sources is not an easy task. • B2B Applications The...composition is very important in B2B applications where online partnerships can automatically be formed without prior agreements. A business who wants to...be same each time due to repeatability assumption. One other thing to note is that, different from the Golog approach, we don’t allow the

  16. Layered Molecule-Based Magnets Formed by Decamethylmetallocenium Cations and Two-Dimensional Bimetallic Complexes [ MIIRu III(ox) 3] -( MII=;Mn, Fe, Co, Cu and Zn; ox=oxalate)

    NASA Astrophysics Data System (ADS)

    Coronado, Eugenio; Galán-Mascarós, José R.; Gómez-García, Carlos J.; Martínez-Agudo, José M.; Martínez-Ferrero, Eugenia; Waerenborgh, Joao C.; Almeida, Manuel

    2001-07-01

    A new series of hybrid organometallic-inorganic layered magnets with formula [ZIIICp*2] [MIIRuIII(ox)3] (ZIII=Co and Fe; MII=Mn, Fe, Co, Cu, and Zn; ox=oxalate: Cp*=pentamethylcyclopentadienyl) has been prepared. All of these compounds are isostructural to the previously reported [ZIIICp*2] [MIIMIII(ox)3] (MIII=Cr, Fe) series and crystallize in the monoclinic space group C2/m, as found by powder X-ray diffraction analysis. They are novel examples of magnetic materials formed by bimetallic oxalate-based extended layers separated by layers of organometallic cations. The magnetic properties of all these compounds have been investigated (ac and dc magnetic susceptibilities and field dependence of the isothermal magnetization at 2 K). In particular, it has been found that FeII and CoII derivatives behave as magnets with ordering temperatures of 12.8 and 2.8 K, respectively, while no long-range magnetic ordering has been detected down to 2 K in the MnII and CuII derivatives. The magnetic ordering in the FeII derivatives has been confirmed through Mössbauer spectroscopy. This technique has also made it possible to observe the spin polarization of the paramagnetic [FeCp*2]+ units caused by the internal magnetic field created by the bimetallic layers in the ordered state.

  17. Enzymatic DNA molecules

    NASA Technical Reports Server (NTRS)

    Joyce, Gerald F. (Inventor); Breaker, Ronald R. (Inventor)

    1998-01-01

    The present invention discloses deoxyribonucleic acid enzymes--catalytic or enzymatic DNA molecules--capable of cleaving nucleic acid sequences or molecules, particularly RNA, in a site-specific manner, as well as compositions including same. Methods of making and using the disclosed enzymes and compositions are also disclosed.

  18. Molecules between the Stars.

    ERIC Educational Resources Information Center

    Verschuur, Gerrit L.

    1987-01-01

    Provides a listing of molecules discovered to date in the vast interstellar clouds of dust and gas. Emphasizes the recent discoveries of organic molecules. Discusses molecular spectral lines, MASERs (microwave amplification by stimulated emission of radiation), molecular clouds, and star birth. (TW)

  19. EMISSIONS OF POLYCHLORINATED BIPHENYLS AS PRODUCTS OF INCOMPLETE COMBUSTION FROM INCINERATORS

    EPA Science Inventory

    The paper discusses emissions of polychlorinated biphenyls (PCBs) as products of incomplete combustion from incinerators. PCBs were used widely as industrial chemicals, particularly as additives in electrical transformer cooling oil. Growing evidence of PCBs' role as a persistent...

  20. Incomplete deployment of the Vena Tech LP filter--case series and concerns.

    PubMed

    Contractor, Sohail; Esmaeili, Azadeh; Reina, Diego; Deitch, Edwin

    2011-05-01

    The Vena Tech LP vena cava filter (B Braun, Evanston, Illinois) has been FDA approved since 2001 and is a permanent vena cava filtration device. It replaced the previous Vena tech LGM filter also manufactured by B Braun. The LGM filter had 2 case series reporting a high incidence of incomplete deployment of the filter, especially when placed from a jugular approach. Design changes were made to this device and the LP filter introduced. The LP filter has also been reported to have incompletely deployed both in peer reviewed literature as well as the FDA MAUDE website. We present here 3 cases of incomplete deployment of the Vena Tech LP filter and review the cases previously described as well as attempt to present possible etiologies for incomplete deployment.

  1. Porous organic molecules

    NASA Astrophysics Data System (ADS)

    Holst, James R.; Trewin, Abbie; Cooper, Andrew I.

    2010-11-01

    Most synthetic materials that show molecular-scale porosity consist of one-, two- or three-dimensional networks. Porous metal-organic frameworks in particular have attracted a lot of recent attention. By contrast, discrete molecules tend to pack efficiently in the solid state, leaving as little empty space as possible, which leads to non-porous materials. This Perspective discusses recent developments with discrete organic molecules that are porous in the solid state. Such molecules, which may be either crystalline or amorphous, can be categorized as either intrinsically porous (containing permanent covalent cavities) or extrinsically porous (inefficiently packed). We focus on the possible advantages of organic molecules over inorganic or hybrid systems in terms of molecular solubility, choice of components and functionalities, and structural mobility and responsiveness in non-covalent extended solids. We also highlight the potential for 'undiscovered' porous systems among the large number of cage-like organic molecules that are already known.

  2. Probing of Amyloid Aβ (14–23) Trimers by Single-Molecule Force Spectroscopy

    PubMed Central

    Maity, Sibaprasad; Lyubchenko, Yuri L.

    2016-01-01

    Self-assembly and aggregation of amyloid peptides, such as Aβ(1–40) and Aβ(1–42), lead to the development of Alzheimer disease and similar neurodegenerative disorders associated with protein aggregation. The structures of large aggregates, specifically fibrils, are well characterized. However, our understanding about the structure of oligomeric forms of amyloids is incomplete and needs to be expanded, particularly given the finding that oligomeric rather than fibrillar amyloid morphologies are neurotoxic. This lack of knowledge is primarily due to the existence of transient oligomeric forms that require the use of non-traditional approaches capable of probing transiently existing amyloid forms. We have recently developed the Single-Molecule Force Spectroscopy (SMFS) approach enabling us to probe dimeric forms of amyloids. These studies suggest that the assembly of amyloid proteins into dimers leads to extremely stabilized amyloids in non-native, misfolded states [1]. Herein, we applied the SMFS approach to probe amyloid trimers. We used the Aβ(14–23) segment of Aβ42 protein that is responsible for full-size protein aggregation. The dimerization of this peptide was recently characterized [2]. The dimeric form of Aβ (14–23) was assembled by the use of a tandem Aβ(14–23)-YNGK-Aβ(14–23), in which the YNGK motif between the two Aβ(14–23) monomers makes a β turn to form a hairpin loop with an antiparallel arrangement of Aβ(14–23) monomers[3]. The Aβ(14–23) monomer was tethered to the AFM tip, and trimers were formed by approaching the tip to the mica surface on which the Aβ(14–23)-YNGK-Aβ(14–23) dimer was immobilized via a polyethylene glycol tether. We identified trimers by rupture forces that were considerably larger than those for dimers. Models for the trimer assembly process are discussed.

  3. Conjugate and method for forming aminomethyl phosphorus conjugates

    DOEpatents

    Katti, Kattesh V.; Berning, Douglas E.; Volkert, Wynn A.; Ketring, Alan R.; Churchill, Robert

    1999-01-01

    A method of forming phosphine-amine conjugates includes reacting a hydroxymethyl phosphine group of an amine-free first molecule with at least one free amine group of a second molecule to covalently bond the first molecule with the second molecule through an aminomethyl phosphorus linkage and the conjugates formed thereby.

  4. Conjugate and method for forming aminomethyl phosphorus conjugates

    SciTech Connect

    Katti, K.V.; Berning, D.E.; Volkert, W.A.; Ketring, A.R.; Churchill, R.

    1999-09-07

    A method of forming phosphine-amine conjugates includes reacting a hydroxymethyl phosphine group of an amine-free first molecule with at least one free amine group of a second molecule to covalently bond the first molecule with the second molecule through an aminomethyl phosphorus linkage and the conjugates formed thereby.

  5. The incomplete inverse and its applications to the linear least squares problem

    NASA Technical Reports Server (NTRS)

    Morduch, G. E.

    1977-01-01

    A modified matrix product is explained, and it is shown that this product defiles a group whose inverse is called the incomplete inverse. It was proven that the incomplete inverse of an augmented normal matrix includes all the quantities associated with the least squares solution. An answer is provided to the problem that occurs when the data residuals are too large and when insufficient data to justify augmenting the model are available.

  6. Neither environmental enrichment nor voluntary wheel running enhances recovery from incomplete spinal cord injury in rats.

    PubMed

    Erschbamer, M K; Pham, T M; Zwart, M C; Baumans, V; Olson, L

    2006-09-01

    Environmental enrichment and exercise may be neuroprotective or promote recovery after different forms of CNS injury. Here, we tested the possible effects of moderate environmental enrichment and voluntary exercise on the outcome of incomplete spinal cord injury in rats. We provided rats in standard cages with basic environmental enrichment (carton house, nesting material, tube, gnawing sticks). We also analyzed the effect of increased activity by housing spinal-cord-injured rats in cages with or without access to running wheels. In a third experiment, we looked at the possible effect of pre-injury training. In all experiments, a battery of behavior tests were used. Enriched environment provided before, after or both before and after injury did not alter the outcome on any of these tests. Similarly, despite excessive running after injury, no differences in terms of recovery and behavior were found in the running experiment. Similarly, running prior to injury did not significantly decrease the degree of functional deficit caused by the injury. Since there were no effects of further enrichment, above the possible effects of being socially housed, and since exercise did not improve the outcome, we conclude that these forms of increased activity do not render the animals significantly less sensitive to spinal cord injury and do not cause robust improvement when initiated after injury. While these results pose a limit to how helpful environmental and physical training programs may be in rodent impact injury models, they do not contradict the fact that voluntary and guided training can be effective tools in human spinal cord rehabilitation.

  7. Cost-effectiveness of one- and two-step incomplete and complete excavations.

    PubMed

    Schwendicke, F; Stolpe, M; Meyer-Lueckel, H; Paris, S; Dörfer, C E

    2013-10-01

    The treatment of deep caries lesions carries significant risks for the integrity of the pulp and often initiates a cascade of re-interventions. Incomplete caries removal may reduce these risks and avoid or delay re-treatment. The present study analyzed the cost-effectiveness of one- and two-step incomplete as well as complete excavations. We used Markov models to simulate treatment of a molar tooth with a deep caries lesion in a 15-year-old patient. Retention of the tooth and its vitality as effectiveness measures as well as accruing costs were analyzed over the patient's lifetime. The model adopted a public-private-payer perspective within German health care. Transition probabilities were calculated based on literature reviews. Monte-Carlo microsimulations were performed with 6-month cycles. One-step incomplete excavation resulted in lower long-term costs and in longer-retained teeth and their vitality (means: 53.5 and 41.0 yrs) compared with two-step incomplete (52.5 and 37.5 yrs) and complete excavations (49.5 and 31.0 yrs), and dominated the other strategies in 70% to 100% of simulations. Regardless of the assumed willingness-to-pay ceiling value, one-step incomplete excavation had the highest probability of being cost-effective. Despite limited evidence levels of input data, we expect one-step incomplete excavation to reduce costs while retaining deeply carious teeth and their vitality for longer.

  8. Estimate of true incomplete exchanges using fluorescence in situ hybridization with telomere probes

    NASA Technical Reports Server (NTRS)

    Wu, H.; George, K.; Yang, T. C.

    1998-01-01

    PURPOSE: To study the frequency of true incomplete exchanges in radiation-induced chromosome aberrations. MATERIALS AND METHODS: Human lymphocytes were exposed to 2 Gy and 5 Gy of gamma-rays. Chromosome aberrations were studied using the fluorescence in situ hybridization (FISH) technique with whole chromosome-specific probes, together with human telomere probes. Chromosomes 2 and 4 were chosen in the present study. RESULTS: The percentage of incomplete exchanges was 27% when telomere signals were not considered. After excluding false incomplete exchanges identified by the telomere signals, the percentage of incomplete exchanges decreased to 11%. Since telomere signals appear on about 82% of the telomeres, the percentage of true incomplete exchanges should be even lower and was estimated to be 3%. This percentage was similar for chromosomes 2 and 4 and for doses of both 2 Gy and 5 Gy. CONCLUSIONS: The percentage of true incomplete exchanges is significantly lower in gamma-irradiated human lymphocytes than the frequencies reported in the literature.

  9. Superresolution Imaging using Single-Molecule Localization

    PubMed Central

    Patterson, George; Davidson, Michael; Manley, Suliana; Lippincott-Schwartz, Jennifer

    2013-01-01

    Superresolution imaging is a rapidly emerging new field of microscopy that dramatically improves the spatial resolution of light microscopy by over an order of magnitude (∼10–20-nm resolution), allowing biological processes to be described at the molecular scale. Here, we discuss a form of superresolution microscopy based on the controlled activation and sampling of sparse subsets of photoconvertible fluorescent molecules. In this single-molecule based imaging approach, a wide variety of probes have proved valuable, ranging from genetically encodable photoactivatable fluorescent proteins to photoswitchable cyanine dyes. These have been used in diverse applications of superresolution imaging: from three-dimensional, multicolor molecule localization to tracking of nanometric structures and molecules in living cells. Single-molecule-based superresolution imaging thus offers exciting possibilities for obtaining molecular-scale information on biological events occurring at variable timescales. PMID:20055680

  10. Chemical principles of single-molecule electronics

    NASA Astrophysics Data System (ADS)

    Su, Timothy A.; Neupane, Madhav; Steigerwald, Michael L.; Venkataraman, Latha; Nuckolls, Colin

    2016-03-01

    The field of single-molecule electronics harnesses expertise from engineering, physics and chemistry to realize circuit elements at the limit of miniaturization; it is a subfield of nanoelectronics in which the electronic components are single molecules. In this Review, we survey the field from a chemical perspective and discuss the structure-property relationships of the three components that form a single-molecule junction: the anchor, the electrode and the molecular bridge. The spatial orientation and electronic coupling between each component profoundly affect the conductance properties and functions of the single-molecule device. We describe the design principles of the anchor group, the influence of the electronic configuration of the electrode and the effect of manipulating the structure of the molecular backbone and of its substituent groups. We discuss single-molecule conductance switches as well as the phenomenon of quantum interference and then trace their fundamental roots back to chemical principles.

  11. Dynamics of Activated Molecules

    SciTech Connect

    Mullin, Amy S.

    2016-11-16

    Experimental studies have been performed to investigate the collisional energy transfer processes of gas-phase molecules that contain large amounts of internal energy. Such molecules are prototypes for molecules under high temperature conditions relevant in combustion and information about their energy transfer mechanisms is needed for a detailed understanding and modeling of the chemistry. We use high resolution transient IR absorption spectroscopy to measure the full, nascent product distributions for collisions of small bath molecules that relax highly vibrationally excited pyrazine molecules with E=38000 cm-1 of vibrational energy. To perform these studies, we developed new instrumentation based on modern IR light sources to expand our experimental capabilities to investigate new molecules as collision partners. This final report describes our research in four areas: the characterization of a new transient absorption spectrometer and the results of state-resolved collision studies of pyrazine(E) with HCl, methane and ammonia. Through this research we have gained fundamental new insights into the microscopic details of relatively large complex molecules at high energy as they undergo quenching collisions and redistribute their energy.

  12. Hepatic infarctions during pregnancy are associated with the antiphospholipid syndrome and in addition with complete or incomplete HELLP syndrome.

    PubMed

    Pauzner, R; Dulitzky, M; Carp, H; Mayan, H; Kenett, R; Farfel, Z; Many, A

    2003-08-01

    Antiphospholipid antibody syndrome (APS) is associated with adverse pregnancy outcomes and maternal complications including thrombotic events and early pre-eclampsia. HELLP syndrome (Hemolysis, Elevated Liver enzymes, Low Platelets) represents a unique form in the spectrum of pre-eclampsia. This report describes four patients with pregnancy-associated hepatic infarctions. All four had APS and HELLP syndrome, which was complete in one patient and incomplete in three patients, with elevated liver enzymes in all, and either thrombocytopenia or hemolysis in two. In the literature, we found descriptions of an additional 24 patients who had 26 pregnancies with concomitant hepatic infarction. Of the total 28 patients, anticardiolipin antibodies (aCL) and/or lupus anticoagulant (LAC) were assessed in 16 patients, out of whom 15 were found to be positive. Hepatic infartction during pregnancy was associated almost always with APS, with HELLP (2/3 complete, 1/3 incomplete), and only in one-third of the pregnancies with pre-eclampsia (PE).

  13. Do triatomic molecules echo atomic periodicity?

    SciTech Connect

    Hefferlin, R. Barrow, J.

    2015-03-30

    Demonstrations of periodicity among triatomic-molecular spectroscopic constants underscore the role of the periodic law as a foundation of chemistry. The objective of this work is to prepare for another test using vibration frequencies ν{sub 1} of free, ground-state, main-group triatomic molecules. Using data from four data bases and from computation, we have collected ν{sub 1} data for molecules formed from second period atoms.

  14. Arabian-Nubian Shield: incomplete vision and opened questions

    NASA Astrophysics Data System (ADS)

    Hassan, Mahmoud; Garni, Saad Al; Hussaini, Adeeb Al; Alnahdi, Mubarak; Shammari, Abdullah Al; Abu-Alam, Tamer

    2015-04-01

    The Arabian-Nubian Shield is a juvenile crust formed during the Pan-African Orozgeny due the closure of the Mozambican ocean as a result of East- and West-Gondwanaland collision. The shield records part of Earth's history of about 300 Myr. The formation of the shield is close related to the activity of the major pre-Mesozoic shear zone on the Earth - the Najd Fault System. The Najd Fault System exhumed several metamorphic complexes in different setting; some of them were exhumed in extension setting as metamorphic core complexes, others were exhumed in compressional setting or in oblique compression setting as strike-slip complexes. The metamorphic complexes represent middle crustal level rocks (25 - 50 km depth) exhumed to a shallower level (of about 14 km depth). At the depth of 14 km the shield was intruded by syn-tectonic granitic suites known as older granites. These metamorphic complexes have an acidic composition in contrast to the average basic composition of the shield. Detrital-zircon geochronological data from Nubian sandstone indicate that the metamorphic complexes exhumed completely to the Earth's surface by the end of the Pan-African orogeny. There are some open questions still need to be addressed to complete our vision of the shield. Some of these questions are: What are the protoliths of the metamorohic complexes? These protoliths are juvenile rocks formed during the Pan-African orogeny and have acidic composition but no information available about the origin, the tectonic setting or the formation mechanism of these rocks. What is the relation between the exhumation of the metamorphic complexes to a crustal level of about 14 km and the intrusion of the syn-tectonic granites to the same crustal level. How did the metamorphic complexes exhumed to the Earth's surface by the end of the Pan-African orogeny?

  15. Nucleon Electromagnetic Form Factors

    SciTech Connect

    Kees de Jager

    2004-08-01

    Although nucleons account for nearly all the visible mass in the universe, they have a complicated structure that is still incompletely understood. The first indication that nucleons have an internal structure, was the measurement of the proton magnetic moment by Frisch and Stern (1933) which revealed a large deviation from the value expected for a point-like Dirac particle. The investigation of the spatial structure of the nucleon, resulting in the first quantitative measurement of the proton charge radius, was initiated by the HEPL (Stanford) experiments in the 1950s, for which Hofstadter was awarded the 1961 Nobel prize. The first indication of a non-zero neutron charge distribution was obtained by scattering thermal neutrons off atomic electrons. The recent revival of its experimental study through the operational implementation of novel instrumentation has instigated a strong theoretical interest. Nucleon electro-magnetic form factors (EMFFs) are optimally studied through the exchange of a virtual photon, in elastic electron-nucleon scattering. The momentum transferred to the nucleon by the virtual photon can be selected to probe different scales of the nucleon, from integral properties such as the charge radius to scaling properties of its internal constituents. Polarization instrumentation, polarized beams and targets, and the measurement of the polarization of the recoiling nucleon have been essential in the accurate separation of the charge and magnetic form factors and in studies of the elusive neutron charge form factor.

  16. Of Molecules and Models.

    ERIC Educational Resources Information Center

    Brinner, Bonnie

    1992-01-01

    Presents an activity in which models help students visualize both the DNA process and transcription. After constructing DNA, RNA messenger, and RNA transfer molecules; students model cells, protein synthesis, codons, and RNA movement. (MDH)

  17. Incomplete resection rate of cold snare polypectomy: a prospective single-arm observational study.

    PubMed

    Matsuura, Noriko; Takeuchi, Yoji; Yamashina, Takeshi; Ito, Takashi; Aoi, Kenji; Nagai, Kengo; Kanesaka, Takashi; Matsui, Fumi; Fujii, Mototsugu; Akasaka, Tomofumi; Hanaoka, Noboru; Higashino, Koji; Tomita, Yasuhiko; Ito, Yuri; Ishihara, Ryu; Iishi, Hiroyasu; Uedo, Noriya

    2017-03-01

    Background and study aims Cold snare polypectomy (CSP) is considered to be safe for the removal of subcentimeter colorectal polyps. This study aimed to determine the rate of incomplete CSP resection for subcentimeter neoplastic polyps at our center. Patients and methods Patients with small or diminutive adenomas (diameter 1 - 9 mm) were recruited to undergo CSP until no polyp was visible. After CSP, a 1 - 3 mm margin around the resection site was removed using endoscopic mucosal resection. The polyps and resection site marginal specimens were microscopically evaluated. Incomplete resection was defined as the presence of neoplastic tissue in the marginal specimen. We also calculated the frequency at which the polyp lateral margins could be assessed for completeness of resection. Results A total of 307 subcentimeter neoplastic polyps were removed from 120 patients. The incomplete resection rate was 3.9 % (95 % confidence interval [CI] 1.7 % - 6.1 %); incomplete resection was not associated with polyp size, location, morphology, or operator experience. The polyp lateral margins could not be assessed adequately for 206 polyps (67.1 %). Interobserver agreement between incomplete resection and lateral polyp margins that were inadequate for assessment was poor (κ = 0.029, 95 %CI 0 - 0.04). Female sex was an independent risk factor for incomplete resection (odds ratio 4.41, 95 %CI 1.26 - 15.48; P  = 0.02). Conclusions At our center, CSP resection was associated with a moderate rate of incomplete resection, which was not associated with polyp characteristics. However, adequate evaluation of resection may not be routinely possible using the lateral margin from subcentimeter polyps that were removed using CSP.Trial registered at University Hospital Medical Information Network (UMIN 000010879).

  18. F1-ATPase conformational cycle from simultaneous single-molecule FRET and rotation measurements

    PubMed Central

    Sugawa, Mitsuhiro; Okazaki, Kei-ichi; Kobayashi, Masaru; Matsui, Takashi; Hummer, Gerhard; Masaike, Tomoko; Nishizaka, Takayuki

    2016-01-01

    Despite extensive studies, the structural basis for the mechanochemical coupling in the rotary molecular motor F1-ATPase (F1) is still incomplete. We performed single-molecule FRET measurements to monitor conformational changes in the stator ring-α3β3, while simultaneously monitoring rotations of the central shaft-γ. In the ATP waiting dwell, two of three β-subunits simultaneously adopt low FRET nonclosed forms. By contrast, in the catalytic intermediate dwell, two β-subunits are simultaneously in a high FRET closed form. These differences allow us to assign crystal structures directly to both major dwell states, thus resolving a long-standing issue and establishing a firm connection between F1 structure and the rotation angle of the motor. Remarkably, a structure of F1 in an ε-inhibited state is consistent with the unique FRET signature of the ATP waiting dwell, while most crystal structures capture the structure in the catalytic dwell. Principal component analysis of the available crystal structures further clarifies the five-step conformational transitions of the αβ-dimer in the ATPase cycle, highlighting the two dominant modes: the opening/closing motions of β and the loosening/tightening motions at the αβ-interface. These results provide a new view of tripartite coupling among chemical reactions, stator conformations, and rotary angles in F1-ATPase. PMID:27166420

  19. Visualization of Bacteriophage T3 Capsids with DNA Incompletely Packaged In Vivo

    PubMed Central

    Fang, Ping-An; Wright, Elena T.; Weintraub, Susan T.; Hakala, Kevin; Wu, Weimin; Serwer, Philip; Jiang, Wen

    2009-01-01

    The tightly packaged dsDNA genome in the mature particles of many tailed bacteriophages has been shown to form multiple concentric rings when reconstructed from cryo-electron micrographs. However, recent single-particle DNA packaging force measurements have suggested that incompletely packaged DNA (ipDNA) is less ordered when it is shorter than ∼25% of the full genome length. The study presented here initially achieves both the isolation and the ipDNA length-based fractionation of ipDNA-containing T3 phage capsids (ipDNA-capsids) produced by DNA packaging in vivo; some ipDNA has quantized lengths, as judged by high-resolution gel electrophoresis of expelled DNA. This is the first isolation of such particles among the tailed dsDNA bacteriophages. The ipDNA-capsids are a minor component (containing ∼10-4 of packaged DNA in all particles) and are initially detected by non-denaturing gel electrophoresis after partial purification by buoyant density centrifugation. The primary contaminants are aggregates of phage particles and empty capsids. This study then investigates ipDNA conformations by the first cryo-electron microscopy (cryo-EM) of ipDNA-capsids produced in vivo. The 3-D structures of DNA-free capsids, ipDNA-capsids with various lengths of ipDNA, and mature bacteriophage are reconstructed, which reveals the typical T=7l icosahedral shell of many tailed dsDNA bacteriophages. Though the icosahedral shell structures of these capsids are indistinguishable at the current resolution for the protein shell (∼15 Å), the conformations of the DNA inside the shell are drastically different. T3 ipDNA-capsids with 10.6 kb or shorter dsDNA (<28% of total genome) have an ipDNA conformation indistinguishable from random. However, T3 ipDNA-capsids with 22 kb DNA (58% of total genome) forms a single DNA ring next to the inner surface of the capsid shell. In contrast, dsDNA fully packaged (38.2 kb) in mature T3 phage particles forms multiple concentric rings like those seen

  20. Search for complex organic molecules in space

    NASA Astrophysics Data System (ADS)

    Ohishi, Masatoshi

    2016-07-01

    It was 1969 when the first organic molecule in space, H2CO, was discovered. Since then many organic molecules were discovered by using the NRAO 11 m (upgraded later to 12 m), Nobeyama 45 m, IRAM 30 m, and other highly sensitive radio telescopes as a result of close collaboration between radio astronomers and microwave spectroscopists. It is noteworthy that many famous organic molecules such as CH3OH, C2H5OH, (CH3)2O and CH3NH2 were detected by 1975. Organic molecules were found in so-called hot cores where molecules were thought to form on cold dust surfaces and then to evaporate by the UV photons emitted from the central star. These days organic molecules are known to exist not only in hot cores but in hot corinos (a warm, compact molecular clump found in the inner envelope of a class 0 protostar) and even protoplanetary disks. As was described above, major organic molecules were known since 1970s. It was very natural that astronomers considered a relationship between organic molecules in space and the origin of life. Several astronomers challenged to detect glycine and other prebiotic molecules without success. ALMA is expected to detect such important materials to further consider the gexogenous deliveryh hypothesis. In this paper I summarize the history in searching for complex organic molecules together with difficulties in observing very weak signals from larger species. The awfully long list of references at the end of this article may be the most useful part for readers who want to feel the exciting discovery stories.

  1. Characterization of Interstellar Organic Molecules

    NASA Astrophysics Data System (ADS)

    Gençaǧa, Deniz; Carbon, Duane F.; Knuth, Kevin H.

    2008-11-01

    Understanding the origins of life has been one of the greatest dreams throughout history. It is now known that star-forming regions contain complex organic molecules, known as Polycyclic Aromatic Hydrocarbons (PAHs), each of which has particular infrared spectral characteristics. By understanding which PAH species are found in specific star-forming regions, we can better understand the biochemistry that takes place in interstellar clouds. Identifying and classifying PAHs is not an easy task: we can only observe a single superposition of PAH spectra at any given astrophysical site, with the PAH species perhaps numbering in the hundreds or even thousands. This is a challenging source separation problem since we have only one observation composed of numerous mixed sources. However, it is made easier with the help of a library of hundreds of PAH spectra. In order to separate PAH molecules from their mixture, we need to identify the specific species and their unique concentrations that would provide the given mixture. We develop a Bayesian approach for this problem where sources are separated from their mixture by Metropolis Hastings algorithm. Separated PAH concentrations are provided with their error bars, illustrating the uncertainties involved in the estimation process. The approach is demonstrated on synthetic spectral mixtures using spectral resolutions from the Infrared Space Observatory (ISO). Performance of the method is tested for different noise levels.

  2. Organic Molecules in Protoplanetary Disks

    NASA Astrophysics Data System (ADS)

    Gibb, Erika; Horne, David; Shenoy, Sachindev; Blake, Daniel; van Brunt, Kari; Brittain, Sean; Rettig, Terrence

    2008-08-01

    We propose to use NIRSPEC to search for organic molecules in circumstellar disks toward nearly edge-on T Tauri stars. The feasibility of this study has been recently illustrated by the NIRSPEC detection of HCN toward two edge-on T Tauri stars, GV Tau (Gibb et al. 2007) and IRS 46 (Lahuis et al. 2006), and Spitzer detections of C_2H_2, HCN, and CO_2 toward IRS 46 (Lahuis et al. 2006) and AA Tau (Carr & Najita 2008). We have selected 10 molecules that are predicted to be abundant based on chemical models, observations of high and low mass star forming regions, and comet comae. We will investigate compositional variations among the T Tauri population and compare that to comets and chemical models of disk chemistry. Through this, we can explore the chemistry occurring in the planet-forming regions of protoplanetary disks and investigate the evolution of organic volatiles, which can help establish the mechanism and timescale for planet formation.

  3. Characterization of Interstellar Organic Molecules

    SciTech Connect

    Gencaga, Deniz; Knuth, Kevin H.; Carbon, Duane F.

    2008-11-06

    Understanding the origins of life has been one of the greatest dreams throughout history. It is now known that star-forming regions contain complex organic molecules, known as Polycyclic Aromatic Hydrocarbons (PAHs), each of which has particular infrared spectral characteristics. By understanding which PAH species are found in specific star-forming regions, we can better understand the biochemistry that takes place in interstellar clouds. Identifying and classifying PAHs is not an easy task: we can only observe a single superposition of PAH spectra at any given astrophysical site, with the PAH species perhaps numbering in the hundreds or even thousands. This is a challenging source separation problem since we have only one observation composed of numerous mixed sources. However, it is made easier with the help of a library of hundreds of PAH spectra. In order to separate PAH molecules from their mixture, we need to identify the specific species and their unique concentrations that would provide the given mixture. We develop a Bayesian approach for this problem where sources are separated from their mixture by Metropolis Hastings algorithm. Separated PAH concentrations are provided with their error bars, illustrating the uncertainties involved in the estimation process. The approach is demonstrated on synthetic spectral mixtures using spectral resolutions from the Infrared Space Observatory (ISO). Performance of the method is tested for different noise levels.

  4. Bayesian model selection for incomplete data using the posterior predictive distribution.

    PubMed

    Daniels, Michael J; Chatterjee, Arkendu S; Wang, Chenguang

    2012-12-01

    We explore the use of a posterior predictive loss criterion for model selection for incomplete longitudinal data. We begin by identifying a property that most model selection criteria for incomplete data should consider. We then show that a straightforward extension of the Gelfand and Ghosh (1998, Biometrika, 85, 1-11) criterion to incomplete data has two problems. First, it introduces an extra term (in addition to the goodness of fit and penalty terms) that compromises the criterion. Second, it does not satisfy the aforementioned property. We propose an alternative and explore its properties via simulations and on a real dataset and compare it to the deviance information criterion (DIC). In general, the DIC outperforms the posterior predictive criterion, but the latter criterion appears to work well overall and is very easy to compute unlike the DIC in certain classes of models for missing data.

  5. Exploring the potential for neural recovery after incomplete tetraplegia through nonsurgical interventions.

    PubMed

    Backus, Deborah

    2010-12-01

    Persons with tetraplegia resulting from a cervical spinal cord injury believe that increasing upper limb (UL) function will improve their quality of life. Various lines of evidence demonstrate that persons with incomplete tetraplegia have the potential for improvements in both neural plasticity and function of the arms and hands. Therefore treatment to improve UL function in persons with incomplete tetraplegia should focus on improving motor control, not just compensation for the paralysis and sensory loss that follows a spinal cord injury. This article highlights the principles that underlie the facilitation of neural plasticity and functional changes: intensity, repeated practice, attention, and somatosensory augmentation. Evidence is presented for the application of these principles through the use of activity-based interventions in persons with tetraplegia and the hypothesis is proposed that the use of activity-based interventions will lead to greater, more beneficial neural plasticity as well as gains in UL function, in persons with incomplete tetraplegia.

  6. Workshop on Incomplete Network Data Held at Sandia National Labs – Livermore

    SciTech Connect

    Soundarajan, Sucheta; Wendt, Jeremy D.

    2016-06-01

    While network analysis is applied in a broad variety of scientific fields (including physics, computer science, biology, and the social sciences), how networks are constructed and the resulting bias and incompleteness have drawn more limited attention. For example, in biology, gene networks are typically developed via experiment -- many actual interactions are likely yet to be discovered. In addition to this incompleteness, the data-collection processes can introduce significant bias into the observed network datasets. For instance, if you observe part of the World Wide Web network through a classic random walk, then high degree nodes are more likely to be found than if you had selected nodes at random. Unfortunately, such incomplete and biasing data collection methods must be often used.

  7. Regression with incomplete covariates and left-truncated time-to-event data.

    PubMed

    Shen, Hua; Cook, Richard J

    2013-03-15

    Studies of chronic diseases routinely sample individuals subject to conditions on an event time of interest. In epidemiology, for example, prevalent cohort studies aiming to evaluate risk factors for survival following onset of dementia require subjects to have survived to the point of screening. In clinical trials designed to assess the effect of experimental cancer treatments on survival, patients are required to survive from the time of cancer diagnosis to recruitment. Such conditions yield samples featuring left-truncated event time distributions. Incomplete covariate data often arise in such settings, but standard methods do not deal with the fact that individuals' covariate distributions are also affected by left truncation. We describe an expectation-maximization algorithm for dealing with incomplete covariate data in such settings, which uses the covariate distribution conditional on the selection criterion. We describe an extension to deal with subgroup analyses in clinical trials for the case in which the stratification variable is incompletely observed.

  8. Bilevel formulation of a policy design problem considering multiple objectives and incomplete preferences

    NASA Astrophysics Data System (ADS)

    Hawthorne, Bryant; Panchal, Jitesh H.

    2014-07-01

    A bilevel optimization formulation of policy design problems considering multiple objectives and incomplete preferences of the stakeholders is presented. The formulation is presented for Feed-in-Tariff (FIT) policy design for decentralized energy infrastructure. The upper-level problem is the policy designer's problem and the lower-level problem is a Nash equilibrium problem resulting from market interactions. The policy designer has two objectives: maximizing the quantity of energy generated and minimizing policy cost. The stakeholders decide on quantities while maximizing net present value and minimizing capital investment. The Nash equilibrium problem in the presence of incomplete preferences is formulated as a stochastic linear complementarity problem and solved using expected value formulation, expected residual minimization formulation, and the Monte Carlo technique. The primary contributions in this article are the mathematical formulation of the FIT policy, the extension of computational policy design problems to multiple objectives, and the consideration of incomplete preferences of stakeholders for policy design problems.

  9. Experimental study of incomplete oxidation of methane in a ring channel

    NASA Astrophysics Data System (ADS)

    Kuznetsov, V. V.; Vitovsky, O. V.; Gasenko, O. A.

    2007-09-01

    Chemical transformations at incomplete methane oxidation in the air medium were studied experimentally at reaction activation on the wall of an annular microchannel. Methane was oxidized incompletely on a rhodium catalyst deposited on an inner wall of the channel. Concentrations of the products of chemical transformations were measured in the outlet gas mixture for different reactor temperatures and stay times. We have determined the range of channel wall temperatures and stay times of the mixture corresponding to an increase in the portion of hydrogen and carbon dioxide indicating transition from predominant methane combustion to cascade chemical reactions with activation of steam and carbon dioxide methane conversions. It is shown that the kinetic model of chemical transformations of methane in the air medium depends significantly on the temperature of channel walls and stay time of the mixture. The effect of outer diffusion deceleration on the rate of chemical transformations at incomplete methane oxidation under the strained conditions is determined.

  10. Design of incomplete derivative fuzzy PID control system for fast-steering mirror

    NASA Astrophysics Data System (ADS)

    Ai, Zhiwei; Tan, Yi; Wu, Qiongyan; Ren, Ge; Tan, Yufen; Zhu, Nengbing; Zhu, Fuyin

    2016-10-01

    The structure parameters of fast-steering mirror (FSM) might change with time goes by. In order to reduce the impact of this change on the output performance of FSM system, an incomplete derivative fuzzy PID control system is proposed. This control system can effectively improve the time domain quality of FSM system by optimizing the PID control parameters online. First, the dynamic model of FSM is established. Second, the initial parameters of the incomplete derivative PID control system are designed according to the frequency domain quality of the closed-loop system. Then, the rules and related factors of the fuzzy controller are designed on the basis of the initial parameters. Finally, simulation experiments are carried out. The results show that the incomplete derivative PID control system has shorter adjustment time, less overshoot and lower dependence on the parameters of FSM when compared with the fixed parameters PID control system.

  11. Multiplicative consistency-based decision support system for incomplete linguistic preference relations

    NASA Astrophysics Data System (ADS)

    Xia, Meimei; Xu, Zeshui; Wang, Zhong

    2014-03-01

    The experts may have difficulty in expressing all their preferences over alternatives or criteria, and produce the incomplete linguistic preference relation. Consistency plays an important role in estimating unknown values from an incomplete linguistic preference relation. Many methods have been developed to obtain a complete linguistic preference relation based on additive consistency, but some unreasonable values may be produced in the estimation process. To overcome this issue, we propose a new characterisation about multiplicative consistency of the linguistic preference relation, present an algorithm to estimate missing values from an incomplete linguistic preference relation, and establish a decision support system for aiding the experts to complete their linguistic preference relations in a more consistent way. Some examples are also given to illustrate the proposed methods.

  12. Positronium ions and molecules

    NASA Technical Reports Server (NTRS)

    Ho, Y. K.

    1990-01-01

    Recent theoretical studies on positronium ions and molecules are discussed. A positronium ion is a three particle system consisting of two electrons in singlet spin state, and a positron. Recent studies include calculations of its binding energy, positron annihilation rate, and investigations of its doubly excited resonant states. A positronium molecule is a four body system consisting of two positrons and two electrons in an overall singlet spin state. The recent calculations of its binding energy against the dissociation into two positronium atoms, and studies of auto-detaching states in positronium molecules are discussed. These auto-dissociating states, which are believed to be part of the Rydberg series as a result of a positron attaching to a negatively charged positronium ion, Ps-, would appear as resonances in Ps-Ps scattering.

  13. Single-Molecule Bioelectronics

    PubMed Central

    Rosenstein, Jacob K.; Lemay, Serge G.; Shepard, Kenneth L.

    2014-01-01

    Experimental techniques which interface single biomolecules directly with microelectronic systems are increasingly being used in a wide range of powerful applications, from fundamental studies of biomolecules to ultra-sensitive assays. Here we review several technologies which can perform electronic measurements of single molecules in solution: ion channels, nanopore sensors, carbon nanotube field-effect transistors, electron tunneling gaps, and redox cycling. We discuss the shared features among these techniques that enable them to resolve individual molecules, and discuss their limitations. Recordings from each of these methods all rely on similar electronic instrumentation, and we discuss the relevant circuit implementations and potential for scaling these single-molecule bioelectronic interfaces to high-throughput arrayed sensing platforms. PMID:25529538

  14. Polarization of deuterium molecules

    SciTech Connect

    J. F. J. van den Brand; H. J. Bulten; M. Ferro-Luzzi; Z.-L. Zhou; Ricardo Alarcon; T. Botto; M. Bouwhuis; Rolf Ent; Peter Heimberg; Douglas W. Higinbotham; Kees de Jager; J. Lang; D. J. de Lange; I. Passchier; H. R. Poolman; J. J. M. Steijger; O. Unal; H. de Vries

    1997-08-01

    For molecular systems, spin relaxation is expected to be suppressed compared to the case of atoms, since the paired electrons in a hydrogen or deuterium molecule are chemically stable, and only weakly interact with the spin of the nucleus. Such systems would be largely insensitive to polarization losses due to spin-exchange collisions, to the interaction of the electron spins with external fields (e.g. the RF-field of a bunched charged-particle beam), and/or to the presence of container walls. Here, we discuss the results of a recent experiment where we obtained evidence that nuclear polarization is maintained, when polarized atoms recombine to molecules on a copper surface (in a magnetic field of 23 mT and at a density of about 10{sup 12} molecules {center_dot} cm{sup -3}).

  15. The Three Forms of Molecular Oxygen.

    ERIC Educational Resources Information Center

    Laing, Michael

    1989-01-01

    Finds that a logical application of the simple rules of the molecular orbital bonding theory for diatomic molecules predicted the existence of three spin isomers of the oxygen molecule: one triplet form with two unpaired electrons and two singlet forms with all electrons paired. (MVL)

  16. Single molecule diffraction.

    PubMed

    Spence, J C H; Doak, R B

    2004-05-14

    For solving the atomic structure of organic molecules such as small proteins which are difficult to crystallize, the use of a jet of doped liquid helium droplets traversing a continuous high energy electron beam is proposed as a means of obtaining electron diffraction patterns (serial crystallography). Organic molecules (such as small proteins) within the droplet (and within a vitreous ice jacket) may be aligned by use of a polarized laser beam. Iterative methods for solving the phase problem are indicated. Comparisons with a related plan for pulsed x-ray diffraction from single proteins in a molecular beam are provided.

  17. Stepwise Excavation Allows Apexogenesis in Permanent Molars with Deep Carious Lesions and Incomplete Root Formation.

    PubMed

    Hernandéz-Gatón, Patrícia; Serrano, César Ruiz; Nelson Filho, Paulo; De Castañeda, Esther Ruiz; Lucisano, Marília P; Silva, Raquel A B da; Silva, Léa A B da

    2015-01-01

    This study evaluated the stepwise excavation technique in 138 permanent molars with deep carious lesions and incomplete root formation within a 24-month clinical and radiographic follow-up period. In 96.7% of the cases, success was observed (no pain, integrity of restoration margins, absence of radiographic alterations and apexogenesis). The cases of failure (3.3%) were due to the loss of the temporary restoration. In conclusion, the stepwise excavation is a promising technique for permanent teeth with deep carious lesions and incomplete root formation as a minimally invasive approach because it allows the preservation of pulp vitality and occurrence of apexogenesis.

  18. Graph Embedding Techniques for Bounding Condition Numbers of Incomplete Factor Preconditioning

    NASA Technical Reports Server (NTRS)

    Guattery, Stephen

    1997-01-01

    We extend graph embedding techniques for bounding the spectral condition number of preconditioned systems involving symmetric, irreducibly diagonally dominant M-matrices to systems where the preconditioner is not diagonally dominant. In particular, this allows us to bound the spectral condition number when the preconditioner is based on an incomplete factorization. We provide a review of previous techniques, describe our extension, and give examples both of a bound for a model problem, and of ways in which our techniques give intuitive way of looking at incomplete factor preconditioners.

  19. Investigation of complete and incomplete fusion in 20Ne + 51V system using recoil range measurement

    NASA Astrophysics Data System (ADS)

    Ali, Sabir; Ahmad, Tauseeef; Kumar, Kamal; Rizvi, I. A.; Agarwal, Avinash; Ghugre, S. S.; Sinha, A. K.; Chaubey, A. K.

    2015-01-01

    Recoil range distributions of evaporation residues, populated in 20Ne + 51V reaction at Elab ≈ 145 MeV, have been studied to determine the degree of momentum transferred through the complete and incomplete fusion reactions. Evaporation residues (ERs) populated through the complete and incomplete fusion reactions have been identified on the basis of their recoil range in the Al catcher medium. Measured recoil range of evaporation residues have been compared with the theoretical value calculated using the code SRIM. Range integrated cross section of observed ERs have been compared with the value predicted by statistical model code PACE4.

  20. Spontaneous Regression of Aneurysm Remnant after Incomplete Surgical Clipping in a Patient with Ruptured Cerebral Aneurysm

    PubMed Central

    Jun, Hyo Sub; Ahn, JunHyong; Song, Joon Ho

    2016-01-01

    Cases of spontaneous regression of cerebral aneurysm remnant after incomplete surgical clipping have been rarely reported. This paper reports the regression of an aneurysm remnant after incomplete surgical clipping during postsurgical follow-up. A 50-year-old male presented with subarachnoid hemorrhage because of rupture of an anterior communicating artery aneurysm. An emergency clipping of the aneurysm was performed. A cerebral angiography, which was performed two weeks postoperatively, revealed an aneurysm remnant. The patient refused additional treatment and was discharged without apparent neurological deficit. One-year follow up cerebral angiography demonstrated a partially regressed aneurysm remnant. PMID:28184353

  1. Dependence of low energy incomplete fusion on projectile's α-Q-value

    NASA Astrophysics Data System (ADS)

    Yadav, Abhishek; Singh, Pushpendra P.; Kumar, P.; Shuaib, Mohd; Sharma, Vijay R.; Bala, Indu; Singh, D. P.; Gupta, Sunita; Gupta, U.; Sharma, M. K.; Kumar, R.; Muralithar, S.; Singh, R. P.; Singh, B. P.; Prasad, R.

    2015-06-01

    An attempt has been made to understand the effect of entrance-channel parameters on low-energy incomplete fusion and a strong projectile dependence in terms of projectile's α-Q-value has been observed. In the present work, the excitation functions of 16O,13,12C+159Tb systems have been measured and compared with PACE4 predictions to study the involvement of different reaction processes. The strength of incomplete fusion reactions for all the studied systems have been extraced and compared to find out the systematics.

  2. Nanodevices for generating power from molecules and batteryless sensing

    DOEpatents

    Wang, Yinmin; Wang, Xianying; Hamza, Alex V.

    2014-07-15

    A nanoconverter or nanosensor is disclosed capable of directly generating electricity through physisorption interactions with molecules that are dipole containing organic species in a molecule interaction zone. High surface-to-volume ratio semiconductor nanowires or nanotubes (such as ZnO, silicon, carbon, etc.) are grown either aligned or randomly-aligned on a substrate. Epoxy or other nonconductive polymers are used to seal portions of the nanowires or nanotubes to create molecule noninteraction zones. By correlating certain molecule species to voltages generated, a nanosensor may quickly identify which species is detected. Nanoconverters in a series parallel arrangement may be constructed in planar, stacked, or rolled arrays to supply power to nano- and micro-devices without use of external batteries. In some cases breath, from human or other life forms, contain sufficient molecules to power a nanoconverter. A membrane permeable to certain molecules around the molecule interaction zone increases specific molecule nanosensor selectivity response.

  3. Nanodevices for generating power from molecules and batteryless sensing

    DOEpatents

    Wang, Yinmin; Wang, Xianying; Hamza, Alex V.

    2017-01-03

    A nanoconverter or nanosensor is disclosed capable of directly generating electricity through physisorption interactions with molecules that are dipole containing organic species in a molecule interaction zone. High surface-to-volume ratio semiconductor nanowires or nanotubes (such as ZnO, silicon, carbon, etc.) are grown either aligned or randomly-aligned on a substrate. Epoxy or other nonconductive polymers are used to seal portions of the nanowires or nanotubes to create molecule noninteraction zones. By correlating certain molecule species to voltages generated, a nanosensor may quickly identify which species is detected. Nanoconverters in a series parallel arrangement may be constructed in planar, stacked, or rolled arrays to supply power to nano- and micro-devices without use of external batteries. In some cases breath, from human or other life forms, contain sufficient molecules to power a nanoconverter. A membrane permeable to certain molecules around the molecule interaction zone increases specific molecule nanosensor selectivity response.

  4. Nanodevices for generating power from molecules and batteryless sensing

    DOEpatents

    Wang, Yinmin; Wang, Xianying; Hamza, Alex V.

    2015-06-09

    A nanoconverter or nanosensor is disclosed capable of directly generating electricity through physisorption interactions with molecules that are dipole containing organic species in a molecule interaction zone. High surface-to-volume ratio semiconductor nanowires or nanotubes (such as ZnO, silicon, carbon, etc.) are grown either aligned or randomly-aligned on a substrate. Epoxy or other nonconductive polymers are used to seal portions of the nanowires or nanotubes to create molecule noninteraction zones. By correlating certain molecule species to voltages generated, a nanosensor may quickly identify which species is detected. Nanoconverters in a series parallel arrangement may be constructed in planar, stacked, or rolled arrays to supply power to nano- and micro-devices without use of external batteries. In some cases breath, from human or other life forms, contain sufficient molecules to power a nanoconverter. A membrane permeable to certain molecules around the molecule interaction zone increases specific molecule nanosensor selectivity response.

  5. Single molecule junction conductance and binding geometry

    NASA Astrophysics Data System (ADS)

    Kamenetska, Maria

    This Thesis addresses the fundamental problem of controlling transport through a metal-organic interface by studying electronic and mechanical properties of single organic molecule-metal junctions. Using a Scanning Tunneling Microscope (STM) we image, probe energy-level alignment and perform STM-based break junction (BJ) measurements on molecules bound to a gold surface. Using Scanning Tunneling Microscope-based break-junction (STM-BJ) techniques, we explore the effect of binding geometry on single-molecule conductance by varying the structure of the molecules, metal-molecule binding chemistry and by applying sub-nanometer manipulation control to the junction. These experiments are performed both in ambient conditions and in ultra high vacuum (UHV) at cryogenic temperatures. First, using STM imaging and scanning tunneling spectroscopy (STS) measurements we explore binding configurations and electronic properties of an amine-terminated benzene derivative on gold. We find that details of metal-molecule binding affect energy-level alignment at the interface. Next, using the STM-BJ technique, we form and rupture metal-molecule-metal junctions ˜104 times to obtain conductance-vs-extension curves and extract most likely conductance values for each molecule. With these measurements, we demonstrated that the control of junction conductance is possible through a choice of metal-molecule binding chemistry and sub-nanometer positioning. First, we show that molecules terminated with amines, sulfides and phosphines bind selectively on gold and therefore demonstrate constant conductance levels even as the junction is elongated and the metal-molecule attachment point is modified. Such well-defined conductance is also obtained with paracyclophane molecules which bind to gold directly through the pi system. Next, we are able to create metal-molecule-metal junctions with more than one reproducible conductance signatures that can be accessed by changing junction geometry. In the

  6. Sweeping molecules with light

    NASA Astrophysics Data System (ADS)

    Hutzler, Nicholas R.

    2017-03-01

    Many areas of physics—precision measurements, quantum information, and physical chemistry, to name a few—are starting to benefit from the enormous advantages offered by cold and ultracold polar molecules. Molecules have more states, more interactions, and more chemical properties compared to atoms, which make them exciting to study but difficult to tame. In particular, the powerful techniques of atomic laser cooling cannot be naïvely applied to molecules due to their complicated structure. Developments over the past few years have made directly laser cooled and trapped molecules a reality, and now much effort is focused on making these samples larger, denser, and colder—an important step to realizing many of their exciting applications. A careful experimental and numerical study by Truppe et al (2017 New J. Phys. 19 022001) demonstrates a significant improvement and advance in understanding of one of the most limiting steps in laser cooling and trapping of molecules—slowing them from a molecular beam to a near-standstill, with small enough kinetic energy that they can be loaded into a trap.

  7. Diversity in Biological Molecules

    ERIC Educational Resources Information Center

    Newbury, H. John

    2010-01-01

    One of the striking characteristics of fundamental biological processes, such as genetic inheritance, development and primary metabolism, is the limited amount of variation in the molecules involved. Natural selective pressures act strongly on these core processes and individuals carrying mutations and producing slightly sub-optimal versions of…

  8. Mighty Molecule Models

    ERIC Educational Resources Information Center

    Brown, Tom; Rushton, Greg; Bencomo, Marie

    2008-01-01

    As part of the SMATHematics Project: The Wonder of Science, The Power of Mathematics--a collaborative partnership between Kennesaw State University and two local school districts, fifth graders had the opportunity to puzzle out chemical formulas of propane, methanol, and other important molecules. In addition, they explored properties that…

  9. Algebraic theory of molecules

    NASA Technical Reports Server (NTRS)

    Iachello, Franco

    1995-01-01

    An algebraic formulation of quantum mechanics is presented. In this formulation, operators of interest are expanded onto elements of an algebra, G. For bound state problems in nu dimensions the algebra G is taken to be U(nu + 1). Applications to the structure of molecules are presented.

  10. Single molecules: Thermodynamic limits

    NASA Astrophysics Data System (ADS)

    Liphardt, Jan

    2012-09-01

    Technologies aimed at single-molecule resolution of non-equilibrium systems increasingly require sophisticated new ways of thinking about thermodynamics. An elegant extension to standard fluctuation theory grants access to the kinetic intermediate states of these systems -- as DNA-pulling experiments now demonstrate.

  11. Three new 'nonterrestrial' molecules

    NASA Astrophysics Data System (ADS)

    Thaddeus, P.; Guelin, M.; Linke, R. A.

    1981-05-01

    Eight new interstellar lines have been detected from three molecules not previously observed spectroscopically in space or in the laboratory. One is a linear or nearly linear molecule with microwave constants B0 equals 21,337.15 plus or minus 0.06 MHz, D0 equals 21.4 plus or minus 1.5 kHz. This is the thioformyl ion HCS(plus), first identified because B0 and D0 are close to those calculated, and now confirmed by laboratory detection of one of the present lines (Gudeman et al.). The second molecule, also linear or nearly so, has microwave constants B0 equals 10,691,406 plus or minus 0.043 MHz, D0 equals 1.84 plus or minus 0.91 kHz close to those expected for the isoelectronic systems HOCO(plus) and HOCN; a choice between the two cannot be made on the basis of the available astronomical data. The existence of a third molecule is deduced from an unidentified line at 85,338 MHz that has been found in many sources, is fairly intense in several, and may be self-absorbed in Sgr B2.

  12. OMG: Open Molecule Generator.

    PubMed

    Peironcely, Julio E; Rojas-Chertó, Miguel; Fichera, Davide; Reijmers, Theo; Coulier, Leon; Faulon, Jean-Loup; Hankemeier, Thomas

    2012-09-17

    Computer Assisted Structure Elucidation has been used for decades to discover the chemical structure of unknown compounds. In this work we introduce the first open source structure generator, Open Molecule Generator (OMG), which for a given elemental composition produces all non-isomorphic chemical structures that match that elemental composition. Furthermore, this structure generator can accept as additional input one or multiple non-overlapping prescribed substructures to drastically reduce the number of possible chemical structures. Being open source allows for customization and future extension of its functionality. OMG relies on a modified version of the Canonical Augmentation Path, which grows intermediate chemical structures by adding bonds and checks that at each step only unique molecules are produced. In order to benchmark the tool, we generated chemical structures for the elemental formulas and substructures of different metabolites and compared the results with a commercially available structure generator. The results obtained, i.e. the number of molecules generated, were identical for elemental compositions having only C, O and H. For elemental compositions containing C, O, H, N, P and S, OMG produces all the chemically valid molecules while the other generator produces more, yet chemically impossible, molecules. The chemical completeness of the OMG results comes at the expense of being slower than the commercial generator. In addition to being open source, OMG clearly showed the added value of constraining the solution space by using multiple prescribed substructures as input. We expect this structure generator to be useful in many fields, but to be especially of great importance for metabolomics, where identifying unknown metabolites is still a major bottleneck.

  13. The Molecules of the Cell Membrane.

    ERIC Educational Resources Information Center

    Bretscher, Mark S.

    1985-01-01

    Cell membrane molecules form a simple, two-dimensional liquid controlling what enters and leaves the cell. Discusses cell membrane molecular architecture, plasma membranes, epithelial cells, cycles of endocytosis and exocytosis, and other topics. Indicates that some cells internalize, then recycle, membrane area equivalent to their entire surface…

  14. Complex organic molecules and star formation

    NASA Astrophysics Data System (ADS)

    Bacmann, A.; Faure, A.

    2014-12-01

    Star forming regions are characterised by the presence of a wealth of chemical species. For the past two to three decades, ever more complex organic species have been detected in the hot cores of protostars. The evolution of these molecules in the course of the star forming process is still uncertain, but it is likely that they are partially incorporated into protoplanetary disks and then into planetesimals and the small bodies of planetary systems. The complex organic molecules seen in star forming regions are particularly interesting since they probably make up building blocks for prebiotic chemistry. Recently we showed that these species were also present in the cold gas in prestellar cores, which represent the very first stages of star formation. These detections question the models which were until now accepted to account for the presence of complex organic molecules in star forming regions. In this article, we shortly review our current understanding of complex organic molecule formation in the early stages of star formation, in hot and cold cores alike and present new results on the formation of their likely precursor radicals.

  15. Incomplete Measures

    ERIC Educational Resources Information Center

    Tanner, John R.

    2010-01-01

    Large-scale test scores are the most visible representation of what happens in schools in the U.S. The prevailing notion is that they will tell people most of what they need to know about a school, including the quality of instruction and the effectiveness of the teaching and administrative staff. Americans put credence in test scores despite the…

  16. Permission Forms

    ERIC Educational Resources Information Center

    Zirkel, Perry A.

    2005-01-01

    The prevailing practice in public schools is to routinely require permission or release forms for field trips and other activities that pose potential for liability. The legal status of such forms varies, but they are generally considered to be neither rock-solid protection nor legally valueless in terms of immunity. The following case and the…

  17. Bacterial invasion reconstructed molecule by molecule

    SciTech Connect

    Werner, James H

    2009-01-01

    We propose to visualize the initial stages of bacterial infection of a human host cell with unmatched spatial and temporal resolution. This work will develop a new capability for the laboratory (super-resolution optical imaging), will test unresolved scientific hypotheses regarding host-pathogen interaction dynamics, and leverages state of the art 3D molecular tracking instrumentation developed recently by our group. There is much to be gained by applying new single molecule tools to the important and familiar problem of pathogen entry into a host cell. For example, conventional fluorescence microscopy has identified key host receptors, such as CD44 and {alpha}5{beta}1 integrin, that aggregate near the site of Salmonella typhimurium infection of human cells. However, due to the small size of the bacteria ({approx} 2 {micro}m) and the diffraction of the emitted light, one just sees a fluorescent 'blob' of host receptors that aggregate at the site of attachment, making it difficult to determine the exact number of receptors present or whether there is any particular spatial arrangement of the receptors that facilitates bacterial adhesion/entry. Using newly developed single molecule based super-resolution imaging methods, we will visualize how host receptors are directed to the site of pathogen adhesion and whether host receptors adopt a specific spatial arrangement for successful infection. Furthermore, we will employ our 3D molecular tracking methods to follow the injection of virulence proteins, or effectors, into the host cell by the pathogen Type III secretion system (TTSS). We expect these studies to provide mechanistic insights into the early events of pathogen infection that have here-to-fore been technically beyond our reach. Our Research Goals are: Goal 1--Construct a super-resolution fluorescence microscope and use this new capability to image the spatial distribution of different host receptors (e.g. CD44, as {alpha}5{beta}1 integrin) at the point of

  18. Back to Basics: Incomplete Knowledge of Differential Object Marking in Spanish Heritage Speakers

    ERIC Educational Resources Information Center

    Montrul, Silvina; Bowles, Melissa

    2009-01-01

    The obligatory use of the preposition a with animate, specific direct objects in Spanish ("Juan conoce a Maria" "Juan knows Maria") is a well-known instance of Differential Object Marking (DOM; Torrego, 1998; Leonetti, 2004). Recent studies have documented the loss and/or incomplete acquisition of several grammatical features in Spanish heritage…

  19. TOPSIS-based consensus model for group decision-making with incomplete interval fuzzy preference relations.

    PubMed

    Liu, Fang; Zhang, Wei-Guo

    2014-08-01

    Due to the vagueness of real-world environments and the subjective nature of human judgments, it is natural for experts to estimate their judgements by using incomplete interval fuzzy preference relations. In this paper, based on the technique for order preference by similarity to ideal solution method, we present a consensus model for group decision-making (GDM) with incomplete interval fuzzy preference relations. To do this, we first define a new consistency measure for incomplete interval fuzzy preference relations. Second, a goal programming model is proposed to estimate the missing interval preference values and it is guided by the consistency property. Third, an ideal interval fuzzy preference relation is constructed by using the induced ordered weighted averaging operator, where the associated weights of characterizing the operator are based on the defined consistency measure. Fourth, a similarity degree between complete interval fuzzy preference relations and the ideal one is defined. The similarity degree is related to the associated weights, and used to aggregate the experts' preference relations in such a way that more importance is given to ones with the higher similarity degree. Finally, a new algorithm is given to solve the GDM problem with incomplete interval fuzzy preference relations, which is further applied to partnership selection in formation of virtual enterprises.

  20. Identifying Useful Auxiliary Variables for Incomplete Data Analyses: A Note on a Group Difference Examination Approach

    ERIC Educational Resources Information Center

    Raykov, Tenko; Marcoulides, George A.

    2014-01-01

    This research note contributes to the discussion of methods that can be used to identify useful auxiliary variables for analyses of incomplete data sets. A latent variable approach is discussed, which is helpful in finding auxiliary variables with the property that if included in subsequent maximum likelihood analyses they may enhance considerably…

  1. Obtaining Paired Comparisons Data from Multiple Rank Orders Using Partially Balanced Incomplete Block Designs

    ERIC Educational Resources Information Center

    Straton, Ralph G.

    1975-01-01

    Complete paired comparisons data was obtained by use of multiple rank order (MRO) in the context of gathering rank order preferences of grade six students, their parents, and teachers for instructional objectives. Partially balanced incomplete block designs with two associate classes were used in the MRO instruments instead of the usual balanced…

  2. Incomplete Reporting: Addressing the Prevalence of Outcome-Reporting Bias in Educational Research

    ERIC Educational Resources Information Center

    Trainor, Brian; Polanin, Joshua; Williams, Ryan; Pigott, Terri

    2015-01-01

    Outcome reporting bias refers to the practice of omitting from primary studies outcomes that were actually collected. When primary studies do not report on all the outcomes assessed, there is an incomplete understanding of a phenomenon that may be compounded when the study is included in a systematic review of research. Outcome reporting bias is…

  3. Double propensity-score adjustment: A solution to design bias or bias due to incomplete matching

    PubMed Central

    2016-01-01

    Propensity-score matching is frequently used to reduce the effects of confounding when using observational data to estimate the effects of treatments. Matching allows one to estimate the average effect of treatment in the treated. Rosenbaum and Rubin coined the term “bias due to incomplete matching” to describe the bias that can occur when some treated subjects are excluded from the matched sample because no appropriate control subject was available. The presence of incomplete matching raises important questions around the generalizability of estimated treatment effects to the entire population of treated subjects. We describe an analytic solution to address the bias due to incomplete matching. Our method is based on using optimal or nearest neighbor matching, rather than caliper matching (which frequently results in the exclusion of some treated subjects). Within the sample matched on the propensity score, covariate adjustment using the propensity score is then employed to impute missing potential outcomes under lack of treatment for each treated subject. Using Monte Carlo simulations, we found that the proposed method resulted in estimates of treatment effect that were essentially unbiased. This method resulted in decreased bias compared to caliper matching alone and compared to either optimal matching or nearest neighbor matching alone. Caliper matching alone resulted in design bias or bias due to incomplete matching, while optimal matching or nearest neighbor matching alone resulted in bias due to residual confounding. The proposed method also tended to result in estimates with decreased mean squared error compared to when caliper matching was used. PMID:25038071

  4. The Devil Is in the Details: Incomplete Reporting in Preclinical Animal Research.

    PubMed

    Avey, Marc T; Moher, David; Sullivan, Katrina J; Fergusson, Dean; Griffin, Gilly; Grimshaw, Jeremy M; Hutton, Brian; Lalu, Manoj M; Macleod, Malcolm; Marshall, John; Mei, Shirley H J; Rudnicki, Michael; Stewart, Duncan J; Turgeon, Alexis F; McIntyre, Lauralyn

    2016-01-01

    Incomplete reporting of study methods and results has become a focal point for failures in the reproducibility and translation of findings from preclinical research. Here we demonstrate that incomplete reporting of preclinical research is not limited to a few elements of research design, but rather is a broader problem that extends to the reporting of the methods and results. We evaluated 47 preclinical research studies from a systematic review of acute lung injury that use mesenchymal stem cells (MSCs) as a treatment. We operationalized the ARRIVE (Animal Research: Reporting of In Vivo Experiments) reporting guidelines for pre-clinical studies into 109 discrete reporting sub-items and extracted 5,123 data elements. Overall, studies reported less than half (47%) of all sub-items (median 51 items; range 37-64). Across all studies, the Methods Section reported less than half (45%) and the Results Section reported less than a third (29%). There was no association between journal impact factor and completeness of reporting, which suggests that incomplete reporting of preclinical research occurs across all journals regardless of their perceived prestige. Incomplete reporting of methods and results will impede attempts to replicate research findings and maximize the value of preclinical studies.

  5. 16 CFR 1702.4 - Petitions with insufficient or incomplete information.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 16 Commercial Practices 2 2011-01-01 2011-01-01 false Petitions with insufficient or incomplete information. 1702.4 Section 1702.4 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION POISON PREVENTION PACKAGING ACT OF 1970 REGULATIONS PETITIONS FOR EXEMPTIONS FROM POISON PREVENTION PACKAGING ACT...

  6. 16 CFR 1702.4 - Petitions with insufficient or incomplete information.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Petitions with insufficient or incomplete information. 1702.4 Section 1702.4 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION POISON PREVENTION PACKAGING ACT OF 1970 REGULATIONS PETITIONS FOR EXEMPTIONS FROM POISON PREVENTION PACKAGING ACT...

  7. 16 CFR 1702.4 - Petitions with insufficient or incomplete information.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 16 Commercial Practices 2 2012-01-01 2012-01-01 false Petitions with insufficient or incomplete information. 1702.4 Section 1702.4 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION POISON PREVENTION PACKAGING ACT OF 1970 REGULATIONS PETITIONS FOR EXEMPTIONS FROM POISON PREVENTION PACKAGING ACT...

  8. 16 CFR 1702.4 - Petitions with insufficient or incomplete information.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 16 Commercial Practices 2 2013-01-01 2013-01-01 false Petitions with insufficient or incomplete information. 1702.4 Section 1702.4 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION POISON PREVENTION PACKAGING ACT OF 1970 REGULATIONS PETITIONS FOR EXEMPTIONS FROM POISON PREVENTION PACKAGING ACT...

  9. 16 CFR 1702.4 - Petitions with insufficient or incomplete information.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 16 Commercial Practices 2 2014-01-01 2014-01-01 false Petitions with insufficient or incomplete information. 1702.4 Section 1702.4 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION POISON PREVENTION PACKAGING ACT OF 1970 REGULATIONS PETITIONS FOR EXEMPTIONS FROM POISON PREVENTION PACKAGING ACT...

  10. Review of "Incomplete: How Middle Class Schools Aren't Making the Grade". Think Tank Review

    ERIC Educational Resources Information Center

    Baker, Bruce D.

    2011-01-01

    "Incomplete: How Middle Class Schools Aren't Making the Grade" is a new report from Third Way, a Washington, D.C.-based policy think tank. The report aims to convince parents, taxpayers and policymakers that they should be as concerned about middle-class schools not making the grade as they are about the failures of the nation's large, poor, urban…

  11. Primary repair of a large incomplete sternal cleft in an asymptomatic infant with Prolene mesh.

    PubMed

    Baqain, Eyad B; Lataifeh, Isam M; Khriesat, Wadah M; Fraiwan, Nayef M; Armooti, Mohamed A

    2008-10-01

    A cleft of the sternum is a rare congenital anomaly, often diagnosed as an asymptomatic condition at birth. We present a case of a large incomplete sternal cleft in a full-term baby boy. Surgical repair of the sternum with the use of Prolene mesh was performed during the neonatal period without cardiac compression.

  12. PRODUCTS OF INCOMPLETE COMBUSTION FROM DIRECT BURNING OF PENTACHLOROPHENOL-TREATED WOOD WASTES

    EPA Science Inventory

    The report gives results of a study to identify potential air pollution problems from the combustion of waste wood treated with pentachlorophenol preservative for energy production in a boiler. The study emphasized the characterization of the products of incomplete combustion (PI...

  13. EMISSIONS OF TRACE PRODUCTS OF INCOMPLETE COMBUSTION FROM A PILOT-SCALE INCINERATOR SECONDARY COMBUSTION CHAMBER

    EPA Science Inventory

    Experiments were performed on a 73 kW rotary kiln incinerator simulator equipped with a 73 kW secondary combustion chamber (SCC) to examine emissions of products of incomplete combustion (PICs) resulting from incineration of carbon tetrachloride (CCl4) and dichlorometh...

  14. The Logical Heart of a Classic Proof Revisited: A Guide to Godel's "Incompleteness" Theorems

    ERIC Educational Resources Information Center

    Padula, Janice

    2011-01-01

    The study of Kurt Godel's proof of the "incompleteness" of a formal system such as "Principia Mathematica" is a great way to stimulate students' thinking and creative processes and interest in mathematics and its important developments. This article describes salient features of the proof together with ways to deal with potential difficulties for…

  15. The (Il)logical Problem of Heritage Speaker Bilingualism and Incomplete Acquisition

    ERIC Educational Resources Information Center

    Cabo, Diego Pascual Y.; Rothman, Jason

    2012-01-01

    This Forum challenges and problematizes the term "incomplete acquisition," which has been widely used to describe the state of competence of heritage speaker (HS) bilinguals for well over a decade (see, e.g., Montrul, 2008). It is suggested and defended that HS competence, while often different from monolingual peers, is in fact not incomplete…

  16. 15 CFR 30.47 - Clearance or departure of carriers under bond on incomplete manifest.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 15 Commerce and Foreign Trade 1 2012-01-01 2012-01-01 false Clearance or departure of carriers under bond on incomplete manifest. 30.47 Section 30.47 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade BUREAU OF THE CENSUS, DEPARTMENT OF COMMERCE FOREIGN TRADE...

  17. 15 CFR 30.47 - Clearance or departure of carriers under bond on incomplete manifest.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 15 Commerce and Foreign Trade 1 2013-01-01 2013-01-01 false Clearance or departure of carriers under bond on incomplete manifest. 30.47 Section 30.47 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade BUREAU OF THE CENSUS, DEPARTMENT OF COMMERCE FOREIGN TRADE...

  18. 15 CFR 30.47 - Clearance or departure of carriers under bond on incomplete manifest.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 15 Commerce and Foreign Trade 1 2011-01-01 2011-01-01 false Clearance or departure of carriers under bond on incomplete manifest. 30.47 Section 30.47 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade BUREAU OF THE CENSUS, DEPARTMENT OF COMMERCE FOREIGN TRADE...

  19. SparseNCA: Sparse Network Component Analysis for Recovering Transcription Factor Activities with Incomplete Prior Information.

    PubMed

    Noor, Amina; Ahmad, Aitzaz; Serpedin, Erchin

    2015-10-27

    Network component analysis (NCA) is an important method for inferring transcriptional regulatory networks (TRNs) and recovering transcription factor activities (TFAs) using gene expression data, and the prior information about the connectivity matrix. The algorithms currently available crucially depend on the completeness of this prior information. However, inaccuracies in the measurement process may render incompleteness in the available knowledge about the connectivity matrix. Hence, computationally efficient algorithms are needed to overcome the possible incompleteness in the available data. We present a sparse network component analysis algorithm (sparseNCA), which incorporates the effect of incompleteness in the estimation of TRNs by imposing an additional sparsity constraint using the `1 norm, which results in a greater estimation accuracy. In order to improve the computational efficiency, an iterative re-weighted `2 method is proposed for the NCA problem which not only promotes sparsity but is hundreds of times faster than the `1 norm based solution. The performance of sparseNCA is rigorously compared to that of FastNCA and NINCA using synthetic data as well as real data. It is shown that sparseNCA outperforms the existing state-of-the-art algorithms both in terms of estimation accuracy and consistency with the added advantage of low computational complexity. The performance of sparseNCA compared to its predecessors is particularly pronounced in case of incomplete prior information about the sparsity of the network. Subnetwork analysis is performed on the E.coli data which reiterates the superior consistency of the proposed algorithm.

  20. Tests of Homoscedasticity, Normality, and Missing Completely at Random for Incomplete Multivariate Data

    ERIC Educational Resources Information Center

    Jamshidian, Mortaza; Jalal, Siavash

    2010-01-01

    Test of homogeneity of covariances (or homoscedasticity) among several groups has many applications in statistical analysis. In the context of incomplete data analysis, tests of homoscedasticity among groups of cases with identical missing data patterns have been proposed to test whether data are missing completely at random (MCAR). These tests of…

  1. Examining the Missing Completely at Random Mechanism in Incomplete Data Sets: A Multiple Testing Approach

    ERIC Educational Resources Information Center

    Raykov, Tenko; Lichtenberg, Peter A.; Paulson, Daniel

    2012-01-01

    A multiple testing procedure for examining implications of the missing completely at random (MCAR) mechanism in incomplete data sets is discussed. The approach uses the false discovery rate concept and is concerned with testing group differences on a set of variables. The method can be used for ascertaining violations of MCAR and disproving this…

  2. Estimation of the KR20 Reliability Coefficient When Data Are Incomplete.

    ERIC Educational Resources Information Center

    Huynh, Huynh

    Three techniques for estimating Kuder Richardson reliability (KR20) coefficients for incomplete data are contrasted. The methods are: (1) Henderson's Method 1 (analysis of variance, or ANOVA); (2) Henderson's Method 3 (FITCO); and (3) Koch's method of symmetric sums (SYSUM). A Monte Carlo simulation was used to assess the precision of the three…

  3. Double propensity-score adjustment: A solution to design bias or bias due to incomplete matching.

    PubMed

    Austin, Peter C

    2017-02-01

    Propensity-score matching is frequently used to reduce the effects of confounding when using observational data to estimate the effects of treatments. Matching allows one to estimate the average effect of treatment in the treated. Rosenbaum and Rubin coined the term "bias due to incomplete matching" to describe the bias that can occur when some treated subjects are excluded from the matched sample because no appropriate control subject was available. The presence of incomplete matching raises important questions around the generalizability of estimated treatment effects to the entire population of treated subjects. We describe an analytic solution to address the bias due to incomplete matching. Our method is based on using optimal or nearest neighbor matching, rather than caliper matching (which frequently results in the exclusion of some treated subjects). Within the sample matched on the propensity score, covariate adjustment using the propensity score is then employed to impute missing potential outcomes under lack of treatment for each treated subject. Using Monte Carlo simulations, we found that the proposed method resulted in estimates of treatment effect that were essentially unbiased. This method resulted in decreased bias compared to caliper matching alone and compared to either optimal matching or nearest neighbor matching alone. Caliper matching alone resulted in design bias or bias due to incomplete matching, while optimal matching or nearest neighbor matching alone resulted in bias due to residual confounding. The proposed method also tended to result in estimates with decreased mean squared error compared to when caliper matching was used.

  4. Masseteric-facial nerve transposition for reanimation of the smile in incomplete facial paralysis.

    PubMed

    Hontanilla, Bernardo; Marre, Diego

    2015-12-01

    Incomplete facial paralysis occurs in about a third of patients with Bell's palsy. Although their faces are symmetrical at rest, when they smile they have varying degrees of disfigurement. Currently, cross-face nerve grafting is one of the most useful techniques for reanimation. Transfer of the masseteric nerve, although widely used for complete paralysis, has not to our knowledge been reported for incomplete palsy. Between December 2008 and November 2013, we reanimated the faces of 9 patients (2 men and 7 women) with incomplete unilateral facial paralysis with transposition of the masseteric nerve. Sex, age at operation, cause of paralysis, duration of denervation, recipient nerves used, and duration of follow-up were recorded. Commissural excursion, velocity, and patients' satisfaction were evaluated with the FACIAL CLIMA and a questionnaire, respectively. The mean (SD) age at operation was 39 (±6) years and the duration of denervation was 29 (±19) months. There were no complications that required further intervention. Duration of follow-up ranged from 6-26 months. FACIAL CLIMA showed improvement in both commissural excursion and velocity of more than two thirds in 6 patients, more than one half in 2 patients and less than one half in one. Qualitative evaluation showed a slight or pronounced improvement in 7/9 patients. The masseteric nerve is a reliable alternative for reanimation of the smile in patients with incomplete facial paralysis. Its main advantages include its consistent anatomy, a one-stage operation, and low morbidity at the donor site.

  5. DEVELOPMENT OF A HAZARDOUS WASTE INCINERATOR TARGET ANALYTE LIST OF PRODUCTS OF INCOMPLETE COMBUSTION

    EPA Science Inventory

    The report gives results of pilot-scale incineration testing to develop a comprehensive list of products of incomplete combustion (PICs) from hazardous waste combustion (HWC) systems. Project goals were to: (1) identify the total mass of organic compounds sufficiently to estimate...

  6. Probabilistic learning from incomplete data for recognition of activities of daily living in smart homes.

    PubMed

    Zhang, Shuai; McClean, Sally I; Scotney, Bryan W

    2012-05-01

    Learning behavioral patterns for activities of daily living in a smart home environment can be challenged by the limited number of training data that may be available. This may be due to the infrequent repetition of routine activities (e.g., once daily), the expense of using observers to label activities, and the intrusion that would be caused by the presence of observers over long time periods. It is important, therefore, to make as much use of any labeled data that are collected, however, incomplete these data may be. In this paper, we propose an algorithm for learning behavioral patterns for multi-inhabitants living in a single smart home environment, by making full use of all limited labeled activities, including incomplete data resulting from unreliable low-level sensors in this environment. Through maximum-likelihood estimation, using Expectation-Maximization, we build a model that captures both environmental uncertainties from sensor readings and user uncertainties, including variations in how individuals carry out activities. Our algorithm outperforms models that cannot handle data incompleteness, with increasing performance gains as incompleteness increases. The approach also enables the impact of particular sensors to be assessed and can thus inform sensor maintenance and deployment.

  7. Thoracoscopic anterior ‘fissure first’ technique for left lung cancer with an incomplete fissure

    PubMed Central

    Samejima, Joji; Matsuura, Yosuke; Nakao, Masayuki; Uehara, Hirofumi; Nakagawa, Ken; Masuda, Munetaka; Okumura, Sakae

    2016-01-01

    Background Dealing with incomplete lung fissures during thoracoscopic surgery is difficult. Our objective was to evaluate the efficacy and safety of a thoracoscopic anterior ‘fissure first’ technique for dealing with incomplete left lung fissures. Methods One hundred and seventy patients underwent left upper lobectomy or left lower lobectomy between April 2008 and July 2014. Of these, 34 patients underwent surgery using a thoracoscopic anterior ‘fissure first’ technique for incomplete fissures (group A) and 136 underwent surgery using a conventional thoracoscopic method for unfused fissures (group B). A four-port complete thoracoscopic approach was used in all patients. After completion of the fissure, hilar lymphadenectomy was performed in the conventional manner. Results There were no significant differences between the two groups in operating time, blood loss, or duration of chest tube drainage. Patients in group A required more staple cartridges than those in group B (mean number of cartridges, 2.4 vs. 1.1; P<0.01). The two groups did not significantly differ with regard to the prevalence of air leaks (12% vs. 4%; P=0.11), either prolonged or delayed. Conclusions We found that a thoracoscopic anterior ‘fissure first’ technique for left lung cancer with an incomplete fissure enabled hilar lymphadenectomy to be performed in the conventional manner without any increase in the prevalence of air leaks, operating time, or duration of chest tube drainage. This technique should be considered for use in left upper lobectomy or left lower lobectomy in patients with an incomplete fissure. PMID:28066589

  8. A Composite-Likelihood Method for Detecting Incomplete Selective Sweep from Population Genomic Data.

    PubMed

    Vy, Ha My T; Kim, Yuseob

    2015-06-01

    Adaptive evolution occurs as beneficial mutations arise and then increase in frequency by positive natural selection. How, when, and where in the genome such evolutionary events occur is a fundamental question in evolutionary biology. It is possible to detect ongoing positive selection or an incomplete selective sweep in species with sexual reproduction because, when a beneficial mutation is on the way to fixation, homologous chromosomes in the population are divided into two groups: one carrying the beneficial allele with very low polymorphism at nearby linked loci and the other carrying the ancestral allele with a normal pattern of sequence variation. Previous studies developed long-range haplotype tests to capture this difference between two groups as the signal of an incomplete selective sweep. In this study, we propose a composite-likelihood-ratio (CLR) test for detecting incomplete selective sweeps based on the joint sampling probabilities for allele frequencies of two groups as a function of strength of selection and recombination rate. Tested against simulated data, this method yielded statistical power and accuracy in parameter estimation that are higher than the iHS test and comparable to the more recently developed nSL test. This procedure was also applied to African Drosophila melanogaster population genomic data to detect candidate genes under ongoing positive selection. Upon visual inspection of sequence polymorphism, candidates detected by our CLR method exhibited clear haplotype structures predicted under incomplete selective sweeps. Our results suggest that different methods capture different aspects of genetic information regarding incomplete sweeps and thus are partially complementary to each other.

  9. The impact of incomplete knowledge on evaluation: an experimental benchmark for protein function prediction

    PubMed Central

    Huttenhower, Curtis; Hibbs, Matthew A.; Myers, Chad L.; Caudy, Amy A.; Hess, David C.; Troyanskaya, Olga G.

    2009-01-01

    Motivation: Rapidly expanding repositories of highly informative genomic data have generated increasing interest in methods for protein function prediction and inference of biological networks. The successful application of supervised machine learning to these tasks requires a gold standard for protein function: a trusted set of correct examples, which can be used to assess performance through cross-validation or other statistical approaches. Since gene annotation is incomplete for even the best studied model organisms, the biological reliability of such evaluations may be called into question. Results: We address this concern by constructing and analyzing an experimentally based gold standard through comprehensive validation of protein function predictions for mitochondrion biogenesis in Saccharomyces cerevisiae. Specifically, we determine that (i) current machine learning approaches are able to generalize and predict novel biology from an incomplete gold standard and (ii) incomplete functional annotations adversely affect the evaluation of machine learning performance. While computational approaches performed better than predicted in the face of incomplete data, relative comparison of competing approaches—even those employing the same training data—is problematic with a sparse gold standard. Incomplete knowledge causes individual methods' performances to be differentially underestimated, resulting in misleading performance evaluations. We provide a benchmark gold standard for yeast mitochondria to complement current databases and an analysis of our experimental results in the hopes of mitigating these effects in future comparative evaluations. Availability: The mitochondrial benchmark gold standard, as well as experimental results and additional data, is available at http://function.princeton.edu/mitochondria Contact: ogt@cs.princeton.edu Supplementary information: Supplementary data are available at Bioinformatics online. PMID:19561015

  10. Is JPC = 3-+ molecule possible?

    NASA Astrophysics Data System (ADS)

    Zhu, Wei; Liu, Yan-Rui; Yao, Tao

    2015-02-01

    The confirmation of charged charmonium-like states indicates that heavy quark molecules should exist. Here we discuss the possibility of a molecule state with JPC = 3-+. In a one-boson-exchange model investigation for the S wave C = + D*D¯2* states, one finds that the strongest attraction is in the case J = 3 and I = 0 for both π and σ exchanges. Numerical analysis indicates that this hadronic bound state might exist if a phenomenological cutoff parameter around 2.3 GeV (1.5 GeV) is reasonable with a dipole (monopole) type form factor in the one-pion-exchange model. The cutoff for binding solutions may be reduced to a smaller value once the σ exchange contribution is included. If a state around the D*D¯2* threshold (≈4472 MeV) in the channel J/ψω (P wave) is observed, the heavy quark spin symmetry implies that it is not a cc¯ meson and the JPC are likely to be 3-+. Supported by National Natural Science Foundation of China (11275115), Shandong Province Natural Science Foundation (ZR2010AM023), SRF for ROCS, SEM, and Independent Innovation Foundation of Shandong University

  11. Molecules in Magnetic Fields

    NASA Astrophysics Data System (ADS)

    Berdyugina, Svetlana

    2015-08-01

    Molecules probe cool matter in the Universe and various astrophysical objects. Their ability to sense magnetic fields provides new insights into magnetic properties of these objects. During the past fifteen years we have carried out a theoretical study of molecular magnetic effects such as the Zeeman, Paschen-Back and Hanle effects and their applications for inferring magnetic structures and spatial inhomogeneities on the Sun, cool stars, brown dwarfs, and exoplanets from molecular spectro-polarimetry (e.g., Berdyugina 2011). Here, we present an overview of this study and compare our theoretical predictions with recent laboratory measurements of magnetic properties of some molecules. We present also a new web-based tool to compute molecular magnetic effects and polarized spectra which is supported by the ERC Advanced Grant HotMol.

  12. Lunar volatile depletion due to incomplete accretion within an impact-generated disk

    NASA Astrophysics Data System (ADS)

    Canup, Robin M.; Visscher, Channon; Salmon, Julien; Fegley, Bruce

    2015-11-01

    The Moon likely formed from a disk produced by a giant impact with the Earth. The Moon and the bulk silicate Earth (BSE) share many compositional similarities (e.g., Ringwood 1979; Dauphas et al. 2014). However compared with the BSE, the Moon is more depleted in volatile elements, including moderately volatile K and Na, as well as more highly volatile elements, e.g., Zn (e.g., O’Neill 1991; Taylor & Wieczorek 2014). The origin of this depletion is poorly understood. Prior results suggest escape (e.g., Paniello et al. 2012), but at least hydrodynamic escape appears minimal for expected disk conditions (Nakajima & Stevenson 2014).In the limit of no escape and a closed system, a depletion could instead result if disk volatiles were preferentially accreted by the Earth rather than by the Moon. Taylor et al. (2006) advocated that the lunar depletion pattern is most consistent with incomplete condensation from an initially high temperature vapor, with the accretion of condensates by the Moon “cut-off” at a temperature allowing incorporation of a small component of alkalis (e.g., K and Na) but only a tiny fraction of more volatile elements (e.g., Zn). Neither the mechanism that would produce the cut-off, nor what the relevant cut-off temperature would be in an oxygen-rich protolunar disk (e.g., Visscher & Fegley 2013), were known.We identify a mechanism wherein a depletion results because disk volatiles are preferentially accreted by the Earth rather than by the Moon. The Moon may acquire the final tens to 60% of its mass from melt originating from the inner portions of the disk (Salmon & Canup 2012). Initially the inner disk melt is hot and volatile-poor, but as the disk cools, volatiles condense. We combine dynamical, thermal and chemical models to show that delivery of inner disk material to the Moon effectively ends as gravitational interactions cause the Moon’s orbit to expand away from the disk, with this cut-off occurring prior to condensation of key

  13. Strange skyrmion molecules

    NASA Astrophysics Data System (ADS)

    Kopeliovich, Vladimir B.; Stern, Boris E.

    1997-05-01

    Composed skyrmions with B=2, strangeness content close to 0.5 and the binding energy of several tens of Mev are described. These skyrmions are obtained starting from the system of two B=1 hedgehogs located in different SU(2) subgroups of SU(3) and have the mass and baryon number distribution of molecular (dipole) type. The quantization of zero modes of skyrmion molecules and physics consequences of their existence are discussed.

  14. Strange skyrmion molecules

    SciTech Connect

    Kopeliovich, Vladimir B.; Stern, Boris E.

    1997-05-20

    Composed skyrmions with B=2, strangeness content close to 0.5 and the binding energy of several tens of Mev are described. These skyrmions are obtained starting from the system of two B=1 hedgehogs located in different SU(2) subgroups of SU(3) and have the mass and baryon number distribution of molecular (dipole) type. The quantization of zero modes of skyrmion molecules and physics consequences of their existence are discussed.

  15. Laser-Assisted Single Molecule Refolding

    NASA Astrophysics Data System (ADS)

    Zhao, Rui; Marshall, Myles; Aleman, Elvin; Lamichhane, Rajan; Rueda, David

    2010-03-01

    In vivo, many RNA molecules can adopt multiple conformations depending on their biological context such as the HIV Dimerization Initiation Sequence (DIS) or the DsrA RNA in bacteria. It is quite common that the initial interaction between the two RNAs takes place via complementary unpaired regions, thus forming a so-called kissing complex. However, the exact kinetic mechanism by which the two RNA molecules reach the dimerized state is still not well understood. To investigate the refolding energy surface of RNA molecules, we have developed new technology based on the combination of single molecule spectroscopy with laser induced temperature jump kinetics, called Laser Assisted Single-molecule Refolding (LASR). LASR enables us to induce folding reactions of otherwise kinetically trapped RNAs at the single molecule level, and to characterize their folding landscape. LASR provides an exciting new approach to study molecular memory effects and kinetically trapped RNAs in general. LASR should be readily applicable to study DNA and protein folding as well.

  16. Sol-gel method for encapsulating molecules

    DOEpatents

    Brinker, C. Jeffrey; Ashley, Carol S.; Bhatia, Rimple; Singh, Anup K.

    2002-01-01

    A method for encapsulating organic molecules, and in particular, biomolecules using sol-gel chemistry. A silica sol is prepared from an aqueous alkali metal silicate solution, such as a mixture of silicon dioxide and sodium or potassium oxide in water. The pH is adjusted to a suitably low value to stabilize the sol by minimizing the rate of siloxane condensation, thereby allowing storage stability of the sol prior to gelation. The organic molecules, generally in solution, is then added with the organic molecules being encapsulated in the sol matrix. After aging, either a thin film can be prepared or a gel can be formed with the encapsulated molecules. Depending upon the acid used, pH, and other processing conditions, the gelation time can be from one minute up to several days. In the method of the present invention, no alcohols are generated as by-products during the sol-gel and encapsulation steps. The organic molecules can be added at any desired pH value, where the pH value is generally chosen to achieve the desired reactivity of the organic molecules. The method of the present invention thereby presents a sufficiently mild encapsulation method to retain a significant portion of the activity of the biomolecules, compared with the activity of the biomolecules in free solution.

  17. Unwinding of circular helicoidal molecules vs. size

    NASA Astrophysics Data System (ADS)

    Zoli, Marco

    2015-04-01

    The thermodynamical stability of a set of circular double helical molecules is analyzed by path integral techniques. The minicircles differ only in i) the radius and ii) the number of base pairs (N) arranged along the molecule axis. Instead, the rise distance is kept constant. For any molecule size, the computational method simulates a broad ensemble of possible helicoidal configurations while the partition function is a sum over the path trajectories describing the base pair fluctuational states. The stablest helical repeat of every minicircle is determined by free-energy minimization. We find that, for molecules with N larger than 100, the helical repeat grows linearly with size and the twist number is constant. On the other hand, by reducing the size below 100 base pairs, the double helices sharply unwind and the twist number drops to one for N = 20. This is predicted as the minimum size for the existence of helicoidal molecules in the closed form. The helix unwinding appears as a strategy to release the bending stress associated to the circularization of the molecules.

  18. Model molecules mimicking asphaltenes.

    PubMed

    Sjöblom, Johan; Simon, Sébastien; Xu, Zhenghe

    2015-04-01

    Asphalthenes are typically defined as the fraction of petroleum insoluble in n-alkanes (typically heptane, but also hexane or pentane) but soluble in toluene. This fraction causes problems of emulsion formation and deposition/precipitation during crude oil production, processing and transport. From the definition it follows that asphaltenes are not a homogeneous fraction but is composed of molecules polydisperse in molecular weight, structure and functionalities. Their complexity makes the understanding of their properties difficult. Proper model molecules with well-defined structures which can resemble the properties of real asphaltenes can help to improve this understanding. Over the last ten years different research groups have proposed different asphaltene model molecules and studied them to determine how well they can mimic the properties of asphaltenes and determine the mechanisms behind the properties of asphaltenes. This article reviews the properties of the different classes of model compounds proposed and present their properties by comparison with fractionated asphaltenes. After presenting the interest of developing model asphaltenes, the composition and properties of asphaltenes are presented, followed by the presentation of approaches and accomplishments of different schools working on asphaltene model compounds. The presentation of bulk and interfacial properties of perylene-based model asphaltene compounds developed by Sjöblom et al. is the subject of the next part. Finally the emulsion-stabilization properties of fractionated asphaltenes and model asphaltene compounds is presented and discussed.

  19. Single Molecule Mechanochemistry

    NASA Astrophysics Data System (ADS)

    Li, Shaowei; Zhang, Yanxing; Ho, Wilson; Wu, Ruqian; Ruqian Wu, Yanxing Zhang Team; Wilson Ho, Shaowei Li Team

    Mechanical forces can be used to trigger chemical reactions through bending and stretching of chemical bonds. Using the reciprocating movement of the tip of a scanning tunneling microscope (STM), mechanical energy can be provided to a single molecule sandwiched between the tip and substrate. When the mechanical pulse center was moved to the outer ring feature of a CO molecule, the reaction rate was significantly increased compared with bare Cu surface and over Au atoms. First, DFT calculations show that the presence of CO makes the Cu cavity more attractive toward H2 Second, H2 prefers the horizontal adsorption geometry in the Cu-Cu and Au-Cu cavities and no hybridization occurs between the antibonding states of H2 and states of Cu atoms. While H2 loses electrons from its bonding state in all three cavities, the filling of its anti-bonding state only occurs in the CO-Cu cavity. Both make the CO-Cu cavity much more effectively to chop the H2 molecule. Work was supported by the National Science Foundation Center for Chemical Innovation on Chemistry at the Space-Time Limit (CaSTL) under Grant No. CHE-1414466.

  20. Studying how protein crystals form

    NASA Technical Reports Server (NTRS)

    2000-01-01

    Watching molecules of the iron-storing protein apoferritin come together to form a nucleus reveals some interesting behavior. In this series of images, researchers observed clusters of four molecules at the corners of a diamond shape (top). As more molecules attach to the cluster, they arrange themselves into rods (second from top), and a raft-like configuration of molecules forms the critical nucleus (third from top), suggesting that crystal growth is much slower than it could be were the molecules arranged in a more compact formation. In the final image, a crystallite consisting of three layers containing approximately 60 to 70 molecules each is formed. Atomic force microscopy made visualizing the process of nucleation possible for the first time. The principal investigator is Peter Vekilov, of the University of Alabama in Huntsville. Vekilov's team at UAH studies protein solutions as they change phases from liquids to crystalline solids. They want to know if the molecules in the solution interact with one another, and if so, how, from the perspectives of thermodynamics and kinetics. They want to understand which forces -- electrical, electrostatic, hydrodynamic, or other kinds of forces -- are responsible for the interactions. They also study nucleation, the begirning stage of crystallization. This process is important to understand because it sets the stage for crystal growth in all kinds of solutions and liquid melts that are important in such diverse fields as agriculture, medicine, and the fabrication of metal components. Nucleation can determine the rate of crystal growth, the number of crystals that will be formed, and the quality and size of the crystals.

  1. Modelling water molecules inside cyclic peptide nanotubes

    NASA Astrophysics Data System (ADS)

    Tiangtrong, Prangsai; Thamwattana, Ngamta; Baowan, Duangkamon

    2016-03-01

    Cyclic peptide nanotubes occur during the self-assembly process of cyclic peptides. Due to the ease of synthesis and ability to control the properties of outer surface and inner diameter by manipulating the functional side chains and the number of amino acids, cyclic peptide nanotubes have attracted much interest from many research areas. A potential application of peptide nanotubes is their use as artificial transmembrane channels for transporting ions, biomolecules and waters into cells. Here, we use the Lennard-Jones potential and a continuum approach to study the interaction of a water molecule in a cyclo[(- D-Ala- L-Ala)_4-] peptide nanotube. Assuming that each unit of a nanotube comprises an inner and an outer tube and that a water molecule is made up of a sphere of two hydrogen atoms uniformly distributed over its surface and a single oxygen atom at the centre, we determine analytically the interaction energy of the water molecule and the peptide nanotube. Using this energy, we find that, independent of the number of peptide units, the water molecule will be accepted inside the nanotube. Once inside the nanotube, we show that a water molecule prefers to be off-axis, closer to the surface of the inner nanotube. Furthermore, our study of two water molecules inside the peptide nanotube supports the finding that water molecules form an array of a 1-2-1-2 file inside peptide nanotubes. The theoretical study presented here can facilitate thorough understanding of the behaviour of water molecules inside peptide nanotubes for applications, such as artificial transmembrane channels.

  2. Small molecule inhibitors of ebola virus infection.

    PubMed

    Picazo, Edwige; Giordanetto, Fabrizio

    2015-02-01

    Ebola viruses are extremely virulent and highly transmissible. They are responsible for sporadic outbreaks of severe hemorrhagic fevers with human mortality rates of up to 90%. No prophylactic or therapeutic treatments in the form of vaccine, biologicals or small molecule, currently exist. Yet, a wealth of antiviral research on ebola virus is being generated and potential inhibitors have been identified in biological screening and medicinal chemistry programs. Here, we detail the state-of-the-art in small molecule inhibitors of ebola virus infection, with >60 examples, including approved drugs, compounds currently in clinical trials, and more exploratory leads, and summarize the associated in vitro and in vivo evidence for their effectiveness.

  3. Student Use of Physics to Make Sense of Incomplete but Functional VPython Programs in a Lab Setting

    NASA Astrophysics Data System (ADS)

    Weatherford, Shawn A.

    2011-12-01

    Computational activities in Matter & Interactions, an introductory calculus-based physics course, have the instructional goal of providing students with the experience of applying the same set of a small number of fundamental principles to model a wide range of physical systems. However there are significant instructional challenges for students to build computer programs under limited time constraints, especially for students who are unfamiliar with programming languages and concepts. Prior attempts at designing effective computational activities were successful at having students ultimately build working VPython programs under the tutelage of experienced teaching assistants in a studio lab setting. A pilot study revealed that students who completed these computational activities had significant difficultly repeating the exact same tasks and further, had difficulty predicting the animation that would be produced by the example program after interpreting the program code. This study explores the interpretation and prediction tasks as part of an instructional sequence where students are asked to read and comprehend a functional, but incomplete program. Rather than asking students to begin their computational tasks with modifying program code, we explicitly ask students to interpret an existing program that is missing key lines of code. The missing lines of code correspond to the algebraic form of fundamental physics principles or the calculation of forces which would exist between analogous physical objects in the natural world. Students are then asked to draw a prediction of what they would see in the simulation produced by the VPython program and ultimately run the program to evaluate the students' prediction. This study specifically looks at how the participants use physics while interpreting the program code and creating a whiteboard prediction. This study also examines how students evaluate their understanding of the program and modification goals at the

  4. Negative ions of polyatomic molecules.

    PubMed Central

    Christophorou, L G

    1980-01-01

    In this paper general concepts relating to, and recent advances in, the study of negative ions of polyatomic molecules area discussed with emphasis on halocarbons. The topics dealt with in the paper are as follows: basic electron attachment processes, modes of electron capture by molecules, short-lived transient negative ions, dissociative electron attachment to ground-state molecules and to "hot" molecules (effects of temperature on electron attachment), parent negative ions, effect of density, nature, and state of the medium on electron attachment, electron attachment to electronically excited molecules, the binding of attached electrons to molecules ("electron affinity"), and the basic and the applied significance of negative-ion studies. PMID:7428744

  5. Negative ions of polyatomic molecules.

    PubMed

    Christophorou, L G

    1980-06-01

    In this paper general concepts relating to, and recent advances in, the study of negative ions of polyatomic molecules area discussed with emphasis on halocarbons. The topics dealt with in the paper are as follows: basic electron attachment processes, modes of electron capture by molecules, short-lived transient negative ions, dissociative electron attachment to ground-state molecules and to "hot" molecules (effects of temperature on electron attachment), parent negative ions, effect of density, nature, and state of the medium on electron attachment, electron attachment to electronically excited molecules, the binding of attached electrons to molecules ("electron affinity"), and the basic and the applied significance of negative-ion studies.

  6. Identification of the growth hormone-releasing hormone analogue [Pro1, Val14]-hGHRH with an incomplete C-term amidation in a confiscated product.

    PubMed

    Esposito, Simone; Deventer, Koen; Van Eenoo, Peter

    2014-01-01

    In this work, a modified version of the 44 amino acid human growth hormone-releasing hormone (hGHRH(1-44)) containing an N-terminal proline extension, a valine residue in position 14, and a C-terminus amidation (sequence: PYADAIFTNSYRKVVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 ) has been identified in a confiscated product by liquid chromatography-high resolution mass spectrometry (LC-HRMS). Investigation of the product suggests also an incomplete C-term amidation. Similarly to other hGHRH analogues, available in black markets, this peptide can potentially be used as performance-enhancing drug due to its growth hormone releasing activity and therefore it should be considered as a prohibited substance in sport. Additionally, the presence of partially amidated molecule reveals the poor pharmaceutical quality of the preparation, an aspect which represents a big concern for public health as well.

  7. The secondary contact zone of phylogenetic lineages of the Philaenus spumarius (Hemiptera: Aphrophoridae): an example of incomplete allopatric speciation.

    PubMed

    Lis, Agata; Maryańska-Nadachowska, Anna; Lachowska-Cierlik, Dorota; Kajtoch, Lukasz

    2014-01-01

    Previous studies on the phylogeography of the meadow spittlebug Philaenus spumarius (L.) (Hemiptera: Aphrophoridae) suggest the existence of a contact zone of its main phylogenetic lineages along mountain chains in Europe and western Asia. This study presents a detailed examination of the population genetics of P. spumarius within the Carpathian Mountains. The main objective was to determine whether the populations inhabiting that area consist of individuals belonging to different genetic units and whether the observed pattern could be an example of secondary contact zone which formed after incomplete allopatric speciation. Specimens from six transects across the Carpathian arc were examined. The mitochondrial phylogeography of the meadow spittlebug in the examined area clearly shows that individuals from both main clades meet and mix there. Representatives of all three main EF1-α clades were also found. The present distribution of the main clades with a zone of overlap along the mountain ranges may suggest that these phylogenetic lineages form a young hybrid zone. Moreover, a limited number of individuals were shown to possess heteroplasmic mitochondrial DNA, which gives additional support to intraspecific hybridization. P. spumarius could be used in future work as an excellent model species in investigating population genetics, intraspecific hybridization, and speciation in progress.

  8. The secondary contact zone of phylogenetic lineages of the Philaenus spumarius (Hemiptera: Aphrophoridae: Cercopidae): an example of incomplete allopatric speciation.

    PubMed

    Lis, Agata; Maryańska-Nadachowska, Anna; Lachowska-Cierlik, Dorota; Kajtoch, Łukasz

    2014-01-01

    Previous studies on the phylogeography of the meadow spittlebug Philaenus spumarius (L.) (Hemiptera: Aphrophoridae: Cercopidae) suggest the existence of a contact zone of its main phylogenetic lineages along mountain chains in Europe and western Asia. This study presents a detailed examination of the population genetics of P. spumarius within the Carpathian Mountains. The main objective was to determine whether the populations inhabiting that area consist of individuals belonging to different genetic units and whether the observed pattern could be an example of secondary contact zone which formed after incomplete allopatric speciation. Specimens from six transects across the Carpathian arc were examined. The mitochondrial phylogeography of the meadow spittlebug in the examined area clearly shows that individuals from both main clades meet and mix there. Representatives of all three main EF1-α clades were also found. The present distribution of the main clades with a zone of overlap along the mountain ranges may suggest that these phylogenetic lineages form a young hybrid zone. Moreover, a limited number of individuals were shown to possess heteroplasmic mitochondrial DNA, which gives additional support to intraspecific hybridization. P. spumarius could be used in future work as an excellent model species in investigating population genetics, intraspecific hybridization, and speciation in progress.

  9. Watching single molecules dance

    NASA Astrophysics Data System (ADS)

    Mehta, Amit Dinesh

    Molecular motors convert chemical energy, from ATP hydrolysis or ion flow, into mechanical motion. A variety of increasingly precise mechanical probes have been developed to monitor and perturb these motors at the single molecule level. Several outstanding questions can be best approached at the single molecule level. These include: how far does a motor progress per energy quanta consumed? how does its reaction cycle respond to load? how many productive catalytic cycles can it undergo per diffusional encounter with its track? and what is the mechanical stiffness of a single molecule connection? A dual beam optical trap, in conjunction with in vitro ensemble motility assays, has been used to characterize two members of the myosin superfamily: muscle myosin II and chick brain myosin V. Both move the helical polymer actin, but myosin II acts in large ensembles to drive muscle contraction or cytokinesis, while myosin V acts in small numbers to transport vesicles. An optical trapping apparatus was rendered sufficiently precise to identify a myosin working stroke with 1nm or so, barring systematic errors such as those perhaps due to random protein orientations. This and other light microscopic motility assays were used to characterize myosin V: unlike myosin II this vesicle transport protein moves through many increments of travel while remaining strongly bound to a single actin filament. The step size, stall force, and travel distance of myosin V reveal a remarkably efficient motor capable of moving along a helical track for over a micrometer without significantly spiraling around it. Such properties are fully consistent with the putative role of an organelle transport motor, present in small numbers to maintain movement over long ranges relative to cellular size scales. The contrast between myosin II and myosin V resembles that between a human running on the moon and one walking on earth, where the former allows for faster motion when in larger ensembles but for less

  10. Molecules in crystals

    NASA Astrophysics Data System (ADS)

    Spackman, Mark A.

    2013-04-01

    Hirshfeld surface analysis has developed from the serendipitous discovery of a novel partitioning of the crystal electron density into discrete molecular fragments, to a suite of computational tools used widely for the identification, analysis and discussion of intermolecular interactions in molecular crystals. The relationship between the Hirshfeld surface and very early ideas on the internal structure of crystals is outlined, and applications of Hirshfeld surface analysis are presented for three molecules of historical importance in the development of modern x-ray crystallography: hexamethylbenzene, hexamethylenetetramine and diketopiperazine.

  11. Computer Modelling of Biological Molecules: Free Resources on the Internet.

    ERIC Educational Resources Information Center

    Millar, Neil

    1996-01-01

    Describes a three-dimensional computer modeling system for biological molecules which is suitable for sixth-form teaching. Consists of the modeling program "RasMol" together with structure files of proteins, DNA, and small biological molecules. Describes how the whole system can be downloaded from various sites on the Internet.…

  12. Elements of the theory of molecular spectra. [multiatomic molecules

    NASA Technical Reports Server (NTRS)

    Gribov, L. A.

    1979-01-01

    The basic aspects of the theory concerning the spectra of multiatomic molecules are presented. The classification of the forms of motions in a molecule, the methods for determining the corresponding Schroudinger levels, the spectral types and the selection rules are discussed in order to identify their presence and state in outer space.

  13. Colonisation and competition dynamics can explain incomplete sterilisation parasitism in ant-plant symbioses.

    PubMed

    Tarnita, Corina E; Palmer, Todd M; Pringle, Robert M

    2014-10-01

    Sterilisation of parasites prevents host reproduction, thereby diverting host resources to their own benefit. Previous theory predicts that parasites should evolve maximum virulence, yet hosts are often incompletely sterilised. Whereas prior attempts to resolve this paradox have sought evolutionary explanations, we present theory and experiments showing that incomplete sterilisation can arise from ecologically driven fluctuations in parasite load. The African ant-plant Acacia drepanolobium reproduced more when occupied by small colonies of the sterilising symbiont Crematogaster nigriceps. In nature, small colonies result from interference competition between ant colonies; these territorial conflicts thus provide intermittent windows of opportunity for host reproduction. Our mean-field model shows that numerical insufficiency of parasites can produce partial sterilisation of host populations, creating the appearance of reduced virulence even if ants have evolved to sterilise completely. This general framework helps explain both the apparent ubiquity of partial sterilisation parasitism and the ability of these symbiotic associations to persist.

  14. A Ranking Procedure by Incomplete Pairwise Comparisons Using Information Entropy and Dempster-Shafer Evidence Theory

    PubMed Central

    Pan, Dongbo; Lu, Xi; Liu, Juan; Deng, Yong

    2014-01-01

    Decision-making, as a way to discover the preference of ranking, has been used in various fields. However, owing to the uncertainty in group decision-making, how to rank alternatives by incomplete pairwise comparisons has become an open issue. In this paper, an improved method is proposed for ranking of alternatives by incomplete pairwise comparisons using Dempster-Shafer evidence theory and information entropy. Firstly, taking the probability assignment of the chosen preference into consideration, the comparison of alternatives to each group is addressed. Experiments verified that the information entropy of the data itself can determine the different weight of each group's choices objectively. Numerical examples in group decision-making environments are used to test the effectiveness of the proposed method. Moreover, the divergence of ranking mechanism is analyzed briefly in conclusion section. PMID:25250393

  15. Imaging a boa constrictor--the incomplete double aortic arch syndrome.

    PubMed

    Narayan, Rajeev L; Kanwar, Anubhav; Jacobi, Adam; Sanz, Javier

    2012-11-01

    Incomplete double aortic arch is a rare anomaly resulting from atresia rather than complete involution in the distal left arch resulting in a non-patent fibrous cord between the left arch and descending thoracic aorta. This anatomic anomaly may cause symptomatic vascular rings, leading to stridor, wheezing, or dysphagia, requiring surgical transection of the fibrous cord. Herein, we describe an asymptomatic 59 year-old man presenting for contrast-enhanced CT angiography to assess cardiac anatomy prior to radiofrequency ablation, who was incidentally found to have an incomplete double aortic arch with hypoplasia of the left arch segment and an aortic diverticulum. Recognition of this abnormality by imaging is important to inform both corrective surgery in symptomatic patients, as well as assist in the planning of percutaneous coronary and vascular interventions.

  16. Application of games with incomplete information for pricing electricity in deregulated power pools

    SciTech Connect

    Ferrero, R.W.; Rivera, J.F.; Shahidehpour, S.M.

    1998-02-01

    The authors present a game theoretical approach to the problem of pricing electricity in deregulated energy marketplaces. They assume that an Independent System Operator receives bids by Pool participants and defines transactions among participants by looking for the minimum price that satisfies the demand in the Pool. The competition among Pool participants is modeled as a non-cooperative game with incomplete information. They assume that each Pool participant knows its own operation costs but does not know his opponents` operation costs. The game with incomplete information is transformed into a game with complete, but imperfect, information and solved using the Nash equilibrium idea. The approach presented in this paper is geared towards providing support for pricing electricity in deregulated Pools.

  17. BECN1-dependent CASP2 incomplete autophagy induction by binding to rabies virus phosphoprotein

    PubMed Central

    Liu, Juan; Wang, Hailong; Gu, Jinyan; Deng, Tingjuan; Yuan, Zhuangchuan; Hu, Boli; Xu, Yunbin; Yan, Yan; Zan, Jie; Liao, Min; DiCaprio, Erin; Li, Jianrong; Su, Shuo; Zhou, Jiyong

    2017-01-01

    ABSTRACT Autophagy is an essential component of host immunity and used by viruses for survival. However, the autophagy signaling pathways involved in virus replication are poorly documented. Here, we observed that rabies virus (RABV) infection triggered intracellular autophagosome accumulation and results in incomplete autophagy by inhibiting autophagy flux. Subsequently, we found that RABV infection induced the reduction of CASP2/caspase 2 and the activation of AMP-activated protein kinase (AMPK)-AKT-MTOR (mechanistic target of rapamycin) and AMPK-MAPK (mitogen-activated protein kinase) pathways. Further investigation revealed that BECN1/Beclin 1 binding to viral phosphoprotein (P) induced an incomplete autophagy via activating the pathways CASP2-AMPK-AKT-MTOR and CASP2-AMPK-MAPK by decreasing CASP2. Taken together, our data first reveals a crosstalk of BECN1 and CASP2-dependent autophagy pathways by RABV infection. PMID:28129024

  18. Multiple imputation for high-dimensional mixed incomplete continuous and binary data.

    PubMed

    He, Ren; Belin, Thomas

    2014-06-15

    It is common in applied research to have large numbers of variables measured on a modest number of cases. Even with low rates of missingness of individual variables, such data sets can have a large number of incomplete cases with a mix of data types. Here, we propose a new joint modeling approach to address the high-dimensional incomplete data with a mix of continuous and binary data. Specifically, we propose a multivariate normal model encompassing both continuous variables and latent variables corresponding to binary variables. We apply a parameter-extended Metropolis–Hastings algorithm to generate the covariance matrix of a mixture of continuous and binary variables. We also introduce prior distribution families for unstructured covariance matrices to reduce the dimension of the parameter space. In several simulation settings, the method is compared with available-case analysis, a rounding method, and a sequential regression method.

  19. When is incomplete epigenetic resetting in germ cells favoured by natural selection?

    PubMed Central

    Uller, Tobias; English, Sinead; Pen, Ido

    2015-01-01

    Resetting of epigenetic marks, such as DNA methylation, in germ cells or early embryos is not always complete. Epigenetic states may therefore persist, decay or accumulate across generations. In spite of mounting empirical evidence for incomplete resetting, it is currently poorly understood whether it simply reflects stochastic noise or plays an adaptive role in phenotype determination. Here, we use a simple model to show that incomplete resetting can be adaptive in heterogeneous environments. Transmission of acquired epigenetic states prevents mismatched phenotypes when the environment changes infrequently relative to generation time and when maternal and environmental cues are unreliable. We discuss how these results may help to interpret the emerging data on transgenerational epigenetic inheritance in plants and animals. PMID:26136447

  20. Nonparametric Bayesian Dictionary Learning for Analysis of Noisy and Incomplete Images

    PubMed Central

    Zhou, Mingyuan; Chen, Haojun; Paisley, John; Ren, Lu; Li, Lingbo; Xing, Zhengming; Dunson, David; Sapiro, Guillermo; Carin, Lawrence

    2013-01-01

    Nonparametric Bayesian methods are considered for recovery of imagery based upon compressive, incomplete, and/or noisy measurements. A truncated beta-Bernoulli process is employed to infer an appropriate dictionary for the data under test and also for image recovery. In the context of compressive sensing, significant improvements in image recovery are manifested using learned dictionaries, relative to using standard orthonormal image expansions. The compressive-measurement projections are also optimized for the learned dictionary. Additionally, we consider simpler (incomplete) measurements, defined by measuring a subset of image pixels, uniformly selected at random. Spatial interrelationships within imagery are exploited through use of the Dirichlet and probit stick-breaking processes. Several example results are presented, with comparisons to other methods in the literature. PMID:21693421

  1. Electrochemotherapy increases local control after incomplete excision of a recurring penile fibrosarcoma in a stallion

    PubMed Central

    Spugnini, E.P.; Bolaffio, C.; Scacco, L.; Baldi, A.

    2016-01-01

    An eleven-year-old stallion was referred for adjuvant treatment of an incompletely excised, recurring penile fibrosarcoma. The horse was bright, alert and responsive with a 15 x 12 cm ulcerated lesion on the ventral side of the penis. The lesion was the tumor bed of an incompletely excised fibrosarcoma. After complete staging procedures, the owner elected to treat the horse with electrochemotherapy (ECT) using cisplatin as chemotherapy agent. Two sessions of ECT were performed at two-week intervals using local cisplatin followed by trains of biphasic electric pulses applied using different electrodes until complete coverage of the area was achieved. The treatment was well tolerated, and the patient is still disease free after 12 months. ECT resulted in improved local control and should be considered among the available adjuvant treatments in equines carrying soft tissue tumors. PMID:27995080

  2. Incomplete Kawasaki disease associated with complicated Streptococcus pyogenes pneumonia: A case report.

    PubMed

    Leahy, Timothy Ronan; Cohen, Eyal; Allen, Upton D

    2012-01-01

    A three-year-old boy presented with community-acquired pneumonia complicated by empyema. Streptococcus pyogenes (group A streptococcus) was identified on culture of the pleural fluid. The patient improved with antibiotic therapy and drainage of the empyema. During his convalescence, the patient developed persistent fever, lethargy and anorexia. His inflammatory markers were elevated, and repeat cultures were negative. Although the patient had none of the classical mucocutaneous features of Kawasaki disease, an echocardiogram was performed, which revealed coronary artery dilation. The patient was diagnosed with incomplete Kawasaki disease and treated with intravenous immunoglobulin and high-dose acetylsalicylic acid. The fever subsided within 48 h. To the authors' knowledge, the present report is the first report of Kawasaki disease associated with complicated S pyogenes pneumonia. It emphasizes the importance of considering incomplete Kawasaki disease among children with persistent fever, the role of echocardiography in diagnosis, and the potential link between Kawasaki disease and superantigen-producing organisms such as S pyogenes.

  3. Impact of observational incompleteness on the structural properties of protein interaction networks

    NASA Astrophysics Data System (ADS)

    Kuhnt, Mathias; Glauche, Ingmar; Greiner, Martin

    2007-01-01

    The observed structure of protein interaction networks is corrupted by many false positive/negative links. This observational incompleteness is abstracted as random link removal and a specific, experimentally motivated (spoke) link rearrangement. Their impact on the structural properties of gene-duplication-and-mutation network models is studied. For the degree distribution a curve collapse is found, showing no sensitive dependence on the link removal/rearrangement strengths and disallowing a quantitative extraction of model parameters. The spoke link rearrangement process moves other structural observables, like degree correlations, cluster coefficient and motif frequencies, closer to their counterparts extracted from the yeast data. This underlines the importance to take a precise modeling of the observational incompleteness into account when network structure models are to be quantitatively compared to data.

  4. Retrieving treatment and control proportions from incomplete summary data in meta-analysis.

    PubMed

    Olkin, Ingram

    2012-09-01

    One of the vexing problems often encountered when combining the results of independent studies in a meta-analysis is that the data provided in individual studies are incomplete. Some studies may provide only a risk difference and others only an odds ratio. Of course, if the proportions for treatment and control are reported, then the meta-analyst can carry out a variety of analyses, such as fixed or random effect estimates. Excluding studies with incomplete data carries a risk and should be avoided if it is possible to retrieve the original proportions. Inclusion criteria in some meta-analyses may require that studies contain full data. This requirement can be relaxed if the original data can be retrieved. Copyright © 2012 John Wiley & Sons, Ltd.

  5. Incomplete optical shielding in cold atom traps: three-dimensional Landau-Zener theory

    SciTech Connect

    Yurovsky, V.A.; Ben-Reuven, A.

    1997-05-01

    Ultracold atom collisions in the presence of a linearly polarized blueshifted laser field are studied theoretically. An analytical solution is presented within the framework of the Landau-Zener approximation. The effect of incomplete shielding is mostly accounted for by incorporating the three-dimensional character of the collisions, using a partial-wave analysis with space degeneracy. A model of two electronic states, including effects of indistinguishability of the colliding atoms, is used. The model associates the incomplete shielding with a process involving two crossing points. The theory is applied to the case of metastable xenon traps, obtaining a fair agreement with the experimental data. {copyright} {ital 1997} {ital The American Physical Society}

  6. Conditional entropy for incomplete decision systems and its application in data mining

    NASA Astrophysics Data System (ADS)

    Dai, Jianhua; Xu, Qing; Wang, Wentao; Tian, Haowei

    2012-10-01

    Rough set theory is a useful mathematic tool for dealing with vague and uncertain information. Shannon's entropy and its variants have been applied to measure uncertainty in rough set theory from the viewpoint of information theory. However, few studies have been carried out on information-theoretical measure of attribute importance in incomplete decision system (IDS) considering the relation between decision attribute and condition attributes. In this paper, we introduce the concept of conditional entropy together with entropy and joint entropy in IDSs. By using the new conditional entropy, we propose a measure for attribute importance. Based on the measure, a heuristic attribute reduction algorithm is presented. Some test experiments on real-lift data-sets show the effectiveness of the algorithm. The attribute importance measure and the attribute reduction algorithm can be used in data mining or machine learning for handling incomplete data.

  7. Analysis of incomplete charge transfer effects in a CMOS image sensor

    NASA Astrophysics Data System (ADS)

    Liqiang, Han; Suying, Yao; Jiangtao, Xu; Chao, Xu; Zhiyuan, Gao

    2013-05-01

    A method to judge complete charger transfer is proposed for a four-transistor CMOS image sensor with a large pixel size. Based on the emission current theory, a qualitative photoresponse model is established to the preliminary prediction. Further analysis of noise for incomplete charge transfer predicts the noise variation. The test pixels were fabricated in a specialized 0.18 μm CMOS image sensor process and two different processes of buried N layer implantation are compared. The trend prediction corresponds with the test results, especially as it can distinguish an unobvious incomplete charge transfer. The method helps us judge whether the charge transfer time satisfies the requirements of the readout circuit for the given process especially for pixels of a large size.

  8. The optimization of low specific speed centrifugal pump based on incomplete sensitivities

    NASA Astrophysics Data System (ADS)

    Zhang, R. H.; Zheng, K.; Yao, L. H.; Shi, F. X.

    2012-11-01

    In this research, the optimization method for low specific speed centrifugal pump impeller based on incomplete sensitivities was proposed. The main feature of the algorithm is that it avoids solving the flow field repeatedly in one optimization cycle in finite difference method and it avoids solving the adjoint equation in adjoint method. The blade meridional plan is considered as constant, and the blade camber line was parameterize by Taylor function. The coefficients in the Taylor function were taken as the control variable. The moment acting on the blade was considered as the objective function. With the incomplete sensitivities we can get the gradient of the objective function with respect to the control variable easily, and the blade shape can be renewed according to the inverse direction of the gradient. We will find the optimum design when the objective function is minimized. The computational cost is greatly reduced. The calculation cases show that the proposed theory and method is rotational.

  9. Exercise Performance in Children and Young Adults After Complete and Incomplete Repair of Congenital Heart Disease.

    PubMed

    Rosenblum, Omer; Katz, Uriel; Reuveny, Ronen; Williams, Craig A; Dubnov-Raz, Gal

    2015-12-01

    Few previous studies have addressed exercise capacity in patients with corrected congenital heart disease (CHD) and significant anatomical residua. The aim of this study was to determine the aerobic fitness and peak cardiac function of patients with corrected CHD with complete or incomplete repairs, as determined by resting echocardiography. Children, adolescents and young adults (<40 years) with CHD from both sexes, who had previously undergone biventricular corrective therapeutic interventions (n = 73), and non-CHD control participants (n = 76) underwent cardiopulmonary exercise testing. The CHD group was further divided according to the absence/presence of significant anatomical residua on a resting echocardiogram ("complete"/"incomplete" repair groups). Aerobic fitness and cardiac function were compared between groups using linear regression and analysis of covariance. Peak oxygen consumption, O2 pulse and ventilatory threshold were significantly lower in CHD patients compared with controls (all p < 0.01). Compared with the complete repair group, the incomplete repair group had a significantly lower mean peak work rate, age-adjusted O2 pulse (expressed as % predicted) and a higher VE/VCO2 ratio (all p ≤ 0.05). Peak oxygen consumption was comparable between the subgroups. Patients after corrected CHD have lower peak and submaximal exercise parameters. Patients with incomplete repair of their heart defect had decreased aerobic fitness, with evidence of impaired peak cardiac function and lower pulmonary perfusion. Patients that had undergone a complete repair had decreased aerobic fitness attributed only to deconditioning. These newly identified differences explain why in previous studies, the lowest fitness was seen in patients with the most hemodynamically significant heart malformations.

  10. Incomplete Infection of Secondarily Infected Potato Plants - an Environment Dependent Underestimated Mechanism in Plant Virology.

    PubMed

    Bertschinger, Lukas; Bühler, Lukas; Dupuis, Brice; Duffy, Brion; Gessler, Cesare; Forbes, Gregory A; Keller, Ernst R; Scheidegger, Urs C; Struik, Paul C

    2017-01-01

    The common assumption in potato virus epidemiology is that all daughter tubers produced by plants coming from infected mother tubers (secondary infection) will become infected via systemic translocation of the virus during growth. We hypothesize that depending on the prevalent environmental conditions, only a portion of the daughter tubers of a plant that is secondarily infected by viruses may become infected. To test this hypothesis experimental data from standardized field experiments were produced in three contrasting environments at 112, 3280, and 4000 m a.s.l. in Peru during two growing seasons. In these experiments, the percentage of infected daughter tubers produced by seed tubers that were infected with either potato potexvirus X (PVX), potato Andean mottle comovirus (APMoV), potato potyvirus Y (PVY) (jointly infected with PVX) or potato leafroll luteovirus (PLRV) was determined. Incomplete autoinfection was found in all cases, as the percentage of virus infected daughter tubers harvested from secondarily infected plants was invariably less than 100%, with the lowest percentage of infection being 30%. Changing the growing site to higher altitudes decreased autoinfection for all viruses. Therefore, the assumption of complete autoinfection of secondarily infected plants were rejected, while the hypothesis of environmentally dependent incomplete autoinfection was accepted. The findings help explain the occurrence of traditional seed management practices in the Andes and may help to develop locally adapted seed systems in environments of the world that have no steady access to healthy seed tubers coming from a formally certified seed system. The results obtained almost three decades ago are discussed in light of most recent knowledge on epigenetic regulation of host plant - virus interactions which allow for speculating about the underlying biological principles of the incomplete autoinfection. A research roadmap is proposed for achieving explicit experimental

  11. Investigation of incomplete fusion dynamics at energy 4-8 MeV/nucleon

    NASA Astrophysics Data System (ADS)

    Kumar, Harish; Tali, Suhail A.; Ansari, M. Afzal; Singh, D.; Ali, Rahbar; Kumar, Kamal; Sathik, N. P. M.; Parashari, Siddharth; Ali, Asif; Dubey, R.; Bala, Indu; Kumar, Rakesh; Singh, R. P.; Muralithar, S.

    2017-04-01

    The recoil-catcher activation technique followed by the offline γ-ray spectroscopy has been adopted for the excitation function measurement of residues populated in 12,13C induced reactions with 175Lu target at lower projectile energies ≈ 4- 8 MeV /nucleon. The independent cross-sections for some of the populated residues have been estimated by subtracting the contributions of higher charge precursor isobars from the measured cumulative cross-sections. The measured excitation functions are compared with theoretical predictions based on statistical model code PACE-4. This comparison reveals that complete fusion process solely contributes in the formation of xn-pxn channels and an enhancement in the measured cross-sections of α-emitting channels from the theoretical predictions may be attributed to the incomplete fusion process. The incomplete fusion probability is found to be higher in case of 12C than for a one neutron rich projectile 13C throughout the incident energy region. Present findings obtained for 12,13C + 175Lu systems have been compared with informations extracted from previously studied systems and projectile structure is found to strongly affect the incomplete fusion dynamics in terms of projectile α-Q-value along with projectile-target mass-asymmetry. Moreover, it may be pointed out that Morgenstern's mass-asymmetry systematic is probably the projectile structure dependent systematic. A substantial contribution to incomplete fusion coming from collision trajectories with ℓ ≤ℓcrit is also observed, contrary to the SUMRULE model assumptions.

  12. Incomplete Infection of Secondarily Infected Potato Plants – an Environment Dependent Underestimated Mechanism in Plant Virology

    PubMed Central

    Bertschinger, Lukas; Bühler, Lukas; Dupuis, Brice; Duffy, Brion; Gessler, Cesare; Forbes, Gregory A.; Keller, Ernst R.; Scheidegger, Urs C.; Struik, Paul C.

    2017-01-01

    The common assumption in potato virus epidemiology is that all daughter tubers produced by plants coming from infected mother tubers (secondary infection) will become infected via systemic translocation of the virus during growth. We hypothesize that depending on the prevalent environmental conditions, only a portion of the daughter tubers of a plant that is secondarily infected by viruses may become infected. To test this hypothesis experimental data from standardized field experiments were produced in three contrasting environments at 112, 3280, and 4000 m a.s.l. in Peru during two growing seasons. In these experiments, the percentage of infected daughter tubers produced by seed tubers that were infected with either potato potexvirus X (PVX), potato Andean mottle comovirus (APMoV), potato potyvirus Y (PVY) (jointly infected with PVX) or potato leafroll luteovirus (PLRV) was determined. Incomplete autoinfection was found in all cases, as the percentage of virus infected daughter tubers harvested from secondarily infected plants was invariably less than 100%, with the lowest percentage of infection being 30%. Changing the growing site to higher altitudes decreased autoinfection for all viruses. Therefore, the assumption of complete autoinfection of secondarily infected plants were rejected, while the hypothesis of environmentally dependent incomplete autoinfection was accepted. The findings help explain the occurrence of traditional seed management practices in the Andes and may help to develop locally adapted seed systems in environments of the world that have no steady access to healthy seed tubers coming from a formally certified seed system. The results obtained almost three decades ago are discussed in light of most recent knowledge on epigenetic regulation of host plant – virus interactions which allow for speculating about the underlying biological principles of the incomplete autoinfection. A research roadmap is proposed for achieving explicit

  13. HIFI: a computer code for projectile fragmentation accompanied by incomplete fusion

    SciTech Connect

    Wu, J.R.

    1980-07-01

    A brief summary of a model proposed to describe projectile fragmentation accompanied by incomplete fusion and the instructions for the use of the computer code HIFI are given. The code HIFI calculates single inclusive spectra, coincident spectra and excitation functions resulting from particle-induced reactions. It is a multipurpose program which can calculate any type of coincident spectra as long as the reaction is assumed to take place in two steps.

  14. The turbulent wall jet: a triple-layered structure and incomplete similarity.

    PubMed

    Barenblatt, G I; Chorin, A J; Prostokishin, V M

    2005-06-21

    We demonstrate using the high-quality experimental data that turbulent wall jet flows consist of two self-similar layers: a top layer and a wall layer, separated by a mixing layer where the velocity is close to maximum. The top and wall layers are significantly different from each other, and both exhibit incomplete similarity, i.e., a strong influence of the width of the slot that had previously been neglected.

  15. Predicting urinary creatinine excretion and its usefulness to identify incomplete 24 h urine collections.

    PubMed

    De Keyzer, Willem; Huybrechts, Inge; Dekkers, Arnold L M; Geelen, Anouk; Crispim, Sandra; Hulshof, Paul J M; Andersen, Lene F; Řehůřková, Irena; Ruprich, Jiří; Volatier, Jean-Luc; Van Maele, Georges; Slimani, Nadia; van't Veer, Pieter; de Boer, Evelien; De Henauw, Stefaan

    2012-09-28

    Studies using 24 h urine collections need to incorporate ways to validate the completeness of the urine samples. Models to predict urinary creatinine excretion (UCE) have been developed for this purpose; however, information on their usefulness to identify incomplete urine collections is limited. We aimed to develop a model for predicting UCE and to assess the performance of a creatinine index using para-aminobenzoic acid (PABA) as a reference. Data were taken from the European Food Consumption Validation study comprising two non-consecutive 24 h urine collections from 600 subjects in five European countries. Data from one collection were used to build a multiple linear regression model to predict UCE, and data from the other collection were used for performance testing of a creatinine index-based strategy to identify incomplete collections. Multiple linear regression (n 458) of UCE showed a significant positive association for body weight (β = 0·07), the interaction term sex × weight (β = 0·09, reference women) and protein intake (β = 0·02). A significant negative association was found for age (β = -0·09) and sex (β = -3·14, reference women). An index of observed-to-predicted creatinine resulted in a sensitivity to identify incomplete collections of 0·06 (95 % CI 0·01, 0·20) and 0·11 (95 % CI 0·03, 0·22) in men and women, respectively. Specificity was 0·97 (95 % CI 0·97, 0·98) in men and 0·98 (95 % CI 0·98, 0·99) in women. The present study shows that UCE can be predicted from weight, age and sex. However, the results revealed that a creatinine index based on these predictions is not sufficiently sensitive to exclude incomplete 24 h urine collections.

  16. Covalent Chemistry beyond Molecules.

    PubMed

    Jiang, Juncong; Zhao, Yingbo; Yaghi, Omar M

    2016-03-16

    Linking molecular building units by covalent bonds to make crystalline extended structures has given rise to metal-organic frameworks (MOFs) and covalent organic frameworks (COFs), thus bringing the precision and versatility of covalent chemistry beyond discrete molecules to extended structures. The key advance in this regard has been the development of strategies to overcome the "crystallization problem", which is usually encountered when attempting to link molecular building units into covalent solids. Currently, numerous MOFs and COFs are made as crystalline materials in which the large size of the constituent units provides for open frameworks. The molecular units thus reticulated become part of a new environment where they have (a) lower degrees of freedom because they are fixed into position within the framework; (b) well-defined spatial arrangements where their properties are influenced by the intricacies of the pores; and (c) ordered patterns onto which functional groups can be covalently attached to produce chemical complexity. The notion of covalent chemistry beyond molecules is further strengthened by the fact that covalent reactions can be carried out on such frameworks, with full retention of their crystallinity and porosity. MOFs are exemplars of how this chemistry has led to porosity with designed metrics and functionality, chemically-rich sequences of information within their frameworks, and well-defined mesoscopic constructs in which nanoMOFs enclose inorganic nanocrystals and give them new levels of spatial definition, stability, and functionality.

  17. Cochleates bridged by drug molecules.

    PubMed

    Syed, Uwais M; Woo, Amy F; Plakogiannis, Fotios; Jin, Tuo; Zhu, Hua

    2008-11-03

    A new type of cochleate, able to microencapsulate water-soluble cationic drugs or peptides into its inter-lipid bi-layer space, was formed through interaction between negatively charged lipids and drugs or peptides acting as the inter-bi-layer bridges instead of multi-cationic metal ions. This new type of cochleate opened up to form large liposomes when treated with EDTA, suggesting that cationic organic molecules can be extracted from these cochleates in a way similar to multivalent metal ions from metal ion-bridged cochleates. Cochleates can be produced in sub-micron size using a method known as "hydrogel isolated cochleation" or simply by increasing the ratio of multivalent cationic peptides over negatively charged liposomes. When nanometer-sized cochleates and liposomes containing the same fluorescent labeled lipid component were incubated with human fibroblasts cells under identical conditions, cells exposed to cochleates showed bright fluorescent cell surfaces, whereas those incubated with liposomes did not. This result suggests that cochleates' edges made them fuse with the cell surfaces as compared to edge free liposomes. This mechanism of cochleates' fusion with cell membrane was supported by a bactericidal activity assay using tobramycin cochleates, which act by inhibiting intracellular ribosomes. Tobramycin bridged cochleates in nanometer size showed improved antibacterial activity than the drug's solution.

  18. Adhesion Molecules: Master Controllers of the Circulatory System.

    PubMed

    Schmidt, Eric P; Kuebler, Wolfgang M; Lee, Warren L; Downey, Gregory P

    2016-03-15

    This manuscript will review our current understanding of cellular adhesion molecules (CAMs) relevant to the circulatory system, their physiological role in control of vascular homeostasis, innate and adaptive immune responses, and their importance in pathophysiological (disease) processes such as acute lung injury, atherosclerosis, and pulmonary hypertension. This is a complex and rapidly changing area of research that is incompletely understood. By design, we will begin with a brief overview of the structure and classification of the major groups of adhesion molecules and their physiological functions including cellular adhesion and signaling. The role of specific CAMs in the process of platelet aggregation and hemostasis and leukocyte adhesion and transendothelial migration will be reviewed as examples of the complex and cooperative interplay between CAMs during physiological and pathophysiological processes. The role of the endothelial glycocalyx and the glycobiology of this complex system related to inflammatory states such as sepsis will be reviewed. We will then focus on the role of adhesion molecules in the pathogenesis of specific disease processes involving the lungs and cardiovascular system. The potential of targeting adhesion molecules in the treatment of immune and inflammatory diseases will be highlighted in the relevant sections throughout the manuscript.

  19. Sticking of Molecules on Nonporous Amorphous Water Ice

    NASA Astrophysics Data System (ADS)

    He, Jiao; Acharyya, Kinsuk; Vidali, Gianfranco

    2016-05-01

    Accurate modeling of physical and chemical processes in the interstellar medium (ISM) requires detailed knowledge of how atoms and molecules adsorb on dust grains. However, the sticking coefficient, a number between 0 and 1 that measures the first step in the interaction of a particle with a surface, is usually assumed in simulations of ISM environments to be either 0.5 or 1. Here we report on the determination of the sticking coefficient of H2, D2, N2, O2, CO, CH4, and CO2 on nonporous amorphous solid water. The sticking coefficient was measured over a wide range of surface temperatures using a highly collimated molecular beam. We showed that the standard way of measuring the sticking coefficient—the King-Wells method—leads to the underestimation of trapping events in which there is incomplete energy accommodation of the molecule on the surface. Surface scattering experiments with the use of a pulsed molecular beam are used instead to measure the sticking coefficient. Based on the values of the measured sticking coefficient, we suggest a useful general formula of the sticking coefficient as a function of grain temperature and molecule-surface binding energy. We use this formula in a simulation of ISM gas-grain chemistry to find the effect of sticking on the abundance of key molecules both on grains and in the gas phase.

  20. Electron Transfer-Induced Fragmentation in (Bio)Molecules by Atom-Molecule Collisions

    NASA Astrophysics Data System (ADS)

    Limão-Vieira, Paulo; da Silva, Filipe Ferreira; Gómez-Tejedor, Gustavo García

    Ion-pair formation to gas phase molecules induced by electron transfer has been studied by investigating the products of collisions between fast potassium atoms and target molecules using a crossed molecular-beam technique. The negative ions formed in such collisions are TOF mass analysed. As far as (bio)molecules are concerned, TOF mass spectra at different collision energies reveal interesting anionic patterns with reduced fragmentation at lower impact energies. In the unimolecular decomposition of the temporary negative ion (TNI), complex internal rearrangement may involve the cleavage and formation of new bonds. In this chapter we report some of the recent achievements in negative ion formation of some polyatomic molecules with the special attention to biological relevant targets.

  1. Incomplete phase-space method to reveal time delay from scalar time series.

    PubMed

    Zhu, Shengli; Gan, Lu

    2016-11-01

    A computationally quick and conceptually simple method to recover time delay of the chaotic system from scalar time series is developed in this paper. We show that the orbits in the incomplete two-dimensional reconstructed phase-space will show local clustering phenomenon after the component reordering procedure proposed in this work. We find that information captured by the incomplete two-dimensional reconstructed phase-space is related to the time delay τ_{0} present in the system, and will be transferred to the reordered component by the procedure of component reordering. We then propose the segmented mean variance (SMV) from the reordered component to identify the time delay τ_{0} of the system. The proposed SMV shows clear maximum when the embedding delay τ of the incomplete reconstruction matches the time delay τ_{0} of the chaotic system. Numerical data generated by a time-delay system based on the Mackey-Glass equation operating in the chaotic regime are used to illustrate the effectiveness of the proposed SMV. Experimental results show that the proposed SMV is robust to additive observational noise and is able to recover the time delay of the chaotic system even though the amount of data is relatively small and the feedback strength is weak. Moreover, the time complexity of the proposed method is quite low.

  2. Effect of Ultrasound-Guided Radiofrequency Ablation in Incompletely Treated Hepatocellular Carcinoma after Transcatheter Arterial Chemoembolization

    PubMed Central

    Chang, Nam Kyu; Kim, Jin Woong; Kim, Hyung Jun; Jeong, Yong Yeon; Heo, Suk Hee; Kim, Jae Kyu; Kang, Heoung Keun

    2012-01-01

    Objective To evaluate the effectiveness of ultrasound-guided radiofrequency (RF) ablation in patients with incompletely treated hepatocellular carcinoma (HCC) after transcatheter arterial chemoembolization (TACE) and to evaluate possible prognostic factors for this therapy. Subjects and Methods Thirty nine patients with incompletely treated single HCC (≤ 5 cm) after TACE were treated with RF ablation. All patients were evaluated for complete tumor ablation rate, local recurrence-free rate, overall survival rate, and complications. Local recurrence-free rate and overall survival rate were calculated using the Kaplan-Meier method. The possible prognostic factors of local recurrence-free rate and survival rate were analyzed using Cox proportional-hazards regression model. Results The complete tumor ablation rate was 92.3%. Local recurrence-free rates for 1-, 2-, 3-, and 5-years were 81.7%, 63.1%, 53.6%, and 35.7%, respectively. One-, 2-, 3-, and 5-year overall survival rates were 96.9%, 82.9%, 67.8%, and 48.4%, respectively. Among prognostic factors included in the analysis, only tumor diameter (≤ 2 cm versus > 2 cm) was statistically significant in terms of predicting local recurrence. Complications were observed in two patients, one with liver abscess and the other with portal venous thrombosis. Conclusion Ultrasound-guided RF ablation could be effective and safe in treating incompletely treated HCC after TACE. The diameter of HCC was a significant prognostic factor for local recurrence. PMID:22563280

  3. Estimating inbreeding rates in natural populations: addressing the problem of incomplete pedigrees.

    PubMed

    Miller, Mark P; Haig, Susan M; Ballou, Jonathan D; Steel, E Ashley

    2017-04-07

    Understanding and estimating inbreeding is essential for managing threatened and endangered wildlife populations. However, determination of inbreeding rates in natural populations is confounded by incomplete parentage information. We present an approach for quantifying inbreeding rates for populations with incomplete parentage information. The approach exploits knowledge of pedigree configurations that lead to inbreeding coefficients of F = 0.25 and F = 0.125, allowing for quantification of Pr(I|k): the probability of observing pedigree I given the fraction of known parents (k). We developed analytical expressions under simplifying assumptions that define properties and behavior of inbreeding rate estimators for varying values of k. We demonstrated that inbreeding is overestimated if Pr(I|k) is not taken into consideration and that bias is primarily influenced by k. By contrast, our new estimator, incorporating Pr(I|k), is unbiased over a wide range of values of k that may be observed in empirical studies. Stochastic computer simulations that allowed complex inter- and intra-generational inbreeding produced similar results. We illustrate the effects that accounting for Pr(I|k) can have in empirical data by revisiting published analyses of Arabian oryx (Oryx leucoryx) and Red deer (Cervus elaphus). Our results demonstrate that incomplete pedigrees are not barriers for quantifying inbreeding in wild populations. Application of our approach will permit a better understanding of the role that inbreeding plays in the dynamics of populations of threatened and endangered species and may help refine our understanding of inbreeding avoidance mechanisms in the wild.

  4. Application of orthogonal sampling to incomplete data interferometric tomography: numerical simulation and experimental analysis.

    PubMed

    Hongbing, Yao; Yongkang, Zhang; Xia, Ye; Anzhi, He

    2008-05-01

    Orthogonal projection sampling mode was proposed to reconstruct the incomplete-data flow field in optical computerized tomography (OCT). With numerical simulation technique, a two-peak plane symmetric flow field was reconstructed in different sampling modes and discussed in simulated results is the reconstructive accuracy with error indexes, such as mean square error (MSE) and peak error (PE). The corresponding experiments were researched with a Fabry-Perot rotary interferometer. The results indicated that the errors were drastically reduced and the precision was improved when orthogonal projection sampling mode was adopted in the reconstruction of the incomplete data field. The MSE obtained with orthogonal sampling mode was decreased 72.81% from that of the sequential projection sampling mode (the difference between the MSE obtained with the orthogonal sampling mode and that with the sequential sampling mode divided by the MSE of the sequential sampling mode) and the PE was decreased by 73.97%. The precision obtained from the experimental results reached 10%, which showed the orthogonal projection sampling could be a practicable sampling mode for the incomplete data field reconstruction in OCT and could provide some guidance for the flow-field measurement and apparatus design in the practical situation.

  5. Handling incomplete correlated continuous and binary outcomes in meta-analysis of individual participant data.

    PubMed

    Gomes, Manuel; Hatfield, Laura; Normand, Sharon-Lise

    2016-09-20

    Meta-analysis of individual participant data (IPD) is increasingly utilised to improve the estimation of treatment effects, particularly among different participant subgroups. An important concern in IPD meta-analysis relates to partially or completely missing outcomes for some studies, a problem exacerbated when interest is on multiple discrete and continuous outcomes. When leveraging information from incomplete correlated outcomes across studies, the fully observed outcomes may provide important information about the incompleteness of the other outcomes. In this paper, we compare two models for handling incomplete continuous and binary outcomes in IPD meta-analysis: a joint hierarchical model and a sequence of full conditional mixed models. We illustrate how these approaches incorporate the correlation across the multiple outcomes and the between-study heterogeneity when addressing the missing data. Simulations characterise the performance of the methods across a range of scenarios which differ according to the proportion and type of missingness, strength of correlation between outcomes and the number of studies. The joint model provided confidence interval coverage consistently closer to nominal levels and lower mean squared error compared with the fully conditional approach across the scenarios considered. Methods are illustrated in a meta-analysis of randomised controlled trials comparing the effectiveness of implantable cardioverter-defibrillator devices alone to implantable cardioverter-defibrillator combined with cardiac resynchronisation therapy for treating patients with chronic heart failure. © 2016 The Authors. Statistics in Medicine Published by John Wiley & Sons Ltd.

  6. Effect of cypermethrin on memory, movement activity and coordination in mice after transient incomplete cerebral ischemia.

    PubMed

    Nieradko-Iwanicka, Barbara; Borzecki, Andrzej

    2008-01-01

    Cypermethrin is a synthetic pyrethroid widely used as an insecticide. The aim of the present study was to investigate the possible effect of 0.1 LD50 of cypermethrin on memory, movement activity and co-ordination in mice exposed to transient incomplete cerebral ischemia. Transient occlusion of both carotid arteries (BCCA) in adult female mice was performed under ketamine + xylazine anesthesia. Intraperitoneal LD50 for cypermethrin was calculated to be 169.9 mg/kg. Memory retention was evaluated in a step-through passive avoidance task (PA), working spatial memory in a Y-maze, spontaneous movement activity in an automated device fitted with two photocells and a counter in two subsequent 30-min periods, and movement co-ordination on a rod spinning at the rate of 10 rotations/min. Neither memory nor movement co-ordination were significantly affected by transient incomplete cerebral ischemia or cypermethrin. BCCA itself did not impair movement activity in the examined mice. Cypermethrin decreased exploratory motor activity in the mice, and the effect was exacerbated by BCCA. These results show that transient incomplete cerebral ischemia combined with exposure to subtoxic doses of cypermethrin do not impair memory, but do affect behavior, producing transient reduction of spontaneous horizontal movement in mice.

  7. Clinicopathological characteristics of patients who underwent additional gastrectomy after incomplete endoscopic resection for early gastric cancer

    PubMed Central

    Hwang, Jae Jin; Lee, Dong Ho; Yoon, Hyuk; Shin, Cheol Min; Park, Young Soo; Kim, Nayoung

    2017-01-01

    Abstract To evaluate the clinicopathological characteristics and factors that lead to residual tumors in patients who underwent additional gastrectomy for incomplete endoscopic resection (ER) for early gastric cancer (EGC). Between 2003 and 2013, the medical records of patients underwent additional gastrectomy after incomplete ER were retrospectively reviewed. Those diagnosed with the presence of histologic residual tumor in specimens obtained by gastrectomy were assigned to the residual tumor (RT) group (n = 47); those diagnosed with the absence of histologic residual tumor were assigned to the nonresidual tumor (NRT) group (n = 33). In the multivariate analysis, endoscopic piecemeal resection, Helicobacter pylori infection, large tumor size (>2 cm), and both (lateral and vertical) marginal involvement were independent factors of the presence of residual tumor in additional gastrectomy after incomplete resection ER for EGC and the rates of independent factors were significantly higher in the RT group than in the NRT group (P < 0.05). Before ER, preexamination to accurately determine the GC invasion depth and the presence of LN metastasis is very important. During ER, surgeons should attempt to perform en bloc resection and to resect the mucous membrane with adequate safety margins to prevent tumor invasion into the lateral and vertical margins. PMID:28207556

  8. Fault diagnosis strategy for incompletely described samples and its application to refrigeration system

    NASA Astrophysics Data System (ADS)

    Ren, Neng; Liang, Jun; Gu, Bo; Han, Hua

    2008-02-01

    Fault diagnosis (FD) plays a very important role in the operation and maintenance of mechanical system and equipment. Existing FD methods are not capable of effectively dealing with incompletely described samples. In this paper, a strategy for FD using the incompletely described samples is presented. It is actualized in two steps, namely the determination of the values of unknown features which is the key step of the presented FD strategy, and the utilization of the regenerated completely described samples to diagnose the system based on support vector machine (SVM) classifiers. And the first step is mainly implemented by the following three sub-steps: (1) with the help of domain knowledge, the similarity transformation matrix of partial problem description (PPD)—problems with incomplete feature description—is generated based on the historical database; (2) the unknown features of the samples are transformed to related known features, through which generates a new retrieval feature vector; (3) the values of unknown features are assigned by the optimal cases which can be retrieved by measuring and comparing similarities between the retrieval feature vector and the completely described samples in the historical database. Finally, the presented FD strategy was applied to a real refrigeration system, and achieved satisfying results.

  9. Decomposition of Chemical Chain Molecules with Atmospheric Pressure Plasma

    NASA Astrophysics Data System (ADS)

    Tansli, Murat; Tasal, Erol

    2016-10-01

    Chemical chain molecules' decomposition is an interesting subject area for the atmospheric pressure plasma applications. The effects of the atmospheric pressure argon plasma on 4-((2-methoxyphenyl)Diazenyl)Benzene-1,3,-Diol molecule at room temperature are investigated. This molecule is one of the industrial dye molecules used widely. When considering the ecological life, this molecule will be very harmful and danger. We suggest a different, easy and useful decomposing method for such molecules. Atmospheric pressure plasma jet was principally treated for this decomposing of the molecule. Fourier transform infrared spectrometry (FT-IR) was used to characterization of the molecule after the plasma application to molecule in liquid phase with ethanol and methanol solvents. The atmospheric-pressure plasma jet of argon (Ar) as non-equilibrium has been formed by ac-power generator with frequency - 24 kHz and voltage - 12 kV. Characterizations for solutions prepared with ethanol and methanol solvents of molecule have been examined after applying (duration: 3 minutes) the atmospheric pressure plasma jet. The molecule was broken at 6C-7N =8N-9C stretching peak after the plasma treatment. The new plasma photo-products for ethanol and methanol solutions were produced as 6C-7N-8N =9C (strong, varying) and 12C =17O (strong, wide) stretching peaks.

  10. Molecules Best Paper Award 2013.

    PubMed

    McPhee, Derek J

    2013-02-05

    Molecules has started to institute a "Best Paper" award to recognize the most outstanding papers in the area of natural products, medicinal chemistry and molecular diversity published in Molecules. We are pleased to announce the second "Molecules Best Paper Award" for 2013.

  11. Behavior of atypical amphiphilic molecules

    NASA Astrophysics Data System (ADS)

    Ko, John

    1997-08-01

    The physical behavior of several atypical amphiphilic molecules was studied in various environments including micelles, model bilayer membranes, and emulsions. The molecules under investigation were nor-chenodeoxycholic acid (nor-CDCA), ursodeoxycholic acid (UDCA), sphingosine (Sp), sphingosine hydrochloride (SpċHCl), and tetrahydrolipstatin (THL). The bile acids, nor-CDCA and UDCA, were studied using 13C-Nuclear Magnetic Resonance ([13C) -NMR) in micelles of taurocholate and in bilayers of phosphatidylcholine. The pK a values of the bile acids in each environment were determined by [13C) -NMR and are as follows: 6.08 ±.03 for nor-CDCA and 6.27 ±.01 for UDCA in micelles, and 7.04 ± 12 for nor-CDCA and 6.89 ±.05 for UDCA in vesicles. Using line shape analysis, the transbilayer movement rate at 36oC for nor-CDCA and UDCA was calculated to be 580 sec--1 and 409 sec-1, respectively. [13C) -NMR titration of Sp gave pK a values of 9.09 ±.02 in micelles and 9.69 ±.21 in bilayers. Differential scanning calorimetry (DSC) and X-ray diffraction were used to establish the Spċwater and SpċHClċwater phase diagrams. Anhydrous and hydrated samples ranging from 5- 90% water were analyzed. The DSC thermograms traced out the transition temperatures of each molecule while the X- ray diffraction patterns revealed their chain and crystalline lattice packing structures. In general, sphingosine exists as a hydrated crystal with β packing phase below 43oC and melts into an Lα phase. Sphingosine hydrochloride, however, exists as a gel phase (L_beta or /beta/sp') below 42oC that swells to 61% hydration. At low water concentrations (0-64%), a lamellar liquid crystal phase (L_alpha) is formed above the chain melting transition of 42oC. At medium concentration (65%), a Hexagonal I phase is present, and at high water concentrations (66-90%), a micellar phase is present. THL, a specific inhibitor of lipases, was analyzed with [ 13C) -NMR to study its behavior in various environments

  12. Factors associated with incomplete gastric endoscopic submucosal dissection due to misdiagnosis

    PubMed Central

    Suzuki, Haruhisa; Oda, Ichiro; Sekiguchi, Masau; Abe, Seiichiro; Nonaka, Satoru; Yoshinaga, Shigetaka; Saito, Yutaka

    2016-01-01

    Background and study aims: Endoscopic submucosal dissection (ESD) is widely accepted for treating early gastric cancer (EGC); however, there can be cases of incomplete resection due to not only technical problems, but also misdiagnosis. Our aim was to identify factors associated with incomplete gastric ESD due to misdiagnosis. Patients and methods: A total of 2,268 patients with solitary EGCs at initial onset underwent ESD with curative intent at our hospital from 1999 to 2008. We retrospectively assessed the clinicopathological factors by comparing the two groups of incomplete ESD cases due to misdiagnosis (cases with a positive lateral margins [LM] [Group A] or those with a positive vertical margins [VM] [Group B]) with complete ESD cases using multivariable analysis. Results: Complete ESD was achieved in 2,097 patients. The 171 patients with incomplete ESDs were divided into 109 with a positive LM and 80 with a positive VM (overlapped). Except 49 cases with a positive LM due to technical problems, a positive LM due to misdiagnosis was identified in 60 cases (Group A). Excluding 32 cases with a positive VM due to technical problems, a positive VM due to misdiagnosis was found in 48 cases (Group B). Significant independent factors (odds ratios [OR]; 95 % confidence intervals [CI]) for each group were as follows: Group A: size > 20 mm (5.4; 3.0 – 9.9), undifferentiated-type (4.1; 1.8 – 9.0), submucosal invasion (2.0; 1.1 – 3.4) and location of upper/middle (1.9; 1.0 – 3.6); Group B: size > 20 mm (3.0; 1.6 – 5.5), undifferentiated-type (3.0; 1.1 – 8.0) and location of upper/middle (2.4; 1.2 – 4.8). Conclusions: Endoscopists must be aware of these factors associated with incomplete gastric ESD due to misdiagnosis to further decrease their incidence. PMID:27556097

  13. Ultracold Dipolar Molecules Composed of Strongly Magnetic Atoms

    NASA Astrophysics Data System (ADS)

    Frisch, A.; Mark, M.; Aikawa, K.; Baier, S.; Grimm, R.; Petrov, A.; Kotochigova, S.; Quéméner, G.; Lepers, M.; Dulieu, O.; Ferlaino, F.

    2015-11-01

    In a combined experimental and theoretical effort, we demonstrate a novel type of dipolar system made of ultracold bosonic dipolar molecules with large magnetic dipole moments. Our dipolar molecules are formed in weakly bound Feshbach molecular states from a sample of strongly magnetic bosonic erbium atoms. We show that the ultracold magnetic molecules can carry very large dipole moments and we demonstrate how to create and characterize them, and how to change their orientation. Finally, we confirm that the relaxation rates of molecules in a quasi-two-dimensional geometry can be reduced by using the anisotropy of the dipole-dipole interaction and that this reduction follows a universal dipolar behavior.

  14. Origin of subdiffusion of water molecules on cell membrane surfaces

    PubMed Central

    Yamamoto, Eiji; Akimoto, Takuma; Yasui, Masato; Yasuoka, Kenji

    2014-01-01

    Water molecules play an important role in providing unique environments for biological reactions on cell membranes. It is widely believed that water molecules form bridges that connect lipid molecules and stabilize cell membranes. Using all-atom molecular dynamics simulations, we show that translational and rotational diffusion of water molecules on lipid membrane surfaces exhibit subdiffusion and aging. Moreover, we provide evidence that both divergent mean trapping time (continuous-time random walk) and long-correlated noise (fractional Brownian motion) contribute to this subdiffusion. These results suggest that subdiffusion on cell membranes causes the water retardation, an enhancement of cell membrane stability, and a higher reaction efficiency. PMID:24739933

  15. Ion Pairs or Neutral Molecule Adducts? Cooperativity in Hydrogen Bonding

    ERIC Educational Resources Information Center

    DeKock, Roger L.; Schipper, Laura A.; Dykhouse, Stephanie C.; Heeringa, Lee P.; Brandsen, Benjamin M.

    2009-01-01

    We performed theoretical studies on the systems NH[subscript 3] times HF times mH[subscript 2]O, NH[subscript 3] times HCl times mH[subscript 2]O, with m = 0, 1, 2, and 6. The molecules with m = 0 form hydrogen-bonded adducts with little tendency to form an ion-pair structure. The molecule NH[subscript 3] times HCl times H[subscript 2]O cannot be…

  16. Biochips - Can molecules compute?

    NASA Astrophysics Data System (ADS)

    Tucker, J. B.

    1984-02-01

    In recent years the possibility has been considered to build 'biochip' computers, in which the silicon transistors of present machines would be replaced by large organic molecules or genetically engineered proteins. Two major advantages of such biochips over current devices would be related to vastly increased densities of computing elements, and entirely new styles of data processing, suited to such high-level tasks as pattern recognition and context-dependent analysis. The limitations of the semiconductor chip with respect to the density of elementary units due to size considerations and heat development could be overcome by making use of molecular switches. Attention is given to soliton switching, soliton logic, bulk molecular devices, analog biochips, 'intelligent' switches based on the employment of enzymes, robot vision, questions of biochip fabrication, protein engineering, and a strategy for the development of biochips.

  17. Chirally-sensitive electron-molecule interactions

    NASA Astrophysics Data System (ADS)

    Dreiling, J. M.; Gay, T. J.

    2015-09-01

    All molecular forms of life have chemically-specific handedness. However, the origin of these asymmetries is not understood. A possible explanation was suggested by Vester and Ulbricht immediately following the discovery of parity violation in 1957: chiral beta radiation in cosmic rays may have preferentially destroyed one enantiomeric form of various biological precursors. In the experiments reported here, we observed chiral specificity in two electron- molecule interactions: quasi-elastic scattering and dissociative electron attachment. Using low- energy longitudinally spin-polarized (chiral) electrons as substitutes for beta rays, we found that chiral bromocamphor molecules exhibited both a transmission and dissociative electron attachment rate that depended on their handedness for a given direction of incident electron spin. Consequently, these results, especially those with dissociative electron attachment, connect the universal chiral asymmetry of the weak force with a molecular breakup process, thereby demonstrating the viability of the Vester-Ulbricht hypothesis.

  18. Novel Small-Molecule Antibacterial Agents

    DTIC Science & Technology

    2014-07-01

    Molecules, Reversible Inhibitors, Irreversible Inhibitors, Therapeutics, Antidotes, Countermeasures, Botulism , and Neurotoxins. REPORT DOCUMENTATION...Standard Form 298 (Rev 8/98) Prescribed by ANSI Std. Z39.18 W911NF-09-1-0095 507-266-7991 Final Report 56085-LS.6 a. REPORT 14. ABSTRACT 16...8,404,728 B2) is 71 ± 26 nM (2 independent experiments with chi square 1. REPORT DATE (DD-MM-YYYY) 4. TITLE AND SUBTITLE 13. SUPPLEMENTARY NOTES

  19. Potential energy landscapes of tetragonal pyramid molecules

    NASA Astrophysics Data System (ADS)

    Yoshida, Yuichiro; Sato, Hirofumi; Morgan, John W. R.; Wales, David J.

    2016-11-01

    Hiraoka et al. have developed a self-assembling system referred to as a nanocube (Hiraoka et al., 2008). In the present contribution a coarse-grained model for this system is analysed, focusing on how the potential energy landscape for self-assembly is related to the geometry of the building blocks. We find that six molecules assemble to form various clusters, with cubic and sheet structures the most stable. The relative stability is determined by the geometry of the building blocks.

  20. Molecule formation by inverse predissociation. [in interstellar space

    NASA Technical Reports Server (NTRS)

    Julienne, P. S.; Krauss, M.

    1973-01-01

    The general theory of inverse predissociation is described, and is applied to specific molecules. The list of molecules which can be formed by radiative association will be lengthened considerably by considering this phenomenon. Typical rate constants for diatoms will lie in the range 10 to the minus 16th power to 10 to the minus 20th power cu cm/sec/molecule, with the heavy atom molecules such as CN, CO, or NO generally having larger rates than the hydrides. An attempt is made to point out what molecular characteristics determine the radiative association rate and also to make estimates of what rates may be expected for various interstellar molecules. The formal theory is developed, and the molecular properties are discussed which determine the inverse predissociation rate. The details of the theory as applied to specific interstellar molecules are studied.