Science.gov

Sample records for monoclinic zirconia nanocrystals

  1. Phonon anharmonicity of monoclinic zirconia and yttrium-stabilized zirconia

    DOE PAGES

    Li, Chen W.; Smith, Hillary L.; Lan, Tian; ...

    2015-04-13

    Inelastic neutron scattering measurements on monoclinic zirconia (ZrO2) and 8 mol% yttrium-stabilized zirconia were performed at temperatures from 300 to 1373 ωK. We reported temperature-dependent phonon densities of states (DOS) and Raman spectra obtained at elevated temperatures. First-principles lattice dynamics calculations with density functional theory gave total and partial phonon DOS curves and mode Grüneisen parameters. These mode Grüneisen parameters were used to predict the experimental temperature dependence of the phonon DOS with partial success. However, substantial anharmonicity was found at elevated temperatures, especially for phonon modes dominated by the motions of oxygen atoms. Yttrium-stabilized zirconia (YSZ) was somewhat moremore » anharmonic and had a broader phonon spectrum at low temperatures, owing in part to defects in its structure. YSZ also has a larger vibrational entropy than monoclinic zirconia.« less

  2. Phonon anharmonicity of monoclinic zirconia and yttrium-stabilized zirconia

    SciTech Connect

    Li, Chen W.; Smith, Hillary L.; Lan, Tian; Niedziela, Jennifer L.; Munoz, Jorge A.; Keith, J. Brian; Mauger, L.; Abernathy, Douglas L; Fultz, B.

    2015-04-13

    Inelastic neutron scattering measurements on monoclinic zirconia (ZrO2) and 8 mol% yttrium-stabilized zirconia were performed at temperatures from 300 to 1373 ωK. We reported temperature-dependent phonon densities of states (DOS) and Raman spectra obtained at elevated temperatures. First-principles lattice dynamics calculations with density functional theory gave total and partial phonon DOS curves and mode Grüneisen parameters. These mode Grüneisen parameters were used to predict the experimental temperature dependence of the phonon DOS with partial success. However, substantial anharmonicity was found at elevated temperatures, especially for phonon modes dominated by the motions of oxygen atoms. Yttrium-stabilized zirconia (YSZ) was somewhat more anharmonic and had a broader phonon spectrum at low temperatures, owing in part to defects in its structure. YSZ also has a larger vibrational entropy than monoclinic zirconia.

  3. Monoclinic zirconia distributions in plasma-sprayed thermal barrier coatings

    NASA Astrophysics Data System (ADS)

    Lance, M. J.; Haynes, J. A.; Ferber, M. K.; Cannon, W. R.

    2000-03-01

    Phase composition in an air plasma-sprayed Y2O3-stabilized ZrO2 (YSZ) top coating of a thermal barrier coating (TBC) system was characterized. Both the bulk phase content and localized pockets of monoclinic zirconia were measured with Raman spectroscopy. The starting powder consisted of ˜15 vol.% monoclinic zirconia, which decreased to ˜2 vol.% in the as-sprayed coating. Monoclinic zirconia was concentrated in porous pockets that were evenly distributed throughout the TBC. The pockets resulted from the presence of unmelted granules in the starting powder. The potential effect of the distributed monoclinic pockets on TBC performance is discussed.

  4. Protonated Forms of Monoclinic Zirconia: A Theoretical Study

    SciTech Connect

    Mantz, Yves A.; Gemmen, Randall S.

    2010-05-06

    In various materials applications of zirconia, protonated forms of monoclinic zirconia may be formed, motivating their study within the framework of density-functional theory. Using the HCTH/120 exchange-correlation functional, the equations of state of yttria and of the three low-pressure zirconia polymorphs are computed, to verify our approach. Next, the favored charge state of a hydrogen atom in monoclinic zirconia is shown to be positive for all Fermilevel energies in the band gap, by the computation of defect formation energies.This result is consistent with a single previous theoretical prediction at midgap as well as muonium spectroscopy experiments. For the formally positively (+1e) charged system of a proton in monoclinic zirconia (with a homogeneous neutralizing background charge densityimplicitly included), modeled using up to a 3 x 3 x 3 arrangement of unit cells, different stable and metastable structures are identified. They are similar to those structures previously proposed for the neutral system of hydrogen-doedmonoclinic zirconia, at a similar level of theory. As predicted using the HCTH/120 functional, the lowest energy structure of the proton bonded to one of the two available oxygen atom types, O1, is favored by 0.39 eV compared to that of the proton bonded to O2. The rate of proton transfer between O1 ions is slower than that for hydrogen-dopedmonoclinic zirconia, whose transition-state structures may be lowered in energy by the extra electron.

  5. Near coincidence site lattice misorientations in monoclinic zirconia

    SciTech Connect

    Gertsman, V.Y. |; Zhilyaev, A.P. |; Szpunar, J.

    1996-12-01

    Zirconium dioxide, ZrO{sub 2}, exists in three crystalline phases: monoclinic, tetragonal, and cubic. Calculations of the coincidence site lattice (CSL) misorientations for the last two lattices and for hexagonal ones using the methods developed represent little difficulty. However, no procedure for the determination of the CSL misorientations in the monoclinic system has been reported so far. Monoclinic zirconia has the crystallographic space group P2{sub 1}/c and the following parameters of the unit cell (e.g., 5, 6): a = 5.1490 {angstrom}, b = 5.2133 {angstrom}, c = 5.3161 {angstrom}, and {beta} = 99.228{degree}. Before discussing possible CSL misorientations in zirconia, consider a simple example based on geometric considerations. In any monoclinic crystal (with any lattice parameters) the two symmetrical boundaries along the (001) and (100) planes must have highly ordered atomic structure. The misorientation of the first boundary is descried as a rotation of either 180{degree} around the [100] direction or 180{degree} around the normal to the (001) plane. The misorientation of the second boundary is 180{degree} [001] or 180{degree} around the normal to the (100) plane. It can be shown that three-dimensional CSLs will exist in both cases if (c/a)cos{beta} is a rational number. This example justifies the following approximation of the unit cell in the monoclinic zirconia: a = b = c and cos{beta} = {minus}1/6 (i.e., {beta} = 99.594{degree}). Consider the following prismatic cell in the monoclinic crystal structure: ([1 0 1], [{bar 1} 0 1], [0 1 0]). With the above approximation, this cell is orthogonal with the ratios of the squares of the edge lengths expressed as 5:7:3. Therefore, one can apply the algorithm for calculations of the CSL misorientations in orthorhombic lattices with rational ratios of squares of the lattice periods, which is based on the general vector-quaternion method of misorientation representation.

  6. Peculiarities of structural transformations in zirconia nanocrystals

    NASA Astrophysics Data System (ADS)

    Vasilevskaya, A.; Almjasheva, O. V.; Gusarov, V. V.

    2016-07-01

    The transitions of metastable tetragonal phase as well as high-temperature tetragonal phase into the low-temperature monoclinic phase upon heating and cooling were thoroughly studied in zirconia nanoparticles. High-temperature X-ray diffraction, thermal analysis and Raman spectroscopy were used to provide the systematic approach to the investigation of zirconia nanoparticles thermal behavior. A phase transformation sequence in the ZrO2-H2O system was determined, and the mechanisms of tetragonal-to-monoclinic transition upon heating and cooling were suggested. Here, the phenomenon was found and described, which was determined as "self-powdering" of nanoparticles occurring during structural transition. This phenomenon was observed by in situ investigation of the evolution of crystalline nanoparticles from amorphous zirconium hydroxide during thermal treatment in air. The tetragonal-to-monoclinic phase transition, induced by cooling from the temperature of equilibrium of tetragonal zirconia (i.e., above 1170 °C), is accompanied by a significant crystallite size decrease (with corresponding 3-4 times decrease of crystallite volume). The experimental results facilitate applications of zirconia nanoparticles to obtain high-performance nanopowders for nanoceramics.

  7. Phase field modeling of tetragonal to monoclinic phase transformation in zirconia

    NASA Astrophysics Data System (ADS)

    Mamivand, Mahmood

    Zirconia based ceramics are strong, hard, inert, and smooth, with low thermal conductivity and good biocompatibility. Such properties made zirconia ceramics an ideal material for different applications form thermal barrier coatings (TBCs) to biomedicine applications like femoral implants and dental bridges. However, this unusual versatility of excellent properties would be mediated by the metastable tetragonal (or cubic) transformation to the stable monoclinic phase after a certain exposure at service temperatures. This transformation from tetragonal to monoclinic, known as LTD (low temperature degradation) in biomedical application, proceeds by propagation of martensite, which corresponds to transformation twinning. As such, tetragonal to monoclinic transformation is highly sensitive to mechanical and chemomechanical stresses. It is known in fact that this transformation is the source of the fracture toughening in stabilized zirconia as it occurs at the stress concentration regions ahead of the crack tip. This dissertation is an attempt to provide a kinetic-based model for tetragonal to monoclinic transformation in zirconia. We used the phase field technique to capture the temporal and spatial evolution of monoclinic phase. In addition to morphological patterns, we were able to calculate the developed internal stresses during tetragonal to monoclinic transformation. The model was started form the two dimensional single crystal then was expanded to the two dimensional polycrystalline and finally to the three dimensional single crystal. The model is able to predict the most physical properties associated with tetragonal to monoclinic transformation in zirconia including: morphological patterns, transformation toughening, shape memory effect, pseudoelasticity, surface uplift, and variants impingement. The model was benched marked with several experimental works. The good agreements between simulation results and experimental data, make the model a reliable tool for

  8. Microstructure, bioactivity and osteoblast behavior of monoclinic zirconia coating with nanostructured surface.

    PubMed

    Wang, Guocheng; Meng, Fanhao; Ding, Chuanxian; Chu, Paul K; Liu, Xuanyong

    2010-03-01

    A monoclinic zirconia coating with a nanostructural surface was prepared on the Ti-6Al-4V substrate by an atmospheric plasma-spraying technique, and its microstructure and composition, as well as mechanical and biological properties, were investigated to explore potential application as a bioactive coating on bone implants. X-ray diffraction, transmission electron microscopy, scanning electron microscopy and Raman spectroscopy revealed that the zirconia coating was composed of monoclinic zirconia which was stable at low temperature, and its surface consists of nano-size grains 30-50 nm in size. The bond strength between the coating and the Ti-6Al-4V substrate was 48.4 + or - 6.1 MPa, which is higher than that of plasma-sprayed HA coatings. Hydrothermal experiments indicated that the coating was stable in a water environment and the phase composition and Vickers hardness were independent of the hydrothermal treatment time. Bone-like apatite is observed to precipitate on the surface of the coating after soaking in simulated body fluid for 6 days, indicating excellent bioactivity in vitro. The nanostructured surface composed of monoclinic zirconia is believed to be crucial to its bioactivity. Morphological observation and the cell proliferation test demonstrated that osteoblast-like MG63 cells could attach to, adhere to and proliferate well on the surface of the monoclinic zirconia coating, suggesting possible applications in hard tissue replacements.

  9. Influence of the monoclinic and tetragonal zirconia phases on the water gas shift reaction. A theoretical study.

    PubMed

    Cerón, María Luisa; Herrera, Barbara; Araya, Paulo; Gracia, Francisco; Toro-Labbé, Alejandro

    2013-07-01

    We present a theoretical study of the water gas shift reaction taking place on zirconia surfaces modeled by monoclinic and tetragonal clusters. In order to understand the charge transfer between the active species, in this work we analyze the influence of the geometry of monoclinic and tetragonal zirconia using reactivity descriptors such as electronic chemical potential (μ), charge transfer (ΔN) and molecular hardness (η). We have found that the most preferred surface is tetragonal zirconia (tZrO2) indicating also that low charge transfer systems will generate less stable intermediates, that will allow to facilitate desorption process.

  10. Monoclinic phase transformation and mechanical durability of zirconia ceramic after fatigue and autoclave aging.

    PubMed

    Mota, Yasmine A; Cotes, Caroline; Carvalho, Rodrigo F; Machado, João P B; Leite, Fabíola P P; Souza, Rodrigo O A; Özcan, Mutlu

    2017-10-01

    This study evaluated the influence of two aging procedures on the biaxial flexural strength of yttria-stabilized tetragonal zirconia ceramics. Disc-shaped zirconia specimens and (ZE: E.max ZirCAD, Ivoclar; ZT: Zirkon Translucent, Zirkonzahn) (N = 80) (∅:12 mm; thickness:1.2 mm, ISO 6872) were prepared and randomly divided into four groups (n = 10 per group) according to the aging procedures: C: Control, no aging; M: mechanical cycling (2 × 10(6) cycles/3.8 Hz/200 N); AUT: Aging in autoclave at 134°C, 2 bar for 24 h; AUT + M: Autoclave aging followed by mechanical cycling. After aging, the transformed monoclinic zirconia (%) were evaluated using X-ray diffraction and surface roughness was measured using atomic force microscopy. The average grain size was measured by scanning electron microscopy and the specimens were submitted to biaxial flexural strength testing (1 mm/min, 1000 kgf in water). Data (MPa) were statistically analyzed using 2-way analysis of variance and Tukey's test (α = 0.05). Aging procedures significantly affected (p = 0.000) the flexural strength data but the effect of zirconia type was not significant (p = 0.657). AUTZT (936.4 ± 120.9(b) ) and AUT + MZE (867.2 ± 49.3(b) ) groups presented significantly higher values (p < 0.05) of flexural strength than those of the control groups (CZT : 716.5 ± 185.7(a) ; CZE : 779.9 ± 114(a) ) (Tukey's test). The monoclinic phase percentage (%) was higher for AUTZE (71), AUTZT (66), AUT + MZE (71), and AUT + MZM (66) compared to the C groups (ZE:0; ZT:0). Surface roughness (µm) was higher for AUTZE (0.09), AUTZT (0.08), AUT + MZE (0.09 µm), and AUT + MZT (0.09 µm) than those of other groups. Regardless of the zirconia type, autoclave aging alone or with mechanical aging increased the flexure strength but also induced higher transformation from tetragonal to monoclinic phase in both zirconia materials tested. © 2016 Wiley Periodicals

  11. Zirconia nanocrystals as submicron level biological label

    NASA Astrophysics Data System (ADS)

    Smits, K.; Liepins, J.; Gavare, M.; Patmalnieks, A.; Gruduls, A.; Jankovica, D.

    2012-08-01

    Inorganic nanocrystals are of increasing interest for their usage in biology and pharmacology research. Our interest was to justify ZrO2 nanocrystal usage as submicron level biological label in baker's yeast Saccharomyces cerevisia culture. For the first time (to our knowledge) images with sub micro up-conversion luminescent particles in biologic media were made. A set of undoped as well as Er and Yb doped ZrO2 samples at different concentrations were prepared by sol-gel method. The up-conversion luminescence for free standing and for nanocrystals with baker's yeast cells was studied and the differences in up-conversion luminescence spectra were analyzed. In vivo toxic effects of ZrO2 nanocrystals were tested by co-cultivation with baker's yeast.

  12. Analysis of tetragonal to monoclinic phase transformation caused by accelerated artificial aging and the effects of microstructure in stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Lucas, Thomas J.

    This investigation addresses the issue that yttria stabilized zirconia is being used as a dental biomaterial without substantial evidence of its long-term viability. Furthermore, stabilized zirconia (SZ) undergoes low temperature degradation (LTD), which can lead to roughening of the surface. A rougher exterior can lead to increased wear of the antagonist in the oral environment. Despite the LTD concerns, SZ is now widely used in restorative dentistry, including full contour crowns. A comparison of aging methods to determine the role of artificial aging on inducing the transformation has not been extensively studied. Therefore, simulations of the transformation process were investigated by comparing different methods of accelerated aging. The rejected null hypothesis is that the temperature of aging treatment will not affect the time required to cause measurable monoclinic transformation of yttria stabilized zirconia. The transformation of SZ starts at the surface and progresses inward; however, it is unclear whether the progression is constant for different aging conditions. This investigation analyzed the depth of transformation as a function of aging conditions for stabilized zirconia in the top 5-6 mum from the surface. The rejected null hypothesis is that the transformation amount is constant throughout the first six micrometers from the surface. The effects of grain size on the amount of monoclinic transformation were also investigated. This study aimed to determine if the grain size of partially stabilized zirconia affects the amount of monoclinic transformation, surface roughness, and property degradation due to aging. The rejected null hypothesis is that the grain size will not affect the amount of monoclinic transformation, thus have no effect on surface roughening or property degradation. The final part of this study addresses the wear of enamel when opposing zirconia by observing how grain size and aging affected the wear rate of an enamel antagonist

  13. Microstructural characterization and optical properties of green emitting hexagonal and monoclinic CePO4:Tb3+ nanocrystals

    NASA Astrophysics Data System (ADS)

    Sisira, S.; Alexander, Dinu; Thomas, Kukku; Vimal, G.; Mani, Kamal P.; Biju, P. R.; Unnikrishnan, N. V.; Joseph, Cyriac

    2017-02-01

    Green emitting CePO4:Tb3+ nanocrystals with hexagonal and monoclinic structures were successfully synthesized through microwave assisted sol gel method. The variation observed in the powder XRD pattern from that of bulk is explained using HRTEM analysis in relation with the preferential growth in distinct directions to form nanorods. The results obtained from the microstructural characterization of the hexagonal and monoclinic CePO4:Tb3+nanocrystals are successfully correlated with the single crystal data of CePO4 for the first time in accordance with the single crystal growth theory. FTIR spectrum of the CePO4 nanocrystals evidenced the splitting of fundamental vibrations of phosphate group in the nine fold coordination of lanthanide atoms and confirmed the low symmetry of monoclinic structure than the hexagonal system. The diminishing intensity of terbium emission in the hexagonal structure than the monoclinic structured CePO4:Tb3+ nanocrystals is explained in relation with the lattice symmetry. The high intensity green emission due to the strong 5D4-7F5 transition in monoclinic CePO4:Tb3+ nanocrystals make it as a potential candidate for optoelectronic applications.

  14. On the kinetics and impact of tetragonal to monoclinic transformation in an alumina/zirconia composite for arthroplasty applications.

    PubMed

    Chevalier, Jérôme; Grandjean, Sylvie; Kuntz, Meinhard; Pezzotti, Giuseppe

    2009-10-01

    Latest trends in load-bearing materials for arthroplastic applications involve the development of highly fracture resistant alumina/zirconia composites, as an alternative choice to alumina and zirconia monolithic ceramics. Composite materials are designed from both chemical and microstructural viewpoints in order to prevent environmental degradation and fracture events in vivo, whose shadow yet hampers the full exploitation of ceramic materials in the field of arthroplasty. The aim of this paper is to evaluate the resistance to environmental degradation in an alumina/zirconia composite (Biolox Delta), which represents a primary candidate for hip and knee joint applications. Our approach consists first in the experimental determination of an activation energy value for environmentally driven tetragonal to monoclinic (t-m, henceforth) polymorphic transformation in the zirconia phase of the material; then, based on such an experimental value, a prediction is given for the long-term in vivo environmental resistance of prostheses made of the composite material. The present evaluation clarifies the in vivo performance of this new composite for orthopedic applications.

  15. Effect of grain size on the monoclinic transformation, hardness, roughness, and modulus of aged partially stabilized zirconia.

    PubMed

    Lucas, Thomas J; Lawson, Nathaniel C; Janowski, Gregg M; Burgess, John O

    2015-12-01

    Low-temperature-degradation (LTD) has been reported to cause property changes in yttria-tetragonal zirconia polycrystals (Y-TZP). The current study measured monoclinic phase transformation of Y-TZP with different grain sizes and corresponding property changes due to artificial aging. the grain size of aged Y-TZP will not influence its transformation, roughness, hardness or modulus of elasticity. Four groups of Y-TZP were examined with differing grain sizes (n=5). The line intercept technique was used to determine grain sizes on SEM images (100,000×). Artificial aging was accomplished by autoclaving at 2 bar pressure for 5 h. X-ray diffraction (30 mA, 40 kV) was used to measure tetragonal to monoclinic transformation (t→m). Surface roughness analysis was performed using a non-contact surface-profilometer. Nano-hardness and modulus of elasticity were measured using nano-indentation. SEM analyses showed different grain sizes for each sample group (0.350 μm, 0.372 μm, 0.428 μm, and 0.574 μm). The fraction of t→m transformation increased as grain size increased; furthermore, aging of zirconia caused increased roughness. Modulus and hardness after aging displayed no significant correlation or interaction with grain size. Smaller grains caused less transformation, and aging caused increased roughness, but grain size did not influence the amount of increased surface roughness. Future studies are needed to determine the effects of grain size on the wear and fracture properties of dental zirconia. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  16. Direct Single-Enzyme Biomineralization of Catalytically Active Ceria and Ceria-Zirconia Nanocrystals.

    PubMed

    Curran, Christopher D; Lu, Li; Jia, Yue; Kiely, Christopher J; Berger, Bryan W; McIntosh, Steven

    2017-02-21

    Biomineralization is an intriguing approach to the synthesis of functional inorganic materials for energy applications whereby biological systems are engineered to mineralize inorganic materials and control their structure over multiple length scales under mild reaction conditions. Herein we demonstrate a single-enzyme-mediated biomineralization route to synthesize crystalline, catalytically active, quantum-confined ceria (CeO2-x) and ceria-zirconia (Ce1-yZryO2-x) nanocrystals for application as environmental catalysts. In contrast to typical anthropogenic synthesis routes, the crystalline oxide nanoparticles are formed at room temperature from an otherwise inert aqueous solution without the addition of a precipitant or additional reactant. An engineered form of silicatein, rCeSi, as a single enzyme not only catalyzes the direct biomineralization of the nanocrystalline oxides but also serves as a templating agent to control their morphological structure. The biomineralized nanocrystals of less than 3 nm in diameter are catalytically active toward carbon monoxide oxidation following an oxidative annealing step to remove carbonaceous residue. The introduction of zirconia into the nanocrystals leads to an increase in Ce(III) concentration, associated catalytic activity, and the thermal stability of the nanocrystals.

  17. Hydrothermal Synthesis of Yttria-Stabilized Zirconia Nanocrystals with Controlled Yttria Content.

    PubMed

    Sato, Kazuyoshi; Horiguchi, Kazuya; Nishikawa, Taku; Yagishita, Sadahiro; Kuruma, Kazuo; Murakami, Takeshi; Abe, Hiroya

    2015-08-17

    In this study, we demonstrate for the first time the hydrothermal synthesis of yttria-stabilized zirconia (YSZ) nanocrystals with controlled yttria content (x = 3-12 mol %; xYSZ) with negligible aggregation from aqueous solution. The nanocrystals were grown via the hydrothermal treatment of basic Zr(IV) and Y(III) carbonate complex aqueous solutions in the presence of a cationic ligand, N(CH3)4(+). The nanocrystals were characterized in detail by dynamic light scattering, ζ-potential measurement, X-ray diffraction, specific surface area measurement based on the Brunauer-Emmett-Teller theory, transmission electron microscopy, energy dispersive X-ray spectroscopy, and Raman spectroscopy. Shorter reaction times and higher Y2O3 content produce aqueous solutions with higher transparencies containing nanocrystals with sizes of 10 nm or less. Nanocrystals with the target composition were obtained by hydrothermal reaction for longer than 3 h, regardless of the Y2O3 content. The main phase is tetragonal for (3-6)YSZ and cubic with disordered oxygen vacancies for (8-12)YSZ. The characteristics of the nanocrystalline material synthesized are consistent with those of bulk YSZ crystals, indicating the growth of high-quality nanocrystals.

  18. Hansen solubility parameter analysis on the dispersion of zirconia nanocrystals.

    PubMed

    Wang, Sho-Hsun; Liu, Jia-Hong; Pai, Chin-Tung; Chen, Chien-Wei; Chung, Pao-Tang; Chiang, Anthony Shiaw-Tseh; Chang, Shinn-Jen

    2013-10-01

    Nanoparticle dispersible in a broad range of solvents is desirable when preparing an organic/inorganic nanocomposite. In this report, the dispersion behavior of carboxylate-grafted zirconia nanoparticle in 25 solvents covering a wide range of polarity was analyzed based on their Hansen solubility parameters (HSP). Particles grafted with alkyl-chain longer than four carbons could only be dispersed in non-polar solvents, while that grafted with acetic acid was dispersible in polar ones. However, particle modified with methacrylic acid (MA) was compatible with both types of solvents, which was rather unexpected. Further NMR analysis showed that the carboxylate-grafted samples contained a trace amount of triethanolamine (TEA) due to the particular ZrO2 synthesis process employed. The combination of the hydrophilic TEA ligand with the short hydrophobic tail of methacrylate broadened the range of compatible solvents from benzene to methanol. Such an extended solvent compatibility was observed previously only for nanoparticles covered with large polymer surfactants having both hydrophilic and hydrophobic groups. Achieving this with two small molecules having separate functional groups is crucial when one needs to maximize the inorganic content in a composite.

  19. Luminescent nanocrystals in the rare-earth niobate–zirconia system formed via hydrothermal method

    SciTech Connect

    Hirano, Masanori Dozono, Hayato

    2013-08-15

    Luminescent nanocrystals based on the rare-earth niobates (Ln{sub 3}NbO{sub 7}, Ln=Y, Eu) and zirconia (ZrO{sub 2}) that were composed of 50 mol% Ln{sub 3}NbO{sub 7} and 50 mol% ZrO{sub 2}, were hydrothermally formed as cubic phase under weakly basic conditions at 240 °C. The lattice parameter of the as-prepared nanoparticles corresponding to the composition of Y{sub 3−x}Eu{sub x}NbO{sub 7}–4ZrO{sub 2} that was estimated as a single phase of cubic gradually increased as the content of europium x increased. The existence of small absorbance peaks at 395 and 466 nm corresponding to the Eu{sup 3+7}F{sub 0}→{sup 5}L{sub 6}, and {sup 7}F{sub 0}→{sup 5}D{sub 2} excitation transition, respectively, was clearly observed in the diffuse reflectance spectra of the as-prepared samples containing europium. The optical band gap of the as-prepared samples was in the range from 3.5 to 3.7 eV. The photoluminescence spectra of the as-prepared nanocrystals containing europium showed orange and red luminescences with main peaks at 590 and 610 nm, corresponding to {sup 5}D{sub 0}→{sup 7}F{sub 1} and {sup 5}D{sub 0}→{sup 7}F{sub 2} transitions of Eu{sup 3+}, respectively, under excitation at 395 nm Xe lamp. The emission intensity corresponding to {sup 5}D{sub 0}→{sup 7}F{sub 2} transition increased as heat-treatment temperature rose from 800 to 1200 °C. - Graphical abstract: This graphical abstract shows the excitation and emission spectra and a transmission electron microscopy image of nanocrystals (with composition based on the rare-earth niobates (Ln{sub 3}NbO{sub 7}, Ln=Y, Eu) and zirconia (ZrO{sub 2}) that were composed of 50 mol% Ln{sub 3}NbO{sub 7} and 50 mol% ZrO{sub 2}) formed via hydrothermal route. Display Omitted - Highlights: • Nanocrystals composed of 50 mol% Y{sub 3−x}Eu{sub x}NbO{sub 7} and 50 mol% ZrO{sub 2} was directly formed. • The nanocrystals were hydrothermally formed under weakly basic conditions at 240 °C. • The Y{sub 3}NbO{sub 7} showed

  20. Ag3PO4 nanocrystals deposited on monoclinic olive-like BiVO4 with efficient photodegradation of organic dyes under visible light irradiation

    NASA Astrophysics Data System (ADS)

    Chen, Jingshuai; Jiang, Liang-Liang; Liu, Xing-Pei; Mao, Chang-Jie; Song, Ji-Ming; Niu, Helin; Zhang, Shengyi

    2017-05-01

    Olive-like BiVO4 microstructures with lengths of 600-1000 nm and widths of 300-600 nm have been synthesized via a facile and additive-free solvothermal method. Studies find that the type of solvent plays an important role in the morphology of the final products. Furthermore, Ag3PO4 nanocrystals are successfully deposited on monoclinic olive-like BiVO4 via in situ precipitation method. The as-synthesized samples were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), high resolution transmission electron microscopy (HRTEM), photoluminescence (PL) spectra, and UV-vis diffuse reflectance spectra (DRS). The photocatalytic activities of the catalysts are evaluated by degradation of rhodamine B (RhB) and methylene blue (MB) under visible light (≥420 nm) irradiation. The experimental results suggest that catalytic activity of the composite photocatalysts is greatly influenced by the loading level of Ag3PO4. The molar ratio of 0.8:1.0 Ag3PO4-loaded BiVO4 exhibits higher photocatalytic activity in both the decolorization of RhB and MB than that of individual BiVO4 and P25. The observed improvement in photocatalytic activity is associated with the extended absorption in the visible light region resulting from the Ag3PO4 nanoparticles, and the effective separation of photogenerated carriers at the Ag3PO4/BiVO4 interfaces through the formation of heterojunction structure. The study provides a general and effective method in the fabrication of composite with sound heterojunctions that may show a variety of applications.

  1. The radiation response of mesoporous nanocrystalline zirconia thin films

    NASA Astrophysics Data System (ADS)

    Manzini, Ayelén M.; Alurralde, Martin A.; Giménez, Gustavo; Luca, Vittorio

    2016-12-01

    The next generation of nuclear systems will require materials capable of withstanding hostile chemical, physical and radiation environments over long time-frames. Aside from its chemical and physical stability, crystalline zirconia is one of the most radiation tolerant materials known. Here we report the first ever study of the radiation response of nanocrystalline and mesoporous zirconia and Ce3+-stabilized nanocrystalline zirconia (Ce0.1Zr0.9O2) thin films supported on silicon wafers. Zirconia films prepared using the block copolymer Brij-58 as the template had a thickness of around 60-80 nm. In the absence of a stabilizing trivalent cation they consisted of monoclinic and tetragonal zirconia nanocrystals with diameters in the range 8-10 nm. Films stabilized with Ce3+ contained only the tetragonal phase. The thin films were irradiated with iodine ions of energies of 70 MeV and 132 keV at low fluences (1013 - 1014 cm-2) corresponding to doses of 0.002 and 1.73 dpa respectively, and at 180 keV and high fluences (2 × 1016 cm-2) corresponding to 82.4 dpa. The influence of heavy ion irradiation on the nanocrystalline structure was monitored through Rietveld analysis of grazing incidence X-ray diffraction (GIXRD) patterns recorded at angles close to the critical angle to ensure minimum contribution to the diffraction pattern from the substrate. Irradiation of the mesoporous nanocrystalline zirconia thin films with 70 MeV iodine ions, for which electronic energy loss is dominant, resulted in slight changes in phase composition and virtually no change in crystallographic parameters as determined by Rietveld analysis. Iodine ion bombardment in the nuclear energy loss regime (132-180 keV) at low fluences did not provoke significant changes in phase composition or crystallographic parameters. However, at 180 keV and high fluences the monoclinic phase was totally eliminated from the GIXRD pattern of films prepared at both 350 and 500 °C implying either a monoclinic

  2. Phase transformation of a new generation yttria-stabilized zirconia femoral head after total hip arthroplasty.

    PubMed

    Hayaishi, Yasuhisa; Miki, Hidenobu; Yoshikawa, Hideki; Sugano, Nobuhiko

    2008-01-01

    We examined a new-generation yttria-stabilized zirconia head manufactured by NGK 1 year after total hip arthroplasty. Monoclinic content of the retrieved head was twice that of the unused head at the pole and equator. A fourfold increase in monoclinic content was observed at 5 mm below the equator. Transformation from the tetragonal phase to the monoclinic phase occurred in the new generation zirconia with alumina doping within a relatively short period in vivo.

  3. Luminescence and energy transfer mechanism in Eu3+/Tb3+-co-doped ZrO2 nanocrystal rods

    NASA Astrophysics Data System (ADS)

    Ahemen, I.; Dejene, F. B.

    2017-01-01

    Nanocrystal rods of Eu3+/Tb3+-co-doped ZrO2 were synthesized using a simple chemical precipitation technique. Both ions were successfully doped into the Zr4+ ion site in a mixed structure containing both monoclinic and tetragonal phases. The Eu3+ or Tb3+ singly doped zirconia produced red and green luminescence which are characteristics of Eu3+ and Tb3+ ions, respectively. The co-doped zirconia samples produced blue emission from defect states transitions in the host ZrO2, red and green luminescence from dopant ions giving cool to warm white light emissions. The phosphors were efficiently excited by ultraviolet and near-ultraviolet/blue radiations giving white and red light, respectively. The decay lifetime was found to increase with increasing donor ion concentration contrary to conventional observations reported by previous researchers. Weak quadrupole-quatdrupole multipolar process was responsible for energy transfer from Tb3+ (donor) ion to Eu3+ ion. No energy back-transfer from Eu3+ to Tb3+ ion was observed from the excitation spectra. Temperature-dependent photoluminescence shows the presence of defects at low temperature, but these defects vanished at room temperature and beyond. The Eu3+/Tb3+-co-doped ZrO2 nanocrystal rod is a potential phosphor for white light application using UV as an excitation source. Thermoluminescence measurements show that the inclusion of Tb3+ ion increases trap depths in the host zirconia.

  4. Phase stability of zirconia at nanoscale.

    NASA Astrophysics Data System (ADS)

    Sabiryanov, Renat; Mei, W. N.

    2004-03-01

    There are three phases of ZrO2, namely cubic, tetragonal and monoclinic. Cubic phase of zirconia is usually stabilized by various dopants such as yttria and magnesia. However, it has been observed that these stablizers are indeed the source failure of doped ZrO2 in both orthopaedics and in ZrO2 used in high temperature applications. Recently, the cubic zirconia was fabricated as granular media with the grain sizes less than 17nm. We examine the phase stability in zirconia nanoparticles using first principle electronic structure method. We observe considerable relaxation of lattice in the monoclinic phase near the surface. This effect combined with surface tension and possibly vacancies in nanostructures are sources of stability of cubic zirconia at nanoscale. We performed calculation of the surface tension calculations for the pure (001) surface. The uniform compressive strain is applied in the plane of the slab to find the elastic response of the system. The slab is allowed to relax in the perpendicular direction. Uniform compressive strain in the plane of the slab causes increase in the distance between Zr and O layers for (001) surface (as a solid tends to preserve the volume). For cubic it gives -0.65N/m, while for monoclinic -0.48N/m. Furthermore, the solid-gas surface tension is a fundamental physical/chemical property of a solid, which affects its wetting properties. Therefore, cubic zirconia is more suitable to design the material combining wettability, ductility and hardness.

  5. (Hyperfine experimental investigation of zirconia ceramics)

    SciTech Connect

    Not Available

    1992-01-01

    This research program has encompassed a broad investigation of microscopic structure and point defect properties in insulating materials and some recent exploratory work on semiconductors. The major experimental technique is perturbed angular correlation (PAC) spectroscopy. Our research provides information about the microscopic structure, nucleation, and equilibrium of structural phases in materials under investigation. We have studied phase equilibria in monoclinic, tetragonal, and cubic zirconia in the past and have recently begun more detailed investigation of high-temperature anomalies in monoclinic zirconia and tetragonal stabilized zirconia. We also have found a number of instances where the indium PAC probe has detected subtle phase changes, small precipitate formation, and other phase behavior that are difficult to detect by conventional diffraction methods. The PAC experimental technique is described briefly in section 2, and recent research is reviewed in section 3.

  6. Zirconia implant abutments: microstructural analysis.

    PubMed

    Vaquero-Aguilar, Cristina; Jiménez-Melendo, Manuel; Torres-Lagares, Daniel; Llena-Blasco, Oriol; Bruguera, August; Llena-Blasco, Jaime; García-Calderón, Manuel; Velázquez-Cayón, Rocío; Gutiérrez-Pérez, José-Luis

    2012-01-01

    Yttria-stabilized zirconia (ZrO₂-Y₂O₃) ceramics have received increasing attention in recent years because of their stress-induced tetragonal-to-monoclinic (martensitic) transformation. This unique process acts as a toughening mechanism, imparting strength and toughness to the ceramic alloy. This property, along with well-documented biocompatibility, is now being exploited in an increasing number of medical applications, including implant dentistry. To prevent clinical problems and predict their behavior and physical limitations, a characterization of the ceramic elements used in dental restorations is essential. The aim of the present study is to characterize the crystal structure, elemental composition, and micr ostructure of asreceived ZiReal Post (Biomet 3i) zirconium oxide abutments, as well as specimens coated with a first layer of a low-fusing fluoroapatite ceramic. Zirconium oxide abutments, both as-received and porcelain-coated, were studied using the following techniques: x-ray diffraction, x-ray fluorescence, energy dispersive x-ray spectroscopy, optical microscopy, and scanning and transmission electron microscopy. X-ray analyses detected only the presence of Zr, O, Y, and hafnium (Hf), in an amount of 3% to 4% molecular weight Y₂O₃-ZrO₂. X-ray diffraction measurements showed that the ceramic abutment crystallizes mainly in the tetragonal phase, with some residual monoclinic phase. The microstructure is characterized by a rather homogenous grain distribution, formed by equiaxed and fine grains with a mean size of 0.30 Μm. Compositional and diffraction results are consistent with polycrystalline yttria-stabilized tetragonal zirconia. The material is susceptible to undergoing the stress-induced transformation toughening mechanism because of the very fine grain size. Except for machining ring marks, the surfaces exhibit an excellent finishing quality. No structural modifications were observed in the fluoroapatite ceramic-coated abutments

  7. [Hyperfine experimental investigation of zirconia ceramics]. [Annual progress report 20

    SciTech Connect

    Not Available

    1992-09-01

    This research program has encompassed a broad investigation of microscopic structure and point defect properties in insulating materials and some recent exploratory work on semiconductors. The major experimental technique is perturbed angular correlation (PAC) spectroscopy. Our research provides information about the microscopic structure, nucleation, and equilibrium of structural phases in materials under investigation. We have studied phase equilibria in monoclinic, tetragonal, and cubic zirconia in the past and have recently begun more detailed investigation of high-temperature anomalies in monoclinic zirconia and tetragonal stabilized zirconia. We also have found a number of instances where the indium PAC probe has detected subtle phase changes, small precipitate formation, and other phase behavior that are difficult to detect by conventional diffraction methods. The PAC experimental technique is described briefly in section 2, and recent research is reviewed in section 3.

  8. Effect of hydrothermal treatment on light transmission of translucent zirconias.

    PubMed

    Putra, Armand; Chung, Kwok-Hung; Flinn, Brian D; Kuykendall, Tuesday; Zheng, Cheng; Harada, Kosuke; Raigrodski, Ariel J

    2017-09-01

    Studies of the light transmission of translucent zirconias after hydrothermal treatment are limited. The purpose of this in vitro study was to evaluate the effect of hydrothermal treatment on the light transmission of translucent zirconias for monolithic restorations. Four commercially available zirconia products, BruxZir Anterior Solid Zirconia (BruxAnt, BA), Lava Plus High Translucency (LPHT), Katana Zirconia Super Translucent (KST), and Katana Zirconia Ultra Translucent (KUT) were assessed and 1 type of lithium disilicate, e.max Press LT (LDLT) was used as a control. Plate specimens, 20×20×1 mm (n=80) for the translucency assessment were sectioned from postsintered zirconia bulk materials and ground with a #400-grit diamond wheel and coolant. The specimens were placed under hydrothermal conditions of 134°C at 0.2 MPa (n=5 per group at 0, 5, 50, and 100 hours). Percentage of total transmittance of light (Tt%) of each specimen was measured using a spectrophotometer with an integrating sphere. X-ray diffraction analyses were used to measure tetragonal-monoclinic phase transformation. Surfaces were examined by scanning electron microscopy and energy dispersive spectrometry. Data were analyzed using 2-way ANOVA followed by the Tukey test (α=.05). The Tt% ranged from 6.5% to 28.3%. Group LDLT obtained significantly higher transmittance than other tested groups, whereas groups KST and KUT had significantly higher Tt% than groups BA and LPHT (P<.05). A statistically significant increase in the amount of monoclinic phase was revealed within all translucent zirconia groups (P<.05), and the increase in group LPHT was significantly higher than those of the other 3 translucent zirconias (P<.05). Minimal changes in the percentages of light transmittance were revealed after 100-hour hydrothermal treatment for all tested translucent zirconias and a lithium disilicate glass-ceramic control. Hydrothermal treatment had minimal effects on the translucency of translucent

  9. Phase transformation of zirconia ceramics by hydrothermal degradation.

    PubMed

    Kawai, Yohei; Uo, Motohiro; Wang, Yongming; Kono, Sayaka; Ohnuki, Somei; Watari, Fumio

    2011-01-01

    Zirconia has found wide application in dentistry because of its high mechanical strength and superior esthetic properties. However, zirconia degradation caused by phase transformation occurring in a hydrothermal environment is of concern. In the present study, phase transformation and microstructure of tetragonal zirconia polycrystal partially stabilized with yttrium oxide (Y-TZP) and alumina-toughened zirconia (ATZ) sintered at different temperatures were estimated. On grazing angle X-ray diffraction analysis, ATZ showed less phase transformation to the monoclinic phase during hydrothermal treatment and this transformation appeared to occur within a few micrometers below the surface. At a higher sintering temperature the monoclinic phase content of ATZ was found to be lesser than that of Y-TZP, indicating that the alumina in ATZ was effective in suppressing hydrothermal degradation. Examination by transmission electron microscopy and studying of electron backscatter diffraction patterns indicated that grain growth in ATZ was slightly suppressed compared with that in Y-TZP at higher sintering temperatures. The present study demonstrated the effect of adding alumina to zirconia for suppressing hydrothermal degradation and studied the effect of this addition on grain growth in zirconia.

  10. Structural and Chemical Analysis of the Zirconia-Veneering Ceramic Interface.

    PubMed

    Inokoshi, M; Yoshihara, K; Nagaoka, N; Nakanishi, M; De Munck, J; Minakuchi, S; Vanmeensel, K; Zhang, F; Yoshida, Y; Vleugels, J; Naert, I; Van Meerbeek, B

    2016-01-01

    The interfacial interaction of veneering ceramic with zirconia is still not fully understood. This study aimed to characterize morphologically and chemically the zirconia-veneering ceramic interface. Three zirconia-veneering conditions were investigated: 1) zirconia-veneering ceramic fired on sandblasted zirconia, 2) zirconia-veneering ceramic on as-sintered zirconia, and 3) alumina-veneering ceramic (lower coefficient of thermal expansion [CTE]) on as-sintered zirconia. Polished cross-sectioned ceramic-veneered zirconia specimens were examined using field emission gun scanning electron microscopy (Feg-SEM). In addition, argon-ion thinned zirconia-veneering ceramic interface cross sections were examined using scanning transmission electron microscopy (STEM)-energy dispersive X-ray spectrometry (EDS) at high resolution. Finally, the zirconia-veneering ceramic interface was quantitatively analyzed for tetragonal-to-monoclinic phase transformation and residual stress using micro-Raman spectroscopy (µRaman). Feg-SEM revealed tight interfaces for all 3 veneering conditions. High-resolution transmission electron microscopy (HRTEM) disclosed an approximately 1.0-µm transformed zone at sandblasted zirconia, in which distinct zirconia grains were no longer observable. Straight grain boundaries and angular grain corners were detected up to the interface of zirconia- and alumina-veneering ceramic with as-sintered zirconia. EDS mapping disclosed within the zirconia-veneering ceramic a few nanometers thick calcium/aluminum-rich layer, touching the as-sintered zirconia base, with an equally thick silicon-rich/aluminum-poor layer on top. µRaman revealed t-ZrO2-to-m-ZrO2 phase transformation and residual compressive stress at the sandblasted zirconia surface. The difference in CTE between zirconia- and the alumina-veneering ceramic resulted in residual tensile stress within the zirconia immediately adjacent to its interface with the veneering ceramic. The rather minor chemical

  11. Nanocrystal structures

    DOEpatents

    Eisler, Hans J.; Sundar, Vikram C.; Walsh, Michael E.; Klimov, Victor I.; Bawendi, Moungi G.; Smith, Henry I.

    2006-12-19

    A structure including a grating and a semiconductor nanocrystal layer on the grating, can be a laser. The semiconductor nanocrystal layer can include a plurality of semiconductor nanocrystals including a Group II–VI compound, the nanocrystals being distributed in a metal oxide matrix. The grating can have a periodicity from 200 nm to 500 nm.

  12. Nanocrystal structures

    DOEpatents

    Eisler, Hans J [Stoneham, MA; Sundar, Vikram C [Stoneham, MA; Walsh, Michael E [Everett, MA; Klimov, Victor I [Los Alamos, NM; Bawendi, Moungi G [Cambridge, MA; Smith, Henry I [Sudbury, MA

    2008-12-30

    A structure including a grating and a semiconductor nanocrystal layer on the grating, can be a laser. The semiconductor nanocrystal layer can include a plurality of semiconductor nanocrystals including a Group II-VI compound, the nanocrystals being distributed in a metal oxide matrix. The grating can have a periodicity from 200 nm to 500 nm.

  13. Synthesis and characterization of mesoporous zirconia and aluminated mesoporous zirconia

    NASA Astrophysics Data System (ADS)

    Zhao, Elizabeth Sun

    Synthesis of mesoporous zirconia has been performed by slowly hydrolyzing zirconium propoxide in the presence of anionic surfactants: namely, dodecyl phosphate or sulfate (P12 and Sf12) and hexadecyl sulfonate (So16) The zirconia. outgassed at 140--150°C has T-plot surface areas higher than 400 M2/g. This outgassing does not remove the surfactant. After calcination in air at 500°C and combustion of the surfactant, the mesoporous volume is reduced by a factor of about 2, whereas the pore wall material crystallizes in the tetragonal phase. The high-resolution electron microscopic study reveals the presence of a disorganized network of polygonal pores structure. It is suggested that the chemistry of the hydrolysis solution is instrumental in determining the pore structure. A schematic model in which the surfactant is a scaffold component is suggested in order to explain these results and the fixation of PO4, or SO4 in the walls may help to preserve the porous structure. It is very different from the templating mechanism. From the density obtained from phase transition temperature, and from the mesoporous volume (N2 adsorption), the thickness of the wall can be calculated as well as the pseudo-length of the pores. From the thickness, the T-plot area can be recalculated and agrees well with the measured T-plot surface area for the sample calcined at 500°C. Around 900°C, the walls become thicker and crystallizes into monoclinic zirconia without pore structure. In order to try to modify, the acidity of the mesoporous sulfated and oxo-phosphated zirconia, they were doped with aluminum. The sulfated zirconia only has a coating layer of amorphous alumina, while the phosphated zirconia has aluminum in the lattice and the alumina coat. A maximum ratio of Al/Zr ˜ 0.04 can be reached in the lattice. The introduction of aluminum into the lattice prevents the crystallization of the oxo-phosphate at 900°C, and helps to preserve the surface area and porosity of the sulfated

  14. Superhard monoclinic polymorph of carbon.

    PubMed

    Li, Quan; Ma, Yanming; Oganov, Artem R; Wang, Hongbo; Wang, Hui; Xu, Ying; Cui, Tian; Mao, Ho-Kwang; Zou, Guangtian

    2009-05-01

    We report a novel phase of carbon possessing a monoclinic C2/m structure (8 atoms/cell) identified using an ab initio evolutionary structural search. This polymorph, which we call M-carbon, is related to the (2x1) reconstruction of the (111) surface of diamond and can also be viewed as a distorted (through sliding and buckling of the sheets) form of graphite. It is stable over cold-compressed graphite above 13.4 GPa. The simulated x-ray diffraction pattern and near K-edge spectroscopy are in satisfactory agreement with the experimental data [W. L. Mao, Science 302, 425 (2003)10.1126/science.1089713] on overcompressed graphite. The hardness and bulk modulus of this new carbon polymorph are calculated to be 83.1 and 431.2 GPa, respectively, which are comparable to those of diamond.

  15. Superhard Monoclinic Polymorph of Carbon

    SciTech Connect

    Li, Quan; Ma, Yanming; Oganov, Artem R.; Wang, Hongbo; Wang, Hui; Xu, Ying; Cui, Tian; Mao, Ho-Kwang; Zou, Guangtian; Jilin; SBU; CIW

    2009-05-08

    We report a novel phase of carbon possessing a monoclinic C2/m structure (8 atoms/cell) identified using an ab initio evolutionary structural search. This polymorph, which we call M-carbon, is related to the (2x1) reconstruction of the (111) surface of diamond and can also be viewed as a distorted (through sliding and buckling of the sheets) form of graphite. It is stable over cold-compressed graphite above 13.4 GPa. The simulated x-ray diffraction pattern and near K-edge spectroscopy are in satisfactory agreement with the experimental data [W.L. Mao et al., Science 302, 425 (2003)] on overcompressed graphite. The hardness and bulk modulus of this new carbon polymorph are calculated to be 83.1 and 431.2 GPa, respectively, which are comparable to those of diamond.

  16. Glass ceramic toughened with tetragonal zirconia

    DOEpatents

    Keefer, K.D.

    1984-02-10

    A phase transformation-toughened glass ceramic and a process for making it are disclosed. A mixture of particulate network-forming oxide, network-modifying oxide, and zirconium oxide is heated to yield a homogeneous melt, and this melt is then heat treated to precipitate an appreciable quantity of tetragonal zirconia, which is retained at ambient temperature to form a phase transformation-toughened glass ceramic. Nuclearing agents and stabilizing agents may be added to the mixture to facilitate processing and improve the ceramic's properties. Preferably, the mixture is first melted at a temperature from 1200 to 1700/sup 0/C and is then heat-treated at a temperature within the range of 800 to 1200/sup 0/C in order to precipitate tetragonal ZrO/sub 2/. The composition, as well as the length and temperature of the heat treatment, must be carefully controlled to prevent solution of the precipitated tetragonal zirconia and subsequent conversion to the monoclinic phase.

  17. Silicon carbide whisker-zirconia reinforced mullite and alumina ceramics

    DOEpatents

    Becher, Paul F.; Tiegs, Terry N.

    1987-01-01

    The flexural strength and/or fracture toughness of SiC whisker-reinforced composites utilizing mullite or alumina as the matrix material for the composite are increased by the addition of zirconia in a monoclinic or tetragonal phase to the matrix. The zirconia addition also provides for a lower hot-pressing temperature and increases the flexural strength and/or fracture toughness of the SiC whisker-reinforced composites over SiC whisker-reinforced composites of the similar matrix materials reinforced with similar concentrations of SiC whiskers.

  18. Phase analysis of plasma-sprayed zirconia-yttria coatings

    NASA Technical Reports Server (NTRS)

    Shankar, N. R.; Berndt, C. C.; Herman, H.

    1983-01-01

    Phase analysis of plasma-sprayed 8 wt pct-yttria-stabilized zirconia (YSZ) thermal barrier coatings and powders was carried out by X-ray diffraction. Step scanning was used for increased peak resolution. Plasma spraying of the YSZ powder into water or onto a steel substrate to form a coating reduced the cubic and monoclinic phases with a simultaneous increase in the tetragonal phase. Heat treatment of the coating at 1150 C for 10 h in an Ar atmosphere increased the amount of cubic and monoclinic phases. The implications of these transformations on coating performance and integrity are discussed.

  19. Conduction band topology and optical properties of monoclinic ZrO_2

    NASA Astrophysics Data System (ADS)

    Freeman, A. J.; Medvedeva, J. E.; Geller, C. B.

    2004-03-01

    Zirconia is an attractive base material for a wide variety of optical applications, on account of its high refractive index, large band gap and low optical loss. We report highly precise density functional theory calculations on pure, monoclinic zirconia employing the self-consistent screened exchange local-density approximation(R. Asahi, W. Mannstadt, A. J. Freeman, Phys. Rev. B) 59, 7486 (1999) (sX-LDA) with the full-potential linearized augmented plane wave (FLAPW) method(E. Wimmer, H. Krakauer, M. Weinert, A.J. Freeman, Phys. Rev. B) 24, 864 (1981). The sX-LDA substantially reduces the overbinding error in the LDA resulting in a more accurate description of the band gap and excited states in semiconductors(C.B. Geller er al), Appl. Phys. Lett. 79, 368 (2001) and insulators (this work). The predicted sX-LDA indirect band gap of monoclinic ZrO2 is 5.7 eV, in agreement with experiment. The effects of carrier concentration on the effective masses and optical properties of zirconia are discussed.

  20. Phase distributions in plasma-sprayed zirconia-yttria

    NASA Technical Reports Server (NTRS)

    Miller, R. A.; Garlick, R. G.; Smialek, J. L.

    1983-01-01

    The distribution of phases in plasma-sprayed zirconia-yttria has been determined over a range of yttria levels from 0 to 26.1 molpct YO(1.5) using room temperature X-ray diffractometry. Pure, plasma-sprayed zirconia is composed almost entirely of the monoclinic phase. At levels of yttria between 4 and 10 percent, a quenched-in tetragonal phase predominates, and at higher levels the cubic phase predominates. The phase distributions are compared with previously reported test lives of thermal barrier coatings formed from these materials. Regions of optimal lives were found to correlate with regions having high amounts of the tetragonal phase, small but nonzero amounts of the monoclinic phase, and little or none of the cubic phase. Possible relationships between phase composition and coating performance are discussed.

  1. Low Energy Surface Activation of Zirconia Based Restorations.

    PubMed

    Aboushelib, Moustafa N

    2016-03-01

    To evaluate the influence of low energy surface activation technique on the biaxial flexure strength of zirconia frameworks. Zirconia discs were prepared by cutting CAD/CAM zirconia blocks. Sintered discs were airborne particle abraded using one of the following particles: 30 μm alumina particles, 50 μm alumina particles, or modified round edges 30 μm alumina particles at low pressure. Scanning electron microscopy, x-ray diffraction analysis, surface roughness, and biaxial flexure strength tests were performed (n = 20). Fractured specimens were fractographically analyzed (α = 0.05). Low energy surface activation resulted in 7% monoclinic crystallographic transformation, increasing surface roughness from 0.05 to 0.3 μm and in significant increase in biaxial flexure strength (1718 MPa) compared 30 μm (1064 MPa), 50 μm (1210 MPa), and as-sintered specimens (1150 MPa). Low energy surface activation of zirconia specimens improved the biaxial flexure strength of zirconia frameworks without creation of surface damage. Clinical implications: by controlling particle size and shape of alumina, the flexure strength of zirconia restorations could be increased usinglow pressure particle abrasion.

  2. Effects of temperature-gradient-induced damage of zirconia metering nozzles

    NASA Astrophysics Data System (ADS)

    Zhao, Liang; Xue, Qun-hu

    2017-09-01

    The effects of temperature-gradient-induced damage of zirconia metering nozzles were investigated through analysis of the phase composition and microstructure of nozzle samples. The analysis was carried out using X-ray diffraction and scanning electron microscopy after the samples were subjected to a heat treatment based on the temperatures of the affected, transition, and original layers of zirconia metering nozzles during the continuous casting of steel. The results showed that, after heat treatment at 1540, 1410, or 1300°C for a dwell time of 5 h, the monoclinic zirconia phase was gradually stabilized with increasing heat-treatment temperature. Moreover, a transformation to the cubic zirconia phase occurred, accompanied by grain growth, which illustrates that the temperature gradient in zirconia metering nozzles affects the mineral composition and microstructure of the nozzles and accelerates damage, thereby deteriorating the quality and service life of the nozzles.

  3. Contamination of dental zirconia before final firing: effects on mechanical properties.

    PubMed

    Ban, Seiji; Okuda, Yuji; Noda, Makoto; Tsuruki, Jiro; Kawai, Tatsushi; Kono, Hiroshi

    2013-01-01

    Plate-like specimens were prepared, using a diamond saw, from Cercon -a pre-sintered yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) block. These specimens were treated with 10 kinds of dental materials which acted as contaminants, and then sintered at 1,350°C or 1,450°C. After the final firing, specimens were subjected to a three-point flexural test and Vickers hardness test. Their surfaces were also characterized by scanning electron microscopy and X-ray diffractometry. Phosphorus-containing contaminants reduced the three-point flexural strength and hardness of final sintered zirconia due to the formation of YPO4 and phase transformation from tetragonal to monoclinic zirconia. Gypsum also reduced both mechanical properties due to the formation of CaZrO3 and phase transformation from tetragonal to cubic zirconia. Other contaminants showed no adverse effects on the mechanical properties of final sintered zirconia.

  4. A sol-powder coating technique for fabrication of yttria stabilised zirconia

    SciTech Connect

    Wattanasiriwech, Darunee . E-mail: darunee@mfu.ac.th; Wattanasiriwech, Suthee; Stevens, Ron

    2006-08-10

    Yttria stabilised zirconia has been prepared using a simple sol-powder coating technique. The polymeric yttria sol, which was prepared using 1,3 propanediol as a network modifier, was homogeneously mixed with nanocrystalline zirconia powder and it showed a dual function: as a binder which promoted densification and a phase modifier which stabilised zirconia in the tetragonal and cubic phases. Thermal analysis and X-ray diffraction revealed that the polymeric yttria sol which decomposed at low temperature into yttrium oxide could change the m {sup {yields}} t phase transformation behaviour of the zirconia, possibly due to the small particle size and very high surface area of both yttria and zirconia particles allowing rapid alloying. The sintered samples exhibited three crystalline phases: monoclinic, tetragonal and cubic, in which cubic and tetragonal are the major phases. The weight fractions of the individual phases present in the selected specimens were determined using quantitative Rietveld analysis.

  5. From Zirconium Nanograins to Zirconia Nanoneedles

    PubMed Central

    Zalnezhad, E.; Hamouda, A. M. S.; Jaworski, J.; Do Kim, Young

    2016-01-01

    Combinations of three simple techniques were utilized to gradually form zirconia nanoneedles from zirconium nanograins. First, a physical vapor deposition magnetron sputtering technique was used to deposit pure zirconium nanograins on top of a substrate. Second, an anodic oxidation was applied to fabricate zirconia nanotubular arrays. Finally, heat treatment was used at different annealing temperatures in order to change the structure and morphology from nanotubes to nanowires and subsequently to nanoneedles in the presence of argon gas. The size of the pure zirconium nanograins was estimated to be approximately 200–300 nm. ZrO2 nanotubular arrays with diameters of 70–120 nm were obtained. Both tetragonal and monoclinic ZrO2 were observed after annealing at 450 °C and 650 °C. Only a few tetragonal peaks appeared at 850 °C, while monoclinic ZrO2 was obtained at 900 °C and 950 °C. In assessing the biocompatibility of the ZrO2 surface, the human cell line MDA-MB-231 was found to attach and proliferate well on surfaces annealed at 850 °C and 450 °C; however, the amorphous ZrO2 surface, which was not heat treated, did not permit extensive cell growth, presumably due to remaining fluoride. PMID:27623486

  6. Zirconia supported catalysts for bioethanol steam reforming: Effect of active phase and zirconia structure

    NASA Astrophysics Data System (ADS)

    Benito, M.; Padilla, R.; Rodríguez, L.; Sanz, J. L.; Daza, L.

    Three new catalysts have been prepared in order to study the active phase influence in ethanol steam reforming reaction. Nickel, cobalt and copper were the active phases selected and were supported on zirconia with monoclinic and tetragonal structure, respectively. To characterize the behaviour of the catalysts in reaction conditions a study of catalytic activity with temperature was performed. The highest activity values were obtained at 973 K where nickel and cobalt based catalysts achieved an ethanol conversion of 100% and a selectivity to hydrogen close to 70%. Nickel supported on tetragonal zirconia exhibited the highest hydrogen production efficiency, higher than 4.5 mol H 2/mol EtOH fed. The influence of steam/carbon (S/C) ratio on product distribution was another parameter studied between the range 3.2-6.5. Nickel supported on tetragonal zirconia at S/C = 3.2 operated at 973 K without by-product production such as ethylene or acetaldehyde. In order to consider a further application in an ethanol processor, a long-term reaction experiment was performed at 973 K, S/C = 3.2 and atmospheric pressure. After 60 h, nickel supported on tetragonal zirconia exhibited high stability and selectivity to hydrogen production.

  7. Stress analysis of zirconia studied by Raman spectroscopy at low temperatures.

    PubMed

    Kurpaska, L; Kozanecki, M; Jasinski, J J; Sitarz, M

    2014-10-15

    The paper presents effect of low temperature upon location of selected Raman bands. The structural properties of pure zirconium pre-oxidized at 773K and 873K have been studied during cooling in the range of temperatures 273K and 93K by Raman spectroscopy. Analysis of the Raman band positions for the monoclinic phase of zirconia oxide was performed. Raman spectroscopy has shown that monoclinic phase of zirconia oxide undergoes a continuous band displacement, individual for each studied Raman mode. Registered shift is aimed towards the high frequency direction. Recorded Raman band displacement was employed to study stress state in zirconia oxide films grown on pure zirconium developed during control cooling. Presented results showed a good correlation between different thicknesses of the oxide scale. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Synthesis of zirconia (ZrO2) nanowires via chemical vapor deposition

    NASA Astrophysics Data System (ADS)

    Baek, M. K.; Park, S. J.; Choi, D. J.

    2017-02-01

    Monoclinic zirconia nanowires were synthesized by chemical vapor deposition using ZrCl4 powder as a starting material at 1200 °C and 760 Torr. Graphite was employed as a substrate, and an Au thin film was pre-deposited on the graphite as a catalyst. The zirconia nanostructure morphology was observed through scanning electron microscopy and transmission electron microscopy. Based on X-ray diffraction, selected area electron diffraction, and Raman spectroscopy data, the resulting crystal structure was found to be single crystalline monoclinic zirconia. The homogeneous distributions of Zr, O and Au were studied by scanning transmission electron microscopy with energy dispersive X-ray spectroscopy mapping, and there was no metal droplet at the nanowire tips despite the use of an Au metal catalyst. This result is apart from that of conventional metal catalyzed nanowires.

  9. An X-Ray Diffraction Investigation of alpha-Al2O2 Addition to Yttria Stabilized Zirconia (YSZ) Thermal Barrier Coatings Subject to Destabilizing Vanadium Pentoxide (V2O5) Exposure

    DTIC Science & Technology

    1993-09-01

    Stabilized Zirconia TZP - Tetragonal Stabilized Zirconia 6 The effect of ’alloying’ ceramic particles or fibers are clearly evident. The fracture toughness...TA!RL OF CONIMn3S I. INTRO.DUCTION . .. . . . 1 11. BACMWrJD .................... 2 A. CRYSTALLOGRAPHY OF ZIRCONIA .... ............ 2 1. Cubic ...7 1. ZrO2 -Y203 Phase Diagram ......... .......... 7 a. Monoclinic - Tetragonal Transformation 9 b. Cubic

  10. Zirconia coating for enhanced thermal stability of gold nanoparticles

    NASA Astrophysics Data System (ADS)

    Pastre, A.; Cristini-Robbe, O.; Bois, L.; Chassagneux, F.; Branzea, D.; Boé, A.; Kinowski, C.; Raulin, K.; Rolland, N.; Bernard, R.

    2016-01-01

    This paper describes a rapid, simple and one-step method for the preparation of 2-4 nm diameter zirconia-coated gold nanoparticles at room temperature. These nanoparticles were synthesized by two simultaneous processes: the chemical reduction of tetrachloroauric acid with sodium borohydride and the formation of zirconia sol-gel matrices. All the gold nanoparticle sols were characterized by UV-visible absorption and transmission electron microscopy to determine the nanoparticle size and shape. The synthesis method is a combination of a polymeric structure of the amorphous zirconia and the use of a strong reducing agent, and it yields to very small quasi-spherical gold nanoparticles at room temperature. The thermal stability up to 1200 °C of the coated nanoparticles was studied by x-ray diffraction. The metastable tetragonal phase of the zirconia coating was obtained at 400 °C, and a progressive transformation from tetragonal to monoclinic phases of the zirconia coating was observed up to 1100 °C. After the heat treatment at 400 °C, the crystallite size of the gold nanoparticles was about 29 nm, and it remained unchanged from 400 °C to 1200 °C. These results are promising for the development of such materials as doping elements for optical fiber applications.

  11. Mechanical properties of zirconia after different surface treatments and repeated firings

    PubMed Central

    Demir, Necla; Kara, Özlem; Ozturk, A. Nilgun; Özel, Faruk

    2014-01-01

    PURPOSE This study investigated the influence of surface conditioning procedures and repeated firings on monoclinic content and strength of zirconia before cementation. MATERIALS AND METHODS Sintered bar-shaped zirconia specimens were subjected to no surface treatment (control), air abrasion, or grinding (n=21). Their roughness was evaluated using a profilometer, and microscope analysis was performed on one specimen of each group. Then, 2 or 10 repeated firings (n=10) were executed, the monoclinic content of specimens was analyzed by X-ray diffraction, and a three-point flexural strength test was performed. Surface roughness values were compared using one-way analysis of variance (ANOVA) and Tukey honestly significant difference (HSD) tests, the monoclinic content values were tested using Kruskal-Wallis and Mann-Whitney U tests, and the flexural strength values were tested using two-way ANOVA and Tukey HSD tests (P=.05). Spearman's correlation test was performed to define relationships among measured parameters. RESULTS Surface-treated specimens were rougher than untreated specimens and had a higher monoclinic content (P<.005), and the relationship between roughness and monoclinic content was significant (P<.000). Neither surface treatment nor firing significantly affected the flexural strength, but Weibull analysis showed that for the air-abraded samples the characteristic strength was significantly lower after the 10th firing than after the 2nd firing. CONCLUSION After firing, a negligible amount of monoclinic content remained on the zirconia surfaces, and rougher surfaces had higher monoclinic contents than untreated surfaces. Multiple firings could be performed if necessary, but the fracture probability could increase after multiple firings for rougher surfaces. PMID:25551006

  12. Exchange-correlation effects in the monoclinic to tetragonal phase stabilization of yttrium-doped ZrO2: A first-principles approach

    NASA Astrophysics Data System (ADS)

    Sangalli, Davide; Debernardi, Alberto

    2011-12-01

    We describe, within an ab initio approach, the stabilization of the tetragonal phase versus the monoclinic one in yttrium-doped zirconia. The process is believed to be influenced from different mechanisms. Indeed, we show that there is a delicate balance between the change in electrostatic and kinetic energy and exchange-correlation effects. In the tetragonal phase, the perturbation induced by doping is better screened at the price of sacrificing correlation energy. Our work opens the opportunity to use the same approach to predict the tetragonal phase stabilization of materials such as zirconia or hafnia, with different and less characterized dopants.

  13. Nanocrystal synthesis

    SciTech Connect

    Tisdale, William; Prins, Ferry; Weidman, Mark; Beck, Megan

    2016-11-01

    A method of preparing monodisperse MX semiconductor nanocrystals can include contacting an M-containing precursor with an X donor to form a mixture, where the molar ratio between the M containing precursor and the X donor is large. Alternatively, if additional X donor is added during the reaction, a smaller ratio between the M containing precursor and the X donor can be used to prepare monodisperse MX semiconductor nanocrystals.

  14. Phase transformation of a zirconia ceramic head after total hip arthroplasty.

    PubMed

    Haraguchi, K; Sugano, N; Nishii, T; Miki, H; Oka, K; Yoshikawa, H

    2001-09-01

    We report two cases of surface deterioration of a zirconia ceramic femoral head associated with phase transformation after total hip arthroplasty. One head was retrieved at revision due to recurrent dislocation after six years and the other because of failure of the locking mechanism of the polyethylene liner after three years. The monoclinic content of the zirconia ceramics rose from 1% to about 30% on the surface of the heads. SEM revealed numerous craters indicating extraction of the zirconia ceramics at the surface. Surface roughness increased from an initial value of 0.006 microm up to 0.12 microm. This is the first report to show that phase transformation of zirconia ceramics causes deterioration of the surface roughness of the head in vivo after total hip arthroplasty.

  15. Contact damage in an yttria stabilized zirconia: implications.

    PubMed

    Zhou, J; Mah, J; Shrotriya, P; Mercer, C; Soboyejo, W O

    2007-01-01

    This paper presents the results of a combined experimental and computational study of contact damage in a 3 mole% yttria partially stabilized zirconia (3-YSZ) that is relevant to hip implants and dental restorations. Contact-induced loading in real applications is idealized using Hertzian contact model to explain plasticity phenomena and failure mechanisms observed under monotonic and cyclic loading. Under monotonic loading, the elastic moduli increase with increasing loading levels. Under cyclic loading, the ceramic specimens fail with progressive cone cracking. X-ray analyses reveal that stress-induced phase transformation (from tetragonal to monoclinic phases) occurs under cyclic contact loading above the critical load levels (approximately 8.5 kN). Furthermore, when the cyclic loading level (5.0 kN) is less than a critical load levels (7.5 kN) that is required to induce surface cone cracks, significant plastic damage is observed in the subsurface zone underneath the contact area. These suggest that the cyclic contact loading induce both plastic damage and tetragonalto-monoclinic phase transformation in the 3-YSZ, leading to significant degradation in long-term strength. The implications of the results are discussed for the design of zirconia femoral heads in total hip replacements and zirconia crowns in dental restoration.

  16. What Is in Your Zirconia?

    PubMed

    Helvey, Gregg A

    2017-04-01

    The immense popularity of zirconia as an indirect restorative material in dentistry has led to seemingly countless numbers of companies selling zirconia discs and blocks. The reliability of zirconia, however, is subject to specific manufacturing and processing protocols. Thus, it is of paramount importance for any dental professional utilizing zirconia to be aware of the source of the material and the various factors that can affect the success or failure of a final restoration. This article discusses the journey of zirconia, from being found among the elements of the earth to being placed in the patient's mouth. It also touches on drawbacks, such as translucency, associated with zirconia.

  17. Ion beam-induced amorphous-to-tetragonal phase transformation and grain growth of nanocrystalline zirconia.

    PubMed

    Lian, Jie; Zhang, Jiaming; Namavar, Fereydoon; Zhang, Yanwen; Lu, Fengyuan; Haider, Hani; Garvin, Kevin; Weber, W J; Ewing, Rodney C

    2009-06-17

    Nanocrystalline zirconia has recently attracted extensive research interest due to its unique mechanical, thermal and electrical properties as compared with bulk zirconia counterparts, and it is of particular importance for controlling the phase stability of different polymorphs (amorphous, cubic, tetragonal and monoclinic phases) in different size regimes. In this work, we performed ion beam bombardments on bilayers (amorphous and cubic) of nano-zirconia using 1 MeV Kr2+ irradiation. Transmission electron microscopy (TEM) analysis reveals that amorphous zirconia transforms to a tetragonal structure under irradiation at room temperature, suggesting that the tetragonal phase is more energetically favorable under these conditions. The final grain size of the tetragonal zirconia can be controlled by irradiation conditions. A slower kinetics in the grain growth from cubic nanocrystalline zirconia was found as compared with that for the tetragonal grains recrystallized from the amorphous layer. The radiation-induced nanograins of tetragonal ZrO2 are stable at ambient conditions and maintain their physical integrity over a long period of time after irradiation. These results demonstrated that ion beam methods provide the means to control the phase stability and structure of zirconia polymorphs.

  18. Scandia-and-Yttria-Stabilized Zirconia for Thermal Barriers

    NASA Technical Reports Server (NTRS)

    Mess, Derek

    2003-01-01

    yttria in suitable proportions has shown promise of being a superior thermal- barrier coating (TBC) material, relative to zirconia stabilized with yttria only. More specifically, a range of compositions in the zirconia/scandia/yttria material system has been found to afford increased resistance to deleterious phase transformations at temperatures high enough to cause deterioration of yttria-stabilized zirconia. Yttria-stabilized zirconia TBCs have been applied to metallic substrates in gas turbine and jet engines to protect the substrates against high operating temperatures. These coatings have porous and microcracked structures, which can accommodate strains induced by thermal-expansion mismatch and thermal shock. The longevity of such a coating depends upon yttria as a stabilizing additive that helps to maintain the zirconia in an yttria-rich, socalled non-transformable tetragonal crystallographic phase, thus preventing transformation to the monoclinic phase with an associated deleterious volume change. However, at a temperature greater than about 1,200 C, there is sufficient atomic mobility that the equilibrium, transformable zirconia phase is formed. Upon subsequent cooling, this phase transforms to the monoclinic phase, with an associated volume change that adversely affects the integrity of the coating. Recently, scandia was identified as a stabilizer that could be used instead of, or in addition to, yttria. Of particular interest are scandia-and-yttria-stabilized zirconia (SYSZ) compositions of about 6 mole percent scandia and 1 mole percent yttria, which have been found to exhibit remarkable phase stability at a temperature of 1,400 C in simple aging tests. Unfortunately, scandia is expensive, so that the problem becomes one of determining whether there are compositions with smaller proportions of scandia that afford the required high-temperature stability. In an attempt to solve this problem, experiments were performed on specimens made with reduced

  19. Role of Y{sub 2}O{sub 3}, CaO, MgO additives on structural and microstructural behavior of zirconia/mullite aggregates

    SciTech Connect

    Mishra, D. K.; Prusty, Sasmita; Mohapatra, B. K.; Singh, S. K.; Behera, S. N.

    2012-07-23

    Zirconia mullite (MUZ), Y{sub 2}O{sub 3}-MUZ, CaO-MUZ and MgO-MUZ composites, synthesized through plasma fusion technique, are becoming important due to their commercial scale of production within five minutes of plasma treatment from sillimanite, zircon and alumina mixture. The X-ray diffraction studies reveal the monoclinic zirconia phase in MUZ composite whereas mixed monoclinic, tetragonal and cubic phases of zirconia have been observed in Y{sub 2}O{sub 3}, CaO, MgO added MUZ composites. The Y{sub 2}O{sub 3}, CaO and MgO additives act as sintering aids to favour the transformation and stabilisation of tetragonal and cubic zirconia phases at room temperature. These additives also play a key role in the development of various forms of microstructure to achieve dense MUZ composites.

  20. Evaluation of zirconia-porcelain interface using X-ray diffraction.

    PubMed

    Alghazzawi, Tariq F; Janowski, Gregg M

    2015-09-14

    The aim of this study was to determine if accelerated aging of porcelain veneering had an effect on the surface properties specific to a tetragonal-to-monoclinic transformation (TMT) of zirconia restorations. Thirty-six zirconia samples were milled and sintered to simulate core fabrication followed by exposure to various combinations of surface treatments including as-received (control), hydrofluoric acid (HF), application of liner plus firings, application of porcelain by manual layering and pressing with firing, plus accelerated aging. The quantity of transformed tetragonal to monoclinic phases was analyzed utilized an X-ray diffractometer and one-way analysis of variance was used to analyze data. The control samples as provided from the dental laboratory after milling and sintering process had no TMT (Xm = 0). There was an effect on zirconia samples of HF application with TMT (Xm = 0.8%) and liner plus HF application with TMT (Xm = 8.7%). There was an effect of aging on zirconia samples (no veneering) with significant TMT (Xm = 70.25%). Both manual and pressing techniques of porcelain applications reduced the TMT (manual, Xm = 4.41%, pressing, Xm = 11.57%), although there was no statistical difference between them. It can be concluded that simulated applications of porcelain demonstrated the ability to protect zirconia from TMT after aging with no effect of a liner between different porcelain applications. The HF treatment also caused TMT.

  1. Glass ceramic toughened with tetragonal zirconia

    DOEpatents

    Keefer, Keith D.; Michalske, Terry A.

    1986-01-01

    A phase transformation-toughened glass ceramic and a process for making it are disclosed. A mixture of particulate network-forming oxide, network-modifying oxide, and zirconium oxide is heated to yield a homogeneous melt, and this melt is then heat-treated to precipitate an appreciable quantity of tetragonal zirconia, which is retained at ambient temperature to form a phase transformation-toughened glass ceramic. Nucleating agents and stabilizing agents may be added to the mixture to facilitate processing and improve the ceramic's properties. Preferably, the mixture is first melted at a temperature from 1200.degree. to 1700.degree. C. and is then heat-treated at a temperature within the range of 800.degree. to 1200.degree. C. in order to precipitate tetragonal ZrO.sub.2. The composition, as well as the length and temperature of the heat-treatment, must be carefully controlled to prevent solution of the precipitated tetragonal zirconia and subsequent conversion to the monoclinic phase.

  2. Effective property of tooth enamel: monoclinic behavior.

    PubMed

    Lu, Cunyou; Nakamura, Toshio; Korach, Chad S

    2012-05-11

    Human tooth enamel possesses a unique morphology characterized by a repeated cell arrangement, which is composed of varying orientations of hydroxyapatite crystals. In the past, various investigators have reported diverse mechanical properties based on isotropic or orthotropic mechanical models in their experimental and numerical studies. However, these models are insufficient to capture the accurate microstructural effects on the enamel mechanical response. In this paper, a monoclinic anisotropic model, which offers correct descriptions of enamel deformation behaviors, is introduced. The model takes into account the 3D orientation changes of the hydroxyapatite crystals and their spatial elastic property variations. The proposed approach is based on a unit-cell and periodic boundary conditions, and it utilizes the collective deformation characteristics of many rods to determine 13 independent material constants required for the monoclinic model. These constants are necessary to utilize the effective property model to study various mechanical conditions such as abrasion, erosion, wear and fracture of whole tooth enamel.

  3. Monoclinal bending of strata over laccolithic intrusions

    USGS Publications Warehouse

    Koch, F.G.; Johnson, A.M.; Pollard, D.D.

    1981-01-01

    Sedimentary strata on top of some laccolithic intrusions are nearly horizontal and little deformed, but are bent into steeply dipping monoclinal flexures over the peripheries of these intrusions. This form of bending is not explained by previous theories of laccolithic intrusion, which predict either horizontal undeformed strata over the center and faulted strata around the periphery, or strata bent continuously into a dome. However, a slight generalization of these theories accomodates the observed form and contains the previous forms as special cases. A critical assumption is that the strength of contacts within a multilayered overburden is overcome locally by layer-parallel shear. If this strength is less than the strength of the layers themselves, then layers over the center remain bonded together and display negligible bending, whereas layers over the periphery slip over one another and are readily bent into a monoclinal flexure. ?? 1981.

  4. Composition, phase analysis, biaxial flexural strength, and fatigue of unshaded versus shaded Procera zirconia ceramic.

    PubMed

    Spyropoulou, Panagiota-Eirini; Kamposiora, Phophi; Eliades, George; Papavasiliou, George; Razzoog, Michael E; Thompson, Jeffrey Y; Smith, Robert L; Bayne, Stephen C

    2016-08-01

    Recent interest in shaded zirconia has raised questions about the relative stability of the tetragonal phase after colorant oxide additions. The purpose of this in vitro study was to evaluate the effects of fatigue cycling on the stability of a commercially available dental zirconia (Procera) in both unshaded and shaded compositions by measuring the change in biaxial flexural strength (BFS) after 500 000 cycles at 80-N loads and in phase composition as detected by x-ray diffraction (XRD). Partially stabilized zirconia disks (NobelProcera) were fabricated in unshaded and shaded forms (12 mm diameter × 0.8 mm thick). Specimens were analyzed by energy-dispersive x-ray spectroscopy (EDS) and by wavelength-dispersive x-ray spectroscopy (WDS) for oxide compositions which indicated the presence of small amounts of Fe-O (0.13 ±0.10 wt %) in the shaded specimens. XRD focused on the tetragonal (T) and monoclinic (M) peaks in the 20 to 40 degrees 2θ range. The disks were polished on 1 side, cyclically loaded (80N, 500 000 cycles, custom 4-station fatigue test machine), and tested for residual BFS after cycling. Unshaded (U) and shaded groups (S) were compared before (U1, S1) and after (U2, S2) load cycling with XRD and residual BFS. Residual BFS (MPa) for specimens before (U1=856 ±99 versus S1= 842 ±40) and after fatigue (U2=772 ±65 versus S2= 718 ±68) were statistically different (U1 versus U2; S1 versus S2; U2 versus S2, P<.05). The XRD of U1 and S1 specimens revealed tetragonal and cubic zirconia. U2 and S2 specimens contained tetragonal zirconia, with the initial appearance of small amounts of monoclinic zirconia after fatigue cycling. Monoclinic detection was measured on the tension side of the tested specimens and varied between tests at the center and radially at 4 mm. The results indicated shaded materials more readily transform the tetragonal to the monoclinic phase during load cycling than unshaded ones. However, extrapolating the effects of any

  5. Current status of zirconia restoration.

    PubMed

    Miyazaki, Takashi; Nakamura, Takashi; Matsumura, Hideo; Ban, Seiji; Kobayashi, Taira

    2013-10-01

    During the past decade, zirconia-based ceramics have been successfully introduced into the clinic to fabricate fixed dental prostheses (FDPs), along with a dental computer-aided/computer-aided manufacturing (CAD/CAM) system. In this article (1) development of dental ceramics, (2) the current status of dental CAD/CAM systems, (3) CAD/CAM and zirconia restoration, (4) bond between zirconia and veneering ceramics, (5) bond of zirconia with resin-based luting agents, (6) surface finish of zirconia restoration and antagonist enamel wear, and (7) clinical evaluation of zirconia restoration are reviewed. Yttria partially stabilized tetragonal zirconia polycrystalline (Y-TZP) showed better mechanical properties and superior resistance to fracture than other conventional dental ceramics. Furthermore, ceria-stabilized tetragonal zirconia polycrystalline and alumina nanocomposites (Ce-TZP/A) had the highest fracture toughness and had resistance to low-temperature aging degradation. Both zirconia-based ceramics have been clinically available as an alternative to the metal framework for fixed dental prostheses (FDPs). Marginal adaptation of zirconia-based FDPs is acceptable for clinical application. The most frequent clinical complication with zirconia-based FDPs was chipping of the veneering porcelain that was affected by many factors. The mechanism for the bonding between zirconia and veneering ceramics remains unknown. There was no clear evidence of chemical bonding and the bond strength between zirconia and porcelain was lower than that between metal and porcelain. There were two alternatives proposed that might avoid chipping of veneering porcelains. One was hybrid-structured FDPs comprising CAD/CAM-fabricated porcelain parts adhering to a CAD/CAM fabricated zirconia framework. Another option was full-contour zirconia FDPs using high translucent zirconia. Combined application of silica coating and/or silane coupler, and 10-methacryloyloxydecyl dihydrogen phosphate is

  6. Microstructural aspects of zirconia thermal barrier coatings

    NASA Technical Reports Server (NTRS)

    Mitchell, T. E.; Suhr, D. S.; Keller, R. J.; Lanteri, V.; Heuer, A. H.

    1985-01-01

    Various combination of plasma-sprayed bond coatings and zirconia ceramic coatings on a nickel-based superalloy substrate were tested by static thermal exposure at 1200 C and cyclic thermal exposure to 1000 C. The bond coats were based on Ni-Cr-Al alloys with additions of rare earth elements and Si. The ceramic coats were various ZrO2-Y2O3 compositions, of which the optimum was found to be ZrO2-8.9 wt percent Y2O3. Microstructural analysis showed that resistance to cracking during thermal exposure is strongly related to deleterious phase changes. Zones depleted of Al formed at the bond coat/ceramic coat interface due to oxidation and at the bond coat/substrate interface due to interdiffusion, leading eventually to breakdown of the bond coat. The 8.9 percent Y2O3 coating performed best because the as-sprayed metastable tetragonal phase converted slowly into the low-Y2O3 tetragonal plus high-Y2O3 cubic-phase mixture, so that the deleterious monoclinic phase was inhibited from forming. Failure appeared to start with the formation of circumferential cracks in the zirconia, probably due to compressive stresses during cooling, followed by the formation of radial cracks due to tensile stresses during heating. Cracks appeared to initiate at the Al2O3 scale/bond coat interface and propagate through the zirconia coating. Comparisons were made with the behavior of bulk ZrO2-Y2O3 and the relationship between the microstructure of the tetragonal phase and the phase diagram. A separate investigation was also made of the ZrO2-Al2O3 interface.

  7. Impact of radiation defects on the structural stability of pure zirconia

    SciTech Connect

    Simeone, D.; Baldinozzi, G.; Gosset, D.

    2004-10-01

    Optical spectroscopy and x-ray diffraction were used to study the behavior of polycrystalline samples of pure monoclinic zirconia irradiated by low energy ions. A microscopic model based on these experiments is proposed to explain the displacive phase transition observed in this material after irradiation. Defects, produced in the oxygen sublattice, induce important strain fields on a nanometric scale. This strain field can be handled as a secondary order parameter within the Landau theory approach, leading to a decrease of the phase transition temperature and thus quenching the high temperature tetragonal phase. The model also explains the consequences of the thermal annealing for restoring the ground state monoclinic structure.

  8. The influence of low-temperature degradation and cyclic loading on the fracture resistance of monolithic zirconia molar crowns.

    PubMed

    Nakamura, K; Harada, A; Kanno, T; Inagaki, R; Niwano, Y; Milleding, P; Örtengren, U

    2015-07-01

    The present study analyzed the kinetics of low-temperature degradation (LTD) in zirconia, and evaluated the influence of LTD and cyclic loading on the fracture resistance of monolithic zirconia molar crowns. Bar-shaped zirconia specimens were divided into nine groups and autoclaved at 134°C for 0-200h to induce LTD. The surface fraction and penetration depth of the monoclinic phase were examined using X-ray diffraction and scanning electron microscopy. Monolithic zirconia molar crowns were prepared for crown fracture testing. The crowns were autoclaved for 0-100h (n=6) and cemented to dies. Six crown-die samples that were not autoclaved and six samples that were autoclaved for 100h were subjected to cyclic loading with a load of 300N for 240,000 cycles. All samples were tested in a load-to-failure test. The monoclinic fraction on the surface increased with autoclaving time and reached a plateau after 50h. The depth of the monoclinic phase increased without reaching a plateau. The fracture load of the crowns significantly decreased from 5683N (SD: 342) to 3975N (SD: 194) after 100h of autoclaving. Cyclic loading did not significantly affect the fracture resistance of the crowns in all cases. Kinetic analysis showed no linear correlation between the surface fraction and depth of the monoclinic phase after 50h of autoclaving. Even though LTD increased the monoclinic phase, resulting in lower strength, the fracture resistance of the monolithic zirconia crowns was still sufficient to withstand the loading conditions in the molar regions.

  9. Probing Local Structures in ZrO2 Nanocrystals Using EXAFS

    NASA Astrophysics Data System (ADS)

    Soo, Y. L.; Chen, P. J.; Huang, S. H.; Shiu, T. J.; Tsai, T. Y.; Chow, Y. H.; Lin, Y. C.; Weng, S. C.; Chang, S. L.; Lee, J. F.; Cheung, C. L.; Sabirianov, R. F.; Namavar, F.; Mei, W. N.

    2008-03-01

    Extended x-ray absorption fine structure (EXAFS) has been employed to investigate the local structures surrounding Zr in cubic zirconia thin films prepared by an ion beam assisted deposition technique. These materials have demonstrated promising mechanical properties such as improved hardness and lubricant wettability compared to yttria-stabilized zirconia. To verify the cubic structure of zirconia in films prepared under different growth conditions and to fully understand the mechanism leading to their unique physical properties, the structural information is a required prerequisite. Since zirconia is in the form of nanosized crystallets, conventional x-ray diffraction method is not useful for this purpose. Our x-ray results reveal cubic-like structure with O vacancies around Zr in several nanocrystal samples. Powders of cubic zirconia prepared using chemical methods were also measured for comparison.

  10. Electrochemically Induced Transformations of Vanadium Dioxide Nanocrystals.

    PubMed

    Dahlman, Clayton J; LeBlanc, Gabriel; Bergerud, Amy; Staller, Corey; Adair, Jacob; Milliron, Delia J

    2016-10-12

    Vanadium dioxide (VO2) undergoes significant optical, electronic, and structural changes as it transforms between the low-temperature monoclinic and high-temperature rutile phases. Recently, alternative stimuli have been utilized to trigger insulator-to-metal transformations in VO2, including electrochemical gating. Here, we prepare and electrochemically reduce mesoporous films of VO2 nanocrystals, prepared from colloidally synthesized V2O3 nanocrystals that have been oxidatively annealed, in a three-electrode electrochemical cell. We observe a reversible transition between infrared transparent insulating phases and a darkened metallic phase by in situ visible-near-infrared spectroelectrochemistry and correlate these observations with structural and electronic changes monitored by X-ray absorption spectroscopy, X-ray diffraction, Raman spectroscopy, and conductivity measurements. An unexpected reversible transition from conductive, reduced monoclinic VO2 to an infrared-transparent insulating phase upon progressive electrochemical reduction is observed. This insulator-metal-insulator transition has not been reported in previous studies of electrochemically gated epitaxial VO2 films and is attributed to improved oxygen vacancy formation kinetics and diffusion due to the mesoporous nanocrystal film structure.

  11. Ion beam-induced amorphous-to-tetragonal phase transformation and grain growth of nanocrystalline zirconia

    SciTech Connect

    Lian, Jie; Zhang, Jiaming; Namavar, Fereydoon; Zhang, Yanwen; Lu, Fengyuan; Haider, Hani; Garvin, Kevin; Weber, William J.; Ewing, Rodney C.

    2009-05-26

    Nanocrystalline zirconia has recently attracted extensive research interest due to its unique mechanical, thermal and electrical properties as compared to bulk zirconia counterparts, and it is of particular importance to control the phase stability of different polymorphs (amorphous, cubic, tetragonal and monoclinic phases) at different size regimes. In this paper, we performed ion beam bombardments on bilayers (amorphous and cubic) of pure nano-zirconia using 1 MeV Kr2+ irradiation. Transmission electron microscopy (TEM) analysis reveals that amorphous zirconia transforms to a tetragonal structure under irradiation at room temperature, suggesting that the tetragonal phase is more energetically favorable under these conditions. The final grain size of the tetragonal zirconia can be controlled by irradiation conditions. The irradiation-induced nanograins of tetragonal ZrO2 are stable at ambient conditions and maintain their physical integrity over a long period of time after irradiation. These results demonstrated that ion-beam modification methods provide the means to control the phase stability and structure of zirconia polymorphs.

  12. Reactions of yttria-stabilized zirconia with oxides and sulfates of various elements

    NASA Technical Reports Server (NTRS)

    Zaplatynsky, I.

    1978-01-01

    The reactions between partially stabilized zirconia, containing 8 weight-percent yttria, and oxides and sulfates of various elements were studied at 1200, 1300, and 1400 C for times to 800, 400, and 200 hours, respectively. These oxides and sulfates represent impurities and additives potentially present in gas turbine fuels or impurities in the turbine combustion air as well as the elements of the substrate alloys in contact with zirconia. Based on the results, these compounds can be classified in four groups: (1) compounds which did not react with zirconia (Na2SO4, K2SO4, Cr2O3, Al2O3 and NiO); (2) compounds that reached completely with both zirconia phases (CaO, BaO, and BaSO4); (3) compounds that reacted preferentially with monoclinic zirconia (Na2O, K2O, CoO, Fe2O3, MgO, SiO2, and ZnO); and (4) compounds that reacted preferentially with cubic zirconia (V2O5, P2O5).

  13. Zirconia in fixed implant prosthodontics.

    PubMed

    Guess, Petra Christine; Att, Wael; Strub, Joerg Rudolf

    2012-10-01

    CAD/CAM technology in combination with zirconia ceramic has increasingly gained popularity in implant dentistry. This narrative review presents the current knowledge on zirconia utilized as framework material for implant-borne restorations and implant abutments, laboratory tests and developments, clinical performance, and possible future trends for implant dentistry are addressed. A review of available literature from 1990 through 2010 was conducted with search terms zirconia,"implants,"abutment,"crown," and "fixed dental prosthesis" using electronic databases (PubMed) and manual searching. Latest applications of zirconia in implant dentistry include implant abutments, multiple unit and full-arch frameworks as well as custom-made bars to support fixed and removable prostheses. High biocompatibility, low bacterial surface adhesion as well as favorable chemical properties of zirconia ceramics are reported. Zirconia stabilized with yttrium oxide exhibits high flexural strength and fracture toughness due to a transformation toughening mechanism. Preliminary clinical data confirmed the high stability of zirconia for abutments and as a framework material for implant borne crowns and fixed dental prostheses. Zirconia abutment or framework damage has rarely been encountered. However, veneering porcelain fractures are the most common technical complication in implant-supported zirconia restorations. These porcelain veneer failures have led to concerns regarding differences in coefficient of thermal expansions between core and veneering porcelain and their respective processing techniques. As presently evidence of clinical long-term data is missing, caution with regard to especially extensive implant-borne zirconia frameworks is recommended. © 2010 Wiley Periodicals, Inc.

  14. Transition temperature of martensitic transformations in hafnia and zirconia

    NASA Astrophysics Data System (ADS)

    Luo, Xuhui; Demkov, A. A.

    2008-03-01

    Transition metal oxides find applications in ceramics, catalysis and semiconductor technology. In particular, hafnium dioxide or hafnia will succeed silica as a gate dielectric in advanced transistors. However, thermodynamic properties of thin hafnia films are not well understood, despite their technological importance. We use density functional theory to investigate the tetragonal to monoclinic phase transition in hafnia and zirconia. We find that unlike the case of the cubic to tetragonal transition, this phase transition is not driven by a soft mode. We use transition state theory to identify the minimum energy path (MEP) employing first principle calculations for hafnia and zirconia, sow that both transformations are martensitic, and obtain the transition barriers. Martensitic transformations include both the internal coordinate transformation and deformation of the cell lattice vectors (``strain and shuffle''), therefore the potential energy surface and MEP are function not only of the internal atomic coordinates but also of the unit cell lattice vectors. Considering the simplest case of uniform strain the transition temperatures we then relate the barrier height to the transition temperature. As a self-consistency check, assuming the equality of thermodynamics potentials of the tetragonal and monoclinic phases during the transition, and using the difference in the internal energy calculated from first principles we estimate the entropy change associated with the transition which is found in good agreement with that calculated form the phonon spectra.

  15. Assessment of residual strain in zirconia-toughened alumina using neutron diffraction

    SciTech Connect

    Riessen, A. van; O'Connor, B.H. . Dept. of Applied Physics)

    1993-08-01

    Substantial strains may be generated in [alpha]-alumina (Al[sub 2]O[sub 3]) matrix ceramics by including zirconia (ZrO[sub 2]) second-phase particles, the material being known as zirconia-toughened alumina (ZTA). These strains arise from the expansion in unit cell volume resulting from tetragonal-to-monoclinic transformation in the ZrO[sub 2] particles and from thermal contraction mismatch (TCM) caused by differences between the expansion coefficients of the Al[sub 2]O[sub 3] and ZrO[sub 2] phases. Neutron powder diffractometry has been used to examine bulk, volume-averaged, microstrain character for each of the crystalline phases in a suite of zirconia-toughened alumina ceramics. Line-broadening estimates and cell parameter shifts, determined by the Rietveld method, have provided microstrain assessments of the nonuniform and uniform types, respectively.

  16. Evaluation of translucency of monolithic zirconia and framework zirconia materials.

    PubMed

    Tuncel, İlkin; Turp, Işıl; Üşümez, Aslıhan

    2016-06-01

    The opacity of zirconia is an esthetic disadvantage that hinders achieving natural and shade-matched restorations. The aim of this study was to evaluate the translucency of non-colored and colored framework zirconia and monolithic zirconia. The three groups tested were: non-colored framework zirconia, colored framework zirconia with the A3 shade according to Vita Classic Scale, and monolithic zirconia (n=5). The specimens were fabricated in the dimensions of 15×12×0.5 mm. A spectrophotometer was used to measure the contrast ratio, which is indicative of translucency. Three measurements were made to obtain the contrast ratios of the materials over a white background (L(*)w) and a black background (L(*)b). The data were analyzed using the one-way analysis of variance and Tukey HSD tests. One specimen from each group was chosen for scanning electron microscope analysis. The determined areas of the SEM images were divided by the number of grains in order to calculate the mean grain size. Statistically significant differences were observed among all groups (P<.05). Non-colored zirconia had the highest translucency with a contrast ratio of 0.75, while monolithic zirconia had the lowest translucency with a contrast ratio of 0.8. The mean grain sizes of the non-colored, colored, and monolithic zirconia were 233, 256, and 361 nm, respectively. The translucency of the zirconia was affected by the coloring procedure and the grain size. Although monolithic zirconia may not be the best esthetic material for the anterior region, it may serve as an alternative in the posterior region for the bilayered zirconia restorations.

  17. Evaluation of translucency of monolithic zirconia and framework zirconia materials

    PubMed Central

    Tuncel, İlkin; Üşümez, Aslıhan

    2016-01-01

    PURPOSE The opacity of zirconia is an esthetic disadvantage that hinders achieving natural and shade-matched restorations. The aim of this study was to evaluate the translucency of non-colored and colored framework zirconia and monolithic zirconia. MATERIALS AND METHODS The three groups tested were: non-colored framework zirconia, colored framework zirconia with the A3 shade according to Vita Classic Scale, and monolithic zirconia (n=5). The specimens were fabricated in the dimensions of 15×12×0.5 mm. A spectrophotometer was used to measure the contrast ratio, which is indicative of translucency. Three measurements were made to obtain the contrast ratios of the materials over a white background (L*w) and a black background (L*b). The data were analyzed using the one-way analysis of variance and Tukey HSD tests. One specimen from each group was chosen for scanning electron microscope analysis. The determined areas of the SEM images were divided by the number of grains in order to calculate the mean grain size. RESULTS Statistically significant differences were observed among all groups (P<.05). Non-colored zirconia had the highest translucency with a contrast ratio of 0.75, while monolithic zirconia had the lowest translucency with a contrast ratio of 0.8. The mean grain sizes of the non-colored, colored, and monolithic zirconia were 233, 256, and 361 nm, respectively. CONCLUSION The translucency of the zirconia was affected by the coloring procedure and the grain size. Although monolithic zirconia may not be the best esthetic material for the anterior region, it may serve as an alternative in the posterior region for the bilayered zirconia restorations. PMID:27350851

  18. Nondestructive inspection of phase transformation in zirconia-containing hip joints by confocal Raman spectroscopy

    NASA Astrophysics Data System (ADS)

    Zhu, Wenliang; Sugano, Nobuhiko; Pezzotti, Giuseppe

    2013-12-01

    Environmental metastability of zirconia (ZrO2) ceramic in the human body [represented by a tetragonal-to-monoclinic (t→m) phase transformation] takes place on the surface of the artificial joint and proceeds with time toward its interior. Its quantitative characterization is mandatory for the safety of joint implants and consists of the assessment of the in-depth monoclinic profile fraction as compared to that of the initially untransformed material. We attempt to fully establish a characterization protocol and present two different nondestructive approaches for resolving highly graded phase-transformation profiles along the hip-joint subsurface by confocal Raman microprobe technique. A series of partially transformed tetragonal zirconia polycrystal and zirconia-toughened alumina ceramics are used as screening samples. Probe biases could be eliminated and the real transformation profiles retrieved through a deconvolution procedure of Raman experimental data collected as a function of pinhole aperture and focal depth, respectively. Confirmation of the confocal assessments was made by a destructive cross-sectional inspection by both laser optical microscope and Raman spectral line scans. This study unveils for the first time the real quantitative amount of surface phase-transformation fractions and the related subsurface profiles in zirconia-based retrieved medical samples.

  19. Possible triggers for phase transformation in zirconia hip balls.

    PubMed

    Brown, Sharon S; Green, Douglas D; Pezzotti, Giuseppe; Donaldson, Thomas K; Clarke, Ian C

    2008-05-01

    The clinical history of yttria-stabilized, zirconia (Zr) ceramic has been controversial. In the patient, combinations of hydrothermal and mechanical shocks may trigger detrimental changes in Zr balls that have inferior metastability. Transformations from tetragonal to monoclinic phase may be influenced by impingement, dislocation, and disassociation in certain patients. Hydrothermal stability was measured in Zr balls from four vendors by autoclave and mechanical models that included "cup-impingement," "abrasive" wear, and "3rd-body" wear. Standard simulator tests for polyethylene (PE) wear studies combined pristine and previously transformed Zr and were also used to test lubricant effects (Zr/Zr-serum, Zr/Zr-water, Zr/PE-water). For in-vivo comparisons we studied retrieved Zr balls at 1-15 years follow-up by laser interferometry, SEM, EDS, XRD, and Raman spectroscopy. We found that severe mechanical shock triggered local surface destruction but little transformation. In contrast, hydrothermal processes revealed 5-13% monoclinic by 7 h, increasing at a rate of 0.56%/h for 22-mm balls and 0.81%/h for 26-mm balls. The all-ceramic Zr/Zr bearings were very sensitive to lubrication mode, showing early catastrophic failure when run in water but surviving 20 million cycles when run with serum lubrication. Wear with Zr/PE combination did not trigger phase changes in water or serum but decreased the monoclinic content measured on previously transformed surfaces. Most retrieved Zr balls showed high transformation (30-85% monoclinic) but some showed no transformation. The ball areas with major monoclinic changes corresponded to PE contact, suggesting that tribological conditions under the cup were the trigger. This indicated that we understand little of the hydrothermal conditions operating under Zr/PE hip joints in-vivo. Copyright 2007 Wiley Periodicals, Inc.

  20. Hole Trapping at Surfaces of m-ZrO2 and m-HfO2 Nanocrystals

    SciTech Connect

    Wolf, Matthew J.; Mckenna, Keith P.; Shlyuger, Alexander L.

    2012-12-03

    We investigate hole trapping at the most prevalent facets of monoclinic zirconia (m-ZrO2) and hafnia (m-HfO2) nanocrystals using first-principles methods. The localization of holes at surface oxygen ions is more favorable than in the bulk crystal by up to ~1 eV. This is caused mainly by the reduction of the absolute value of the electrostatic potential at the surface ions with respect to the bulk and by the significant surface distortion caused by the hole localization. The mobility of holes at surfaces is much lower than that found in the bulk and is fairly isotropic. Unlike in cubic oxides, such as MgO and CaO, we do not find a significant driving force for preferential trapping of holes at steps on the m-ZrO2 surface. These fundamental results are relevant to mechanisms of water oxidation, photocatalysis, contact charging, and photodesorption.

  1. Zirconia implant abutments: a review.

    PubMed

    Gomes, Ana-Luísa; Montero, Javier

    2011-01-01

    An increasing aesthetic demand within developed populations conducted to the fabrication of metal-free restorations and to a wide use of ceramic materials, due to its excellent characteristics of biocompatibility and aesthetics. With the incessant increase of commercial labels involved in this technological advance, a review is imposed on ceramic abutments, specifically on zirconia. We made a search of articles of peer-reviewed Journals in PubMed/Medline, crossing the terms "Dental Abutments", "Dental Porcelain" and "Zirconia". The review was divided by subtopics: zirconia physical and mechanical properties, precision fit in the implant-abutment interface, zirconia abutments strength and, finally, bacterial adherence and tissues response. Several studies demonstrate that zirconia abutments offer good results at all the levels but relevant issues need further studies and evaluation. One of the most important is the clinical long term success of zirconia abutments on implants, given that in the literature there are no sufficient in vivo studies that prove it.

  2. Phase Stability of t;#8242;-Zirconia-Based Thermal Barrier Coatings: Mechanistic Insights

    SciTech Connect

    Krogstad, Jessica A.; Krämer, Stephan; Lipkin, Don M.; Johnson, Curtis A.; Mitchell, David R.G.; Cairney, Julie M.; Levi, Carlos G.

    2011-11-07

    The temperature capability of yttria-stabilized zirconia thermal barrier coatings (TBCs) is ultimately tied to the rate of evolution of the 'nontransformable' t' phase into a depleted tetragonal form predisposed to the monoclinic transformation on cooling. The t' phase, however, has been shown to decompose in a small fraction of the time necessary to form the monoclinic phase. Instead, a modulated microstructure consisting of a coherent array of Y-rich and Y-lean lamellar phases develops early in the process, with mechanistic features suggestive of spinodal decomposition. Coarsening of this microstructure leads to loss of coherency and ultimately transformation into the monoclinic form, making the kinetics of this process, and not the initial decomposition, the critical factor in determining the phase stability of TBCs. Transmission electron microscopy is shown to be essential not only for characterizing the microstructure but also for proper interpretation of X-ray diffraction analysis.

  3. Influence of starting precursors and synthesis methods on the physiochemical properties of zirconia

    SciTech Connect

    Gaydhankar, T.R.; Jha, R.K.; Nikalje, M.D.; Waghmare, K.J.

    2014-07-01

    Graphical abstract: Crystallite size of tetragonal phase of the zirconia samples prepared using different synthesis parameters and precursors as a function of calcination temperature. Surface area values of the zirconia samples calcined at 500 and 700 °C are in given brackets. - Highlights: • Zirconia prepared with modified sol–gel method is less stable compared with zirconia prepared by precipitation method. • Optimized synthesis conditions shifted the glow exotherm to higher temperature range indicating better thermal stability. • Tetragonal-zirconia could be synthesized in cost-effective manner using zirconium oxy-nitrate. • In our studies no co-relation between the surface area and crystallite size was observed. - Abstract: Under identical and judiciously pre-optimized synthesis conditions, the influence of different combinations of zirconium sources and/or post treatment conditions on structural properties, thermal stability, phase composition and morphology of zirconia has been investigated. High surface area tetragonal zirconia could be synthesized in a cost-effective manner from 1 M solution of zirconium oxy-nitrate at pH 11 using aqueous ammonia solution as a precipitant when calcined at 400 °C for 3 h. Irrespective of the preparation method, pH and starting precursor, zirconia samples prepared without digestion contained dominant monoclinic phase with some traces of tetragonal phase when calcined at 700 °C. Even though there is linear decrease in surface area with increase in the crystallite size for each sample as a function of calcination temperature, no co-relation between the surface area and crystallite size could be achieved. SEM images show agglomerated and irregular shape particles between 10 to 20 μm.

  4. Doped zirconia phase and luminescence dependence on the nature of charge compensation

    PubMed Central

    Smits, Krisjanis; Olsteins, Dags; Zolotarjovs, Aleksejs; Laganovska, Katrina; Millers, Donats; Ignatans, Reinis; Grabis, Janis

    2017-01-01

    Zirconia is a relatively new material with many promising practical applications in medical imaging, biolabeling, sensors, and other fields. In this study we have investigated lanthanide and niobium doped zirconia by luminescence and XRD methods. It was proven that charge compensation in different zirconia phases determines the incorporation of intrinsic defects and activators. Thus, the structure of zirconia does not affect the Er luminescence directly; however, it strongly affects the defect distribution around lanthanide ions and the way in which activator ions are incorporated in the lattice. Our results demonstrate the correlation between the crystalline phase of zirconia and charge compensation, as well as the contribution of different nanocrystal grain sizes. In addition, our experimental results verify the theoretical studies of metastable (tetragonal, cubic) phase stabilization determined using only oxygen vacancies. Moreover, it was found that adding niobium drastically increases activator luminescence intensity, which makes Ln3+ doped zirconia even more attractive for various practical applications. Although this study was based on the luminescence of the Er ion, the phase stabilization, charge compensation, and luminescence properties described in our results are expected to be similar for other lanthanide elements. Our results suggest that the luminescence intensity of other oxide matrices where lanthanides incorporate in place of tetravalent cations could be increased by addition of Nb ions. PMID:28287623

  5. Doped zirconia phase and luminescence dependence on the nature of charge compensation

    NASA Astrophysics Data System (ADS)

    Smits, Krisjanis; Olsteins, Dags; Zolotarjovs, Aleksejs; Laganovska, Katrina; Millers, Donats; Ignatans, Reinis; Grabis, Janis

    2017-03-01

    Zirconia is a relatively new material with many promising practical applications in medical imaging, biolabeling, sensors, and other fields. In this study we have investigated lanthanide and niobium doped zirconia by luminescence and XRD methods. It was proven that charge compensation in different zirconia phases determines the incorporation of intrinsic defects and activators. Thus, the structure of zirconia does not affect the Er luminescence directly; however, it strongly affects the defect distribution around lanthanide ions and the way in which activator ions are incorporated in the lattice. Our results demonstrate the correlation between the crystalline phase of zirconia and charge compensation, as well as the contribution of different nanocrystal grain sizes. In addition, our experimental results verify the theoretical studies of metastable (tetragonal, cubic) phase stabilization determined using only oxygen vacancies. Moreover, it was found that adding niobium drastically increases activator luminescence intensity, which makes Ln3+ doped zirconia even more attractive for various practical applications. Although this study was based on the luminescence of the Er ion, the phase stabilization, charge compensation, and luminescence properties described in our results are expected to be similar for other lanthanide elements. Our results suggest that the luminescence intensity of other oxide matrices where lanthanides incorporate in place of tetravalent cations could be increased by addition of Nb ions.

  6. Zirconia as a Dental Biomaterial.

    PubMed

    Bona, Alvaro Della; Pecho, Oscar E; Alessandretti, Rodrigo

    2015-08-04

    Ceramics are very important in the science of dental biomaterials. Among all dental ceramics, zirconia is in evidence as a dental biomaterial and it is the material of choice in contemporary restorative dentistry. Zirconia has been applied as structural material for dental bridges, crowns, inserts, and implants, mostly because of its biocompatibility, high fracture toughness, and radiopacity. However, the clinical success of restorative dentistry has to consider the adhesion to different substrates, which has offered a great challenge to dental zirconia research and development. This study characterizes zirconia as a dental biomaterial, presenting the current consensus and challenges to its dental applications.

  7. Influence of thermal treatment on the formation of zirconia nanostructured powder by thermal decomposition of different precursors

    NASA Astrophysics Data System (ADS)

    Stoia, Marcela; Barvinschi, Paul; Barbu-Tudoran, Lucian; Negrea, Adina; Barvinschi, Floricica

    2013-10-01

    The paper presents some results concerning the preparation of zirconia powders starting from ZrOCl2·8H2O by using two synthesis methods: (a) precipitation with NH3, at 90 °C, and (b) thermal decomposition of carboxylate precursors, obtained in the reaction of zirconium nitrate and two different alcohols, 1,3-propanediol (PD) and poly(vinyl alcohol) (PVA), at 150 °C. The precursors obtained at different temperatures have been characterized by thermal analysis (TG, DTA) and FT-IR spectroscopy. DTA analysis evidenced very clearly the transition temperatures between zirconia crystalline phases. The precursors have been annealed at different temperatures in order to obtain zirconia powders and the as obtained powders have been characterized by means of X-Ray Diffraction (XRD), Fourier Transform Infrared Spectroscopy (FTIR), and Scanning Electron Microscopy (SEM). In case of precipitation method the presence of the tetragonal phase was observed at 400 °C, while the monoclinic phase appears at temperatures higher than 400 °C, becoming major crystalline phase starting with 700 °C. In case of the powders prepared by thermal decomposition of carboxylate precursors, the tetragonal phase was formed at temperatures below 700 °C, when the monoclinic phase begin to crystallize as secondary phase, in a higher proportion for the samples synthesized with 1,3-propanediol. All powders annealed at 1200 °C are pure monoclinic zirconia. SEM images have evidenced for the zirconia powders annealed at 1000 °C particles with diameters up to 150 nm, agglomerated in micrometer-sized aggregates, more individualized and homogenous than that obtained in the case of zirconia powder synthesized with poly(vinyl alcohol).

  8. Elaboration of Alumina-Zirconia Composites: Role of the Zirconia Content on the Microstructure and Mechanical Properties

    PubMed Central

    Naglieri, Valentina; Palmero, Paola; Montanaro, Laura; Chevalier, Jérôme

    2013-01-01

    Alumina-zirconia (AZ) composites are attractive structural materials, which combine the high hardness and Young’s modulus of the alumina matrix with additional toughening effects, due to the zirconia dispersion. In this study, AZ composites containing different amounts of zirconia (in the range 5–20 vol %) were prepared by a wet chemical method, consisting on the surface coating of alumina powders by mixing them with zirconium salt aqueous solutions. After spray-drying, powders were calcined at 600 °C for 1 h. Green bodies were then prepared by two methods: uniaxial pressing of spray-dried granules and slip casting of slurries, obtained by re-dispersing the spray dried granulates. After pressureless sintering at 1500 °C for 1 h, the slip cast samples gave rise to fully dense materials, characterized by a quite homogeneous distribution of ZrO2 grains in the alumina matrix. The microstructure, phase composition, tetragonal to monoclinic transformation behavior and mechanical properties were investigated and are here discussed as a function of the ZrO2 content. The material containing 10 vol % ZrO2 presented a relevant hardness and exhibited the maximum value of KI0, mainly imputable to the t → m transformation at the crack tip. PMID:28809262

  9. Nitrogen-doped zirconia: A comparison with cation stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Lee, Jong-Sook; Lerch, Martin; Maier, Joachim

    2006-01-01

    The conductivity behavior of nitrogen-doped zirconia is compared with that of zirconia doped with lower-valent cations and discussed in the framework of defect-defect interactions. While nominally introducing the same number of vacancies as yttrium, nitrogen dopants introduced in the anion sublattice of zirconia lead to substantially different defect kinetics and energetics. Compared to the equivalent yttrium doping nitrogen doping in the Y-Zr-O-N system substantially increases the activation energy and correspondingly decreases the conductivity at temperatures below 500C in the vacancy range below 4 mol%. The comparison of N-doped zirconia and zirconia systems doped with size-matched cation stabilizers, such as Sc, Yb and Y, shows that elastically driven vacancy-vacancy ordering interactions can phenomenologically account for the temperature- and composition-dependence. It is striking that materials with superior high-temperature conductivities due to weak dopant-vacancy interactions undergo severe deterioration at low temperature due to the strong vacancy-ordering. The analysis also explains qualitatively similar effects of Y co-doping in Yb-, Sc-, and N-doped zirconia. Small amount of Y in N-doped zirconia as well as in Sc-doped zirconia appears to hinder the formation of the long-range ordered phase and thus enhance the conductivity substantially.

  10. Nitrogen-doped zirconia: A comparison with cation stabilized zirconia

    SciTech Connect

    Lee, Jong-Sook . E-mail: jong-sook.lee@fkf.mpg.de; Lerch, Martin; Maier, Joachim

    2006-01-15

    The conductivity behavior of nitrogen-doped zirconia is compared with that of zirconia doped with lower-valent cations and discussed in the framework of defect-defect interactions. While nominally introducing the same number of vacancies as yttrium, nitrogen dopants introduced in the anion sublattice of zirconia lead to substantially different defect kinetics and energetics. Compared to the equivalent yttrium doping nitrogen doping in the Y-Zr-O-N system substantially increases the activation energy and correspondingly decreases the conductivity at temperatures below 500{sup -}bar C in the vacancy range below 4mol%. The comparison of N-doped zirconia and zirconia systems doped with size-matched cation stabilizers, such as Sc, Yb and Y, shows that elastically driven vacancy-vacancy ordering interactions can phenomenologically account for the temperature- and composition-dependence. It is striking that materials with superior high-temperature conductivities due to weak dopant-vacancy interactions undergo severe deterioration at low temperature due to the strong vacancy-ordering. The analysis also explains qualitatively similar effects of Y co-doping in Yb-, Sc-, and N-doped zirconia. Small amount of Y in N-doped zirconia as well as in Sc-doped zirconia appears to hinder the formation of the long-range ordered phase and thus enhance the conductivity substantially.

  11. Sintering additives for zirconia ceramics

    SciTech Connect

    Wu, S.

    1986-01-01

    This book is an overview of sintering science and its application to zirconia materials including CaO, MgO, and Y/sub 2/O/sub 3/-CeO/sub 2/ doped materials. This book is a reference for first-time exposure to zirconia materials technology, particularly densification.

  12. A new testing protocol for zirconia dental implants.

    PubMed

    Sanon, Clarisse; Chevalier, Jérôme; Douillard, Thierry; Cattani-Lorente, Maria; Scherrer, Susanne S; Gremillard, Laurent

    2015-01-01

    Based on the current lack of standards concerning zirconia dental implants, we aim at developing a protocol to validate their functionality and safety prior their clinical use. The protocol is designed to account for the specific brittle nature of ceramics and the specific behavior of zirconia in terms of phase transformation. Several types of zirconia dental implants with different surface textures (porous, alveolar, rough) were assessed. The implants were first characterized in their as-received state by Scanning Electron Microscopy (SEM), Focused Ion Beam (FIB), X-Ray Diffraction (XRD). Fracture tests following a method adapted from ISO 14801 were conducted to evaluate their initial mechanical properties. Accelerated aging was performed on the implants, and XRD monoclinic content measured directly at their surface instead of using polished samples as in ISO 13356. The implants were then characterized again after aging. Implants with an alveolar surface presented large defects. The protocol shows that such defects compromise the long-term mechanical properties. Implants with a porous surface exhibited sufficient strength but a significant sensitivity to aging. Even if associated to micro cracking clearly observed by FIB, aging did not decrease mechanical strength of the implants. As each dental implant company has its own process, all zirconia implants may behave differently, even if the starting powder is the same. Especially, surface modifications have a large influence on strength and aging resistance, which is not taken into account by the current standards. Protocols adapted from this work could be useful. Copyright © 2014 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  13. Growth of platinum nanocrystals

    SciTech Connect

    2009-01-01

    Movie showing the growth of platinum nanocrystals in a liquid cell observed in situ using the JEOL 3010 TEM at the National Center for Electron Microscopy. This is the first ever-real time movie showing nucleation and growth by monomer attachment or by smaller nanocrystals coalescing to form larger nanocrystals. All the nanocrystals end up being roughly the same shape and size. http://newscenter.lbl.gov/feature-stories/2009/08/04/growth-spurts/

  14. Influence of Specimen Preparation and Test Methods on the Flexural Strength Results of Monolithic Zirconia Materials

    PubMed Central

    Schatz, Christine; Strickstrock, Monika; Roos, Malgorzata; Edelhoff, Daniel; Eichberger, Marlis; Zylla, Isabella-Maria; Stawarczyk, Bogna

    2016-01-01

    The aim of this work was to evaluate the influence of specimen preparation and test method on the flexural strength results of monolithic zirconia. Different monolithic zirconia materials (Ceramill Zolid (Amann Girrbach, Koblach, Austria), Zenostar ZrTranslucent (Wieland Dental, Pforzheim, Germany), and DD Bio zx2 (Dental Direkt, Spenge, Germany)) were tested with three different methods: 3-point, 4-point, and biaxial flexural strength. Additionally, different specimen preparation methods were applied: either dry polishing before sintering or wet polishing after sintering. Each subgroup included 40 specimens. The surface roughness was assessed using scanning electron microscopy (SEM) and a profilometer whereas monoclinic phase transformation was investigated with X-ray diffraction. The data were analyzed using a three-way Analysis of Variance (ANOVA) with respect to the three factors: zirconia, specimen preparation, and test method. One-way ANOVA was conducted for the test method and zirconia factors within the combination of two other factors. A 2-parameter Weibull distribution assumption was applied to analyze the reliability under different testing conditions. In general, values measured using the 4-point test method presented the lowest flexural strength values. The flexural strength findings can be grouped in the following order: 4-point < 3-point < biaxial. Specimens prepared after sintering showed significantly higher flexural strength values than prepared before sintering. The Weibull moduli ranged from 5.1 to 16.5. Specimens polished before sintering showed higher surface roughness values than specimens polished after sintering. In contrast, no strong impact of the polishing procedures on the monoclinic surface layer was observed. No impact of zirconia material on flexural strength was found. The test method and the preparation method significantly influenced the flexural strength values. PMID:28773307

  15. Influence of Specimen Preparation and Test Methods on the Flexural Strength Results of Monolithic Zirconia Materials.

    PubMed

    Schatz, Christine; Strickstrock, Monika; Roos, Malgorzata; Edelhoff, Daniel; Eichberger, Marlis; Zylla, Isabella-Maria; Stawarczyk, Bogna

    2016-03-09

    The aim of this work was to evaluate the influence of specimen preparation and test method on the flexural strength results of monolithic zirconia. Different monolithic zirconia materials (Ceramill Zolid (Amann Girrbach, Koblach, Austria), Zenostar ZrTranslucent (Wieland Dental, Pforzheim, Germany), and DD Bio zx² (Dental Direkt, Spenge, Germany)) were tested with three different methods: 3-point, 4-point, and biaxial flexural strength. Additionally, different specimen preparation methods were applied: either dry polishing before sintering or wet polishing after sintering. Each subgroup included 40 specimens. The surface roughness was assessed using scanning electron microscopy (SEM) and a profilometer whereas monoclinic phase transformation was investigated with X-ray diffraction. The data were analyzed using a three-way Analysis of Variance (ANOVA) with respect to the three factors: zirconia, specimen preparation, and test method. One-way ANOVA was conducted for the test method and zirconia factors within the combination of two other factors. A 2-parameter Weibull distribution assumption was applied to analyze the reliability under different testing conditions. In general, values measured using the 4-point test method presented the lowest flexural strength values. The flexural strength findings can be grouped in the following order: 4-point < 3-point < biaxial. Specimens prepared after sintering showed significantly higher flexural strength values than prepared before sintering. The Weibull moduli ranged from 5.1 to 16.5. Specimens polished before sintering showed higher surface roughness values than specimens polished after sintering. In contrast, no strong impact of the polishing procedures on the monoclinic surface layer was observed. No impact of zirconia material on flexural strength was found. The test method and the preparation method significantly influenced the flexural strength values.

  16. Effect of grinding and heat treatment on the mechanical behavior of zirconia ceramic.

    PubMed

    Ramos, Gabriela Freitas; Pereira, Gabriel Kalil Rocha; Amaral, Marina; Valandro, Luiz Felipe; Bottino, Marco Antonio

    2016-01-01

    The present study investigated the effect of grinding on roughness, flexural strength, and reliability of a zirconia ceramic before and after heat treatment. Seven groups were tested (n = 15): a control group (labeled CG, untreated), and six groups of samples ground with diamond discs, simulating diamond burs, with grits of 200 µm (G80); 160 µm (G120), and 25 µm (G600), either untreated or heat-treated at 1200°C for 2 h (labeled A). Yttria tetragonal zirconia polycrystal discs were manufactured, ground, and submitted to roughness and crystalline phase analyses before the biaxial flexural strength test. There was no correlation between roughness (Ra and Rz) and flexural strength. The reliability of the materials was not affected by grinding or heat treatment, but the characteristic strength was higher after abrasion with diamond discs, irrespective of grit size. The X-ray diffraction data showed that grinding leads to a higher monoclinic (m) phase content, whereas heat treatment produces reverse transformation, leading to a fraction of m-phase in ground samples similar to that observed in the control group. However, after heat treatment, only the G80A samples presented strength similar to that of the control group, while the other groups showed higher strength values. When zirconia pieces must be adjusted for clinical use, a smoother surface can be obtained by employing finer-grit diamond burs. Moreover, when the amount of monoclinic phase is related to the degradation of zirconia, the laboratory heat treatment of ground pieces is indicated for the reverse transformation of zirconia crystals.

  17. Generalized dispersion analysis of arbitrarily cut monoclinic crystals.

    PubMed

    Höfer, Sonja; Ivanovski, Vladimir; Uecker, Reinhard; Kwasniewski, Albert; Popp, Jürgen; Mayerhöfer, Thomas G

    2017-10-05

    Dispersion analysis is applicable to arbitrarily cut monoclinic crystals of unknown orientation in order to find the symmetry axis. By this it is possible to differentiate between the transition moments oriented parallel and normal to the b-axis and to determine the dielectric tensor functions of those two principal directions. Dispersion analysis of arbitrarily cut monoclinic crystals is based on an extension of the evaluation scheme developed for arbitrarily cut orthorhombic crystals. We present dispersion analysis of monoclinic crystals exemplarily on spodumene (LiAl(SiO3)2) and yttrium orthosilicate (Y2SiO5). Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Generalized dispersion analysis of arbitrarily cut monoclinic crystals

    NASA Astrophysics Data System (ADS)

    Höfer, Sonja; Ivanovski, Vladimir; Uecker, Reinhard; Kwasniewski, Albert; Popp, Jürgen; Mayerhöfer, Thomas G.

    2017-10-01

    Dispersion analysis is applicable to arbitrarily cut monoclinic crystals of unknown orientation in order to find the symmetry axis. By this it is possible to differentiate between the transition moments oriented parallel and normal to the b-axis and to determine the dielectric tensor functions of those two principal directions. Dispersion analysis of arbitrarily cut monoclinic crystals is based on an extension of the evaluation scheme developed for arbitrarily cut orthorhombic crystals. We present dispersion analysis of monoclinic crystals exemplarily on spodumene (LiAl(SiO3)2) and yttrium orthosilicate (Y2SiO5).

  19. Surface Monocline Development Along Normal Faults in Basalt, Southwest Iceland

    NASA Astrophysics Data System (ADS)

    Boersma, N. D.; Kattenhorn, S. A.

    2005-12-01

    The subaerial exposure of the Mid-Atlantic Ridge in southwest Iceland is characterized by a high angle of spreading obliquity (30°), resulting in a complex structural fabric along the ridge segment at the Reykjanes Peninsula (RP). Tension fractures, normal, oblique-slip, and strike-slip faults, eruptive fissures, and prominent hyaloclastite ridges demarcate a series of four closely-spaced fissure swarms across the length of the RP. Monoclines flank the hanging wall sides of numerous normal and oblique-slip faults in the fissure swarms. The formation of these surface flexures is likely the result of upward fault propagation from depth, facilitated by the growth of vertical fractures that nucleate at the upper fault tip and then rip through the highly fractured basalt lava pile. Subsurface slip along the buried fault causes a monocline to develop at the surface above the fault tip. As slip continues, the monocline grows in both height and width, accommodating throw at the surface purely by flexure. Bending stresses within the flexure induce tensile fracturing that breaches the upper hinge at the surface. Further movement along the underlying fault increases the dilation of this fracture resulting in a gaping chasm that may widen by collapse along the fracture walls. No throw occurs along this hinge fracture until the fault ultimately breaches the surface via the fracture. At this time, the monocline becomes a passive and detached hanging wall structure along a vertical fault scarp, thus preventing further growth of the flexure. Detailed field and aerial photo mapping from scanned then digitally orthorectified photos (0.125m/pixel) were used to analyze fracture style, surface monocline geometries, and to assess the spatial variability of monoclinal flexures across the RP and northwards into the Western Volcanic Zone (WVZ). To capture along-strike changes in monocline shape, elevation profiles were constructed at numerous locations along, and orthogonal to, fault

  20. EFFECT OF (Bi2O3)0.75(Y2O3)0.25 ADDITION ON MICROSTRUCTURES AND IONIC CONDUCTIVITIES OF CODOPED ZIRCONIA

    NASA Astrophysics Data System (ADS)

    Chou, Chen Chia; Huang, Chun Feng; Yeh, Tsung Her

    2012-09-01

    Variation of microstructures and ionic conductivities in (Bi2O3)0.75(Y2O3)0.25 (YSB) modified electrolyte of 8 mol% Y2O3 stabilized zirconia (8YSZ) and YSB modified codoped zirconia (ZrO2)0.92(Y2O3)0.075(MgO)0.005 (YSZM) is investigated in this work. The results demonstrated that a small amount of δ-YSB addition is effective in reducing the sintering temperature of 8YSZ from 1500 to 1200°C and promoting the densification rate of ceramics. Compared to 8YSZ electrolyte, it is interesting that a very limited amount of monoclinic ZrO2 was observed due to the MgO stabilizer in YSB modified codoped zirconia electrolyte. Besides, enhancement of ionic conductivity in δ-YSB modified codoped zirconia is evidently increased by 67% in comparison to the specimen of 8YSZ electrolyte.

  1. Physico-mechanical and morphological features of zirconia substituted hydroxyapatite nano crystals

    PubMed Central

    Mansour, S. F.; El-dek, S. I.; Ahmed, M. K.

    2017-01-01

    Zirconia doped Hydroxyapatite (HAP) nanocrystals [Ca10(PO4)6−x(ZrO2)x(OH)2]; (0 ≤ x ≤ 1 step 0.2) were synthesized using simple low cost facile method. The crystalline phases were examined by X-ray diffraction (XRD). The crystallinity percentage decreased with increasing zirconia content for the as-synthesized samples. The existence of zirconia as secondary phase on the grain boundaries; as observed from scanning electron micrographs (FESEM); resulted in negative values of microstrain. The crystallite size was computed and the results showed that it increased with increasing annealing temperature. Thermo-gravimetric analysis (TGA) assured the thermal stability of the nano crystals over the temperature from room up to 1200 °C depending on the zirconia content. The corrosion rate was found to decrease around 25 times with increasing zirconia content from x = 0.0 to 1.0. Microhardness displayed both compositional and temperature dependence. For the sample (x = 0.6), annealed at 1200 °C, the former increased up to 1.2 times its original value (x = 0.0). PMID:28256557

  2. Physico-mechanical and morphological features of zirconia substituted hydroxyapatite nano crystals

    NASA Astrophysics Data System (ADS)

    Mansour, S. F.; El-Dek, S. I.; Ahmed, M. K.

    2017-03-01

    Zirconia doped Hydroxyapatite (HAP) nanocrystals [Ca10(PO4)6‑x(ZrO2)x(OH)2] (0 ≤ x ≤ 1 step 0.2) were synthesized using simple low cost facile method. The crystalline phases were examined by X-ray diffraction (XRD). The crystallinity percentage decreased with increasing zirconia content for the as-synthesized samples. The existence of zirconia as secondary phase on the grain boundaries; as observed from scanning electron micrographs (FESEM); resulted in negative values of microstrain. The crystallite size was computed and the results showed that it increased with increasing annealing temperature. Thermo-gravimetric analysis (TGA) assured the thermal stability of the nano crystals over the temperature from room up to 1200 °C depending on the zirconia content. The corrosion rate was found to decrease around 25 times with increasing zirconia content from x = 0.0 to 1.0. Microhardness displayed both compositional and temperature dependence. For the sample (x = 0.6), annealed at 1200 °C, the former increased up to 1.2 times its original value (x = 0.0).

  3. Synthesis of nanocrystalline zirconia by amorphous citrate route: structural and thermal (HTXRD) studies

    SciTech Connect

    Bhagwat, Mahesh; Ramaswamy, Veda

    2004-09-01

    Nanocrystalline zirconia powder with a fairly narrow particle size distribution has been synthesized by the amorphous citrate route. The sample obtained has a high BET surface area of 89 m{sup 2} g{sup -1}. Rietveld refinement of the powder X-ray diffraction (XRD) profile of the zirconia sample confirms stabilization of zirconia in the tetragonal phase with around 8% monoclinic impurity. The data show the presence of both anionic as well as cationic vacancies in the lattice. Crystallite size determined from XRD is 8 nm and is in close agreement with the particle size determined by TEM. The in situ high temperature-X-ray diffraction (HTXRD) study revealed high thermal stability of the mixture till around 1023 K after which the transformation of tetragonal phase into the monoclinic phase has been seen as a function of temperature till 1473 K. This transformation is accompanied by an increase in the crystallite size of the sample from 8 to 55 nm. The thermal expansion coefficients are 9.14 x 10{sup -6} K{sup -1} along 'a'- and 15.8 x 10{sup -6} K{sup -1} along 'c'-axis. The lattice thermal expansion coefficient in the temperature range 298-1623 K is 34.6 x 10{sup -6} K{sup -1}.

  4. Development of a novel zirconia dental post resistant to hydrothermal degradation

    NASA Astrophysics Data System (ADS)

    Camposilvan, E.; Marro, F. G.; Mestra, A.; Anglada, M. J.

    2012-02-01

    Tetragonal Zirconia Polycrystals stabilized with 3% mol. content of yttria (3Y-TZP) has excellent properties in terms of strength and fracture toughness. These properties are mostly imputable to the transformation toughening mechanism, by which the doped metastable tetragonal phase of zirconia transforms to monoclinic under applied stress ahead of a crack. This phenomenon is accompanied by a volume expansion of 5%, and increases the resistance to crack growth, thus leading to higher toughness and strength. An important drawback of this material is represented by the Low Temperature Degradation (LTD or aging), which consists in the progressive tetragonal-to-monoclinic phase transformation by the influence of water. This work focuses on the improvement of 3Y-TZP aging behavior in order to develop a novel dental post, by means of the addition of ceria from the surface. This was achieved through the impregnation of the pre-sintered samples with a solution containing Cerium, followed by sintering. Various pre-sintering temperatures were studied in terms of microstructure, mechanical properties and aging resistance. The novel zirconia dental posts developed in this work are much more resistant to LTD as compared to the base material with no loss in mechanical properties.

  5. Dilemmas in zirconia bonding: A review.

    PubMed

    Dbradović-Djuricić, Kosovka; Medić, Vesna; Dodić, Slobodan; Gavrilov, Dragan; Antonijević, Djordje; Zrilić, Milorad

    2013-01-01

    This article presents a literature review on the resin bond to zirconia ceramic. Modern esthetic dentistry has highly recognized zirconia, among other ceramic materials. Biocompatibility of zirconia, chemical and dimensional stability, excellent mechanical properties, all together could guarantee optimal therapeutical results in complex prosthodontic reconstruction. On the other hand, low thermal degradation, aging of zirconia as well as problematic bonding of zirconia framework to dental luting cements and tooth structures, opened the room for discussion concerning their clinical durability.The well known methods of mechanical and chemical bonding used on glass-ceramics are not applicable for use with zirconia. Therefore, under critical clinical situations, selection of the bonding mechanism should be focused on two important points: high initial bond strength value and long term bond strength between zirconia-resin interface. Also, this paper emphases the use of phosphate monomer luting cements on freshly air-abraded zirconia as the simplest and most effective way for zirconia cementation procedure today.

  6. Surface chemical modification of nanocrystals

    DOEpatents

    Helms, Brett Anthony; Milliron, Delia Jane; Rosen, Evelyn Louise; Buonsanti, Raffaella; Llordes, Anna

    2017-03-14

    Nanocrystals comprising organic ligands at surfaces of the plurality of nanocrystals are provided. The organic ligands are removed from the surfaces of the nanocrystals using a solution comprising a trialkyloxonium salt in a polar aprotic solvent. The removal of the organic ligands causes the nanocrystals to become naked nanocrystals with cationic surfaces.

  7. Pressure induced phase transitions in ceramic compounds containing tetragonal zirconia

    SciTech Connect

    Sparks, R.G.; Pfeiffer, G.; Paesler, M.A.

    1988-12-01

    Stabilized tetragonal zirconia compounds exhibit a transformation toughening process in which stress applied to the material induces a crystallographic phase transition. The phase transition is accompanied by a volume expansion in the stressed region thereby dissipating stress and increasing the fracture strength of the material. The hydrostatic component of the stress required to induce the phase transition can be investigated by the use of a high pressure technique in combination with Micro-Raman spectroscopy. The intensity of Raman lines characteristic for the crystallographic phases can be used to calculate the amount of material that has undergone the transition as a function of pressure. It was found that pressures on the order of 2-5 kBar were sufficient to produce an almost complete transition from the original tetragonal to the less dense monoclinic phase; while a further increase in pressure caused a gradual reversal of the transition back to the original tetragonal structure.

  8. Gelcast zirconia-alumina composites

    SciTech Connect

    Omatete, O.O.; Bleier, A.; Westmoreland, C.G.; Young, A.C.

    1991-01-01

    Near net-shaped parts of zirconia-alumina composites have been successfully formed by gelcasting, a technique which utilizes in situ polymerization of acrylamide monomers. The high solids loading required for gelcasting ({approximately}50 vol %) was obtained by controlling the pH-dependent stability of the aqueous zirconia-alumina suspensions. A strong correspondence was found among the surface charges on the particles, colloidal stability, and the maximum solids loading. 14 refs., 3 figs., 2 tabs.

  9. Rate-dependent phase transitions in Li2FeSiO4 cathode nanocrystals

    PubMed Central

    Lu, Xia; Wei, Huijing; Chiu, Hsien-Chieh; Gauvin, Raynald; Hovington, Pierre; Guerfi, Abdelbast; Zaghib, Karim; Demopoulos, George P.

    2015-01-01

    Nanostructured lithium metal orthosilicate materials hold a lot of promise as next generation cathodes but their full potential realization is hampered by complex crystal and electrochemical behavior. In this work Li2FeSiO4 crystals are synthesized using organic-assisted precipitation method. By varying the annealing temperature different structures are obtained, namely the monoclinic phase at 400°C, the orthorhombic phase at 900°C, and a mixed phase at 700°C. The three Li2FeSiO4 crystal phases exhibit totally different charge/discharge profiles upon delithiation/lithiation. Thus the 400°C monoclinic nanocrystals exhibit initially one Li extraction via typical solid solution reaction, while the 900°C orthorhombic crystals are characterized by unacceptably high cell polarization. In the meantime the mixed phase Li2FeSiO4 crystals reveal a mixed cycling profile. We have found that the monoclinic nanocrystals undergo phase transition to orthorhombic structure resulting in significant progressive deterioration of the material's Li storage capability. By contrast, we discovered when the monoclinic nanocrystals are cycled initially at higher rate (C/20) and subsequently subjected to low rate (C/50) cycling the material's intercalation performance is stabilized. The discovered rate-dependent electrochemically-induced phase transition and stabilization of lithium metal silicate structure provides a novel and potentially rewarding avenue towards the development of high capacity Li-ion cathodes. PMID:25715655

  10. A comparative study of the surface structure, acidity, and catalytic performance of tungstated zirconia prepared from crystalline zirconia or amorphous zirconium oxyhydroxide.

    PubMed

    Lebarbier, Vanessa; Clet, Guillaume; Houalla, Marwan

    2006-07-20

    Tungstated zirconias prepared from W deposition on zirconium oxyhydroxide are reportedly active for alkane isomerization, whereas solids synthesized by impregnation of zirconia are inactive. The origin of the differences between the two preparations is not fully understood. The present paper examines the influence of W surface density and the nature of the support on the surface structure, development of the acidity, and catalytic performance of WO(x)()/ ZrO(2) catalysts. Two series of catalysts containing W surface densities up to 5.2 at. W/nm(2) were prepared by pore volume impregnation of two different supports: zirconium oxyhydroxide and predominantly tetragonal zirconia (65% tetragonal, 35% monoclinic). The texture and structure of the catalysts were investigated by BET measurements, X-ray diffraction, Raman and infrared spectroscopy. The catalytic activity was tested for 2-propanol dehydration and n-hexane isomerization. For catalysts obtained by impregnation of Zr oxyhydroxide, Raman results showed that W was present as a surface phase. Infrared spectra indicated an increase in the degree of polymerization of W species with increasing W surface density. The development of the acidity was monitored by lutidine adsorption and desorption at 523 K, followed by infrared spectroscopy. The results indicated the presence of a threshold of W surface density at 1.3 at. W/ nm(2) for the detection of these acid sites, followed by a progressive increase in their abundance with increasing W surface density. The development of Brønsted acidity correlated with the evolution of the infrared bands attributed to "extensively" polymerized W species. A direct relationship was observed between the abundance of Brønsted acid sites and the catalytic activity for 2-propanol dehydration. For n-hexane isomerization, compared to 2-propanol dehydration, a higher threshold of W surface densities (3.4 at. W/ nm(2)) for the development of activity was observed. The difference was

  11. Shift in low-frequency vibrational spectra measured in-situ at 600 °C by Raman spectroscopy of zirconia developed on pure zirconium and Zr-1%Nb alloy

    NASA Astrophysics Data System (ADS)

    Kurpaska, L.; Lesniak, M.; Jadach, R.; Sitarz, M.; Jasinski, J. J.; Grosseau-Poussard, J.-L.

    2016-12-01

    In this study displacement of monoclinic bands of zirconia were investigated in the function of oxidation time using the Raman spectroscopy technique. Oxidations were performed on pure zirconium and zirconium alloy in-situ at 600 °C for 6 h. Analysis of the absolute intensities as well as the positions of the characteristic for monoclinic and tetragonal phase Raman bands were performed. Reported results has highlighted that monoclinic phase of zirconia undergoes a continuous band displacement, individual for each Raman mode. Recorded shift of low frequency vibrational spectra of monoclinic phase was employed to study stress developed in zirconia during high temperature oxidation - herein called as growing stress. In addition, based on the Raman band intensity we discuss observed transition of the metastable tetragonal phase to stable monoclinic phase. Reported results, for the first time showed that studied metals (pure zirconium and its alloy) behave similarly in terms of band shift. However the resulting value of growing stress associated to the band displacement is slightly different in regards of individual band and studied sample.

  12. Synthesis of nano-crystalline multifibrous zirconia needle

    SciTech Connect

    Biswas, Mridula; Bandyopadhyay, Siddhartha

    2013-06-01

    Graphical abstract: - Highlights: • Zirconia needles have been successfully prepared by simple inorganic sol–gel route. • The shape of the needles was retained after firing with aspect ratio > 400. • Needles are composed of multiple fibres. • Fibres are composed of nano crystals. - Abstract: Zirconia needles have been successfully synthesized using a simple inorganic sol–gel process without using any template. The method employs mixture of zirconium oxychloride octahydrate and sulphuric acid in aqueous medium. This process requires heat treatment at 40 °C for 2 h in an oven for nucleus formation. Complete formation of needle occurs after 17 days. The green needle retained its original shape after calcination at 1200 °C. Fired needles were of 1–2 cm in length and 5–50 μm in diameter and possess monoclinic phase. Needles are composed of multiple fibres. Depending on the heat treatment temperature, crystallite size varies in the range of 8 to around 300 nm.

  13. Translucency of monolithic and core zirconia after hydrothermal aging

    PubMed Central

    Fathy, Salma M.; El-Fallal, Abeer A.; El-Negoly, Salwa A.; El Bedawy, Abu Baker

    2015-01-01

    Abstract Objective: To evaluate the hydrothermal aging effect on the translucency of partially stabilized tetragonal zirconia with yttria (Y-TZP) used as monolithic or fully milled zirconia and of core type. Methods: Twenty disc-shaped specimens (1 and 10 mm) for each type of monolithic and core Y-TZP materials were milled and sintered according to the manufacturer’s instruction. The final specimens were divided into two groups according to the type of Y-TZP used. Translucency parameter (TP) was measured over white and black backgrounds with the diffuse reflectance method; X-ray diffraction (XRD) and scanning electron microscope (SEM) were used to analyze the microstructure of both Y-TZP types before and after aging. Data for TP values was statistically analyzed using Student’s t-test. Results: Monolithic Y-TZP showed the highest TP mean value (16.4 ± 0.316) before aging while core Y-TZP showed the lowest TP mean value (7.05 ± 0.261) after aging. There was a significant difference between the two Y-TZP types before and after hydrothermal aging. XRD analysis showed increases in monoclinic content in both Y-TZP surfaces after aging. Conclusion: Monolithic Y-TZP has a higher chance to low-temperature degradation than core type, which may significantly affect the esthetic appearance and translucency hence durability of translucent Y-TZP. PMID:27335897

  14. Amorphization of nanocrystalline monoclinic ZrO2 by swift heavy ion irradiation.

    PubMed

    Lu, Fengyuan; Wang, Jianwei; Lang, Maik; Toulemonde, Marcel; Namavar, Fereydoon; Trautmann, Christina; Zhang, Jiaming; Ewing, Rodney C; Lian, Jie

    2012-09-21

    Bulk ZrO(2) polymorphs generally have an extremely high amorphization tolerance upon low energy ion and swift heavy ion irradiation in which ballistic interaction and ionization radiation dominate the ion-solid interaction, respectively. However, under very high-energy irradiation by 1.33 GeV U-238, nanocrystalline (40-50 nm) monoclinic ZrO(2) can be amorphized. A computational simulation based on a thermal spike model reveals that the strong ionizing radiation from swift heavy ions with a very high electronic energy loss of 52.2 keV nm(-1) can induce transient zones with temperatures well above the ZrO(2) melting point. The extreme electronic energy loss, coupled with the high energy state of the nanostructured materials and a high thermal confinement due to the less effective heat transport within the transient hot zone, may eventually be responsible for the ionizing radiation-induced amorphization without transforming to the tetragonal polymorph. The amorphization of nanocrystalline zirconia was also confirmed by 1.69 GeV Au ion irradiation with the electronic energy loss of 40 keV nm(-1). These results suggest that highly radiation tolerant materials in bulk forms, such as ZrO(2), may be radiation sensitive with the reduced length scale down to the nano-metered regime upon irradiation above a threshold value of electronic energy loss.

  15. Protection of yttria-stabilized zirconia for dental applications by oxidic PVD coating.

    PubMed

    Hübsch, C; Dellinger, P; Maier, H J; Stemme, F; Bruns, M; Stiesch, M; Borchers, L

    2015-01-01

    In this study, the application of transparent physical vapor deposition (PVD) coatings on zirconia ceramics was examined as an approach to retard the low-temperature degradation of zirconia for dental applications. Transparent monolayers of titanium oxide (TixOy) and multilayers consisting of titanium oxide-alumina-titanium oxide (TixOy-AlxOy-TixOy) were deposited onto standardized discs of 3Y-TZP using magnetron sputtering. Using X-ray photospectroscopy and time-of-flight secondary-ion mass spectrometry, the compositions of the coatings were verified, and an approximate thickness of 50 nm for each type of coating was ascertained. After aging the coated and uncoated samples in water vapor at 134°C and 3 bar for 4, 8, 16, 32, 64 and 128 h, the monoclinic phase content was determined using X-ray diffraction, and its impact on mechanical properties was assessed in biaxial flexural strength tests. In addition, the depth of the transformation zone was measured from scanning electron microscopy images of the fracture surfaces of hydrothermally aged samples. The results revealed that the tetragonal-to-monoclinic phase transformation of the zirconia ceramic was retarded by the application of PVD coatings. During the first stages of aging, the coated samples exhibited a significantly lower monoclinic phase content than the uncoated samples and, after 128 h of aging, showed a transformation zone which was only ∼12-15 μm thick compared to ∼30 μm in the control group. Biaxial flexural strength decreased by ∼10% during aging and was not influenced by the application of a PVD coating.

  16. Optical, structural and morphological properties of zirconia nanoparticles prepared by laser ablation in liquids

    SciTech Connect

    Borodina, T I; Val'yano, G E; Gololobova, O A; Karpukhin, V T; Malikov, M M; Strikanov, D A

    2014-09-30

    Absorption, fluorescence and Raman spectra, the structural composition and morphology of zirconia nanoparticles synthesised via the laser ablation of a metal in water and aqueous solutions of the sodium dodecyl sulphate (SDS) surfactant have been studied using absorption spectroscopy, Raman spectroscopy, X-ray diffraction and scanning electron microscopy. The results demonstrate that, exposing zirconium to intense nanosecond laser pulses at a high repetition rate in these liquids, one can obtain stable cubic, tetragonal and monoclinic crystalline phases of nanozirconia with a particle size in the range 40 – 100 nm and a Zr – SDS organic – inorganic composite. The absorption and fluorescence of the synthesised zirconia strongly depend on the SDS concentration in the starting solution. The gas – vapour bubbles forming during ablation are shown to serve as templates for the formation of hollow nanoand microstructures. (nanostructures)

  17. Zirconia dental implants degradation by confocal Raman microspectroscopy: analytical simulation and experiments.

    PubMed

    Djaker, Nadia; Wulfman, Claudine; Sadoun, Michaël; Lamy de la Chapelle, Marc

    2013-05-01

    Subsurface hydrothermal degradation of yttria stabilized tetragonal zirconia polycrystals (3Y-TZP) is presented. Evaluation of low temperature degradation (LTD) phase transformation induced by aging in 3Y-TZP is experimentally studied by Raman confocal microspectroscopy. A non-linear distribution of monoclinic volume fraction is determined in depth by using different pinhole sizes. A theoretical simulation is proposed based on the convolution of the excitation intensity profile and the Beer-Lambert law (optical properties of zirconia) to compare between experiment and theory. The calculated theoretical degradation curves matche closely to the experimental ones. Surface transformation (V0) and transformation factor in depth (T) are obtained by comparing simulation and experience for each sample with nondestructive optical sectioning.

  18. Zirconia dental implants degradation by confocal Raman microspectroscopy: analytical simulation and experiments

    PubMed Central

    Djaker, Nadia; Wulfman, Claudine; Sadoun, Michaël; Lamy de la Chapelle, Marc

    2013-01-01

    Subsurface hydrothermal degradation of yttria stabilized tetragonal zirconia polycrystals (3Y-TZP) is presented. Evaluation of low temperature degradation (LTD) phase transformation induced by aging in 3Y-TZP is experimentally studied by Raman confocal microspectroscopy. A non-linear distribution of monoclinic volume fraction is determined in depth by using different pinhole sizes. A theoretical simulation is proposed based on the convolution of the excitation intensity profile and the Beer-Lambert law (optical properties of zirconia) to compare between experiment and theory. The calculated theoretical degradation curves matche closely to the experimental ones. Surface transformation (V0) and transformation factor in depth (T) are obtained by comparing simulation and experience for each sample with nondestructive optical sectioning. PMID:23667788

  19. Nanocrystal doped matrixes

    DOEpatents

    Parce, J. Wallace; Bernatis, Paul; Dubrow, Robert; Freeman, William P.; Gamoras, Joel; Kan, Shihai; Meisel, Andreas; Qian, Baixin; Whiteford, Jeffery A.; Ziebarth, Jonathan

    2010-01-12

    Matrixes doped with semiconductor nanocrystals are provided. In certain embodiments, the semiconductor nanocrystals have a size and composition such that they absorb or emit light at particular wavelengths. The nanocrystals can comprise ligands that allow for mixing with various matrix materials, including polymers, such that a minimal portion of light is scattered by the matrixes. The matrixes of the present invention can also be utilized in refractive index matching applications. In other embodiments, semiconductor nanocrystals are embedded within matrixes to form a nanocrystal density gradient, thereby creating an effective refractive index gradient. The matrixes of the present invention can also be used as filters and antireflective coatings on optical devices and as down-converting layers. Processes for producing matrixes comprising semiconductor nanocrystals are also provided. Nanostructures having high quantum efficiency, small size, and/or a narrow size distribution are also described, as are methods of producing indium phosphide nanostructures and core-shell nanostructures with Group II-VI shells.

  20. The Zirconia Ceramic: Strengths and Weaknesses

    PubMed Central

    Daou, Elie E.

    2014-01-01

    Metal ceramic restorations were considered the gold standard as reliable materials. Increasing demand for esthetics supported the commercialization of new metal free restorations. A growing demand is rising for zirconia prostheses. Peer-reviewed articles published till July 2013 were identified through a Medline (Pubmed and Elsevier). Emphasizing was made on zirconia properties and applications. Zirconia materials are able to withstand posterior physiologic loads. Although zirconia cores are considered as reliable materials, these restorations are not problem free. PMID:24851138

  1. Determining europium compositional fluctuations in partially stabilized zirconia nanopowders: a non-line-broadening-based method.

    PubMed

    Marin, Riccardo; Sponchia, Gabriele; Back, Michele; Riello, Pietro

    2016-02-01

    A method is reported for assessing the compositional fluctuations in a ceramic sample, based only on the determination of the crystalline lattice parameters. Pure tetragonal phase partially stabilized zirconia powders are synthesized through the co-precipitation method by incorporating 4% Eu(3+). The powder is subjected to compression cycles to promote the tetragonal-to-monoclinic transformation. The Rietveld analysis of the X-ray powder diffraction patterns, recorded after each compression cycle, gives information about the lattice parameters and monoclinic phase content. The determination of europium content in the residual tetragonal phase is accomplished considering the unit cell volume of t-ZrO2 using Vegard's law. Using this information the compositional fluctuations over the sample were determined by considering two possible distributions of lanthanide ion content in the powders: a Gaussian and a Log-normal one. It was found that the Gaussian distribution better fits the experimental data. It was eventually demonstrated that these results are physically meaningful.

  2. Shear bond strength of veneering porcelain to porous zirconia.

    PubMed

    Nakamura, Takashi; Sugano, Tsuyoshi; Usami, Hirofumi; Wakabayashi, Kazumichi; Ohnishi, Hiroshi; Sekino, Tohru; Yatani, Hirofumi

    2014-01-01

    In this study, two types of porous zirconia and dense zirconia were used. The flexural strength of non-layered zirconia specimens and those of the layered zirconia specimens with veneering porcelain were examined. Furthermore, the shear bond strength of veneering porcelain to zirconia was examined. The flexural strength of the non-layered specimens was 1,220 MPa for dense zirconia and 220 to 306 MPa for porous zirconia. The flexural strength of the layered specimens was 360 MPa for dense zirconia and 132 to 156 MPa for porous zirconia, when a load was applied to the porcelain side. The shear bond strength of porcelain veneered to dense zirconia was 27.4 MPa and that of porcelain veneered to porous zirconia was 33.6 to 35.1 MPa. This suggests that the veneering porcelain bonded strongly to porous zirconia although porous zirconia has a lower flexural strength than dense zirconia.

  3. Low temperature environmental degradation of zirconia ceramics

    NASA Astrophysics Data System (ADS)

    Zhao, Zhenbo

    2005-11-01

    The low temperature environmental degradation (LTED) of yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) has been prevented, or at least retarded, by using both bulk doping and surface doping methods with either cation, or anion, stabilizers. The introduction of both mullite and alumina into 3Y-TZP by a bulk-doping method was found to be effective in suppressing the tetragonal-->monoclinic transformation induced by water during hydrothermal treatment thus giving rise to better mechanical properties. The beneficial effects of alumina on the phase stability of the 3Y-TZP ceramic are considered to be due to the increase in the elastic modulus of the constraining matrix, as well as to the segregation of A12O3 at grain boundaries. The LTED transformation kinetics as determined by x-ray diffraction (XRD) and White Light Interferometer (WLI) analysis showed that the isothermal tetragonal-to-monoclinic transformation starts from the surface and has an incubation-nucleation-growth mechanism which can be described by the Johnson-Mehl-Avrami equation. The degradation of Y-TZP ceramic after hydrothermal treatment can be effectively overcome by surface doping by a solid diffusion method with tetravalent dopants: CeO2 and GeO2; with trivalent dopants: La2O 3 and Fe2O3; and with divalent dopants: CuO and MgO. For surface CeO2-, GeO2- and Fe2O 3-doping, this degradation inhibition behaviour is attributed to a localized increase in cation stabilizer content which satisfies the requirements for stabilization of the tetragonal phase. However, in each case, the stability mechanisms are different. For surface La2O3doping, surface doping overcomes the formation of La2O3 and La 2Zr2O7 since the extra La2O3 can further diffuse to the center of the 3Y-TZP ceramic. For CuO-doping, small amounts of CuO form a liquid that can act as a conduit for the re-distribution of yttria. In the case of surface MgO modification, the stabilization results from the isolated nature of the

  4. Metal Adatoms and Clusters on Ultrathin Zirconia Films

    PubMed Central

    2016-01-01

    Nucleation and growth of transition metals on zirconia has been studied by scanning tunneling microscopy (STM) and density functional theory (DFT) calculations. Since STM requires electrical conductivity, ultrathin ZrO2 films grown by oxidation of Pt3Zr(0001) and Pd3Zr(0001) were used as model systems. DFT studies were performed for single metal adatoms on supported ZrO2 films as well as the (1̅11) surface of monoclinic ZrO2. STM shows decreasing cluster size, indicative of increasing metal–oxide interaction, in the sequence Ag < Pd ≈ Au < Ni ≈ Fe. Ag and Pd nucleate mostly at steps and domain boundaries of ZrO2/Pt3Zr(0001) and form three-dimensional clusters. Deposition of low coverages of Ni and Fe at room temperature leads to a high density of few-atom clusters on the oxide terraces. Weak bonding of Ag to the oxide is demonstrated by removing Ag clusters with the STM tip. DFT calculations for single adatoms show that the metal–oxide interaction strength increases in the sequence Ag < Au < Pd < Ni on monoclinic ZrO2, and Ag ≈ Au < Pd < Ni on the supported ultrathin ZrO2 film. With the exception of Au, metal nucleation and growth on ultrathin zirconia films follow the usual rules: More reactive (more electropositive) metals result in a higher cluster density and wet the surface more strongly than more noble metals. These bind mainly to the oxygen anions of the oxide. Au is an exception because it can bind strongly to the Zr cations. Au diffusion may be impeded by changing its charge state between −1 and +1. We discuss differences between the supported ultrathin zirconia films and the surfaces of bulk ZrO2, such as the possibility of charge transfer to the substrate of the films. Due to their large in-plane lattice constant and the variety of adsorption sites, ZrO2{111} surfaces are more reactive than many other oxygen-terminated oxide surfaces. PMID:27213024

  5. Low temperature synthesis of high purity monoclinic celsian using topaz

    SciTech Connect

    Talmy, I.G.; Haught, D.A.

    1991-02-19

    This patent describes a process for preparing monoclinic BaO {center dot} Al{sub 2}O{sub 3} {center dot} 2SiO{sub 2}. It comprises: forming an intimate reaction mixture of powders of topaz and BaCO{sub 3} wherein the molar ratio of topaz to BaCO{sub 3} is from 2:1 to 4:1; and heating the reaction mixture to initiate a celsian formation reaction, in an atmosphere of gases generated by the celsian formation reaction, at a temperature in the range of from 900{degrees} C. to less than 1590{degrees} C. until the monoclinic celsian is produced.

  6. Biomineralization: Nanocrystals by design

    NASA Astrophysics Data System (ADS)

    Shang, Li; Nienhaus, Gerd Ulrich

    2015-10-01

    Nanocrystals with precisely defined structures offer promise as components of advanced materials yet they are challenging to create. Now, a nanocrystal made up of seven cadmium and twelve chloride ions has been synthesized via a biotemplating approach that uses a de novo designed protein.

  7. How to Bond Zirconia: The APC Concept.

    PubMed

    Blatz, Markus B; Alvarez, Marcela; Sawyer, Kimiyo; Brindis, Marco

    2016-10-01

    Zirconia has become one of the most popular materials in dentistry. New high-translucent zirconia ceramics have favorable optical properties and can be applied as monolithic full-contour restorations in various clinical indications for posterior and anterior teeth. However, having reliable cementation protocols is fundamental for clinical success of indirect ceramic dental restorations, including those made from zirconia materials. Resin bonding supports ceramic restorations and is necessary for onlays, laminate veneers, and resinbonded fixed dental prostheses. The APC zirconia-bonding concept is based on decades of research on how to achieve high and long-term durable bond strengths to high-strength ceramics. It includes three practical steps: (A) airparticle abrasion, (P) zirconia primer, and (C) adhesive composite resin. This article discusses the history and development of high-translucent zirconia and explains the necessity for proper cementation. The rationale and science behind a simplified zirconia-bonding concept is explained and illustrated with a clinical case presentation.

  8. Silicon Nanocrystal Laser

    SciTech Connect

    Yu, J

    2005-03-09

    The purpose of this feasibility study project was to attempt to demonstrate the silicon-nanocrystal-based laser. Such a silicon laser (made using conventional silicon-manufacturing technologies) would provide the crucial missing link that would enable a completely-silicon-based photonic system. We prepared thin layers of silicon nanocrystal material by ion-implanting Si in fused silica substrates, followed by a high temperature anneal process. These Si nanocrystals produced intense photoluminescence when optically pumped with ultraviolet light. Laser structures based on Fabry-Perot cavity and distributed feedback (DFB) designs were fabricated using the Si nanocrystals as the ''lasing'' medium. We optically pumped the samples with CW lasers at 413nm wavelength to quickly assess the feasibility of making lasers out of the Nanocrystal Si material and to verify the gain coefficients reported by other research groups.

  9. Effect of Time and Temperature on Transformation Toughened Zirconias.

    DTIC Science & Technology

    1987-06-01

    TTZ) and tetragonal airconia polycrystal ( TZP ), as well as sirconla toughened alumina (ZTA), among others. Zirconia based materials are of interest due... zirconia case, two ftctors that affect the analysis are the difficulty in resolving the tetragonal (101) and cubic (111) peaks when copper radiation is...The materials were magnesia stabilized transforma- tion toughened zirconia , yttria stabilized tetragonal zirconia polycrystal, and zirconia toughened

  10. The East Kaibab Monocline as a Lobate Scarp on Earth

    NASA Astrophysics Data System (ADS)

    Byrne, Paul; Klimczak, Christian

    2017-04-01

    The surfaces of Mercury, Mars, and the Moon show substantial evidence of crustal shortening. A principal manifestation of this tectonic deformation, usually in response to global contraction from interior cooling and/or volcanic loading, are cliff-like escarpments termed "lobate scarps". These landforms are highly asymmetric in transverse view, with steep slopes on one side and gentle backslopes on the other; in map view they typically show a broadly lobate outline. Analogues to another widespread class of extraterrestrial shortening structure, so-called "wrinkle ridges", have been reported at various locations across Earth, but so far no Terran counterparts to lobate scarps have been documented. We conducted a field survey and performed forward modeling to test the hypothesis that a major intraplate shortening landform in southern Utah—the East Kaibab monocline—is an eroded lobate scarp. Our field observations indicate that the fault-related folding that characterizes the monocline at the kilometer scale is accommodated by substantial brittle deformation at meter- to decameter scales, from distributed sets of small fractures to highly localized high-angle reverse faults. With the COULOMB elastic dislocation program we modeled topographic transects perpendicular to the strike of the monocline, using published parameters of the underlying Butte Fault, and restored the eroded portion of the monocline. When reconstructed, the monocline has a steep forward-facing escarpment and a gentle backslope, and bears a strong morphologically similarity to lobate scarps on Mercury, Mars, and the Moon. The attitudes of the deformed model rock volume at specific stratigraphic levels match our field measurements of dip angle for corresponding stratigraphic units in the monocline, verifying our model solutions. Our results strongly imply that the landforms historically termed "lobate scarps" on other planetary bodies are monoclines and asymmetric anticlines. The geometry

  11. Fracture resistance of zirconia-composite veneered crowns in comparison with zirconia-porcelain crowns.

    PubMed

    Alsadon, Omar; Patrick, David; Johnson, Anthony; Pollington, Sarah; Wood, Duncan

    2017-02-11

    The objectives were to evaluate the fracture resistance and stress concentration in zirconia/composite veneered crowns in comparison to zirconia/porcelain crowns using occlusal fracture resistance and by stress analysis using finite element analysis method. Zirconia substructures were divided into two groups based on the veneering material. A static load was applied occlusally using a ball indenter and the load to fracture was recorded in Newtons (N). The same crown design was used to create 3D crown models and evaluated using FEA. The zirconia/composite crowns subjected to static occlusal load showed comparable results to the zirconia/porcelain crowns. Zirconia/composite crowns showed higher stress on the zirconia substructure at 63.6 and 50.9 MPa on the zirconia substructure veneered with porcelain. In conclusion, zirconia/composite crowns withstood high occlusal loads similar to zirconia/porcelain crowns with no significant difference. However, the zirconia/composite crowns showed higher stress values than the zirconia/porcelain crowns at the zirconia substructure.

  12. Nanocrystal diffusion doping.

    PubMed

    Vlaskin, Vladimir A; Barrows, Charles J; Erickson, Christian S; Gamelin, Daniel R

    2013-09-25

    A diffusion-based synthesis of doped colloidal semiconductor nanocrystals is demonstrated. This approach involves thermodynamically controlled addition of both impurity cations and host anions to preformed seed nanocrystals under equilibrium conditions, rather than kinetically controlled doping during growth. This chemistry allows thermodynamic crystal compositions to be prepared without sacrificing other kinetically trapped properties such as shape, size, or crystallographic phase. This doping chemistry thus shares some similarities with cation-exchange reactions, but proceeds without the loss of host cations and excels at the introduction of relatively unreactive impurity ions that have not been previously accessible using cation exchange. Specifically, we demonstrate the preparation of Cd(1-x)Mn(x)Se (0 ≤ x ≤ ∼0.2) nanocrystals with narrow size distribution, unprecedentedly high Mn(2+) content, and very large magneto-optical effects by diffusion of Mn(2+) into seed CdSe nanocrystals grown by hot injection. Controlling the solution and lattice chemical potentials of Cd(2+) and Mn(2+) allows Mn(2+) diffusion into the internal volumes of the CdSe nanocrystals with negligible Ostwald ripening, while retaining the crystallographic phase (wurtzite or zinc blende), shape anisotropy, and ensemble size uniformity of the seed nanocrystals. Experimental results for diffusion doping of other nanocrystals with other cations are also presented that indicate this method may be generalized, providing access to a variety of new doped semiconductor nanostructures not previously attainable by kinetic routes or cation exchange.

  13. Hot Corrosion of Yttria-Stabilized Zirconia Coating, in a Mixture of Sodium Sulfate and Vanadium Oxide at 950 °C

    NASA Astrophysics Data System (ADS)

    Qureshi, Imran Nazir; Shahid, Muhammad; Nusair Khan, A.

    2016-02-01

    Yttria-stabilized zirconia thermal barrier coating along with CoNiCrAlY bondcoat was deposited using air plasma spray on Inconel-X750 superalloy. The coated samples were exposed at 950 °C in a mixture of Na2SO4 and V2O5. The exposed specimens were investigated using XRD and SEM. The formation of spinel and perovskite structures was revealed at the interface of topcoat and the bondcoat. Further, the chemical composition profile of all samples helped to analyze the diffusion behavior of different constituent elements of bondcoat and substrate. XRD analyses of the samples confirmed the phase transformation of the tetragonal zirconia into monoclinic zirconia and yttrium vanadate. The shift of high angle peaks indicated lattice distortion, which was directly related to the stresses in the coating.

  14. On Ultrasmall Nanocrystals

    PubMed Central

    McBride, James R.; Dukes, Albert D.; Schreuder, Michael A.; Rosenthal, Sandra J.

    2010-01-01

    Ultrasmall nanocrystals are a growing sub-class of traditional nanocrystals that exhibit new properties at diameters typically below 2 nm. In this review, we define what constitutes an ultrasmall nanoparticle while distinguishing between ultrasmall and magic-size nanoparticles. After a brief overview of ultrasmall nanoparticles, including ultrasmall gold clusters, our recent work is presented covering the optical properties, structure, and application of ultrasmall CdSe nanocrystals. This unique material has potential application in solid state lighting due to its balanced white emission. This section is followed by a discussion on the blurring boundary between what can be considered a nanoparticle and a molecule. PMID:21132106

  15. Alpha decay self-damage in cubic and monoclinic zirconolite

    SciTech Connect

    Clinard, F.W. Jr.; Land, C.C.; Peterson, D.E.; Rohr, D.L.; Roof, R.B.

    1981-01-01

    Samples of primarily-monoclinic /sup 238/Pu-doped zirconolite were stored at ambient temperature to allow accumulation of alpha decay self-damage to a dose of 1 x 10/sup 24/ ..cap alpha../m/sup 3/ (equivalent to a SYNROC age of approx. 10/sup 3/y). Bulk swelling reached 2.3 vol% with no tendency toward saturation, a damage response similar to that observed for cubic Pu-doped zirconolite. X-ray volumetric swelling at 4 x 10/sup 24/ ..cap alpha../m/sup 3/ was 1 vol%, considerably less than that for the cubic material. Changes in cell dimensions differed significantly from those reported by others for a monoclinic natural mineral. Extensive microcracking was observed, and is attributed at least partially to swelling differences between the matrix and minor phases.

  16. Different structures of monoclinic martensitic phases in titanium nickelide

    NASA Astrophysics Data System (ADS)

    Voronin, V. I.; Naish, V. E.; Novoselova, T. V.; Pushin, V. G.; Sagaradze, I. V.

    2000-03-01

    The detailed theoretical and experimental analysis has been undertaken to bring to light the true structure of the monoclinic phase in titanium nickelide (NiTi). Theoretical models for such a phase have been proposed to describe the experimental data. In addition to the well-known B19‧ phase two more structures - new monoclinic M phase with Cm space group and triclinic phase with P1 space group - have been produced and analyzed in detail. Diffraction patterns have been obtained from different NiTi samples by using the neutron diffractometer IVV2 at different temperatures. From the refinement by DBWS-9411 program all these neutron patterns have been decoded successfully. The proposed new structures and stereotype B19‧ one agree with correspondent experimental data and the agreement is quite good.

  17. A study on the wear of enamel caused by monolithic zirconia and the subsequent phase transformation compared to two other ceramic systems.

    PubMed

    Rupawala, Amreen; Musani, Smita I; Madanshetty, Pallavi; Dugal, Ramandeep; Shah, Umang D; Sheth, Ektaa J

    2017-01-01

    The purpose of this in vitro research project was to evaluate and compare the wear behavior of human tooth enamel opposing monolithic zirconia and other different ceramic restorative materials and also to observe the tetragonal to monoclinic phase transformation in zirconia-based ceramics that may occur while simulating wear occurring at room temperature in a wet environment. A total of sixty samples were prepared for this study. Fifteen discs of glazed zirconia, 15 discs of polished zirconia without glaze, 15 discs of metal ceramic, and 15 discs of lithium disilicate were fabricated. Sixty extracted premolars were collected and randomly divided into four groups of 15 each. The discs and extracted human premolars were placed onto holders on a two-body wear machine under a constant load of 5 kg to simulate the oral wear cycle. A diffractometer was used to analyze phase transformation. One-way analysis of variance and Tukey's post hoc tests was used. The mean loss of height of tooth samples and its standard deviation for Group I (monolithic zirconia with glaze), Group II (mechanically polished monolithic zirconia without glaze), Group III (porcelain fused to metal), and Group IV (glazed monolithic lithium disilicate) was obtained as 0.2716 ± 0.1409, 0.1240 ± 0.0625, 0.1567 ± 0.0996, and 0.2377 ± 0.1350, respectively. The highest mean loss in height was observed in Group I and the least was observed in Group II. Mechanically polished zirconia showed the least amount of enamel wear followed by porcelain fused to metal and glazed monolithic lithium disilicate, whereas glazed monolithic zirconia showed the highest enamel wear.

  18. Synthetic smythite and monoclinic Fe3S4

    NASA Astrophysics Data System (ADS)

    Fleet, Michael E.

    1982-11-01

    Smythite and monoclinic Fe3S4 have been identified by X-ray diffraction procedures in quenched ironsulfide compositions. Both phases appear to be metastable under the conditions of the experiments and their development is structurally induced. Smythite occurs as a coherent twinned intergrowth with hexagonal 3C pyrrhotite. Individual single crystals contain about 50% smythite. Reciprocal lattice rows with h-k ≠ 3n show continuous diffraction streaks. The available data suggest that smythite forms via a “polytypic” displacive transformation, by the introduction of stacking faults in the hexagonal close-packed layers of S atoms in high-temperature 1C pyrrhotite. This is analogous to the transformation of 2H wurtzite to intermediate ordered and disordered ZnS layer sequences. The ideal formula of smythite appears to be Fe13S16. Monoclinic Fe3S4 ( a=5.93, b=3.42, c=10.64 Å, β=91.9°) is present in amounts up to 25% of total sulfides. It has a derivative NiAs-type structure, and is isomorphous with monoclinic Cr3S4 and Fe3Se4. It occurs as small lenticular lamellae within grains of 3C pyrrhotite, and apparently corresponds to the unidentified lamellar phase of Arnold (1962). The lamellae have a rhombohedral morphology, with a habit plane close to {1011}. In single crystal grains of pyrrhotite, monoclinic Fe3S4 in twinned in a manner consistent with transformation from high-temperature 1C pyrrhotite. Although Fe3S4 lamellae have the general appearance of plate martensite, they do not represent a diffusionless transformation.

  19. Nanocrystal dispersed amorphous alloys

    NASA Technical Reports Server (NTRS)

    Perepezko, John H. (Inventor); Allen, Donald R. (Inventor); Foley, James C. (Inventor)

    2001-01-01

    Compositions and methods for obtaining nanocrystal dispersed amorphous alloys are described. A composition includes an amorphous matrix forming element (e.g., Al or Fe); at least one transition metal element; and at least one crystallizing agent that is insoluble in the resulting amorphous matrix. During devitrification, the crystallizing agent causes the formation of a high density nanocrystal dispersion. The compositions and methods provide advantages in that materials with superior properties are provided.

  20. Nanocrystal-Powered Nanomotor

    SciTech Connect

    Regan, B.C.; Aloni, S.; Jensen, K.; Ritchie, R.O.; Zettl, A.

    2005-07-05

    We have constructed and operated a nanoscale linear motorpowered by a single metal nanocrystal ram sandwiched between mechanicallever arms. Low-level electrical voltages applied to the carbon nanotubelever arms cause the nanocrystal to grow or shrink in a controlledmanner. The length of the ram is adjustable from 0 to more than 150 nm,with extension speeds exceeding 1900 nm/s. The thermodynamic principlesgoverning motor operation resemble those driving frost heave, a naturalsolid-state linear motor.

  1. Nanocrystals for electronics.

    PubMed

    Panthani, Matthew G; Korgel, Brian A

    2012-01-01

    Semiconductor nanocrystals are promising materials for low-cost large-area electronic device fabrication. They can be synthesized with a wide variety of chemical compositions and size-tunable optical and electronic properties as well as dispersed in solvents for room-temperature deposition using various types of printing processes. This review addresses research progress in large-area electronic device applications using nanocrystal-based electrically active thin films, including thin-film transistors, light-emitting diodes, photovoltaics, and thermoelectrics.

  2. Performance of Zirconia for Dental Healthcare

    PubMed Central

    Silva, Nelson R.F.A.; Sailer, Irena; Zhang, Yu; Coelho, Paulo G.; Guess, Petra C.; Zembic, Anja; Kohal, Ralf J.

    2010-01-01

    The positive results of the performance of zirconia for orthopedics devices have led the dental community to explore possible esthetical and mechanical outcomes using this material. However, questions regarding long-term results have opened strong and controversial discussions regarding the utilization of zirconia as a substitute for alloys for restorations and implants. This narrative review presents the current knowledge on zirconia utilized for dental restorations, oral implant components, and zirconia oral implants, and also addresses laboratory tests and developments, clinical performance, and possible future trends of this material for dental healthcare.

  3. Solid State Synthesis and Properties of Monoclinic Celsian

    NASA Technical Reports Server (NTRS)

    Bansal, Narottam P.

    1996-01-01

    Monoclinic celsian of Ba(0.75)Sr(0.25)Al2Si2O8 (BSAS-1) and B(0.85)Sr(O.15)Al2Si2O8 (BSAS-2) compositions have been synthesized from metal carbonates and oxides by solid state reaction. A mixture of BaCO3, SrCO3, Al2O3, and SiO2 powders was precalcined at approx. 900-940 C to decompose the carbonates followed by hot pressing at approx. 1300 C. The hot pressed BSAS-1 material was almost fully dense and contained the monoclinic celsian phase, with complete absence of the undesirable hexacelsian as indicated by x-ray diffraction. In contrast, a small fraction of hexacelsian was still present in hot pressed BSAS-2. However, on further heat treatment at 1200 C for 24 h, the hexacelsian phase was completely eliminated. The average linear thermal expansion coefficients of BSAS-1 and BSAS-2 compositions, having the monoclinic celsian phase, were measured to be 5.28 x 10(exp -6)/deg C and 5.15 x 10(exp -6)/deg C, respectively from room temperature to 1200 C. The hot pressed BSAS-1 celsian showed room temperature flexural strength of 131 MPa, elastic modulus of 96 GPa and was stable in air up to temperatures as high as approx. 1500 C.

  4. Assignments of the Raman modes of monoclinic erbium oxide

    SciTech Connect

    Yan, D.; Wu, P. Zhang, S. P.; Liang, L.; Yang, F.; Pei, Y. L.; Chen, S.

    2013-11-21

    As a heavy rare earth oxide, erbium oxide (Er{sub 2}O{sub 3}) has many attractive properties. Monoclinic Er{sub 2}O{sub 3} has useful properties not found in stable cubic Er{sub 2}O{sub 3}, such as unique optical properties and high radiation damage tolerance. In this study, cubic Er{sub 2}O{sub 3} coating and Er{sub 2}O{sub 3} coating with mixed phases were prepared. The Raman scattering spectra of these coatings were investigated by using a confocal micro-Raman spectrometer equipped with 325, 473, 514, 532, 633, and 784 nm lasers. A total of 17 first-order Raman modes of monoclinic Er{sub 2}O{sub 3} were identified and assigned. The modes at 83, 112, 152, 170, 278, 290, 409, 446, 478, 521, 603, and 622 cm{sup −1} are of A{sub g} symmetry, whereas modes at 71, 98, 333, 409, 446, and 468 cm{sup −1} are of B{sub g} symmetry. This research provides basic data necessary for the characterization of monoclinic Er{sub 2}O{sub 3} by Raman spectroscopy.

  5. Zoledronic acid: monoclinic and triclinic polymorphs from powder diffraction data.

    PubMed

    Chernyshev, Vladimir V; Shkavrov, Sergey V; Paseshnichenko, Ksenia A; Puryaeva, Tamara P; Velikodny, Yurii A

    2013-03-01

    The crystal structures of the monoclinic and triclinic polymorphs of zoledronic acid, C5H10N2O7P2, have been established from laboratory powder X-ray diffraction data. The molecules in both polymorphs are described as zwitterions, namely 1-(2-hydroxy-2-phosphonato-2-phosphonoethyl)-1H-imidazol-3-ium. Strong intermolecular hydrogen bonds (with donor-acceptor distances of 2.60 Å or less) link the molecules into layers, parallel to the (100) plane in the monoclinic polymorph and to the (1-10) plane in the triclinic polymorph. The phosphonic acid groups form the inner side of each layer, while the imidazolium groups lie to the outside of the layer, protruding in opposite directions. In both polymorphs, layers related by translation along [100] interact through weak hydrogen bonds (with donor-acceptor distances greater than 2.70 Å), forming three-dimensional layered structures. In the monoclinic polymorph, there are hydrogen-bonded centrosymmetric dimers linked by four strong O-H...O hydrogen bonds, which are not present in the triclinic polymorph.

  6. Cubic zirconia as a high-quality facet coating for semiconductor lasers

    NASA Astrophysics Data System (ADS)

    Chin, A. K.; Satyanarayan, A.; Zarrabi, J. H.; Vetterling, W.

    1988-08-01

    In this paper we describe the properties of high-quality, semiconductor laser facet coatings based on yttria-stabilizied cubic zirconia (90-m% ZrO2/10-m% Y2O3). We have found that cubic zirconia films can be reproducibly deposited by electron-beam evaporation with an index of refraction of 1.98 at 6328 Å, almost ideal for use as a single-layer antireflection coating for GaAs/GaAlAs-based lasers. ZrO2 has a monoclinic crystal structure at room temperature, but changes to tetragonal, hexagonal, and cubic phases upon heating to higher temperatures. However, the addition of the Y2O3 stabilizes ZrO2 in the cubic form, thus allowing electron-beam deposition of thin films of this material to be more controllable and reproducible without the usual addition of oxygen into the vacuum chamber during deposition. Preliminary aging tests of high-power GaAs/GaAlAs lasers show that cubic zirconia films suppress the photo-enhanced oxidation of laser facets that degrades device performance.

  7. Alumina-Reinforced Zirconia Composites

    NASA Technical Reports Server (NTRS)

    Choi, Sung R.; Bansal, Narottam P.

    2003-01-01

    Alumina-reinforced zirconia composites, used as electrolyte materials for solid oxide fuel cells, were fabricated by hot pressing 10 mol percent yttria-stabilized zirconia (10-YSZ) reinforced with two different forms of alumina particulates and platelets each containing 0 to 30 mol percent alumina. Major mechanical and physical properties of both particulate and platelet composites including flexure strength, fracture toughness, slow crack growth, elastic modulus, density, Vickers microhardness, thermal conductivity, and microstructures were determined as a function of alumina content either at 25 C or at both 25 and 1000 C. Flexure strength and fracture toughness at 1000 C were maximized with 30 particulate and 30 mol percent platelet composites, respectively, while resistance to slow crack growth at 1000 C in air was greater for 30 mol percent platelet composite than for 30 mol percent particulate composites.

  8. Synthesis of Cu2SnSe3 nanocrystals for solution processable photovoltaic cells.

    PubMed

    Ahmadi, Mahshid; Pramana, Stevin S; Batabyal, Sudip K; Boothroyd, Chris; Mhaisalkar, Subodh G; Lam, Yeng Ming

    2013-02-18

    This paper describes the synthesis of ternary chalcogenide Cu(2)SnSe(3) nanocrystals as an alternative solar absorber material to conventional quaternary CuIn(x)Ga(1-x)Se(2). We used the hot coordination solvent method with hexadecylamine as the capping ligand for the first time for this material system. Using a variety of characterization techniques, such as X-ray diffraction, selected area electron diffraction, convergent beam electron diffraction, and Raman spectroscopy, the nanocrystals were found to be monoclinic Cu(2)SnSe(3) with an optical energy band gap of 1.3 eV and have a narrow size distribution. These nanocrystals are shown to be photosensitive in the range of wavelengths corresponding to the solar spectrum, which makes them highly promising as alternative photon absorber materials for photovoltaic applications.

  9. Zirconia-molybdenum disilicide composites

    DOEpatents

    Petrovic, John J.; Honnell, Richard E.

    1991-01-01

    Compositions of matter comprised of molybdenum disilicide and zirconium oxide in one of three forms: pure, partially stabilized, or fully stabilized and methods of making the compositions. The stabilized zirconia is crystallographically stabilized by mixing it with yttrium oxide, calcium oxide, cerium oxide, or magnesium oxide and it may be partially stabilized or fully stabilized depending on the amount of stabilizing agent in the mixture.

  10. Effect of autoclave induced low-temperature degradation on the adhesion energy between yttria-stabilized zirconia veneered with porcelain.

    PubMed

    Li, Kai Chun; Waddell, J Neil; Prior, David J; Ting, Stephanie; Girvan, Liz; van Vuuren, Ludwig Jansen; Swain, Michael V

    2013-11-01

    To investigate the effect of autoclave induced low-temperature degradation on the adhesion energy between yttria-stabilized zirconia veneered with porcelain. The strain energy release rate using a four-point bending stable fracture test was evaluated for two different porcelains [leucite containing (VM9) and glass (Zirox) porcelain] veneered to zirconia. Prior to veneering the zirconia had been subjected to 0 (control), 1, 5, 10 and 20 autoclave cycles. The specimens were manufactured to a total bi-layer dimension of 30 mm × 8 mm × 3 mm. Subsequent scanning electron microscopy/energy dispersive spectrometry, electron backscatter diffraction and X-ray diffraction analysis were performed to identify the phase transformation and fracture behavior. The strain energy release rate for debonding of the VM9 specimens were significantly higher (p<0.05) compared to the Zirox specimens across all test groups. Increasing autoclave cycles lowered the strain energy release rate significantly (p<0.05) from 18.67 J/m(2) (control) to the lowest of 12.79 J/m(2) (cycle 10) for only the VM9 specimens. SEM analyses showed predominant cohesive fracture within the porcelain for all cycle groups. XRD analysis of the substrate prior to veneering confirmed a tetragonal to monoclinic phase transformation with increasing the number of autoclave cycles between 5 and 20. The monoclinic phase reverted back to tetragonal phase after undergoing conventional porcelain firing cycles. EBSD data showed significant changes of the grain size distribution between the control and autoclaved specimen (cycle 20). Increasing autoclave cycles only significantly decreased the adhesion of the VM9 layered specimens. In addition, a conventional porcelain firing schedule completely reverted the monoclinic phase back to tetragonal. Copyright © 2013 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  11. Spall strength, dynamic elastic limit and fracture of ittrya dopped tetragonal zirconia

    NASA Astrophysics Data System (ADS)

    Milyavskiy, Vladimir; Savinykh, Andrey; Schlothauer, Thomas; Lukin, Evgeny; Akopov, Felix

    2013-06-01

    Specimens of the ceramics based on zirconia partially stabilized by yttrium oxide of the composition of 97 mol % ZrO2 + 3 mol % Y2O3 were prepared. The densities of the specimens were 5.79 and 6.01 g/cc. The ceramics mainly have the tetragonal structure (93-98 wt. % of t-ZrO2) . The mechanical action on the ceramic activates the transformation of the tetragonal phase into the monoclinic one: at the abrasive cutting or at the fracture by hammer shock, the content of the monoclinic phase is increasing. The same trend was observed in the specimens, recovered after stepwise shock compression up to 36, 52 and 99 GPa. It was found that shock compression do not initiates tetragonal-monoclinic phase transition directly, and this transition is caused by the destruction. Recovered specimens do not reveal any traces of the phase change which was observed by Mashimo et al. under the pressures 30-35 GPa (J. Appl. Phys. 1995. V. 77. P. 5069). Recording of the profiles of the free surface velocity of the specimens during single-stage shock compression allowed us to determine the dynamic elastic limit, as well as spall strength of the material versus maximal shock stress. In addition, the ceramics were subjected to the action of low temperatures. There were no significant changes in the specimens recovered after storage in liquid nitrogen and helium. The work was supported by The State Atomic Energy Corporation ROSATOM.

  12. Neutron and X-ray diffraction of plasma-sprayed zirconia-yttria thermal barrier coatings

    NASA Technical Reports Server (NTRS)

    Shankar, N. R.; Herman, H.; Singhal, S. P.; Berndt, C. C.

    1984-01-01

    ZrO2-7.8mol. pct. YO1.5, a fused powder, and ZrO2-8.7mol. pct. YO1.5, a prereacted powder, were plasma-sprayed onto steel substrates. Neutron diffraction and X-ray diffraction of the as-received powder, the powder plasma sprayed into water, as-sprayed coatings, and coatings heat-treated for 10 and 100 h were carried out to study phase transformations and ordering of the oxygen ions on the oxygen sublattice. The as-received fused powder has a much lower monoclinic percentage than does the pre-reacted powder, this resulting in a much lower monoclinic percentage in the coating. Heat treatment increases the percentages of the cubic and monoclinic phases, while decreasing the tetragonal content. An ordered tetragonal phase is detected by the presence of extra neutron diffraction peaks. These phase transformations and ordering will result in volume changes. The implications of these transformations on the performance of partially stabilized zirconia thermal barrier coatings is discussed.

  13. Silica coating of zirconia by silicon nitride hydrolysis on adhesion promotion of resin to zirconia.

    PubMed

    Lung, Christie Ying Kei; Liu, Dan; Matinlinna, Jukka Pekka

    2015-01-01

    In this study, the effect of silica coating on zirconia by silicon nitride hydrolysis in resin zirconia bonding was investigated. The silica coated zirconia samples were prepared in silicon nitride dispersion at 90 °C under different immersion times followed by a thermal treatment at 1400 °C. Four test groups were prepared: 1) zirconia samples treated by sandblasting, 2) zirconia samples treated by immersion in silicon nitride dispersion for 6 h, 3) zirconia samples treated by immersion in silicon nitride dispersion for 24 h and 4) zirconia samples treated by immersion in silicon nitride dispersion for 48 h. The coatings were characterized by SEM, EDX, XRD and Raman. The resin zirconia bond strengths of the four test groups were evaluated under three storage conditions: dry storage, water storage in deionized water at 37 °C for 30 days and thermo-cycling for 6000 cycles between 5.0 and 55.0 °C. Surface morphology and composition of zirconia were changed after surface treatments. Phase transformation was observed for zirconia surface by sandblasting treatment but was not observed for zirconia surface treated with silicon nitride hydrolysis. Significant differences in bond strengths were found under different surface treatments (p<0.001) and under three storage conditions (p<0.005). The highest bond strength values were obtained by sandblasting treatment.

  14. Influence of low-temperature environmental exposure on the mechanical properties and structural stability of dental zirconia.

    PubMed

    Alghazzawi, Tariq F; Lemons, Jack; Liu, Perng-Ru; Essig, Milton E; Bartolucci, Alfred A; Janowski, Gregg M

    2012-07-01

    The effect of dental fabrication procedures of zirconia monolithic restorations and changes in properties during low-temperature exposure in the oral environment is not completely understood. The purpose of this study was to investigate the effect of procedures for fabrication of dental restorations by low-temperature simulation and relative changes of flexural strength, nanoindentation hardness, Young's modulus, surface roughness, and structural stability of yttria-stabilized zirconia. A total of 64 zirconia specimens were prepared to simulate dental practice. The specimens were divided into the control group and the accelerated aging group. The simulated group followed the same procedure as the control group except for the aging treatment. Atomic force microscopy was used to measure surface roughness. The degree of tetragonal-to-monoclinic transformation was determined using X-ray diffraction. Nanoindentation hardness and modulus measurements were carried out on the surface of the zirconia specimens using a nanoindenter XP/G200 system. The yttria levels for nonaged and aged specimens were measured using energy dispersive spectroscopy. Flexural strength was determined using the piston-on-three-ball test. The t-test was used to determine statistical significance. Means and standard deviations were calculated using all observations for each condition and evaluated using a group t-test (p < 0.05). The LTD treatment resulted in increased surface roughness (from 12.23 nm to 21.56 nm for Ra and 15.06 nm to 27.45 nm for RMS) and monoclinic phase fractions (from 2% to 21%), with a concomitant decrease in hardness (from 16.56 GPa to 15.14 GPa) and modulus (from 275.68 GPa to 256.56 GPa). Yttria content (from 4.43% to 4.46%) and flexural strength (from 586 MPa to 578 MPa) were not significantly altered, supporting longer term in vivo function without biomechanical fracture. The LTD treatment induced the tetragonal-to-monoclinic transformation with surface roughening in

  15. Zirconia in fixed prosthesis. A literature review

    PubMed Central

    Román-Rodríguez, Juan L.; Ferreiroa, Alberto; Solá-Ruíz, María F.; Fons-Font, Antonio

    2014-01-01

    Statement of problem: Evidence is limited on the efficacy of zirconia-based fixed dental prostheses. Objective: To carry out a literature review of the behavior of zirconium oxide dental restorations. Material and Methods: This literature review searched the Pubmed, Scopus, Medline and Cochrane Library databases using key search words “zirconium oxide,” “zirconia,” “non-metal restorations,” “ceramic oxides,” “veneering ceramic,” “zirconia-based fixed dental prostheses”. Both in vivo and in vitro studies into zirconia-based prosthodontic restoration behavior were included. Results: Clinical studies have revealed a high rate of fracture for porcelain-veneered zirconia-based restorations that varies between 6% and 15% over a 3- to 5-year period, while for ceramo-metallic restorations the fracture rate ranges between 4 and 10% over ten years. These results provoke uncertainty as to the long-term prognosis for this material in the oral medium. The cause of veneering porcelain fractures is unknown but hypothetically they could be associated with bond failure between the veneer material and the zirconia sub-structure. Key words:Veneering ceramic, zirconia-based ceramic restoration, crown, zirconia, tooth-supported fixed prosthesis. PMID:24596638

  16. Enamel wear opposing polished and aged zirconia.

    PubMed

    Burgess, J O; Janyavula, S; Lawson, N C; Lucas, T J; Cakir, D

    2014-01-01

    Aging of dental zirconia roughens its surface through low temperature degradation. We hypothesized that age-related roughening of zirconia crowns may cause detrimental wear to the enamel of an opposing tooth. To test our hypothesis, we subjected artificially aged zirconia and reference specimens to simulated mastication in a wear device and measured the wear of an opposing enamel cusp. Additionally, the roughness of the pretest surfaces was measured. The zirconia specimens, artificially aged by autoclave, showed no significant increase in roughness compared to the nonaged specimens. Furthermore, no significant difference in material or opposing enamel wear between the aged and nonaged zirconia was seen. All zirconia specimens showed less material and opposing enamel wear than the enamel to enamel control or veneering porcelain specimens. Scanning electron micrographs showed relatively smooth surfaces of aged and nonaged zirconia following wear testing. The micrographs of the veneering ceramic showed sharp fractured edges and fragments of wear debris. Zirconia may be considered a wear-friendly material for restorations opposing enamel, even after simulated aging.

  17. Nanocrystal Solar Cells

    SciTech Connect

    Gur, Ilan

    2006-01-01

    This dissertation presents the results of a research agenda aimed at improving integration and stability in nanocrystal-based solar cells through advances in active materials and device architectures. The introduction of 3-dimensional nanocrystals illustrates the potential for improving transport and percolation in hybrid solar cells and enables novel fabrication methods for optimizing integration in these systems. Fabricating cells by sequential deposition allows for solution-based assembly of hybrid composites with controlled and well-characterized dispersion and electrode contact. Hyperbranched nanocrystals emerge as a nearly ideal building block for hybrid cells, allowing the controlled morphologies targeted by templated approaches to be achieved in an easily fabricated solution-cast device. In addition to offering practical benefits to device processing, these approaches offer fundamental insight into the operation of hybrid solar cells, shedding light on key phenomena such as the roles of electrode-contact and percolation behavior in these cells. Finally, all-inorganic nanocrystal solar cells are presented as a wholly new cell concept, illustrating that donor-acceptor charge transfer and directed carrier diffusion can be utilized in a system with no organic components, and that nanocrystals may act as building blocks for efficient, stable, and low-cost thin-film solar cells.

  18. Flexural strength and the probability of failure of cold isostatic pressed zirconia core ceramics.

    PubMed

    Siarampi, Eleni; Kontonasaki, Eleana; Papadopoulou, Lambrini; Kantiranis, Nikolaos; Zorba, Triantafillia; Paraskevopoulos, Konstantinos M; Koidis, Petros

    2012-08-01

    The flexural strength of zirconia core ceramics must predictably withstand the high stresses developed during oral function. The in-depth interpretation of strength parameters and the probability of failure during clinical performance could assist the clinician in selecting the optimum materials while planning treatment. The purpose of this study was to evaluate the flexural strength based on survival probability and Weibull statistical analysis of 2 zirconia cores for ceramic restorations. Twenty bar-shaped specimens were milled from 2 core ceramics, IPS e.max ZirCAD and Wieland ZENO Zr, and were loaded until fracture according to ISO 6872 (3-point bending test). An independent samples t test was used to assess significant differences of fracture strength (α=.05). Weibull statistical analysis of the flexural strength data provided 2 parameter estimates: Weibull modulus (m) and characteristic strength (σ(0)). The fractured surfaces of the specimens were evaluated by scanning electron microscopy (SEM) and energy dispersive spectroscopy (EDS). The investigation of the crystallographic state of the materials was performed with x-ray diffraction analysis (XRD) and Fourier transform infrared (FTIR) spectroscopy. Higher mean flexural strength (P<.001) and σ(0) were recorded for WZ ceramics. However IZ ceramics presented a higher m value and a microstructure with fewer voids and pores. The fractured surfaces presented similar fractographic properties (mirror regions followed by hackle lines zones). Both groups primarily sustained the tetragonal phase of zirconia and a negligible amount of the monoclinic phase. Although both zirconia ceramics presented similar fractographic and crystallographic properties, the higher flexural strength of WZ ceramics was associated with a lower m and more voids in their microstructure. These findings suggest a greater scattering of strength values and a flaw distribution that are expected to increase failure probability. Copyright

  19. Effect of different grinding burs on the physical properties of zirconia

    PubMed Central

    2016-01-01

    PURPOSE Grinding with less stress on 3Y-TZP through proper selection of methods and instruments can lead to a long-term success of prosthesis. The purpose of this study was to compare the phase transformation and physical properties after zirconia surface grinding with 3 different grinding burs. MATERIALS AND METHODS Forty disc-shaped zirconia specimens were fabricated. Each Ten specimens were ground with AllCeramic SuperMax (NTI, Kahla, Germany), Dura-Green DIA (Shofu Inc., Kyoto, Japan), and Dura-Green (Shofu Inc., Kyoto, Japan). Ten specimens were not ground and used as a control group. After the specimen grinding, XRD analysis, surface roughness test, FE-SEM imaging, and biaxial flexural strength test were performed. RESULTS After surface grinding, small amount of monoclinic phase in all experimental groups was observed. The phase change was higher in specimens, which were ground with Dura-Green DIA and AllCeramic SuperMax burs. The roughness of surfaces increased in specimens, which were ground with Dura-Green DIA and AllCeramic SuperMax burs than control groups and ground with Dura-Green. All experimental groups showed lower flexural strength than control group, but there was no statistically significant difference between control group and ground with Dura-Green DIA and AllCeramic SuperMax burs. The specimens, which were ground with Dura- Green showed the lowest strength. CONCLUSION The use of dedicated zirconia-specific grinding burs such as Dura-Green DIA and AllCeramic SuperMax burs decreases the grinding time and did not significantly affect the flexural strength of zirconia, and therefore, they may be recommended. However, a fine polishing process should be accompanied to reduce the surface roughness after grinding. PMID:27141258

  20. Low-temperature anisotropy changes in monoclinic pyrrhotite

    NASA Astrophysics Data System (ADS)

    Koulialias, D.; Charilaou, M.; Löffler, J. F.; Gehring, A. U.

    2016-12-01

    Pyrrhotite refers to an iron monosulfide solid solution (Fe1-xS; 0 < x < 0.125) with a NiAs-type structure in common where iron occupies the interstitials in a hexagonal close-packed array of sulfur. Unoccupied octahedral sites form variable stacking sequences of vacancy and full sublattices that generate different superstructures. Torque measurements of monoclinic 4C pyrrhotite (ideal formula: Fe7S8) at 300 K generally show a 6-fold symmetry that stems from the hexagonal NiAs-type substructure (1). At 25 K, a 4-fold symmetry was reported and explained by a crystallographic change from monoclinic to triclinic associated with the Besnus transition (2). We investigated the anisotropy properties in the c-plane of the hexagonal substructure of a monoclinic pyrrhotite that consists of intergrown 4C and 5C* superstructures (3), between 200 and 10 K using a Physical Property Measurement System (PPMS: Quantum Design). In this temperature range, Fourier analysis of the torque shows a 6-fold and a 4-fold symmetry, whereby the intensity ratio I4/I6 down to 25 K is << 1. Upon further cooling, I4/I6 increases continuously from 1.1 at 20 K to 3.9 at 10 K. Such behavior is not expected for crystallographic changes. The 4-fold term, however, is explained by the interaction of the two epitaxial-intergrown superstructures with their hexagonal anisotropy systems displaced by 30°. This can be phenomenologically verified by extending the analytical solution to describe the anisotropy of 4C pyrrhotite (4). In this approach, the 4-fold term is the result of the different behavior of the anisotropy constants within the triaxial 5C* system and this in turn also leads to its striking increase below 25 K. The dominant presence of a 4-fold symmetry in pyrrhotite can further be shown by means of Monte Carlo simulations. Given the above, the occurrence of a 4-fold symmetry provides evidence of the heterogeneity in the superstructures of monoclinic pyrhotite. (1) Martín-Hernández et al

  1. Absence of ferromagnetism in Mn-doped tetragonal zirconia

    NASA Astrophysics Data System (ADS)

    Srivastava, S. K.; Lejay, P.; Barbara, B.; Boisron, O.; Pailhès, S.; Bouzerar, G.

    2011-08-01

    In a recent letter, it has been predicted within first principle studies that Mn-doped ZrO2 compounds could be good candidates for spintronics application because expected to exhibit ferromagnetism far beyond room temperature. Our purpose is to address this issue experimentally for Mn-doped tetragonal zirconia. We have prepared polycrystalline samples of Y0.15(Zr0.85-yMny)O2 (y = 0, 0.05, 0.10, 0.15, 0.20) by using standard solid state method at equilibrium. The obtained samples were carefully characterized by using x-ray diffraction, scanning electron microscopy, elemental color mapping, x-ray photoemission spectroscopy, and magnetization measurements. From the detailed structural analyses, we have observed that the 5% Mn doped compound crystallized into two symmetries (dominating tetragonal and monoclinic), whereas higher Mn doped compounds are found to be in the tetragonal symmetry only. The spectral splitting of the Mn 3s core-level x-ray photoelectron spectra confirms that Mn ions are in the Mn3+ oxidation state and indicate a local magnetic moment of about 4.5 μB/Mn. Magnetic measurements showed that compounds up to 10% of Mn doping are paramagnetic with antiferromagnetic interactions. However, higher Mn doped compound exhibits local ferrimagnetic ordering. Thus, no ferromagnetism has been observed for all Mn-doped tetragonal ZrO2 samples.

  2. Zirconia solubility in boroaluminosilicate glass

    SciTech Connect

    Raman, S.V.; Bopp, R.; Batcheller, T.A.; Yan, Q.

    1995-12-31

    In the Idaho Chemical Processing Plant (ICPP) waste streams, zirconia is often the waste load limiting species. It modifies the glass network, enhances durability, increases viscosity and induces crystallization. The limits of its dissolution in boroaluminosilicate glass, with magnesia and soda additions were experimentally determined. A ternary compositional surface is evolved to present the isothermal regimes of liquid, liquid + zircon, liquid + forsterite, and liquid phase sintered ceramic. The potential of partitioning the transuranics, transition elements and solutes in these regimes is discussed. The visible Raman spectroscopic results are presented to elucidate the dependence among glass composition, structure and chemical durability.

  3. Fitting accuracy and fracture resistance of crowns using a hybrid zirconia frame made of both porous and dense zirconia.

    PubMed

    Nakamura, Takashi; Sugano, Tsuyoshi; Usami, Hirofumi; Wakabayashi, Kazumichi; Ohnishi, Hiroshi; Sekino, Tohru; Yatani, Hirofumi

    2015-01-01

    The purpose of this study is to evaluate the fitting accuracy and fracture resistance of crowns using a hybrid zirconia frame made of both porous and dense zirconia. Commercial semi-sintered zirconia, sintered dense zirconia and sintered hybrid zirconia were used. Sintered zirconia was milled using the CAD/CAM system, and semi-sintered zirconia was milled and sintered to fabricate molar crown frames. Completed frames were veneered with tooth-colored porcelain. The marginal and internal gaps between frames/crowns and abutments were measured. Each crown specimen was subjected to a fracture test. There were no significant differences in marginal and internal gap among all the frames and crowns. The crown with the hybrid zirconia frame had a 31-35% greater fracture load than that with the commercial or dense zirconia frame (p<0.01). This suggests that the all-ceramic crowns with a hybrid zirconia frame have a high fracture resistance.

  4. Catastrophic failure of a monolithic zirconia prosthesis.

    PubMed

    Chang, Jae-Seung; Ji, Woon; Choi, Chang-Hoon; Kim, Sunjai

    2015-02-01

    Recently, monolithic zirconia restorations have received attention as an alternative to zirconia veneered with feldspathic porcelain to eliminate chipping failures of veneer ceramics. In this clinical report, a patient with mandibular edentulism received 4 dental implants in the interforaminal area, and a screw-retained monolithic zirconia prosthesis was fabricated. The patient also received a maxillary complete removable dental prosthesis over 4 anterior roots. At the 18-month follow-up, all of the zirconia cylinders were seen to be fractured, and the contacting abutment surfaces had lost structural integrity. The damaged abutments were replaced with new abutments, and a new prosthesis was delivered with a computer-assisted design and computer-assisted manufacturing fabricated titanium framework with denture teeth and denture base resins. At the 6-month recall, the patient did not have any problems. Dental zirconia has excellent physical properties; however, care should be taken to prevent excessive stresses on the zirconia cylinders when a screw-retained zirconia restoration is planned as a definitive prosthesis.

  5. Substitutional doping in nanocrystal superlattices

    NASA Astrophysics Data System (ADS)

    Cargnello, Matteo; Johnston-Peck, Aaron C.; Diroll, Benjamin T.; Wong, Eric; Datta, Bianca; Damodhar, Divij; Doan-Nguyen, Vicky V. T.; Herzing, Andrew A.; Kagan, Cherie R.; Murray, Christopher B.

    2015-08-01

    Doping is a process in which atomic impurities are intentionally added to a host material to modify its properties. It has had a revolutionary impact in altering or introducing electronic, magnetic, luminescent, and catalytic properties for several applications, for example in semiconductors. Here we explore and demonstrate the extension of the concept of substitutional atomic doping to nanometre-scale crystal doping, in which one nanocrystal is used to replace another to form doped self-assembled superlattices. Towards this goal, we show that gold nanocrystals act as substitutional dopants in superlattices of cadmium selenide or lead selenide nanocrystals when the size of the gold nanocrystal is very close to that of the host. The gold nanocrystals occupy random positions in the superlattice and their density is readily and widely controllable, analogous to the case of atomic doping, but here through nanocrystal self-assembly. We also show that the electronic properties of the superlattices are highly tunable and strongly affected by the presence and density of the gold nanocrystal dopants. The conductivity of lead selenide films, for example, can be manipulated over at least six orders of magnitude by the addition of gold nanocrystals and is explained by a percolation model. As this process relies on the self-assembly of uniform nanocrystals, it can be generally applied to assemble a wide variety of nanocrystal-doped structures for electronic, optical, magnetic, and catalytic materials.

  6. Nanocrystal superlattices: No need to wait

    NASA Astrophysics Data System (ADS)

    Liu, Kun; Kumacheva, Eugenia

    2017-09-01

    In contrast with protocols reporting self-assembly of nanocrystals after synthesis, Pd nanocrystals rapidly form 3D micrometre-size superlattices during growth. The nanocrystals keep growing after assembly, tuning the size of the lattice.

  7. Oxide Nanocrystal Model Catalysts.

    PubMed

    Huang, Weixin

    2016-03-15

    Model catalysts with uniform and well-defined surface structures have been extensively employed to explore structure-property relationships of powder catalysts. Traditional oxide model catalysts are based on oxide single crystals and single crystal thin films, and the surface chemistry and catalysis are studied under ultrahigh-vacuum conditions. However, the acquired fundamental understandings often suffer from the "materials gap" and "pressure gap" when they are extended to the real world of powder catalysts working at atmospheric or higher pressures. Recent advances in colloidal synthesis have realized controlled synthesis of catalytic oxide nanocrystals with uniform and well-defined morphologies. These oxide nanocrystals consist of a novel type of oxide model catalyst whose surface chemistry and catalysis can be studied under the same conditions as working oxide catalysts. In this Account, the emerging concept of oxide nanocrystal model catalysts is demonstrated using our investigations of surface chemistry and catalysis of uniform and well-defined cuprous oxide nanocrystals and ceria nanocrystals. Cu2O cubes enclosed with the {100} crystal planes, Cu2O octahedra enclosed with the {111} crystal planes, and Cu2O rhombic dodecahedra enclosed with the {110} crystal planes exhibit distinct morphology-dependent surface reactivities and catalytic properties that can be well correlated with the surface compositions and structures of exposed crystal planes. Among these types of Cu2O nanocrystals, the octahedra are most reactive and catalytically active due to the presence of coordination-unsaturated (1-fold-coordinated) Cu on the exposed {111} crystal planes. The crystal-plane-controlled surface restructuring and catalytic activity of Cu2O nanocrystals were observed in CO oxidation with excess oxygen. In the propylene oxidation reaction with O2, 1-fold-coordinated Cu on Cu2O(111), 3-fold-coordinated O on Cu2O(110), and 2-fold-coordinated O on Cu2O(100) were identified

  8. A Raman study of the nanocrystallite size effect on the pressure temperature phase diagram of zirconia grown by zirconium-based alloys oxidation

    NASA Astrophysics Data System (ADS)

    Bouvier, P.; Godlewski, J.; Lucazeau, G.

    2002-02-01

    The pressure-temperature phase diagrams of different zirconia samples prepared by oxidation of Zircaloy-4 and Zr-1%Nb-0.12O alloys were monitored by Raman spectrometry from 0.1 MPa to 12 GPa and from 300 to 640 K. These new diagrams show that the monoclinic-tetragonal equilibrium line is strongly downshifted in temperature compared to literature measurements performed on usual polycrystalline zirconia. In addition, the monoclinic-orthorhombic equilibrium line is slightly shifted to higher pressure (i.e. 6 GPa). The crystallite sizes smaller than 30 nm, are thought to be responsible for these equilibrium line displacements. The tetragonal phase obtained in temperature under high pressure can be quenched at room temperature, if the pressure is maintained, and it is destabilised and transforms completely into monoclinic phase if the pressure is released. These results confirm that coupled effects of stress, temperature and nanosized grain are responsible for the formation of the tetragonal phase near the metal/oxide interface during the oxidation of zirconium-based alloys.

  9. Paired, facing monoclines in the Sanpete-Sevier Valley area, central Utah

    USGS Publications Warehouse

    Witkind, I.J.

    1992-01-01

    Several major monoclines that trend northward through the Sanpete-Sevier Valley area of central Utah are paired and face one another. This pairing of monoclines may have occurred when near-horizontal sedimentary and volcanic strata subsided into voids created as salt was removed from a salt diapir concealed beneath valley fill. Removal was mostly by dissolution or extrusion during Neogene time. The paired monoclines, thus, are viewed as collapse features rather than as normal synclinal folds. -from Author

  10. Hydroxyapatite: Vibrational spectra and monoclinic to hexagonal phase transition

    NASA Astrophysics Data System (ADS)

    Slepko, Alexander; Demkov, Alexander A.

    2015-02-01

    Fundamental studies of biomaterials are necessary to deepen our understanding of their degradation and to develop cure for related illnesses. Biomineral hydroxyapatite Ca10(PO4)6(OH)2 is the main mineral constituent of mammal bone, and its synthetic analogues are used in biomedical applications. The mineral can be found in either hexagonal or monoclinic form. The transformation between these two phases is poorly understood, but knowing its mechanism may be critical to reversing processes in bone related to aging. Using density functional theory, we investigate the mechanisms of the phase transformation and estimate the transition temperature to be 680 K in fair agreement with the experimental temperature of 470 K. We also report the heat capacity of hydroxyapatite and a peculiarity in its phonon dispersion that might allow for non-destructive measurements of the crystal composition with applications in preventive medical screening for bone mineral loss.

  11. Sorting fluorescent nanocrystals with DNA

    SciTech Connect

    Gerion, Daniele; Parak, Wolfgang J.; Williams, Shara C.; Zanchet, Daniela; Micheel, Christine M.; Alivisatos, A. Paul

    2001-12-10

    Semiconductor nanocrystals with narrow and tunable fluorescence are covalently linked to oligonucleotides. These biocompounds retain the properties of both nanocrystals and DNA. Therefore, different sequences of DNA can be coded with nanocrystals and still preserve their ability to hybridize to their complements. We report the case where four different sequences of DNA are linked to four nanocrystal samples having different colors of emission in the range of 530-640 nm. When the DNA-nanocrystal conjugates are mixed together, it is possible to sort each type of nanoparticle using hybridization on a defined micrometer -size surface containing the complementary oligonucleotide. Detection of sorting requires only a single excitation source and an epifluorescence microscope. The possibility of directing fluorescent nanocrystals towards specific biological targets and detecting them, combined with their superior photo-stability compared to organic dyes, opens the way to improved biolabeling experiments, such as gene mapping on a nanometer scale or multicolor microarray analysis.

  12. Tetragonal BiFeO{sub 3} on yttria-stabilized zirconia

    SciTech Connect

    Liu, Heng-Jui; Du, Yu-Hao; Gao, Peng; Ikuhara, Yuichi; Huang, Yen-Chin; Chen, Yi-Chun; Chen, Hsiao-Wen; Liu, Hsiang-Lin; He, Qing; Chu, Ying-Hao

    2015-11-01

    High structural susceptibility of multiferroic BiFeO{sub 3} (BFO) makes it a potential replacement of current Pb-based piezoelectrics. In this study, a tetragonal phase is identified based on a combination of x-ray diffraction, scanning transmission electronic microscopy, x-ray absorption spectroscopy, and Raman spectroscopy when BFO is grown on yttria-stabilized zirconia (YSZ) substrates. To distinguish the discrepancy between this tetragonal phase and common cases of monoclinic BFO, piezoelectric force microscopy images and optical property are also performed. It shows a lower electrostatic energy of ferroelectric domains and a large reduction of band gap for BFO grown on YSZ substrate comparing to the well-known one grown on LaAlO{sub 3} substrate. Our findings in this work can provide more insights to understand the structural diversity of multiferroic BFO system for further applications.

  13. Phase Stability and Transformations in Vanadium Oxide Nanocrystals

    NASA Astrophysics Data System (ADS)

    Bergerud, Amy Jo

    Vanadium oxides are both fascinating and complex, due in part to the many compounds and phases that can be stabilized as well as the phase transformations which occur between them. The metal to insulator transitions (MITs) that take place in vanadium oxides are particularly interesting for both fundamental and applied study as they can be induced by a variety of stimuli ( i.e., temperature, pressure, doping) and utilized in many applications (i.e., smart windows, sensors, phase change memory). Nanocrystals also tend to demonstrate interesting phase behavior, due in part to the enhanced influence of surface energy on material thermodynamics. Vanadium oxide nanocrystals are thus expected to demonstrate very interesting properties in regard to phase stability and phase transformations, although synthesizing vanadium oxides in nanocrystal form remains a challenge. Vanadium sesquioxide (V2O3) is an example of a material that undergoes a MIT. For decades, the low temperature monoclinic phase and high temperature corundum phase were the only known crystal structures of V2O3. However, in 2011, a new metastable polymorph of V2O3 was reported with a cubic, bixbyite crystal structure. In Chapter 2, a colloidal route to bixbyite V2O 3 nanocrystals is presented. In addition to being one of the first reported observations of the bixbyite phase in V2O3, it is also one of the first successful colloidal syntheses of any of the vanadium oxides. The nanocrystals possess a flower-like morphology, the size and shape of which are dependent on synthesis time and temperature, respectively. An aminolysis reaction mechanism is determined from Fourier transform infrared spectroscopy data and the bixbyite crystal structure is confirmed by Rietveld refinement of X-ray diffraction (XRD) data. Phase stability is assessed in both air and inert environments, confirming the metastable nature of the material. Upon heating in an inert atmosphere above 700°C, the nanocrystals irreversibly transform

  14. On the interfacial fracture resistance of resin-bonded zirconia and glass-infiltrated graded zirconia

    PubMed Central

    Chai, Herzl; Kaizer, Marina; Chughtai, Asima; Tong, Hui; Tanaka, Carina; Zhang, Yu

    2015-01-01

    Objective A major limiting factor for the widespread use of zirconia in prosthetic dentistry is its poor resin-cement bonding capabilities. We show that this deficiency can be overcome by infiltrating the zirconia cementation surface with glass. Current methods for assessing the fracture resistance of resin-ceramic bonds are marred by uneven stress distribution at the interface, which may result in erroneous interfacial fracture resistance values. We have applied a wedge-loaded double-cantilever-beam testing approach to accurately measure the interfacial fracture resistance of adhesively bonded zirconia-based restorative materials. Methods The interfacial fracture energy GC was determined for adhesively bonded zirconia, graded zirconia and feldspathic ceramic bars. The bonding surfaces were subjected to sandblasting or acid etching treatments. Baseline GC was measured for bonded specimens subjected to 7 days hydration at 37 °C. Long-term GC was determined for specimens exposed to 20,000 thermal cycles between 5 and 55 °C followed by 2-month aging at 37 °C in water. The test data were interpreted with the aid of a 2D finite element fracture analysis. Results The baseline and long-term GC for graded zirconia was 2–3 and 8 times that for zirconia, respectively. More significantly, both the baseline and long-term GC of graded zirconia were similar to those for feldspathic ceramic. Significance The interfacial fracture energy of feldspathic ceramic and graded zirconia was controlled by the fracture energy of the resin cement while that of zirconia by the interface. GC for the graded zirconia was as large as for feldspathic ceramic, making it an attractive material for use in dentistry. PMID:26365987

  15. Mesoporous silica templated zirconia nanoparticles

    NASA Astrophysics Data System (ADS)

    Ballem, Mohamed A.; Córdoba, José M.; Odén, Magnus

    2011-07-01

    Nanoparticles of zirconium oxide (ZrO2) were synthesized by infiltration of a zirconia precursor (ZrOCl2·8H2O) into a SBA-15 mesoporous silica mold using a wet-impregnation technique. X-ray diffractometry and high-resolution transmission electron microscopy show formation of stable ZrO2 nanoparticles inside the silica pores after a thermal treatment at 550 °C. Subsequent leaching out of the silica template by NaOH resulted in well-dispersed ZrO2 nanoparticles with an average diameter of 4 nm. The formed single crystal nanoparticles are faceted with 110 surfaces termination suggesting it to be the preferred growth orientation. A growth model of these nanoparticles is also suggested.

  16. Chemical design of nanocrystal solids.

    PubMed

    Kovalenko, Maksym V

    2013-01-01

    This account highlights our recent and present activities dedicated to chemical synthesis and applications of inorganic nanostructures. In particular, we discuss the potential of metal amides as precursors in the synthesis of metallic and semiconductor nanocrystals. We show the importance of surface chemical functionalization for the emergence of collective electronic properties in nanocrystal solids. We also demonstrate a new kind of long-range ordered, crystalline matter comprising colloidal nanocrystals and atomically defined inorganic clusters. Finally, we point the reader's attention to the high potential benefits of size- and shape-tunability of nanocrystals for achieving higher performance of rechargeable Li-ion battery electrodes.

  17. Effects of Acid Treatment on Dental Zirconia: An In Vitro Study

    PubMed Central

    Xie, Haifeng; Shen, Shuping; Qian, Mengke; Zhang, Feimin; Chen, Chen; Tay, Franklin R.

    2015-01-01

    The aim of this study was to evaluate the effects of hydrofluoric (HF) acid, acetic acid, and citric acid treatments on the physical properties and structure of yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) at ambient temperature. In total, 110 bar-shaped zirconia specimens were randomly assigned to 11 groups. The specimens in the control group (C) received no surface treatment, while those in the Cage group were hydrothermally aged at 134°C and 0.2 MPa for 20 h. Ten specimens each were immersed at ambient temperature in 5% and 40% HF acid for 2 h (40HF0), 1 day (5HF1, 40HF1), and 5 days (5HF5, 40HF5), while 10 each were immersed at ambient temperature in 10% acetic acid and 20% citric acid for 7 (AC7, CI7) and 14 days (AC14, CI14). X-ray diffraction (XRD) was used to quantitatively estimate the monoclinic phase. Furthermore, flexural strength, surface roughness, and surface Vickers hardness were measured after treatment. Scanning electron microscopy (SEM) was used to characterize the surface morphology. The Cage group specimens exhibited an increased monoclinic phase and flexural strength. Furthermore, 40% HF acid immersion decreased the flexural strength and surface hardness and deteriorated the surface finish, while 5% HF acid immersion only decreased the surface hardness. All the HF acid-immersed specimens showed an etched surface texture on SEM observations, while the other groups did not. These findings suggest that the treatment of Y-TZP with 40% HF acid at ambient temperature causes potential damage, while treatment with 5% HF acid, acetic acid, and citric acid is safe. PMID:26301413

  18. Ferroelasticity, mechanical behavior, and phase stability of t prime zirconia ceramics

    SciTech Connect

    Jue Janfong.

    1991-01-01

    Large-grained (100-200 {mu}m), yttria doped, polycrystalline t{prime}-zirconia ceramics were fabricated by heating presintered samples at 2100C. Two point four and 3 mol% yttria-doped single crystals obtained from a commercial source were oriented by the Laue back-reflection method and cut along {l angle}100{r angle}, {l angle}110{r angle}, and {l angle}111{r angle} directions. They were also heat treated at 2100C. Ferroelastic domain structure was predicted by group theory and examined by transmission optical microscopy under polarized light and transmission electron microscopy. Orientations of domain boundaries were in accordance with predictions of group theory. X-ray diffraction showed that no monoclinic phase was detected on as-polished, ground, fracture surfaces, and on surfaces under tensile stresses as high as 400 MPa. Relative changes in the tetragonal peak intensities occurred and were attributed to ferroelastic domain switching. Higher toughness of 3 mol% Y{sub 2}O{sub 3} doped t{prime} samples (7.7MPam{sup 1/2}) compared to that of zirconia in the cubic phase (8 mol% Y{sub 2}O{sub 3}, 2.4MPam{sup 1/2}) was attributed in part to ferroelastic domain switching. Polished surfaces of polycrystalline t{prime}-materials showed no mono-clinic phase even after 1,000 hours at 275C in air, whereas conventional Y-TZP ceramics of a grain size larger than 0.5 {mu}m showed substantial transformation.

  19. Nanosilica coating for bonding improvements to zirconia

    PubMed Central

    Chen, Chen; Chen, Gang; Xie, Haifeng; Dai, Wenyong; Zhang, Feimin

    2013-01-01

    Resin bonding to zirconia cannot be established from standard methods that are currently utilized in conventional silica-based dental ceramics. The solution–gelatin (sol–gel) process is a well developed silica-coating technique used to modify the surface of nonsilica-based ceramics. Here, we use this technique to improve resin bonding to zirconia, which we compared to zirconia surfaces treated with alumina sandblasting and tribochemical silica coating. We used the shear bond strength test to examine the effect of the various coatings on the short-term resin bonding of zirconia. Furthermore, we employed field emission scanning electron microscopy, energy-dispersive X-ray spectroscopy, atomic force microscopy, and Fourier transform infrared spectroscopy to characterize the zirconia surfaces. Water–mist spraying was used to evaluate the durability of the coatings. To evaluate the biological safety of the experimental sol–gel silica coating, we conducted an in vitro Salmonella typhimurium reverse mutation assay (Ames mutagenicity test), cytotoxicity tests, and in vivo oral mucous membrane irritation tests. When compared to the conventional tribochemical silica coating, the experimental sol–gel silica coating provided the same shear bond strength, higher silicon contents, and better durability. Moreover, we observed no apparent mutagenicity, cytotoxicity, or irritation in this study. Therefore, the sol–gel technique represents a promising method for producing silica coatings on zirconia. PMID:24179333

  20. The osseointegration of zirconia dental implants.

    PubMed

    Assal, Patrick A

    2013-01-01

    Zirconia is currently extensively used in medicine, especially in orthopedic surgery for various joint replacement appliances. Its outstanding mechanical and chemical properties have made it the "material of choice" for various types of prostheses. Its color in particular makes it a favored material to manufacture dental implants. A literature search through Medline enables one to see zirconia's potential but also to point out and identify its weaknesses. The search shows that zirconia is a biocompatible, osteoconductive material that has the ability to osseointegrate. Its strength of bonding to bone depends on the surface structure of the implant. Although interesting, the studies do not allow for the recommendation of the use of zirconia implants in daily practice. The lack of studies examining the chemical and structural composition of zirconia implants does not allow for a "gold standard" to be established in the implant manufacturing process. Randomized clinical trials (RCT) are urgently needed on surface treatments of zirconia implants intended to achieve the best possible osseointegration.

  1. Zirconia in dental implantology: A review

    PubMed Central

    Apratim, Abhishek; Eachempati, Prashanti; Krishnappa Salian, Kiran Kumar; Singh, Vijendra; Chhabra, Saurabh; Shah, Sanket

    2015-01-01

    Background: Titanium has been the most popular material of choice for dental implantology over the past few decades. Its properties have been found to be most suitable for the success of implant treatment. But recently, zirconia is slowly emerging as one of the materials which might replace the gold standard of dental implant, i.e., titanium. Materials and Methods: Literature was searched to retrieve information about zirconia dental implant and studies were critically analyzed. PubMed database was searched for information about zirconia dental implant regarding mechanical properties, osseointegration, surface roughness, biocompatibility, and soft tissue health around it. The literature search was limited to English language articles published from 1975 to 2015. Results: A total of 45 papers met the inclusion criteria for this review, among the relevant search in the database. Conclusion: Literature search showed that some of the properties of zirconia seem to be suitable for making it an ideal dental implant, such as biocompatibility, osseointegration, favourable soft tissue response and aesthetics due to light transmission and its color. At the same time, some studies also point out its drawbacks. It was also found that most of the studies on zirconia dental implants are short-term studies and there is a need for more long-term clinical trials to prove that zirconia is worth enough to replace titanium as a biomaterial in dental implantology. PMID:26236672

  2. Ultrasound assisted synthesis of monoclinic structured spindle BiVO4 particles with hollow structure and its photocatalytic property.

    PubMed

    Liu, Wei; Cao, Lixin; Su, Ge; Liu, Haisong; Wang, Xiangfei; Zhang, Lan

    2010-04-01

    Bismuth vanadate (BiVO(4)) spindle particles with monoclinic scheelite structure have been successfully synthesized via a facile sonochemical method. The as-prepared BiVO(4) photocatalyst exhibited a hollow interior structure constructed from the self-assembly of cone shape primary nanocrystals. A possible oriented attachment growth mechanism has been proposed based on the results of time-dependent experiments, which indicates the formation of spindle particles is mainly attributed to the phase transformation procedure induced by ultrasound irradiation. A series of morphology evolutions of BiVO(4) from compact microspheres, to hollow microspheres, and then to spindle particles have been arrested in the process of sonochemical treatment. Optical absorption experiments revealed the BiVO(4) spindle had strong absorption in the visible light region. A much higher photocatalytic activity of these spindle particles was found in comparison with the SSR-BiVO(4) material for degradation of rhodamine-B under visible light irradiation, which may be ascribed to its special single-crystalline nanostructure.

  3. Nanocrystal waveguide (NOW) laser

    DOEpatents

    Simpson, John T.; Simpson, Marcus L.; Withrow, Stephen P.; White, Clark W.; Jaiswal, Supriya L.

    2005-02-08

    A solid state laser includes an optical waveguide and a laser cavity including at least one subwavelength mirror disposed in or on the optical waveguide. A plurality of photoluminescent nanocrystals are disposed in the laser cavity. The reflective subwavelength mirror can be a pair of subwavelength resonant gratings (SWG), a pair of photonic crystal structures (PC), or a distributed feedback structure. In the case of a pair of mirrors, a PC which is substantially transmissive at an operating wavelength of the laser can be disposed in the laser cavity between the subwavelength mirrors to improve the mode structure, coherence and overall efficiency of the laser. A method for forming a solid state laser includes the steps of providing an optical waveguide, creating a laser cavity in the optical waveguide by disposing at least one subwavelength mirror on or in the waveguide, and positioning a plurality of photoluminescent nanocrystals in the laser cavity.

  4. Synthesis and Phase Stability of Scandia, Gadolinia, and Ytterbia Co-doped Zirconia for Thermal Barrier Coating Application

    NASA Astrophysics Data System (ADS)

    Li, Qi-Lian; Cui, Xiang-Zhong; Li, Shu-Qing; Yang, Wei-Hua; Wang, Chun; Cao, Qian

    2015-01-01

    Scandia, gadolinia, and ytterbia co-doped zirconia (SGYZ) ceramic powder was synthesized by chemical co-precipitation and calcination processes for application in thermal barrier coatings to promote the durability of gas turbines. The ceramic powder was agglomerated and sintered at 1150 °C for 2 h, and the powder exhibited good flowability and apparent density to be suitable for plasma spraying process. The microstructure, morphology and phase stability of the powder and plasma-sprayed SGYZ coatings were analyzed by means of scanning electron microscope and x-ray diffraction. Thermal conductivity of plasma-sprayed SGYZ coatings was measured. The results indicated that the SGYZ ceramic powder and the coating exhibit excellent stability to retain single non-transformable tetragonal zirconia even after high temperature (1400 °C) exposure for 500 h and do not undergo a tetragonal-to-monoclinic phase transition upon cooling. Furthermore, the plasma-sprayed SGYZ coating also exhibits lower thermal conductivity than yttria stabilized zirconia coating currently used in gas turbine engine industry. SGYZ can be explored as a candidate material of ultra-high temperature thermal barrier coating for advanced gas turbine engines.

  5. X-ray, Raman and FTIRS studies of the microstructural evolution of zirconia particles caused by the thermal treatment

    NASA Astrophysics Data System (ADS)

    Zyuzin, Dmitry A.; Cherepanova, Svetlana V.; Moroz, Ella M.; Burgina, Elena B.; Sadykov, Vladislav A.; Kostrovskii, Victor G.; Matyshak, Valerii A.

    2006-10-01

    Genesis of the structure of zirconia particles prepared by precipitation of amorphous hydrated zirconia by ammonia from the ZrO(NO 3) 2 solution followed by a mild hydrothermal treatment (HTT) of precipitate, washing and calcination under air up to 1000 °C has been studied by X-ray diffraction (XRD), Raman and FTIRS. As revealed by FTIRS of lattice modes, the local structure of amorphous zirconia subjected to HTT is close to that in m-ZrO 2. This helps to obtain nearly single-phase monoclinic nanozirconia (particle size 5-15 nm) already after a mild calcination at 500 °C. Stability of this phase with nanoparticles sizes below the critical value determined by thermodynamic constraints is due to its excessive hydroxylation demonstrated by FTIRS. Dehydroxilation and sintering of these nanoparticles at higher (600-650 °C) temperatures of calcination leads to reappearance of the (111) "cubic" reflection in XRD patterns. Modeling of XRD patterns revealed that this phenomenon could be explained by polysynthetic (001) twinning earlier observed by HRTEM.

  6. What causes the Besnus transition in monoclinic pyrrhotite?

    NASA Astrophysics Data System (ADS)

    Gehring, A. U.; Koulialias, D.; Löffler, J. F.; Charilaou, M.

    2016-12-01

    Monoclinic 4C pyrrhotite (ideal formula Fe7S8) is a major magnetic remanence carrier in the Earth's crust and in extraterrestrial materials. Because of its low-temperature magnetic transition around 30 K also known as Besnus transition, this mineral phase is easily detectable in rock samples. An intrinsic origin of the Besnus transition due to a crystallographic change similar to that in the Verwey transition has generally been postulated (1). Although the physical properties of pyrrhotite have intensively been studied, the physics behind the pronounced change in magnetization at the low-temperature transition is still unresolved. To address this question we performed structural and magnetic analyses on a natural pyrrhotite single crystal (Fe6.6S8) from Auerbach, Germany (2,3). Chemical analysis, X-ray diffractometry and transmission electron microscopy show that this pyrrhotite consists of an intergrowth of 4C and an incommensurate 5C* superstructure that are polymorphs with different vacancy distributions. The occurrence of two superstructures is magnetically confirmed by symmetric inflection points in the hysteresis measurements above the transition at about 30 K. The disappearance of the inflection points and the associated change of the hysteresis parameters indicate that the two superstructures become embedded to form a unitary magnetic anisotropy system at the transition. This embedding of the 5C* into the 4C pyrrhotite at about 30 K is directly visible by the occurrence of additional 4-fold and 12-fold symmetry terms in magnetic anisotropy and anisotropic magnetic resistivity mesarurements, respectively. From this it follows that the Besnus transition in monoclinic pyrrhotite is an extrinsic magnetic phenomenon with respect to the 4C superstructure, i.e., a coupling effect, and therefore the physics behind it is in fact different from that of the well-known Verwey transition. (1) Rochette et al., The IRM Quarterly, 21, 1 (2011); (2) Charilaou et al., J

  7. Electronic and magnetic properties of iron doped zirconia: Theory and experiment

    SciTech Connect

    Debernardi, A. Sangalli, D.; Lamperti, A.; Cianci, E.; Lupo, P.; Casoli, F.; Albertini, F.; Nasi, L.

    2014-05-07

    We systematically investigated, both theoretically and experimentally, Zr{sub 1−x}Fe{sub x}O{sub 2−y} ranging from diluted (x ≈ 0.05) up to large (x ≈ 0.25) Fe concentration. By atomic layer deposition, we grew thin films of high-κ zirconia in cubic phase with Fe uniformly distributed in the film, as proven by time of flight secondary ion mass spectrometry and transmission electron microscopy measurements. Iron is in Fe{sup 3+} oxidation state suggesting the formation of oxygen vacancies with y concentration close to x/2. By ab-initio simulations, we studied the phase diagram relating the stability of monoclinic vs. tetragonal phase as a function of Fe doping and film thickness: the critical thickness at which the pure zirconia is stabilized in the tetragonal phase is estimated ranging from 2 to 6 nm according to film morphology. Preliminary results by X-ray magnetic circular dichroism and alternating gradient force magnetometry are discussed in comparison to ab initio data enlightening the role of oxygen vacancies in the magnetic properties of the system.

  8. Electronic and magnetic properties of iron doped zirconia: Theory and experiment

    NASA Astrophysics Data System (ADS)

    Debernardi, A.; Sangalli, D.; Lamperti, A.; Cianci, E.; Lupo, P.; Casoli, F.; Albertini, F.; Nasi, L.; Ciprian, R.; Torelli, P.

    2014-05-01

    We systematically investigated, both theoretically and experimentally, Zr1-xFexO2-y ranging from diluted (x ≈ 0.05) up to large (x ≈ 0.25) Fe concentration. By atomic layer deposition, we grew thin films of high-κ zirconia in cubic phase with Fe uniformly distributed in the film, as proven by time of flight secondary ion mass spectrometry and transmission electron microscopy measurements. Iron is in Fe3+ oxidation state suggesting the formation of oxygen vacancies with y concentration close to x/2. By ab-initio simulations, we studied the phase diagram relating the stability of monoclinic vs. tetragonal phase as a function of Fe doping and film thickness: the critical thickness at which the pure zirconia is stabilized in the tetragonal phase is estimated ranging from 2 to 6 nm according to film morphology. Preliminary results by X-ray magnetic circular dichroism and alternating gradient force magnetometry are discussed in comparison to ab initio data enlightening the role of oxygen vacancies in the magnetic properties of the system.

  9. Encapsulated monoclinic sulfur for stable cycling of li-s rechargeable batteries.

    PubMed

    Moon, San; Jung, Young Hwa; Jung, Wook Ki; Jung, Dae Soo; Choi, Jang Wook; Kim, Do Kyung

    2013-12-03

    Monoclinic S8 , an uncommon allotrope of sulfur at room temperature, can be formed when common orthorhombic S8 is heat-treated under enclosed environments in nanometer dimensions. Monoclinic S8 prevents the formation of soluble polysulfides during battery operation, resulting in unprecedented cycling performance over 1000 cycles under the highest sulfur content to date.

  10. Ceramic fiber-reinforced monoclinic celsian phase glass-ceramic matrix composite material

    NASA Technical Reports Server (NTRS)

    Bansal, Narottam P. (Inventor); Dicarlo, James A. (Inventor)

    1994-01-01

    A hyridopolysilazane-derived ceramic fiber reinforced monoclinic celsian phase barium aluminum silicate glass-ceramic matrix composite material is prepared by ball-milling an aqueous slurry of BAS glass powder and fine monoclinic celsian seeds. The fibers improve the mechanical strength and fracture toughness and with the matrix provide superior dielectric properties.

  11. Effect of Stress-Induced Phase Transformation on the Fracture Toughness of Fe3Al Intermetallic Reinforced with Yttria-Partially Stabilized Zirconia Particles

    NASA Astrophysics Data System (ADS)

    Amiri Talischi, Lima; Samadi, Ahad

    2017-10-01

    In this study, fracture toughness and microhardness of Fe3Al intermetallic reinforced with yttria-partially stabilized zirconia (Y-PSZ) particles were investigated. Fe3Al/Y-PSZ composites containing up to 20 wt pct of Y-PSZ were fabricated by hot pressing of powder mixtures. It is found that the microhardness and fracture toughness of Fe3Al intermetallic increase by adding Y-PSZ particles. The maximal levels of fracture toughness and microhardness correspond to Fe3Al-10 wt pct Y-PSZ composite with the fracture toughness of 23.1 MPa√m and the microhardness of 645 HV. The improvement in fracture toughness could be related to the stress-induced structural transformation of zirconia particles from tetragonal to monoclinic which causes crack deflection and prevents crack propagation.

  12. Microstructure and mechanical properties of bulk and plasma-sprayed y2O3-partially stabilized zirconia

    NASA Technical Reports Server (NTRS)

    Valentine, P. G.; Maier, R. D.

    1980-01-01

    Bulk 8.0 weight percent yttria partially stabilied zirconia (PSZ) was studied by light microscopy, transmission electron microscopy, X-ray analysis, microhardness testing, and fracture toughness testing. The as received PSZ contained spheroidal and grain boundary precipitates up to 4 micrometers in size. Spheroids up to 1.26 micrometers were metastable tetragonal; large spheroids were monoclinic. Grinding the PSZ into powder did not cause a significant amount of tetragonal to transform to monoclinic. This indicates that transformation toughness is not a significant mechanism in PSZ. Aging the PSZ at 1500 C caused the fine tetragonal precipitates to grow from 0.06 to 0.12 micrometers, in 250 minutes. A peak hardness of 1400 kg/sq mm was attained after 50 minutes. Solution annealing and quenching the as received PSZ eliminated the large precipitates, but fine tetragonal precipitates reformed on quenching. Aging at 1500 C caused the fine 0.02 micrometers tetragonal precipitates to grow into plates about 0.10 by 0.50 micrometers. A peak hardness of 1517 kg/sq mm was obtained after 250 minutes. On further aging, monoclinic percipitates formed along grain boundaries. The fracture toughness of the aged and unaged solution annealed and quenched PSZ was found to be between 2 and 3 MN /square root of m cubed. This range of fracture toughness is consistent with PSZ's that do not undergo transformation toughening.

  13. Effects of specimen size and yttria concentration on mechanical properties of single crystalline yttria-stabilized tetragonal zirconia nanopillars

    NASA Astrophysics Data System (ADS)

    Zhang, Ning; Asle Zaeem, Mohsen

    2017-07-01

    The nanoscale plastic deformation of yttria-stabilized tetragonal zirconia (YSTZ) is highly dependent on the crystallographic orientations, i.e., dislocation is induced when the loading direction is 45° tilted to {111} and {101} slip planes, while tetragonal to monoclinic phase transformation dominates the plastic deformation when loading direction is perpendicular to the slip planes. This study investigates the effects of specimen size and yttria concentration on the mechanical response of single crystalline YSTZ nanopillars. Through uniaxial compression test, the smaller-is-stronger phenomenon is revealed in nanopillars deformed through a dislocation motion mechanism. Serrated stacking faults are observed in the smallest nanopillar, while neat primary slip plane forms in the largest nanopillar. In contrast, the larger-is-stronger relation is observed in nanopillars in which deformation is mediated by tetragonal to monoclinic phase transformation. It is noted that the ratio of transformed monoclinic phase to the remaining tetragonal phase is the highest in the smallest nanopillar. The strength of nanopillars is identified to decrease by increasing the amount of yttria due to the creation of more oxygen vacancies that act as weak points to facilitate dislocation motion and accelerate phase transformation.

  14. Patterning nanocrystals using DNA

    SciTech Connect

    Williams, Shara Carol

    2003-01-01

    One of the goals of nanotechnology is to enable programmed self-assembly of patterns made of various materials with nanometer-sized control. This dissertation describes the results of experiments templating arrangements of gold and semiconductor nanocrystals using 2'-deoxyribonucleic acid (DNA). Previously, simple DNA-templated linear arrangements of two and three nanocrystals structures have been made.[1] Here, we have sought to assemble larger and more complex nanostructures. Gold-DNA conjugates with 50 to 100 bases self-assembled into planned arrangements using strands of DNA containing complementary base sequences. We used two methods to increase the complexity of the arrangements: using branched synthetic doublers within the DNA covalent backbone to create discrete nanocrystal groupings, and incorporating the nanocrystals into a previously developed DNA lattice structure [2][3] that self-assembles from tiles made of DNA double-crossover molecules to create ordered nanoparticle arrays. In the first project, the introduction of a covalently-branched synthetic doubler reagent into the backbone of DNA strands created a branched DNA ''trimer.'' This DNA trimer templated various structures that contained groupings of three and four gold nanoparticles, giving promising, but inconclusive transmission electron microscopy (TEM) results. Due to the presence of a variety of possible structures in the reaction mixtures, and due to the difficulty of isolating the desired structures, the TEM and gel electrophoresis results for larger structures having four particles, and for structures containing both 5 and 10 nm gold nanoparticles were inconclusive. Better results may come from using optical detection methods, or from improved sample preparation. In the second project, we worked toward making two-dimensional ordered arrays of nanocrystals. We replicated and improved upon previous results for making DNA lattices, increasing the size of the lattices to a length greater than

  15. Preparation and characterization of TiO2 and Si-doped octacalcium phosphate composite coatings on zirconia ceramics (Y-TZP) for dental implant applications

    NASA Astrophysics Data System (ADS)

    Bao, Lei; Liu, Jingxiao; Shi, Fei; Jiang, Yanyan; Liu, Guishan

    2014-01-01

    In order to prevent the low temperature degradation and improve the bioactivity of zirconia ceramic implants, TiO2 and Si-doped octacalcium phosphate composite coating was prepared on zirconia substrate. The preventive effect on low temperature degradation and surface morphology of the TiO2 layer were studied. Meanwhile, the structure and property changes of the bioactive coating after doping Si were discussed. The results indicate that the dense TiO2 layer, in spite of some microcracks, inhibited the direct contact of the water vapor with the sample's surface and thus prevented the low temperature degradation of zirconia substrates. The acceleration aging test shows that the ratio of the monoclinic phase transition decreased from 10% for the original zirconia substrate to 4% for the TiO2-coated substrate. As to the Si-doped octacalcium phosphate coating prepared by biomimetic method, the main phase composition of the coating was octacalcium phosphate. The morphology of the coating was lamellar-like, and the surface was uniform and continuous with no cracks being observed. It is suggested that Si was added into the coating both through substituting for PO43- and doping as NaSiO3.

  16. Comparative investigation on nanocrystal structure and luminescence properties of gadolinium molybdates codoped with Er(3+)/Yb (3+).

    PubMed

    Pan, Y X; Zhang, Q Y; Jiang, Z H

    2007-07-01

    This paper reports on the comparative investigation of nanocrystal structure and luminescence properties of Er(3+)/Yb(3+)-codoped gadolinium molybdate nanocrystals Gd(2)(MoO(4))(3) and Gd(2)MoO(6) synthesized by the Pechini method with citric acid and ethylene glycol. Their crystallization, structure transformation, and morphologies have been investigated by X-ray diffraction, thermogravimetric/differential scanning calorimetry, and transmission electron microscopy. It is noticed that Er(3+)/Yb(3+)-codoped monoclinic Gd(2)(MoO(4))(3) nanocrystals have shown an intense upconversion through a sintering of the organic complex precursor at 600 degrees C. Furthermore, it transforms to orthorhombic Gd(2)(MoO(4))(3) when the precursor is sintered at 900 degrees C. In counterpart of monoclinic Gd(2)MoO(6), however, the monoclinic structure remains unchanged when the precursor is sintered at a temperature ranging from 600 degrees C to 900 degrees C. Intense visible emissions of Er(3+) attributed to the transitions of (2)H(11/2), (4)S(3/2)-(4)I(15/2) at 520 and 550 nm, and (4)F(9/2)-(4)I(15/2) at 650 nm have been observed upon an excitation with a UV source and a 980 nm laser diode, and the involved mechanisms have been explained. It is quite interesting to observe obvious differences both in the excitation and the upconversion emission spectra of Er(3+)/Yb(3+)-codoped Gd(2)(MoO(4))(3) respectively with monoclinic and orthorhombic structure. The quadratic dependence of fluorescence on excitation laser power has confirmed that two-photons contribute to upconversion of the green-red emissions.

  17. Photoemission studies of semiconductor nanocrystals

    SciTech Connect

    Hamad, K. S.; Roth, R.; Alivisatos, A. P.

    1997-04-01

    Semiconductor nanocrystals have been the focus of much attention in the last ten years due predominantly to their size dependent optical properties. Namely, the band gap of nanocrystals exhibits a shift to higher energy with decreasing size due to quantum confinement effects. Research in this field has employed primarily optical techniques to study nanocrystals, and in this respect this system has been investigated extensively. In addition, one is able to synthesize monodisperse, crystalline particles of CdS, CdSe, Si, InP, InAs, as well as CdS/HgS/CdS and CdSe/CdS composites. However, optical spectroscopies have proven ambiguous in determining the degree to which electronic excitations are interior or surface admixtures or giving a complete picture of the density of states. Photoemission is a useful technique for understanding the electronic structure of nanocrystals and the effects of quantum confinement, chemical environments of the nanocrystals, and surface coverages. Of particular interest to the authors is the surface composition and structure of these particles, for they have found that much of the behavior of nanocrystals is governed by their surface. Previously, the authors had performed x-ray photoelectron spectroscopy (XPS) on CdSe nanocrystals. XPS has proven to be a powerful tool in that it allows one to determine the composition of the nanocrystal surface.

  18. Nanocrystal/sol-gel nanocomposites

    DOEpatents

    Petruska, Melissa A [Los Alamos, NM; Klimov, Victor L [Los Alamos, NM

    2012-06-12

    The present invention is directed to solid composites including colloidal nanocrystals within a sol-gel host or matrix and to processes of forming such solid composites. The present invention is further directed to alcohol soluble colloidal nanocrystals useful in formation of sol-gel based solid composites

  19. Nanocrystal/sol-gel nanocomposites

    DOEpatents

    Petruska, Melissa A [Los Alamos, NM; Klimov, Victor L [Los Alamos, NM

    2007-06-05

    The present invention is directed to solid composites including colloidal nanocrystals within a sol-gel host or matrix and to processes of forming such solid composites. The present invention is further directed to alcohol soluble colloidal nanocrystals useful in formation of sol-gel based solid composites.

  20. Electronic spectra of semiconductor nanocrystals

    SciTech Connect

    Alivisatos, A.P.

    1993-12-31

    Semiconductor nanocrystals smaller than the bulk exciton show substantial quantum confinement effects. Recent experiments including Stark effect, resonance Raman, valence band photoemission, and near edge X-ray adsorption will be used to put together a picture of the nanocrystal electronic states.

  1. Method of synthesizing pyrite nanocrystals

    DOEpatents

    Wadia, Cyrus; Wu, Yue

    2013-04-23

    A method of synthesizing pyrite nanocrystals is disclosed which in one embodiment includes forming a solution of iron (III) diethyl dithiophosphate and tetra-alkyl-ammonium halide in water. The solution is heated under pressure. Pyrite nanocrystal particles are then recovered from the solution.

  2. Octahedral tilting, monoclinic phase and the phase diagram of PZT

    NASA Astrophysics Data System (ADS)

    Cordero, F.; Trequattrini, F.; Craciun, F.; Galassi, C.

    2011-10-01

    Anelastic and dielectric spectroscopy measurements on PbZr1-xTixO3 (PZT) close to the morphotropic (MPB) and antiferroelectric boundaries provide new insight into some controversial aspects of its phase diagram. No evidence is found of a border separating monoclinic (M) from rhombohedral (R) phases, in agreement with recent structural studies supporting a coexistence of the two phases over a broad composition range x < 0.5, with the fraction of M increasing toward the MPB. It is also discussed why the observed maximum of elastic compliance appears to be due to a rotational instability of the polarization linearly coupled to shear strain. Therefore it cannot be explained by extrinsic softening from finely twinned R phase alone, but indicates the presence also of M phase, not necessarily homogeneous. A new diffuse transition is found within the ferroelectric phase near x ˜ 0.1, at a temperature TIT higher than the well established boundary TT to the phase with tilted octahedra. It is proposed that around TIT the octahedra start rotating in a disordered manner and finally become ordered below TT. In this interpretation, the onset temperature for octahedral tilting monotonically increases up to the antiferroelectric transition of PbZrO3, and the depression of TT(x) below x = 0.18 would be a consequence of the partial relief of the mismatch between the average cation radii with the initial stage of tilting below TIT.

  3. Mechanical Properties of Nanocrystal Supercrystals

    SciTech Connect

    Tam, Enrico; Podsiadlo, Paul; Shevchenko, Elena; Ogletree, D. Frank; Delplancke-Ogletree, Marie-Paule; Ashby, Paul D.

    2009-12-30

    Colloidal nanocrystals attract significant interest due to their potential applications in electronic, magnetic, and optical devices. Nanocrystal supercrystals (NCSCs) are particularly appealing for their well ordered structure and homogeneity. The interactions between organic ligands that passivate the inorganic nanocrystal cores critically influence their self-organization into supercrystals, By investigating the mechanical properties of supercrystals, we can directly characterize the particle-particle interactions in a well-defined geometry, and gain insight into both the self-assembly process and the potential applications of nanocrystal supercrystals. Here we report nanoindentation studies of well ordered lead-sulfide (Pbs) nanocrystal supercrystals. Their modulus and hardness were found to be similar to soft polymers at 1.7 GPa and 70 MPa respectively and the fractures toughness was 39 KPa/m1/2, revealing the extremely brittle nature of these materials.

  4. Nanocrystal/sol-gel nanocomposites

    DOEpatents

    Klimov, Victor L.; Petruska, Melissa A.

    2010-05-25

    The present invention is directed to a process for preparing a solid composite having colloidal nanocrystals dispersed within a sol-gel matrix, the process including admixing colloidal nanocrystals with an amphiphilic polymer including hydrophilic groups selected from the group consisting of --COOH, --OH, --SO.sub.3H, --NH.sub.2, and --PO.sub.3H.sub.2 within a solvent to form an alcohol-soluble colloidal nanocrystal-polymer complex, admixing the alcohol-soluble colloidal nanocrystal-polymer complex and a sol-gel precursor material, and, forming the solid composite from the admixture. The present invention is also directed to the resultant solid composites and to the alcohol-soluble colloidal nanocrystal-polymer complexes.

  5. Effect of various polishing systems on the surface roughness and phase transformation of zirconia and the durability of the polishing systems.

    PubMed

    Park, Chan; Vang, Mong-Sook; Park, Sang-Won; Lim, Hyun-Pil

    2017-03-01

    system (F1). When polishing treatment was carried out on zirconia specimens for 8 minutes, the maximum percentages of monoclinic phase increased by 0.03% in the Z1 system and by 0.09% in the Z2 system. The volume change for the durability evaluation of the polishing system was 13.35 and 29.37% in the Z1 system, 2.05 and 5.92% in the Z2 system, and 3.60 and 4.95% in the F1 system, respectively. Zirconia polishing systems created a smoother surface on zirconia than the feldspathic porcelain polishing system. No significant changes in the phase transformation of zirconia were found before and after polishing. Each polishing system showed different levels of wear resistance. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.

  6. Molybdenum disilicide composites reinforced with zirconia and silicon carbide

    DOEpatents

    Petrovic, John J.

    1995-01-01

    Compositions consisting essentially of molybdenum disilicide, silicon carbide, and a zirconium oxide component. The silicon carbide used in the compositions is in whisker or powder form. The zirconium oxide component is pure zirconia or partially stabilized zirconia or fully stabilized zirconia.

  7. Molybdenum disilicide composites reinforced with zirconia and silicon carbide

    DOEpatents

    Petrovic, J.J.

    1995-01-17

    Compositions are disclosed consisting essentially of molybdenum disilicide, silicon carbide, and a zirconium oxide component. The silicon carbide used in the compositions is in whisker or powder form. The zirconium oxide component is pure zirconia or partially stabilized zirconia or fully stabilized zirconia.

  8. Molybdenum disilicide composites reinforced with zirconia and silicon carbide

    SciTech Connect

    Petrovic, J.J.

    1992-12-31

    This patent pertains to compositions consisting essentially of molybdenum disilicide, silicon carbide, and a zirconium oxide component. The silicon carbide used in the compositions is in whisker or powder form. The zirconium oxide component is pure zirconia or partially stabilized zirconia or fully stabilized zirconia. Fabrication, fracture toughness, and bend strength are covered.

  9. Oxygen separation from air using zirconia solid electrolyte membranes

    NASA Technical Reports Server (NTRS)

    Suitor, J. W.; Marner, W. J.; Schroeder, J. E.; Losey, R. W.; Ferrall, J. F.

    1988-01-01

    Air separation using a zirconia solid electrolyte membrane is a possible alternative source of oxygen. The process of zirconia oxygen separation is reviewed, and an oxygen plant concept using such separation is described. Potential cell designs, stack designs, and testing procedures are examined. Fabrication of the materials used in a zirconia module as well as distribution plate design and fabrication are examined.

  10. Oxygen separation from air using zirconia solid electrolyte membranes

    NASA Technical Reports Server (NTRS)

    Suitor, J. W.; Marner, W. J.; Schroeder, J. E.; Losey, R. W.; Ferrall, J. F.

    1988-01-01

    Air separation using a zirconia solid electrolyte membrane is a possible alternative source of oxygen. The process of zirconia oxygen separation is reviewed, and an oxygen plant concept using such separation is described. Potential cell designs, stack designs, and testing procedures are examined. Fabrication of the materials used in a zirconia module as well as distribution plate design and fabrication are examined.

  11. Effect of air-particle abrasion protocols on the biaxial flexural strength, surface characteristics and phase transformation of zirconia after cyclic loading.

    PubMed

    Ozcan, Mutlu; Melo, Renata M; Souza, Rodrigo O A; Machado, João P B; Felipe Valandro, Luiz; Botttino, Marco A

    2013-04-01

    This study evaluated the effect of air-particle abrasion protocols on the biaxial flexural strength, surface characteristics and phase transformation of zirconia after cyclic loading. Disc-shaped zirconia specimens (Ø: 15mm, thickness: 1.2mm) (N=32) were submitted to one of the air-particle abrasion protocols (n=8 per group): (a) 50μm Al2O3 particles, (b) 110μm Al2O3 particles coated with silica (Rocatec Plus), (c) 30μm Al2O3 particles coated with silica (CoJet Sand) for 20s at 2.8bar pressure. Control group received no air-abrasion. All specimens were initially cyclic loaded (×20,000, 50N, 1Hz) in water at 37°C and then subjected to biaxial flexural strength testing where the conditioned surface was under tension. Zirconia surfaces were characterized and roughness was measured with 3D surface profilometer. Phase transformation from tetragonal to monoclinic was determined by Raman spectroscopy. The relative amount of transformed monoclinic zirconia (FM) and transformed zone depth (TZD) were measured using XRD. The data (MPa) were analyzed using ANOVA, Tukey's tests and Weibull modulus (m) were calculated for each group (95% CI). The biaxial flexural strength (MPa) of CoJet treated group (1266.3±158(A)) was not significantly different than that of Rocatec Plus group (1179±216.4(A,B)) but was significantly higher than the other groups (Control: 942.3±74.6(C); 50μm Al2O3: 915.2±185.7(B,C)). Weibull modulus was higher for control (m=13.79) than those of other groups (m=4.95, m=5.64, m=9.13 for group a, b and c, respectively). Surface roughness (Ra) was the highest with 50μm Al2O3 (0.261μm) than those of other groups (0.15-0.195μm). After all air-abrasion protocols, FM increased (15.02%-19.25%) compared to control group (11.12%). TZD also showed increase after air-abrasion protocols (0.83-1.07μm) compared to control group (0.59μm). Air-abrasion protocols increased the roughness and monoclinic phase but in turn abrasion with 30μm Al2O3 particles coated

  12. Silicon nanocrystal inks, films, and methods

    DOEpatents

    Wheeler, Lance Michael; Kortshagen, Uwe Richard

    2015-09-01

    Silicon nanocrystal inks and films, and methods of making and using silicon nanocrystal inks and films, are disclosed herein. In certain embodiments the nanocrystal inks and films include halide-terminated (e.g., chloride-terminated) and/or halide and hydrogen-terminated nanocrystals of silicon or alloys thereof. Silicon nanocrystal inks and films can be used, for example, to prepare semiconductor devices.

  13. Fabrication and characterization of dense zirconia and zirconia-silica ceramic nanofibers.

    PubMed

    Xu, Xiaoming; Guo, Guangqing; Fan, Yuwei

    2010-09-01

    The objective of this study was to prepare dense zirconia-yttria (ZY), zirconia-silica (ZS) and zirconia-yttria-silica (ZYS) nanofibers as reinforcing elements for dental composites. Zirconium (IV) propoxide, yttrium nitrate hexahydrate, and tetraethyl orthosilicate (TEOS) were used as precursors for the preparation of zirconia, yttria, and silica sols. A small amount (1-1.5 wt%) of polyethylene oxide (PEO) was used as a carry polymer. The sols were preheated at 70 degrees C before electrospinning and their viscosity was measured with a viscometer at different heating time. The gel point was determined by viscosity-time (eta-t) curve. The ZY, ZS and ZYS gel nanofibers were prepared using a special reactive electrospinning device under the conditions near the gel point. The as-prepared gel nanofibers had diameters between 200 and 400 nm. Dense (nonporous) ceramic nanofibers of zirconia-yttria (96/4), zirconia-silica (80/20) and zirconia-yttria-silica (76.8/3.2/20) with diameter of 100-300 nm were obtained by subsequent calcinations at different temperatures. The gel and ceramic nanofibers obtained were characterized by scanning electron microscope (SEM), high-resolution field-emission scanning electron microscope (FE-SEM), thermogravimetric analyzer (TGA), differential scanning calorimeter (DSC), Fourier transform infrared spectrometer (FT-IR), and X-ray diffraction (XRD). SEM micrograph revealed that ceramic ZY nanofibers had grained structure, while ceramic ZS and ZYS nanofibers had smooth surfaces, both showing no visible porosity under FE-SEM. Complete removal of the polymer PEO was confirmed by TGA/DSC and FT-IR. The formation of tetragonal phase of zirconia and amorphous silica was proved by XRD. In conclusion, dense zirconia-based ceramic nanofibers can be fabricated using the new reactive sol-gel electrospinning technology with minimum organic polymer additives.

  14. Creep of plasma sprayed zirconia

    NASA Technical Reports Server (NTRS)

    Firestone, R. F.; Logan, W. R.; Adams, J. W.

    1982-01-01

    Specimens of plasma-sprayed zirconia thermal barrier coatings with three different porosities and different initial particle sizes were deformed in compression at initial loads of 1000, 2000, and 3500 psi and temperatures of 1100 C, 1250 C, and 1400 C. The coatings were stabilized with lime, magnesia, and two different concentrations of yttria. Creep began as soon as the load was applied and continued at a constantly decreasing rate until the load was removed. Temperature and stabilization had a pronounced effect on creep rate. The creep rate for 20% Y2O3-80% ZrO2 was 1/3 to 1/2 that of 8% Y2O3-92% ZrO2. Both magnesia and calcia stabilized ZrO2 crept at a rate 5 to 10 times that of the 20% Y2O3 material. A near proportionality between creep rate and applied stress was observed. The rate controlling process appeared to be thermally activated, with an activation energy of approximately 100 cal/gm mole K. Creep deformation was due to cracking and particle sliding.

  15. Grafting Sulfated Zirconia on Mesoporous Silica

    SciTech Connect

    Wang, Yong; Lee, Kwan Young; Choi, Saemin; Liu, Jun; Wang, Li Q.; Peden, Charles HF

    2007-06-01

    Sulfated zirconia has received considerable attention as a potential solid acid catalyst in recent years. In this paper, the preparation and properties of acid catalysts obtained by grafting ziconia with atomic precision on MCM-41 mesoporous silica were studied. TEM and potential titration characterizations revealed that ZrO2/MCM-41 with monolayer coverage can be obtained using this grafting technique. Sulfated ZrO2/MCM-41 exhibits improved thermal stability than that of bulk sulfated zirconia, as evidenced by temperature programmed characterizations and XRD analysis. Temperature programmed reaction of isopropanol was used to evaluate the acidity of sulfated ZrO2/MCM-41. It was found that the acid strength of sulfated ZrO2/MCM-41 with monolayer coverage is weaker than bulk sulfated zirconia but stronger than SiO2-Al2O3, a common strong acid catalyst.

  16. Processing of Alumina-Toughened Zirconia Composites

    NASA Technical Reports Server (NTRS)

    Bansal, Narottam P.; Choi, Sung R.

    2003-01-01

    Dense and crack-free 10-mol%-yttria-stabilized zirconia (10YSZ)-alumina composites, containing 0 to 30 mol% of alumina, have been fabricated by hot pressing. Release of pressure before onset of cooling was crucial in obtaining crack-free material. Hot pressing at 1600 C resulted in the formation of ZrC by reaction of zirconia with grafoil. However, no such reaction was observed at 1500 C. Cubic zirconia and -alumina were the only phases detected from x-ray diffraction indicating no chemical reaction between the composite constituents during hot pressing. Microstructure of the composites was analyzed by scanning electron microscopy and transmission electron microscopy. Density and elastic modulus of the composites followed the rule-of-mixtures. Addition of alumina to 10YSZ resulted in lighter, stronger, and stiffer composites by decreasing density and increasing strength and elastic modulus.

  17. Local structures surrounding Zr in nanostructurally stabilized cubic zirconia: Structural origin of phase stability

    SciTech Connect

    Soo, Y. L.; Chen, P. J.; Huang, S. H.; Shiu, T. J.; Tsai, T. Y.; Chow, Y. H.; Lin, Y. C.; Weng, S. C.; Chang, S. L.; Wang, G.; Cheung, C. L.; Sabirianov, R. F.; Mei, W. N.; Namavar, F.; Haider, H.; Garvin, K. L.; Lee, J. F.; Lee, H. Y.; Chu, P. P.

    2008-12-01

    Local environment surrounding Zr atoms in the thin films of nanocrystalline zirconia (ZrO{sub 2}) has been investigated by using the extended x-ray absorption fine structure (EXAFS) technique. These films prepared by the ion beam assisted deposition exhibit long-range structural order of cubic phase and high hardness at room temperature without chemical stabilizers. The local structure around Zr probed by EXAFS indicates a cubic Zr sublattice with O atoms located on the nearest tetragonal sites with respect to the Zr central atoms, as well as highly disordered locations. Similar Zr local structure was also found in a ZrO{sub 2} nanocrystal sample prepared by a sol-gel method. Variations in local structures due to thermal annealing were observed and analyzed. Most importantly, our x-ray results provide direct experimental evidence for the existence of oxygen vacancies arising from local disorder and distortion of the oxygen sublattice in nanocrystalline ZrO{sub 2}. These oxygen vacancies are regarded as the essential stabilizing factor for the nanostructurally stabilized cubic zirconia.

  18. Air abrasion before and/or after zirconia sintering: surface characterization, flexural strength, and resin cement bond strength.

    PubMed

    Abi-Rached, F O; Martins, S B; Almeida-Júnior, A A; Adabo, G L; Góes, M Sousa; Fonseca, R G

    2015-01-01

    order provided differences in the surface morphology. The nonabraded (926.8 MPa) and BS (816.3 MPa) groups exhibited statistically similar FS values but lower values than the AS (1249.1 MPa) and BAS (1181.4 MPa) groups, with no significant difference between them. The nonabraded, AS, BS, and BAS groups exhibited, respectively, percentages of monoclinic phase of 0.0 wt%, 12.2 wt%, 0.0 wt%, and 8.6 wt%. The rougher surface provided by the air-abrasion before zirconia sintering may have impaired the bonding with the resin cement. The morphological patterns were consistent with the surface roughness. Considering the short-term SBS and FS, the BAS group exhibited the best performance. Air abrasion, regardless of its performance order, provides tetragonal to monoclinic transformation, while sintering tends to zero the monoclinic phase content.

  19. Silicon nanocrystals as handy biomarkers

    NASA Astrophysics Data System (ADS)

    Fujioka, Kouki; Hoshino, Akiyoshi; Manabe, Noriyoshi; Futamura, Yasuhiro; Tilley, Richard; Yamamoto, Kenji

    2007-02-01

    Quantum dots (QDs) have brighter and longer fluorescence than organic dyes. Therefore, QDs can be applied to biotechnology, and have capability to be applied to medical technology. Currently, among the several types of QDs, CdSe with a ZnS shell is one of the most popular QDs to be used in biological experiments. However, when the CdSe QDs were applied to clinical technology, potential toxicological problems due to CdSe core should be considered. To eliminate the problem, silicon nanocrystals, which have the potential of biocompatibility, could be a candidate of alternate probes. Silicon nanocrystals have been synthesized using several techniques such as aerosol, electrochemical etching, laser pyrolysis, plasma deposition, and colloids. Recently, the silicon nanocrystals were reported to be synthesized in inverse micelles and also stabilized with 1-heptene or allylamine capping. Blue fluorescence of the nanocrystals was observed when excited with a UV light. The nanocrystals covered with 1-heptene are hydrophobic, whereas the ones covered with allylamine are hydrophilic. To test the stability in cytosol, the water-soluble nanocrystals covered with allylamine were examined with a Hela cell incorporation experiment. Bright blue fluorescence of the nanocrystals was detected in the cytosol when excited with a UV light, implying that the nanocrystals were able to be applied to biological imaging. In order to expand the application range, we synthesized and compared a series of silicon nanocrystals, which have variable surface modification, such as alkyl group, alcohol group, and odorant molecules. This study will provide a wider range of optoelectronic applications and bioimaging technology.

  20. Biomolecular Assembly of Gold Nanocrystals

    SciTech Connect

    Micheel, Christine Marya

    2005-05-20

    Over the past ten years, methods have been developed to construct discrete nanostructures using nanocrystals and biomolecules. While these frequently consist of gold nanocrystals and DNA, semiconductor nanocrystals as well as antibodies and enzymes have also been used. One example of discrete nanostructures is dimers of gold nanocrystals linked together with complementary DNA. This type of nanostructure is also known as a nanocrystal molecule. Discrete nanostructures of this kind have a number of potential applications, from highly parallel self-assembly of electronics components and rapid read-out of DNA computations to biological imaging and a variety of bioassays. My research focused in three main areas. The first area, the refinement of electrophoresis as a purification and characterization method, included application of agarose gel electrophoresis to the purification of discrete gold nanocrystal/DNA conjugates and nanocrystal molecules, as well as development of a more detailed understanding of the hydrodynamic behavior of these materials in gels. The second area, the development of methods for quantitative analysis of transmission electron microscope data, used computer programs written to find pair correlations as well as higher order correlations. With these programs, it is possible to reliably locate and measure nanocrystal molecules in TEM images. The final area of research explored the use of DNA ligase in the formation of nanocrystal molecules. Synthesis of dimers of gold particles linked with a single strand of DNA possible through the use of DNA ligase opens the possibility for amplification of nanostructures in a manner similar to polymerase chain reaction. These three areas are discussed in the context of the work in the Alivisatos group, as well as the field as a whole.

  1. Identification of monoclinic θ-phase dispersoids in a 6061 aluminium alloy

    NASA Astrophysics Data System (ADS)

    Buchanan, Karl; Ribis, Joël; Garnier, Jérôme; Colas, Kimberly

    2016-04-01

    Intermetallic dispersoids play an important role in controlling the 6xxx alloy series' grain distribution and increasing the alloy's toughness. The dispersoid distribution in a 6061 aluminium alloy (Al-Mg-Si) was analysed by transmission electron microscopy, selected area diffraction and energy-dispersive X-ray spectroscopy. The dispersoids had three unique crystal structures: simple cubic ?, body-centred cubic ? and monoclinic (C2/m). While the SC and BCC dispersoids have been well characterized in the literature, a detailed analysis of monoclinic dispersoids has not been presented. Therefore, the current work discusses the chemical composition, crystal structure and morphology of the monoclinic dispersoids.

  2. Chipping resistance of graded zirconia ceramics for dental crowns.

    PubMed

    Zhang, Y; Chai, H; Lee, J J-W; Lawn, B R

    2012-03-01

    A serious drawback of veneering porcelains is a pronounced susceptibility to chipping. Glass-infiltrated dense zirconia structures can now be produced with esthetic quality, making them an attractive alternative. In this study, we examined the hypothesis that such infiltrated structures are much more chip-resistant than conventional porcelains, and at least as chip-resistant as non-infiltrated zirconia. A sharp indenter was used to produce chips in flat and anatomically correct glass-infiltrated zirconia crown materials, and critical loads were measured as a function of distance from the specimen edge (flat) or side wall (crown). Control data were obtained on zirconia specimens without infiltration and on crowns veneered with porcelains. The results confirmed that the resistance to chipping in graded zirconia is more than 4 times higher than that of porcelain-veneered zirconia and is at least as high as that of non-veneered zirconia.

  3. Cellulose nanocrystal submonolayers by spin coating.

    PubMed

    Kontturi, Eero; Johansson, Leena-Sisko; Kontturi, Katri S; Ahonen, Päivi; Thüne, Peter C; Laine, Janne

    2007-09-11

    Dilute concentrations of cellulose nanocrystal solutions were spin coated onto different substrates to investigate the effect of the substrate on the nanocrystal submonolayers. Three substrates were probed: silica, titania, and amorphous cellulose. According to atomic force microscopy (AFM) images, anionic cellulose nanocrystals formed small aggregates on the anionic silica substrate, whereas a uniform two-dimensional distribution of nanocrystals was achieved on the cationic titania substrate. The uniform distribution of cellulose nanocrystal submonolayers on titania is an important factor when dimensional analysis of the nanocrystals is desired. Furthermore, the amount of nanocrystals deposited on titania was multifold in comparison to the amounts on silica, as revealed by AFM image analysis and X-ray photoelectron spectroscopy. Amorphous cellulose, the third substrate, resulted in a somewhat homogeneous distribution of the nanocrystal submonolayers, but the amounts were as low as those on the silica substrate. These differences in the cellulose nanocrystal deposition were attributed to electrostatic effects: anionic cellulose nanocrystals are adsorbed on cationic titania in addition to the normal spin coating deposition. The anionic silica surface, on the other hand, causes aggregation of the weakly anionic cellulose nanocrystals which are forced on the repulsive substrate by spin coating. The electrostatically driven adsorption also influences the film thickness of continuous ultrathin films of cellulose nanocrystals. The thicker films of charged nanocrystals on a substrate of opposite charge means that the film thickness is not independent of the substrate when spin coating cellulose nanocrystals in the ultrathin regime (<100 nm).

  4. Synthesis and Doping of Silicon Nanocrystals for Versatile Nanocrystal Inks

    NASA Astrophysics Data System (ADS)

    Kramer, Nicolaas Johannes

    The impact of nanotechnology on our society is getting larger every year. Electronics are becoming smaller and more powerful, the "Internet of Things" is all around us, and data generation is increasing exponentially. None of this would have been possible without the developments in nanotechnology. Crystalline semiconductor nanoparticles (nanocrystals) are one of the latest developments in the field of nanotechnology. This thesis addresses three important challenges for the transition of silicon nanocrystals from the lab bench to the marketplace: A better understanding of the nanocrystal synthesis was obtained, the electronic properties of the nanocrystals were characterized and tuned, and novel silicon nanocrystal inks were formed and applied using simple coating technologies. Plasma synthesis of nanocrystals has numerous advantages over traditional solution-based synthesis methods. While the formation of nanoparticles in low pressure nonthermal plasmas is well known, the heating mechanism leading to their crystallization is poorly understood. A combination of comprehensive plasma characterization with a nanoparticle heating model presented here reveals the underlying plasma physics leading to crystallization. The model predicts that the nanoparticles reach temperatures as high as 900 K in the plasma as a result of heating reactions on the nanoparticle surface. These temperatures are well above the gas temperature and sufficient for complete nanoparticle crystallization. Moving the field of plasma nanoparticle synthesis to atmospheric pressures is important for lowering its cost and making the process attractive for industrial applications. The heating and charging model for silicon nanoparticles was adapted in Chapter 3 to study plasmas maintained over a wide range of pressures (10 -- 105 Pa). The model considers three collisionality regimes and determines the dominant contribution of each regime under various plasma conditions. Strong nanoparticle cooling at

  5. Dynamic nanocrystal response and high temperature growth of carbon nanotube-ferroelectric hybrid nanostructure

    NASA Astrophysics Data System (ADS)

    Kumar, Ashok; Scott, J. F.; Katiyar, R. S.

    2013-12-01

    A long standing problem related to the capping of carbon nanotubes (CNT) by inorganic materials at high temperature has been solved. In situ dynamic response of Pb(Zr0.52Ti0.48)O3 (PZT) nanocrystals attached to the wings of the outer surface of PZT/CNT hybrid-nanostructure has been demonstrated under a constant-energy high-resolution transmission electron microscopy (HRTEM) e-beam. PZT nanocrystals revealed that the crystal orientations, positions, faces, and hopping states change with time. HRTEM study has been performed to investigate the microstructure of hybrid nanostructures and nanosize polycrystal trapped across the wings. Raman spectroscopy was utilized to investigate the local structures, defects, crystal qualities and temperature dependent growth and degradation of hybrid nanostructures. Raman spectra indicate that MWCNT and PZT/MWCNT/n-Si possess good quality of CNT before and after PZT deposition until 650 °C. The monoclinic Cc/Cm phase of PZT which is optimum in piezoelectric properties was prominent in the hybrid structure and should be useful for device applications. An unusual hexagonal faceting oscillation of the nano-crystal perimeter on a 10-30 s period is also observed.A long standing problem related to the capping of carbon nanotubes (CNT) by inorganic materials at high temperature has been solved. In situ dynamic response of Pb(Zr0.52Ti0.48)O3 (PZT) nanocrystals attached to the wings of the outer surface of PZT/CNT hybrid-nanostructure has been demonstrated under a constant-energy high-resolution transmission electron microscopy (HRTEM) e-beam. PZT nanocrystals revealed that the crystal orientations, positions, faces, and hopping states change with time. HRTEM study has been performed to investigate the microstructure of hybrid nanostructures and nanosize polycrystal trapped across the wings. Raman spectroscopy was utilized to investigate the local structures, defects, crystal qualities and temperature dependent growth and degradation of

  6. [Vibrational spectra of monoclinic diphosphates of formula AMP2O7].

    PubMed

    Serghini Idrissi, M; Rghioui, L; Nejjar, R; Benarafa, L; Saidi Idrissi, M; Lorriaux, A; Wallart, F

    2004-07-01

    The monoclinic pyrophosphates with AMP2O7 formula were synthesized. Their infrared and Raman spectra have been reported and analysed. The results of a force field calculation for CaCuP2O7 are presented.

  7. Early stage of nanocrystal growth

    SciTech Connect

    2012-01-01

    Berkeley Lab researchers at the Molecular Foundry have elucidated important mechanisms behind oriented attachment, the phenomenon that drives biomineralization and the growth of nanocrystals. This electron microscopy movie shows the early stage of nanocrystal growth. Nanoparticles make transient contact at many points and orientations until their lattices are perfectly matched. The particles then make a sudden jump-to-contact to form attached aggregates. (Movie courtesy of Jim DeYoreo)

  8. Improved Zirconia Oxygen-Separation Cell

    NASA Technical Reports Server (NTRS)

    Walsh, John V.; Zwissler, James G.

    1988-01-01

    Cell structure distributes feed gas more evenly for more efficent oxygen production. Multilayer cell structure containing passages, channels, tubes, and pores help distribute pressure evenly over zirconia electrolytic membrane. Resulting more uniform pressure distribution expected to improve efficiency of oxygen production.

  9. Yield stress of alumina-zirconia suspensions

    SciTech Connect

    Ramakrishnan, V.; Pradip; Malghan, S.G.

    1996-10-01

    The yield stress of concentrated suspensions of alumina, zirconia, and mixed alumina-zirconia powders was measured by the vane technique as a function of solids loading, relative amounts of alumina and zirconia, and pH. At the isoelectric point (IEP), the yield stress varied as the fourth power of the solids loading. The relative ratio of alumina and zirconia particles was important in determining the yield stress of the suspension at the IEP. The yield stress of single and mixed suspensions showed a marked variation with pH. The maximum value occurred at or near the IEP of the suspension. The effect of electrical double-layer forces on the yield stress can be described on the basis of the Derjaguin-Landau-Verwey-Overbeek (DLVO) theory. A normalized yield stress--that is, the ratio of the yield stress at a given pH to the yield stress at the IEP predicted by this model--showed good correlation with experimental data.

  10. Assemblies of Cellulose Nanocrystals

    NASA Astrophysics Data System (ADS)

    Kumacheva, Eugenia

    The entropically driven coassembly of nanorods (cellulose nanocrystals, CNCs) and different types of nanoparticles (NPs), including dye-labeled latex NPs, carbon dots and plasmonic NPs was experimentally studied in aqueous suspensions and in solid films. In mixed CNC-NP suspensions, phase separation into an isotropic NP-rich and a chiral nematic CNC-rich phase took place; the latter contained a significant amount of NPs. Drying the mixed suspension resulted in CNC-NP films with planar disordered layers of NPs, which alternated with chiral nematic CNC-rich regions. In addition, NPs were embedded in the chiral nematic domains. The stratified morphology of the films, together with a random distribution of NPs in the anisotropic phase, led to the films having close-to-uniform fluorescence, birefringence, and circular dichroism properties.

  11. Direct silanization of zirconia for increased biointegration.

    PubMed

    Caravaca, Carlos; Shi, Liu; Balvay, Sandra; Rivory, Pascaline; Laurenceau, Emmanuelle; Chevolot, Yann; Hartmann, Daniel; Gremillard, Laurent; Chevalier, Jérôme

    2016-12-01

    High-performance bioinert ceramics such as zirconia have been used for biomedical devices since the early seventies. In order to promote osseointegration, the historical solution has been to increase the specific surface of the implant through roughness. Nevertheless these treatments on ceramics may create defects at the surface, exposing the material to higher chances of early failure. In zirconia, such treatments may also affect the stability of the surface. More recently, the interest of improving osseointegration of implants has moved the research focus towards the actual chemistry of the surface. Inspired by this, we have adapted the current knowledge and techniques of silica functionalization and applied it to successfully introduce 3-aminopropyldimethylethoxy silane (APDMES) directly on the surface of zirconia (3Y-TZP). We used plasma of oxygen to clean the surface and promote hydroxylation of the surface to increase silane density. The samples were extensively characterized by means of X-ray photoelectron spectroscopy (XPS) and contact angle, mechanically tested and its cytotoxicity was evaluated through cell adhesion and proliferation tests. Additionally, aging was studied to discard negative effects of the treatment on the stability of the tetragonal phase. No adverse effect was found on the mechanical response of treated samples. In addition, plasma-treated samples exhibited an unexpectedly higher resistance to aging. Finally, silane density was 35% lower than the one reported in literature for silica. However cells displayed a qualitatively higher spreading in opposition to the rounder appearance of cells on untreated zirconia. These results lay the foundations for the next generation of zirconia implants with biologically friendlier surfaces.

  12. Zirconia: cementation of prosthetic restorations. Literature review

    PubMed Central

    GARGARI, M.; GLORIA, F.; NAPOLI, E.; PUJIA, A.M.

    2011-01-01

    SUMMARY Aim of the work Aim of the work was to execute a review of the international literature about the cementation of zirconia restorations, analyzing the properties of the cements most commonly used in clinical activities. Materials and methods It was performed, through PubMed, a bibliographic search on the international literature of the last 10 years using the following limits: studies in English, in vitro studies, randomized clinical trial, reviews, meta-analysis, guide-lines. Were excluded from the search: descriptive studies, case reports, discussion articles, opinion’s leader. Results From studies results that common surface treatments (silanization, acid etching) are ineffective on zirconia because it has an inert surface without glassy component (on which this surface treatments act primarily), instead the sandblasting at 1atm with aluminium oxide (Al2O3) results significantly effective for the resulting roughening that increase the surface energy and the wettability of the material. Furthermore it has been shown that zinc phosphate-based cements, Bis-GMA-based and glass-ionomer cements can’t guarantee a stable long-term adhesion, instead resin cements containing phosphate monomer 10-methacryloyloxyidecyl-dihyidrogenphosphate (MDP) have shown higher adhesion and stability values than the other cements. In particular, it has seen that bond strength of zirconia copings on dentin, using MDP-based cement, is about 6,9MPa; this value is comparable to that obtained with gold copings cementation. Conclusions Analyzed studies have led to the following conclusions: sandblasting with aluminium oxide (Al2O3) is the best surface treatment to improve adhesion between resin cements and zirconia; resin cements containing phosphate ester monomers 10-methacryloyloxyidecyl-dihyidrogenphosphate (MDP) have shown in the studies an higher bond strength and stability after ageing treatment; the best procedure for cementing zirconia restorations results the combination of

  13. Development of a zirconia toughened hydroxyapatite

    NASA Astrophysics Data System (ADS)

    Mager, Carie Christine Wilkinson

    2000-10-01

    Because of its low fracture toughness (<1 MPa m 1/2) compared to bone (2--12 MPa m1/2), the use of HAp in dentistry and orthopedics is limited to low load bearing applications. In order to broaden its applications, HAp was reinforced through the addition of partially stabilized zirconia. HAp composites with varying amounts of zirconia were processed using a 2 level, 8 variable factorial design to determine the effect of various processing conditions on the stability of the zirconia and HAp phases and on the resulting toughening behavior of the composites. The processing conditions included in the design were; (a) milling times and fluid dispersion mediums; (b) sintering times and temperatures in ambient air and atmospheric pressure; and (c) hot isostatic pressing time and temperature in inert and "wet" environments. The effect of volume fraction and particle size of the zirconia in the range of 0--30 wt % and -0.9mum to -2.0mum respectively on the material's fracture toughness were also determined. The composites were also placed in a serum like solution for 6 months to study the effect of physiological environment on the various processing parameters and the resulting toughening behavior. The toughening behavior before and after in vitro exposure was monitored using micro Raman spectroscopy which enabled the size and shape of the transformation zone to, be quantified. The optimization of the design parameter's resulted in an increase in the fracture toughness by a factor of three and the six month in vitro study indicated that a zirconia toughened HAp implant could be processed so as to retain its hardness and toughness in vivo.

  14. Compositional limits and analogs of monoclinic triple-chain silicates

    NASA Astrophysics Data System (ADS)

    Jenkins, David M.; Gilleaudeau, Geoffrey J.; Kawa, Cynthia; Dibiase, Jaclyn M.; Fokin, Maria

    2012-08-01

    Growing recognition of triple-chain silicates in nature has prompted experimental research into the conditions under which they can form and the extent of solid solution that is feasible for some key chemical substitutions. Experiments were done primarily in the range of 0.1-0.5 GPa and 200-850 °C for durations of 18-1,034 h. A wide range of bulk compositions were explored in this study that can be classified broadly into two groups: those that are Na free and involve various possible chemical substitutions into jimthompsonite (Mg10Si12O32(OH)4), and those that are Na bearing and involve chemical substitutions into the ideal end-member Na4Mg8Si12O32(OH)4. Numerous attempts to synthesize jimthompsonite or clinojimthompsonite were unsuccessful despite the type of starting material used (reagent oxides, magnesite + SiO2, talc + enstatite, or anthophyllite). Similarly, the chemical substitutions of F- for OH-, Mn2+, Ca2+, or Fe2+ for Mg2+, and 2Li+ for Mg2+ and a vacancy were unsuccessful at nucleating triple-chain silicates. Conversely, nearly pure yields of monoclinic triple-chain silicate could be made at temperatures of 440-630 °C and 0.2 GPa from the composition Na4Mg8Si12O32(OH)4, as found in previous studies, though its composition is most likely depleted in Na as evidenced by electron microprobe and FTIR analysis. Pure yields of triple-chain silicate were also obtained for the F-analog composition Na4Mg8Si12O32F4 at 550-750 °C and 0.2-0.5 GPa if a flux consisting of Na-halide salt and water in a 2:1 ratio by weight was used. In addition, limited chemical substitution could be documented for the substitutions of 2 Na+ for Na+ + H+ and of Mg2+ + vacancy for 2Na+. For the former, the Na content appears to be limited to 2.5 cations giving the ideal composition of Na2.5Mg8Si12O30.5(OH)5.5, while for the latter substitution the Na content may go as low as 1.1 cations giving the composition Na1.1Mg9.4Si12O31.9(OH)4.1 based on a fixed number of Si cations. Further

  15. Preparation and Characterization of Zirconia-Coated Nanodiamonds as a Pt Catalyst Support for Methanol Electro-Oxidation

    PubMed Central

    Lu, Jing; Zang, Jianbing; Wang, Yanhui; Xu, Yongchao; Xu, Xipeng

    2016-01-01

    Zirconia-coated nanodiamond (ZrO2/ND) electrode material was successfully prepared by one-step isothermal hydrolyzing from ND-dispersed ZrOCl2·8H2O aqueous solution. High-resolution transmission electron microscopy reveals that a highly conformal and uniform ZrO2 shell was deposited on NDs by this simple method. The coating obtained at 90 °C without further calcination was mainly composed of monoclinic nanocrystalline ZrO2 rather than common amorphous Zr(OH)4 clusters. The ZrO2/NDs and pristine ND powder were decorated with platinum (Pt) nanoparticles by electrodeposition from 5 mM chloroplatinic acid solution. The electrochemical studies indicate that Pt/ZrO2/ND catalysts have higher electrocatalytic activity and better stability for methanol oxidation than Pt/ND catalysts in acid. PMID:28335361

  16. The effects of mechanical and hydrothermal aging on microstructure and biaxial flexural strength of an anterior and a posterior monolithic zirconia.

    PubMed

    Muñoz, Eduardo Mariscal; Longhini, Diogo; Antonio, Selma Gutierres; Adabo, Gelson Luis

    2017-08-01

    To evaluate the effect of hydrothermal aging (H), mechanical cycling (M), and the combination of hydrothermal plus mechanical cycling (H+M) on biaxial flexural strength (BFS) and microstructure of two monolithic zirconias, indicated for anterior (AMZ) or posterior restorations (PMZ) and a conventional zirconia (IZr). Disc specimens of each material (n=12) were submitted to: i) H (8h in autoclave at 134°C); ii) M (10(6) cycles, at 40% of BFS); and iii) H+M. BFS was measured (ISO-6872) and Weibull modulus (m) and the characteristic strength (σ(0)) were calculated. crystalline phase composition analyzed by XRD, and grain size measured by MEV analysis. XRD analysis showed AMZ was not susceptible to monoclinic transformation in any treatment. Conventional zirconia (IZr) and PMZ had monoclinic transformation only after H and H+M. BFS of AMZ was lower than PMZ and IZr. Cubic phase was found in all conditions for AMZ and IZr, while it was identified in PMZ only after H and H+M. BFS of AMZ was affected by M and H+M. For IZr and PMZ the unique difference detected in BFS was in the comparison of H to M. H treatment induced lower Weibull modulus, but characteristic strength was compatible with the BFS results. AMZ grain size (μm(2)) was 8.6 times larger than PMZ grains, and 13.6 times larger than IZr grains. AMZ showed the largest mean grain size, had the lowest BFS values, and was affected when mechanical cycling was involved. Monoclinic transformation was not found in any treatment for AMZ, but was found in IZr and PMZ when hydrothermal aging was used alone or when combined with mechanical cycling. PMZ showed similar behavior to the IZr. H induced to higher fracture probability. Translucent monolithic dental zirconia available on the market may behave differently under simulated oral aging. The relationship between composition and microstructure determines their properties presumably, and clinical performance. Copyright © 2017 Elsevier Ltd. All rights reserved.

  17. The effect of graded glass-zirconia structure on the bond between core and veneer in layered zirconia restorations.

    PubMed

    Liu, Ruoyu; Sun, Ting; Zhang, Yanli; Zhang, Yaokun; Jiang, Danyu; Shao, Longquan

    2015-06-01

    The aim of this study was to test the hypothesis that a graded glass-zirconia structure can strengthen the core-veneer bond in layered zirconia materials. A graded glass-zirconia structure was fabricated by infiltrating glass compositions developed in our laboratory into a presintered yttria tetrahedral zirconia polycrystal (Y-TZP) substrate by the action of capillary forces. The wettability of the infiltrated glass and Y-TZP substrate was investigated by the sessile drop technique. The microstructures of the graded glass-zirconia structure were examined by scanning electron microscopy (SEM). The phase structure characterization in the graded glass-zirconia structure were identified by X-ray diffraction (XRD) analysis. The elastic modulus and hardness of the graded glass-zirconia structure were evaluated from nanoindentations. Further, the shear bond strength (SBS) of the graded glass-zirconia structure and veneering porcelain was also evaluated. SEM images confirmed the formation of the graded glass-zirconia structure. Glass frits wet the Y-TZP substrate at 1200 °C with a contact angle of 43.2°. Only a small amount of t-m transformation was observed in as-infiltrated Y-TZP specimens. Nanoindentation studies of the glass-zirconia graded structure showed that the elastic modulus and hardness of the surface glass layer were higher than those of the dense Y-TZP layer. The mean SBS values for the graded glass-zirconia structure and veneering porcelain (24.35 ± 0.40 MPa) were statistically higher than those of zirconia and veneering porcelain (9.22 ± 0.20 MPa) (P<0.05). A graded glass-zirconia structure can be fabricated by the glass infiltration/densification technique, and this structure exhibits a strong core-veneer bond. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Semiconductor nanocrystal-based phagokinetic tracking

    DOEpatents

    Alivisatos, A Paul; Larabell, Carolyn A; Parak, Wolfgang J; Le Gros, Mark; Boudreau, Rosanne

    2014-11-18

    Methods for determining metabolic properties of living cells through the uptake of semiconductor nanocrystals by cells. Generally the methods require a layer of neutral or hydrophilic semiconductor nanocrystals and a layer of cells seeded onto a culture surface and changes in the layer of semiconductor nanocrystals are detected. The observed changes made to the layer of semiconductor nanocrystals can be correlated to such metabolic properties as metastatic potential, cell motility or migration.

  19. Mechanics of monoclinal systems in the Colorado Plateau during the Laramide orogeny

    NASA Astrophysics Data System (ADS)

    Yin, An

    1994-11-01

    Monoclines developed in the Colorado Plateau region during the Laramide orogeny are divided into western and eastern groups by a broad NNW trending antiform through the central part of the plateau. In the western group the major monoclines verge to the east, whereas in the eastern group the major monoclines verge to the west. Paleogeographic reconstruction based on paleocurrent indicators and sedimentary facies distribution suggests that the broad antiform was developed during the Laramide orogeny and was coeval with the formation of the monoclines in the plateau. This relationship implies that the monoclines were drag folds verging towards the center of the plateau as a response to the antiformal warping of the plateau. To simulate the warping of the plateau region and the stress distribution that produced the variable trends of the monoclines, an elastic thin plate model considering in-plane stress was developed. This model assumes that (1) sedimentation in the Laramide basins provided vertical loading along the edge of the plateau region, (2) frictional sliding was operating along the Laramide faults on the northern and eastern boundaries, and (3) the greatest regional compressive stress was oriented in the N 60 deg E direction and was applied uniformly along the western and southwestern sides of the plateau. Buoyancy due to instantaneous isostatic adjustment of crustal thickening or magmatic addition was also considered. The result of the model suggests that the frictional strength of the Uinta thrust system on the northern side of the plateau is at least 2 times greater than that along the Park Range and Sangre de Cristo thrust systems on the eastern side of the plateau in order to explain the observed monoclinal trends and the warping pattern within the plateau during the Laramide orogeny.

  20. Effects of cementation surface modifications on fracture resistance of zirconia.

    PubMed

    Srikanth, Ramanathan; Kosmac, Tomaz; Della Bona, Alvaro; Yin, Ling; Zhang, Yu

    2015-04-01

    To examine the effects of glass infiltration (GI) and alumina coating (AC) on the indentation flexural load and four-point bending strength of monolithic zirconia. Plate-shaped (12 mm × 12 mm × 1.0 mm or 1.5 or 2.0 mm) and bar-shaped (4 mm × 3 mm × 25 mm) monolithic zirconia specimens were fabricated. In addition to monolithic zirconia (group Z), zirconia monoliths were glass-infiltrated or alumina-coated on their tensile surfaces to form groups ZGI and ZAC, respectively. They were also glass-infiltrated on their upper surfaces, and glass-infiltrated or alumina-coated on their lower (tensile) surfaces to make groups ZGI2 and ZAC2, respectively. For comparison, porcelain-veneered zirconia (group PVZ) and monolithic lithium disilicate glass-ceramic (group LiDi) specimens were also fabricated. The plate-shaped specimens were cemented onto a restorative composite base for Hertzian indentation using a tungsten carbide spherical indenter with a radius of 3.2mm. Critical loads for indentation flexural fracture at the zirconia cementation surface were measured. Strengths of bar-shaped specimens were evaluated in four-point bending. Glass infiltration on zirconia tensile surfaces increased indentation flexural loads by 32% in Hertzian contact and flexural strength by 24% in four-point bending. Alumina coating showed no significant effect on resistance to flexural damage of zirconia. Monolithic zirconia outperformed porcelain-veneered zirconia and monolithic lithium disilicate glass-ceramics in terms of both indentation flexural load and flexural strength. While both alumina coating and glass infiltration can be used to effectively modify the cementation surface of zirconia, glass infiltration can further increase the flexural fracture resistance of zirconia. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  1. Effects of cementation surface modifications on fracture resistance of zirconia

    PubMed Central

    Srikanth, Ramanathan; Kosmac, Tomaz; Bona, Alvaro Della; Yin, Ling; Zhang, Yu

    2015-01-01

    Objectives To examine the effects of glass infiltration (GI) and alumina coating (AC) on the indentation flexural load and four-point bending strength of monolithic zirconia. Methods Plate-shaped (12 mm × 12 mm × 1.0 mm or 1.5 mm or 2.0 mm) and bar-shaped (4 mm × 3 mm × 25 mm) monolithic zirconia specimens were fabricated. In addition to monolithic zirconia (group Z), zirconia monoliths were glass-infiltrated or alumina-coated on their tensile surfaces to form groups ZGI and ZAC, respectively. They were also glass-infiltrated on their upper surfaces, and glass-infiltrated or alumina-coated on their lower (tensile) surfaces to make groups ZGI2 and ZAC2, respectively. For comparison, porcelain-veneered zirconia (group PVZ) and monolithic lithium disilicate glass-ceramic (group LiDi) specimens were also fabricated. The plate-shaped specimens were cemented onto a restorative composite base for Hertzian indentation using a tungsten carbide spherical indenter with a radius of 3.2 mm. Critical loads for indentation flexural fracture at the zirconia cementation surface were measured. Strengths of bar-shaped specimens were evaluated in four-point bending. Results Glass infiltration on zirconia tensile surfaces increased indentation flexural loads by 32% in Hertzian contact and flexural strength by 24% in four-point bending. Alumina coating showed no significant effect on resistance to flexural damage of zirconia. Monolithic zirconia outperformed porcelain-veneered zirconia and monolithic lithium disilicate glass-ceramics in terms of both indentation flexural load and flexural strength. Significance While both alumina coating and glass infiltration can be used to effectively modify the cementation surface of zirconia, glass infiltration can further increase the flexural fracture resistance of zirconia. PMID:25687628

  2. Novel fabrication method for zirconia restorations: bonding strength of machinable ceramic to zirconia with resin cements.

    PubMed

    Kuriyama, Soichi; Terui, Yuichi; Higuchi, Daisuke; Goto, Daisuke; Hotta, Yasuhiro; Manabe, Atsufumi; Miyazaki, Takashi

    2011-01-01

    A novel method was developed to fabricate all-ceramic restorations which comprised CAD/CAM-fabricated machinable ceramic bonded to CAD/CAM-fabricated zirconia framework using resin cement. The feasibility of this fabrication method was assessed in this study by investigating the bonding strength of a machinable ceramic to zirconia. A machinable ceramic was bonded to a zirconia plate using three kinds of resin cements: ResiCem (RE), Panavia (PA), and Multilink (ML). Conventional porcelain-fused-to-zirconia specimens were also prepared to serve as control. Shear bond strength test (SBT) and Schwickerath crack initiation test (SCT) were carried out. SBT revealed that PA (40.42 MPa) yielded a significantly higher bonding strength than RE (28.01 MPa) and ML (18.89 MPa). SCT revealed that the bonding strengths of test groups using resin cement were significantly higher than those of Control. Notably, the bonding strengths of RE and ML were above 25 MPa even after 10,000 times of thermal cycling -adequately meeting the ISO 9693 standard for metal-ceramic restorations. These results affirmed the feasibility of the novel fabrication method, in that a CAD/CAM-fabricated machinable ceramic is bonded to a CAD/CAM-fabricated zirconia framework using a resin cement.

  3. Multilayered thermal insulation formed of zirconia bonded layers of zirconia fibers and metal oxide fibers and method for making same

    DOEpatents

    Wrenn, G.E. Jr.; Holcombe, C.E. Jr.

    1988-09-13

    A multilayered thermal insulating composite is formed of a first layer of zirconia-bonded zirconia fibers for utilization near the hot phase or surface of a furnace or the like. A second layer of zirconia-bonded metal oxide fibers is attached to the zirconia fiber layer by a transition layer formed of intermingled zirconia fibers and metal oxide fibers. The thermal insulation is fabricated by vacuum molding with the layers being sequentially applied from aqueous solutions containing the fibers to a configured mandrel. A portion of the solution containing the fibers forming the first layer is intermixed with the solution containing the fibers of the second layer for forming the layer of mixed fibers. The two layers of fibers joined together by the transition layer are saturated with a solution of zirconium oxynitrate which provides a zirconia matrix for the composite when the fibers are sintered together at their nexi.

  4. Multilayered thermal insulation formed of zirconia bonded layers of zirconia fibers and metal oxide fibers and method for making same

    DOEpatents

    Wrenn, Jr., George E.; Holcombe, Jr., Cressie E.

    1988-01-01

    A multilayered thermal insulating composite is formed of a first layer of zirconia-bonded zirconia fibers for utilization near the hot phase or surface of a furnace or the like. A second layer of zirconia-bonded metal oxide fibers is attached to the zirconia fiber layer by a transition layer formed of intermingled zirconia fibers and metal oxide fibers. The thermal insulation is fabricated by vacuum molding with the layers being sequentially applied from aqueous solutions containing the fibers to a configured mandrel. A portion of the solution containing the fibers forming the first layer is intermixed with the solution containing the fibers of the second layer for forming the layer of mixed fibers. The two layers of fibers joined together by the transition layer are saturated with a solution of zirconium oxynitrate which provides a zirconia matrix for the composite when the fibers are sintered together at their nexi.

  5. Zirconia abutments and restorations: from laboratory to clinical investigations.

    PubMed

    Ferrari, M; Vichi, A; Zarone, F

    2015-03-01

    In last years the use of zirconia in dentistry has become very popular. Unfortunately, the clinical indications for a dental use of zirconia are not completely clear yet, neither are their limitations. The objective of this review was to evaluate the basic science knowledge on zirconia and to discuss some aspects of the clinical behavior of zirconia-based restorations. In particular, one of the goals was highlighting the possible correlation between in vitro and in vivo studies. The definition of concepts like success, survival and failure was still debated and the correlation between in vitro results and predictability of clinical behavior was investigated.

  6. Overview of zirconia with respect to gas turbine applications

    NASA Technical Reports Server (NTRS)

    Cawley, J. D.

    1984-01-01

    Phase relationships and the mechanical properties of zirconia are examined as well as the thermal conductivity, deformation, diffusion, and chemical reactivity of this refractory material. Observations from the literature particular to plasma-sprayed material and implications for gas turbine engine applications are discussed. The literature review indicates that Mg-PSZ (partially stabilized zirconia) and Ca-PSZ are unsuitable for advanced gas turbine applications; a thorough characterization of the microstructure of plasma-sprayed zirconia is needed. Transformation-toughened zirconia may be suitable for use in monolithic components.

  7. Core/Shell semiconductor nanocrystals.

    PubMed

    Reiss, Peter; Protière, Myriam; Li, Liang

    2009-02-01

    Colloidal core/shell nanocrystals contain at least two semiconductor materials in an onionlike structure. The possibility to tune the basic optical properties of the core nanocrystals, for example, their fluorescence wavelength, quantum yield, and lifetime, by growing an epitaxial-type shell of another semiconductor has fueled significant progress on the chemical synthesis of these systems. In such core/shell nanocrystals, the shell provides a physical barrier between the optically active core and the surrounding medium, thus making the nanocrystals less sensitive to environmental changes, surface chemistry, and photo-oxidation. The shell further provides an efficient passivation of the surface trap states, giving rise to a strongly enhanced fluorescence quantum yield. This effect is a fundamental prerequisite for the use of nanocrystals in applications such as biological labeling and light-emitting devices, which rely on their emission properties. Focusing on recent advances, this Review discusses the fundamental properties and synthesis methods of core/shell and core/multiple shell structures of II-VI, IV-VI, and III-V semiconductors.

  8. Linearly arranged polytypic CZTSSe nanocrystals

    PubMed Central

    Fan, Feng-Jia; Wu, Liang; Gong, Ming; Chen, Shi You; Liu, Guang Yao; Yao, Hong-Bin; Liang, Hai-Wei; Wang, Yi-Xiu; Yu, Shu-Hong

    2012-01-01

    Even colloidal polytypic nanostructures show promising future in band-gap tuning and alignment, researches on them have been much less reported than the standard nano-heterostructures because of the difficulties involved in synthesis. Up to now, controlled synthesis of colloidal polytypic nanocrsytals has been only realized in II-VI tetrapod and octopod nanocrystals with branched configurations. Herein, we report a colloidal approach for synthesizing non-branched but linearly arranged polytypic I2-II-IV-VI4 nanocrystals, with a focus on polytypic non-stoichiometric Cu2ZnSnSxSe4−x nanocrystals. Each synthesized polytypic non-stoichiometric Cu2ZnSnSxSe4−x nanocrystal is consisted of two zinc blende-derived ends and one wurtzite-derived center part. The formation mechanism has been studied and the phase composition can be tuned through adjusting the reaction temperature, which brings a new band-gap tuning approach to Cu2ZnSnSxSe4-x nanocrystals. PMID:23233871

  9. Post-patterning of an electronic homojunction in atomically thin monoclinic MoTe2

    NASA Astrophysics Data System (ADS)

    Kim, Sera; Kim, Jung Ho; Kim, Dohyun; Hwang, Geunwoo; Baik, Jaeyoon; Yang, Heejun; Cho, Suyeon

    2017-06-01

    Monoclinic group 6 transition metal dichalcogenides (TMDs) have been extensively studied for their intriguing 2D physics (e.g. spin Hall insulator) as well as for ohmic homojunction contacts in 2D device applications. A critical prerequisite for those applications is thickness control of the monoclinic 2D materials, which allows subtle engineering of the topological states or electronic bandgaps. Local thickness control enables the realization of clean homojunctions between different electronic states, and novel device operation in a single material. However, conventional fabrication processes, including chemical methods, typically produce non-homogeneous and relatively thick monoclinic TMDs, due to their distorted octahedral structures. Here, we report on a post-patterning technique using laser-irradiation to fabricate homojunctions between two different thickness areas in monoclinic MoTe2. A thickness-dependent electronic change from a metallic to semiconducting state, resulting in an electronic homojunction, was realized by the optical patterning of pristine MoTe2 flakes, and a pre-patterned device channel of monoclinic MoTe2 with a thickness-resolution of 5 nm. Our work provides insight on an optical post-process method for controlling thickness, as a promising approach for fabricating impurity-free 2D TMDs homojunction devices.

  10. Large scale synthesis of nanostructured zirconia-based compounds from freeze-dried precursors

    SciTech Connect

    Gomez, A.; Villanueva, R.; Vie, D.; Murcia-Mascaros, S.; Martinez, E.; Beltran, A.; Sapina, F.; Vicent, M.; Sanchez, E.

    2013-01-15

    Nanocrystalline zirconia powders have been obtained at the multigram scale by thermal decomposition of precursors resulting from the freeze-drying of aqueous acetic solutions. This technique has equally made possible to synthesize a variety of nanostructured yttria or scandia doped zirconia compositions. SEM images, as well as the analysis of the XRD patterns, show the nanoparticulated character of those solids obtained at low temperature, with typical particle size in the 10-15 nm range when prepared at 673 K. The presence of the monoclinic, the tetragonal or both phases depends on the temperature of the thermal treatment, the doping concentration and the nature of the dopant. In addition, Rietveld refinement of the XRD profiles of selected samples allows detecting the coexistence of the tetragonal and the cubic phases for high doping concentration and high thermal treatment temperatures. Raman experiments suggest the presence of both phases also at relatively low treatment temperatures. - Graphical abstract: Zr{sub 1-x}A{sub x}O{sub 2-x/2} (A=Y, Sc; 0{<=}x{<=}0.12) solid solutions have been prepared as nanostructured powders by thermal decomposition of precursors obtained by freeze-drying, and this synthetic procedure has been scaled up to the 100 g scale. Highlights: Black-Right-Pointing-Pointer Zr{sub 1-x}A{sub x}O{sub 2-x/2} (A=Y, Sc; 0{<=}x{<=}0.12) solid solutions have been prepared as nanostructured powders. Black-Right-Pointing-Pointer The synthetic method involves the thermal decomposition of precursors obtained by freeze-drying. Black-Right-Pointing-Pointer The temperature of the thermal treatment controls particle sizes. Black-Right-Pointing-Pointer The preparation procedure has been scaled up to the 100 g scale. Black-Right-Pointing-Pointer This method is appropriate for the large-scale industrial preparation of multimetallic systems.

  11. Comparison of alternative adhesive cementation concepts for zirconia ceramic: glaze layer vs zirconia primer.

    PubMed

    Cura, Cenk; Özcan, Mutlu; Isik, Gül; Saracoglu, Ahmet

    2012-02-01

    Zirconia-based ceramics offer strong restorations in dentistry, but the adhesive bond strength of resin cements to such ceramics is not optimal. This study evaluated the bond strength of silane/adhesive/resin cement and zirconia primer/resin cement combinations on non-glazed and glazed zirconia surfaces before and after aging. Disk-shaped zirconia ceramic specimens (diameter: 8 mm; thickness: 2 mm) (N = 80, n = 10 per group) were randomly divided into 2 groups. While half of the specimens received one coat of glaze and were later finished by grinding, the other half was only ground using 1200-grit silicone carbide abrasives under water. The glazed specimens were then conditioned with 9.5% HF acid gel for 60 s, rinsed with water for 90 s, and neutralized. The glazed and non-glazed specimens were further divided into two groups. Two resin cements, namely, Variolink II and Multilink Automix were adhered onto the zirconia surfaces with their corresponding adhesive systems. In the Variolink II group, zirconia surfaces were silanized (Monobond-S), and adhesive resin (Heliobond) was applied and photopolymerized. In the Multilink Automix group, one coat of Metal/Zirconia Primer was applied with a microbrush, left to react for 180 s, and dried using oil-free air. Half of the specimens in each cement group were subjected to 5000 thermocycles (5°C to 55°C) and the other half was kept in the dark for 24 h at 37°C prior to testing. Specimens were mounted in the jig of the universal testing machine, and force was applied to the ceramic/cement interface until failure occurred (1 mm/min). After evaluating all debonded specimens under SEM, the failure types were defined as either "adhesive" with no cement left on the zirconia (score 0) or "mixed" with less than half of the cement left on the surface with no cohesive failure of the substrate (score 1). Data were analyzed using three-way ANOVA and Dunnett-T3 post-hoc tests. Application of a glaze layer significantly improved the

  12. (Perturbed angular correlations in zirconia ceramics)

    SciTech Connect

    Not Available

    1990-01-01

    This is the progress report for the first year of the currently-approved three year funding cycle. We have carried on a vigorous program of experimental and theoretical research on microscopic properties of zirconia and ceria using the Perturbed Angular Correlation (PAC) experimental technique. The experimental method was described in the original proposal and in a number of references as well as several of the technical reports that accompany this progress report.

  13. Making yttria-stabilized tetragonal zirconia translucent

    PubMed Central

    Zhang, Yu

    2014-01-01

    Objective The aim of this study was to provide a design guideline for developing tetragonal yttria-stabilized zirconia with improved translucency. Methods The translucency, the in-line transmission in particular, of 3 mol.% yttria-stabilized tetragonal zirconia (3Y-TZP) has been examined using the Rayleigh scattering model. The theory predicts that the in-line transmission of 3Y-TZP can be related to its thickness with grain size and birefringence the governing parameters. To achieve a threshold value of translucency, the critical grain size of 3Y-TZP was predicted for various thicknesses (0.3 – 2.0 mm). The threshold value was defined by a measured average in-line transmission value of a suite of dental porcelains with a common thickness of 1 mm. Our theoretical predictions were calibrated with one of the very few experimental data available in the literature. Results For a dense, high-purity zirconia, its in-line transmission increased with decreasing grain size and thickness. To achieve a translucency similar to that of dental porcelains, a nanocyrstalline 3Y-TZP structure was necessitated, due primarily to its large birefringence and high refractive index. Such a grain size dependence became more pronounced as the 3Y-TZP thickness increased. For example, at a thickness of 1.3 mm, the mean grain size of a translucent 3Y-TZP should be 82 nm. At 1.5 mm and 2 mm thicknesses, the mean grain size needed to be 77 nm and 70 nm, respectively. Significance A promising future for zirconia restorations, with combined translucency and mechanical properties, can be realized by reducing its grain size. PMID:25193781

  14. Hot Corrosion of Yttrium Stabilized Zirconia Coatings Deposited by Air Plasma Spray on a Nickel-Based Superalloy

    NASA Astrophysics Data System (ADS)

    Vallejo, N. Diaz; Sanchez, O.; Caicedo, J. C.; Aperador, W.; Zambrano, G.

    In this research, the electrochemical impedance spectroscopy (EIS) and Tafel analysis were utilized to study the hot corrosion performance at 700∘C of air plasma-sprayed (APS) yttria-stabilized zirconia (YSZ) coatings with a NiCrAlY bond coat grown by high velocity oxygen fuel spraying (HVOF), deposited on an INCONEL 625 substrate, in contact with corrosive solids salts as vanadium pentoxide V2O5 and sodium sulfate Na2SO4. The EIS data were interpreted based on proposed equivalent electrical circuits using a suitable fitting procedure performed with Echem AnalystTM Software. Phase transformations and microstructural development were examined using X-ray diffraction (XRD), with Rietveld refinement for quantitative phase analysis, scanning electron microscopy (SEM) was used to determinate the coating morphology and corrosion products. The XRD analysis indicated that the reaction between sodium vanadate (NaVO3) and yttrium oxide (Y2O3) produces yttrium vanadate (YVO4) and leads to the transformation from tetragonal to monoclinic zirconia phase.

  15. Oxygen diffusion in niobia-doped zirconia as surrogate for oxide film on Zr-Nb alloy: AC impedance analysis

    NASA Astrophysics Data System (ADS)

    Yamana, Teppei; Arima, Tatsumi; Yoshihara, Takatoshi; Inagaki, Yaohiro; Idemitsu, Kazuya

    2013-11-01

    The oxygen conductivities and crystallographic properties of niobia-doped yttria-stabilized tetragonal zirconia with 0.0-2.6 wt% Nb2O5 were evaluated by the AC impedance analysis and the X-ray diffraction measurement, respectively. The tetragonality of zirconia increased with niobia content and approached ˜1.017 while the tetragonal-to-monoclinic phase transition occurred above ca. 1 wt% Nb2O5. On the other hand, oxygen conductivities of bulk and grain-boundary (GB) decreased with increasing niobia content. The bulk conductivity controlled the total ionic conductivity at high temperatures, and its activation energy had smaller dependence on temperature than that of GB. In addition to the effect of [VO] depletion by niobia addition, the behaviors of bulk and GB conductivities might be explained by the decrease of mobility of oxygen ion due to Coulomb repulsion between Nb5+ and VO and by no segregation of Nb ions in the space-charge layers, respectively.

  16. Nanocrystal powered nanomotor

    DOEpatents

    Regan, Brian C [Los Angeles, CA; Zettl, Alexander K [Kensington, CA; Aloni, Shaul [Albany, CA

    2011-01-04

    A nanoscale nanocrystal which may be used as a reciprocating motor is provided, comprising a substrate having an energy differential across it, e.g. an electrical connection to a voltage source at a proximal end; an atom reservoir on the substrate distal to the electrical connection; a nanoparticle ram on the substrate distal to the atom reservoir; a nanolever contacting the nanoparticle ram and having an electrical connection to a voltage source, whereby a voltage applied between the electrical connections on the substrate and the nanolever causes movement of atoms between the reservoir and the ram. Movement of the ram causes movement of the nanolever relative to the substrate. The substrate and nanolever preferably comprise multiwalled carbon nanotubes (MWNTs) and the atom reservoir and nanoparticle ram are preferably metal (e.g. indium) deposited as small particles on the MWNTs. The substrate may comprise a silicon chip that has been fabricated to provide the necessary electrodes and other electromechanical structures, and further supports an atomic track, which may comprise an MWNT.

  17. In vitro color changes of soft tissues caused by dyed fluorescent zirconia and nondyed, nonfluorescent zirconia in thin mucosa.

    PubMed

    Happe, Arndt; Schulte-Mattler, Verena; Strassert, Christian; Naumann, Michael; Stimmelmayr, Michael; Zoller, Joachim E; Rothamel, Daniel

    2013-01-01

    Abutment material selection may have an effect on the color of the peri-implant soft tissue, especially in thin mucosa. The objective of this in vitro study was to investigate the effect of titanium, zirconia, and dyed fluorescent zirconia on the color of 1.5-mm-thick mucosa. Ten pig maxillae were used to simulate thin mucosa according to a previously published setup. Three different abutment materials were placed under the mucosa, and the color of the soft tissue was evaluated using a spectrophotometer. The test area without underlying material was used as a control. Whereas titanium induced visible color change values of ΔE7.3, significantly above the threshold level of ΔE3.7 (P < .05, Student t test), the changes after insertion of zirconia ( ΔE3.7) and dyed fluorescent zirconia (3.5) were not statistically different from the visible threshold of ΔE3.7 (P < .05, Student t test). The difference between the two zirconia specimens was not statistically significant, although the dyed zirconia material was darker; the color difference was ΔE10.35 between the two. In contrast to titanium, neither nondyed zirconia nor dyed fluorescent zirconia changed the gingival coloration. Moreover, shading of white zirconia with a fluorescent dye leads to an all-ceramic abutment material that mimics the optical properties of natural teeth.

  18. Nanocrystals for luminescent solar concentrators.

    PubMed

    Bradshaw, Liam R; Knowles, Kathryn E; McDowall, Stephen; Gamelin, Daniel R

    2015-02-11

    Luminescent solar concentrators (LSCs) harvest sunlight over large areas and concentrate this energy onto photovoltaics or for other uses by transporting photons through macroscopic waveguides. Although attractive for lowering solar energy costs, LSCs remain severely limited by luminophore reabsorption losses. Here, we report a quantitative comparison of four types of nanocrystal (NC) phosphors recently proposed to minimize reabsorption in large-scale LSCs: two nanocrystal heterostructures and two doped nanocrystals. Experimental and numerical analyses both show that even the small core absorption of the leading NC heterostructures causes major reabsorption losses at relatively short transport lengths. Doped NCs outperform the heterostructures substantially in this critical property. A new LSC phosphor is introduced, nanocrystalline Cd(1-x)Cu(x)Se, that outperforms all other leading NCs by a significant margin in both small- and large-scale LSCs under full-spectrum conditions.

  19. Nanocrystal assembly for tandem catalysis

    DOEpatents

    Yang, Peidong; Somorjai, Gabor; Yamada, Yusuke; Tsung, Chia-Kuang; Huang, Wenyu

    2014-10-14

    The present invention provides a nanocrystal tandem catalyst comprising at least two metal-metal oxide interfaces for the catalysis of sequential reactions. One embodiment utilizes a nanocrystal bilayer structure formed by assembling sub-10 nm platinum and cerium oxide nanocube monolayers on a silica substrate. The two distinct metal-metal oxide interfaces, CeO.sub.2--Pt and Pt--SiO.sub.2, can be used to catalyze two distinct sequential reactions. The CeO.sub.2--Pt interface catalyzed methanol decomposition to produce CO and H.sub.2, which were then subsequently used for ethylene hydroformylation catalyzed by the nearby Pt--SiO.sub.2 interface. Consequently, propanal was selectively produced on this nanocrystal bilayer tandem catalyst.

  20. Niobia and tantala codoped orthorhombic zirconia ceramics

    SciTech Connect

    Hoeftberger, M.; Gritzner, G.

    1995-04-15

    During recent studies it was found that codoping of zirconia with niobia and tantala yielded very corrosion resistant, orthorhombic zirconia ceramics. The powders for those novel ceramics were made via the sol-gel technique by hydrolysis of the respective metal propoxides; a method which required dry-box techniques during the preparation of the alkoxides. In these studies the authors investigated the fabrication of precursor material from aqueous solutions. The preparation of aqueous solutions of salts of zirconium, niobium and tantalum is hampered by rapid hydrolysis. Premature hydrolysis of the chlorides and oxichlorides of niobium, tantalum and zirconium can be, however, prevented in aqueous solutions of oxalic acid. Thus the authors investigated the coprecipitation of hydroxides as precursors by reacting oxalic acid solutions of the respective cations with aqueous ammonia. In addition they studied the effects of calcination and of hydrothermal conversion of the hydroxides to oxides on the powder characteristics and on the mechanical properties of the niobia and tantala codoped zirconia ceramics.

  1. Monolithic zirconia and digital impression: case report.

    PubMed

    De Angelis, F; Brauner, E; Pignatiello, G; Mencio, F; Rosella, D; Papi, P; Di Carlo, T; Giovannetti, A; Pompa, G; Di Carlo, S

    2017-01-01

    The aim of this study is to present a clinical case of a full arch prosthetic rehabilitation on natural teeth, combining both digital work-flow and monolithic zirconia. Digital impression was taken with an intraoral optical scanner (CS3500, Carestream Dental, Atlanta, GA, USA). A prosthetic rehabilitation was realized on natural teeth using monolithic zirconia from 1.6 to 1.4 and from 2.7 to 2.4 frameworks, while in the aesthetic area (from 2.3 to 1.3), technicians left on the structure a 0.8 mm vestibular space for ceramic layering. The combination of digital impression technology and the use of the monolithic zirconia had demonstrated the delivery of the final prosthetic device in a quick time without the need to remodel functional or aesthetic areas. The digital work-flow combines intraoral optical impression techniques and CAD/CAM technology, in order to achieve a fully digital and successful way to deliver prosthetic restorations to patients, providing aesthetics and function in shorter intervals of time. The clinical outcome of this study was satisfactory but a long-term evaluation is needed.

  2. Effects of artificial aging conditions on yttria-stabilized zirconia implant abutments.

    PubMed

    Basílio, Mariana de Almeida; Cardoso, Kátia Vieira; Antonio, Selma Gutierrez; Rizkalla, Amin Sami; Santos Junior, Gildo Coelho; Arioli Filho, João Neudenir

    2016-08-01

    Most ceramic abutments are fabricated from yttria-stabilized tetragonal zirconia (Y-TZP). However, Y-TZP undergoes hydrothermal degradation, a process that is not well understood. The purpose of this in vitro study was to assess the effects of artificial aging conditions on the fracture load, phase stability, and surface microstructure of a Y-TZP abutment. Thirty-two prefabricated Y-TZP abutments were screwed and tightened down to external hexagon implants and divided into 4 groups (n = 8): C, control; MC, mechanical cycling (1×10(6) cycles; 10 Hz); AUT, autoclaving (134°C; 5 hours; 0.2 MPa); and TC, thermal cycling (10(4) cycles; 5°/55°C). A single-load-to-fracture test was performed at a crosshead speed of 0.5 mm/min to assess the assembly's resistance to fracture (ISO Norm 14801). X-ray diffraction (XRD) analysis was applied to observe and quantify the tetragonal-monoclinic (t-m) phase transformation. Representative abutments were examined with high-resolution scanning electron microscopy (SEM) to observe the surface characteristics of the abutments. Load-to-fracture test results (N) were compared by ANOVA and Tukey test (α=.05). XRD measurements revealed the monoclinic phase in some abutments after each aging condition. All the aging conditions reduced the fracture load significantly (P<.001). Mechanical cycling reduced the fracture load more than autoclaving (P=.034). No differences were found in the process of surface degradation among the groups; however, the SEM detected grinding-induced surface flaws and microcracks. The resistance to fracture and the phase stability of Y-TZP implant abutments were susceptible to hydrothermal and mechanical conditions. The surface microstructure of Y-TZP abutments did not change after aging conditions. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.

  3. Effects of Purity and Phase Content of Feedstock Powder on Thermal Durability of Zirconia-Based Thermal Barrier Coatings

    NASA Astrophysics Data System (ADS)

    Park, Kwang-Yong; Jung, Yeon-Gil; Kim, In-Soo; Yang, Byung-Il

    2017-08-01

    The thermal durability of thermal barrier coatings (TBCs) obtained using feedstock powders with different purity and phase content was investigated by cyclic thermal testing, including the effects on the sintering and phase transformation behaviors. Three kinds of 8 wt.% yttria-stabilized zirconia, namely regular purity (8YSZ), high purity (HP), and no monoclinic phase (nMP), were employed to prepare top coats by atmospheric plasma spraying on a NiCoCrAlY bond coat using a high-velocity oxy-fuel system. Use of 8YSZ, HP, and nMP for plasma spraying affected the microstructure and lifetime of the TBC in furnace cyclic testing (FCT) at 1100 °C and the sintering rate during annealing at 1400 °C for 50, 100, 200, and 400 h. In FCT, the TBC formed from nMP showed the longest durability, while that formed from HP showed lifetime performance similar to that obtained with regular-purity 8YSZ. The TBC obtained with nMP also exhibited the lowest monoclinic phase transition rate, followed by those obtained using HP and 8YSZ.

  4. High-resolution and analytical TEM investigation of metastable-tetragonal phase stabilization in undoped nanocrystalline zirconia.

    PubMed

    Oleshko, Vladimir P; Howe, James M; Shukla, Satyajit; Seal, Sudipta

    2004-09-01

    Submicron and nano-sized nanocrystalline pure zirconia (ZrO2) powders having metastable tetragonal and tetragonal-plus-monoclinic crystal structures, respectively, were synthesized using the sol-gel technique. The as-precipitated and the calcinated ZrO2 powders were analyzed for their morphology, nanocrystallite size and structures, aggregation tendency, local electronic properties, and elemental compositions by conventional and high-resolution transmission electron microscopy and field-emission analytical electron microscopy, including energy-dispersive X-ray and electron energy-loss spectroscopies. The results from this study indicate that a combination of nanocrystallite size, strain-induced grain-growth confinement, and the simultaneous presence of the monoclinic phase can lead to stabilization of the metastable tetragonal-phase in undoped ZrO2. As a result, the tetragonal phase is stabilized within ZrO2 nanocrystallites up to 100 nm in size, which is 16 times larger than the previously reported critical size of 6 nm.

  5. Memory and coupling in nanocrystal optoelectronic devices

    NASA Astrophysics Data System (ADS)

    Fairfield, Jessamyn A.

    Optoelectronic devices incorporating semiconducting nanocrystals are promising for many potential applications. Nanocrystals whose size is below the exciton Bohr radius have optical absorption and emission that is tunable with size, due to the quantum confinement of the charge carriers. However, the same confinement that yields these optical properties also makes electrical conduction in a film of nanocrystals occur via tunneling, due to the high energy barrier between nanocrystals. Hence, the extraction of photo-generated charge carriers presents a significant challenge. Several approaches to optimizing the reliability and efficiency of optoelectronic devices using semiconducting nanocrystals are explored herein. Force microscopy is used to investigate charge behavior in nanocrystal films. Plasmonic structures are lithographically defined to enhance electric field and thus charge collection efficiency in two-electrode nanocrystal devices illuminated at plasmonically resonant wavelengths. Graphene substrates are shown to couple electronically with nanocrystal films, improving device conduction while maintaining carrier quantum confinement within the nanocrystal. And finally, the occupancy of charge carrier traps is shown to both directly impact the temperature-dependent photocurrent behavior, and be tunable using a combination of illumination and electric field treatments. Trap population manipulation is robustly demonstrated and verified using a variety of wavelength, intensity, and time-dependent measurements of photocurrent in nanogap nanocrystal devices, emphasizing the importance of measurement history and the possibility of advanced device behavior tuning based on desired operating conditions. Each of these experiments reveals a path toward understanding and optimizing semiconducting nanocrystal optoelectronic devices.

  6. Controlling polymorphic structures and investigating electric properties of Ca-doped zirconia using solid state ceramic method

    SciTech Connect

    Emam, W.I.; Mabied, Ahmed F.; Hashem, H.M.; Selim, M.M.; El-Shabiny, A.M.; Ahmed Farag, I.S.

    2015-08-15

    Structural study of Zr{sub 1−x}Ca{sub x}O{sub 2−x} samples with x=0.01–0.15 were prepared using solid state ceramic method. X-ray diffraction analysis revealed a mixture of the high temperature phase and the monoclinic one for the samples with x≤0.05. On the other hand, the formation of a single high temperature cubic phase was observed within a concentration range of x=0.06–0.10. At concentrations higher than 0.10 the calcium zirconate phase was observed besides the dominant high temperature one. Rietveld refinement of the single phase data clearly revealed, that substitution of zirconium by calcium increases both the lattice parameters as well as the tetrahedral bond length. Ionic to electronic conductivity ratio enhanced considerably as Ca-doping level ascends. The dielectric constant shows strong temperature dependence at lower frequencies. The dielectric loss factor increases rapidly with the increase in temperature at lower frequencies, while decreases with the increase in frequency at higher temperatures. The ionic conduction is considered as the dominant process at higher temperatures. - Graphical abstract: Forming a high temperature cubic zirconia phase at 1200 °C using ceramic solid state method and aliovalent cation. - Highlights: • Formation the high temperature cubic polymorph of zirconia using Ca-doping. • Solid state ceramic method was used for preparing the cubic Ca-doped zirconia. • Substitution of zirconium by calcium increases the lattice parameters and the bond length. • Ionic to electronic conductivity ratio enhanced considerably as Ca-doping level increases.

  7. Y-TZP zirconia run against highly crosslinked UHMWPE tibial inserts: knee simulator wear and phase-transformation studies.

    PubMed

    Tsukamoto, Riichiro; Williams, Paul A; Clarke, Ian C; Pezzotti, Giuseppe; Shoji, Hiromu; Akagi, Masao; Yamamoto, Kengo

    2008-07-01

    Zirconia (ZrO(2)) ceramics combined with highly cross-linked polyethylene appears to be a promising approach to minimize wear in artificial knee joints. The wear performance of yttria-stabilized zirconia (YZr) femoral condyles on 7-Mrad tibial inserts was compared in a knee simulator to CoCr bearing on 3.5-Mrad inserts. The knee design was the Bi-Surface type with a 9-year clinical history in Japan (JMM, Japan). A displacement-controlled knee simulator was used with kinematics that included 20 degrees flexion, +/-5 degrees rotation, and 6 mm anterior/posterior translation. Lubricant was alpha-calf serum, test duration was 10 million cycles (10 Mc), and wear was measured by weight-loss techniques. The wear zones were studied by laser interferometry, scanning electron microscopy, and Raman microprobe spectroscopy. At 10 Mc the wear rates of the CoCr controls averaged 4.5 mm(3)/Mc. This was within 7% of the prior estimate at 5-Mc duration and comparable to Bi-Surface wear data from another laboratory. The CoCr condyles increased in roughness (R(a)) from <50 nm to average R(a) = 250 nm due to linear scratching. The ceramic condyles remained pristine throughout the wear study (R(a) <7 nm). With the YZr/7-Mrad combination, the weight change had a positive slope over at 10 Mc, which meant that the actual polyethylene wear was unmeasurable. Microscopic examinations at 10 Mc showed that the zirconia surfaces were intact and there was no detectable change from tetragonal to monoclinic phase. Our laboratory knee wear simulation appeared very supportive of the 9-year YZr/PE clinical results with Bi-Surface total knee replacements in Japan. 2007 Wiley Periodicals, Inc.

  8. Measurement of elastic constants of monoclinic nickel-titanium and validation of first principles calculations

    SciTech Connect

    Stebner, A. P.; Brown, D. W.; Brinson, L. C.

    2013-05-27

    Polycrystalline, monoclinic nickel-titanium specimens were subjected to tensile and compressive deformations while neutron diffraction spectra were recorded in situ. Using these data, orientation-specific and macroscopic Young's moduli are determined from analysis of linear-elastic deformation exhibited by 13 unique orientations of monoclinic lattices and their relationships to each macroscopic stress and strain. Five of 13 elastic compliance constants are also identified: s{sub 11} = 1.15, s{sub 15} = -1.10, s{sub 22} = 1.34, s{sub 33} = 1.06, s{sub 35} = -1.54, all Multiplication-Sign 10{sup -2} GPa{sup -1}. Through these results, recent atomistic calculations of monoclinic nickel-titanium elastic constants are validated.

  9. Injected nanocrystals for targeted drug delivery

    PubMed Central

    Lu, Yi; Li, Ye; Wu, Wei

    2016-01-01

    Nanocrystals are pure drug crystals with sizes in the nanometer range. Due to the advantages of high drug loading, platform stability, and ease of scaling-up, nanocrystals have been widely used to deliver poorly water-soluble drugs. Nanocrystals in the blood stream can be recognized and sequestered as exogenous materials by mononuclear phagocytic system (MPS) cells, leading to passive accumulation in MPS-rich organs, such as liver, spleen and lung. Particle size, morphology and surface modification affect the biodistribution of nanocrystals. Ligand conjugation and stimuli-responsive polymers can also be used to target nanocrystals to specific pathogenic sites. In this review, the progress on injected nanocrystals for targeted drug delivery is discussed following a brief introduction to nanocrystal preparation methods, i.e., top-down and bottom-up technologies. PMID:27006893

  10. Semiconductor Nanocrystals for Biological Imaging

    SciTech Connect

    Fu, Aihua; Gu, Weiwei; Larabell, Carolyn; Alivisatos, A. Paul

    2005-06-28

    Conventional organic fluorophores suffer from poor photo stability, narrow absorption spectra and broad emission feature. Semiconductor nanocrystals, on the other hand, are highly photo-stable with broad absorption spectra and narrow size-tunable emission spectra. Recent advances in the synthesis of these materials have resulted in bright, sensitive, extremely photo-stable and biocompatible semiconductor fluorophores. Commercial availability facilitates their application in a variety of unprecedented biological experiments, including multiplexed cellular imaging, long-term in vitro and in vivo labeling, deep tissue structure mapping and single particle investigation of dynamic cellular processes. Semiconductor nanocrystals are one of the first examples of nanotechnology enabling a new class of biomedical applications.

  11. Selected-control hydrothermal synthesis and formation mechanism of monazite- and zircon-type LaVO(4) nanocrystals.

    PubMed

    Fan, Weiliu; Song, Xinyu; Bu, Yuxiang; Sun, Sixiu; Zhao, Xian

    2006-11-23

    Selective-controlled structure and shape of LaVO(4) nanocrystals were successfully synthesized by a simple hydrothermal method without the presence of catalysts or templates. It was found that tuning the pH of the growth solution was a crucial step for the control of the structure transformation, that is, from monoclinic (m-) to tetragonal (t-) phase, and morphology evolution of LaVO(4) nanocrystals. Further studies demonstrated that the morphology of the product had a strong dependence on the initial lanthanum sources. In the La(NO(3))(3) or LaCl(3) reaction system, pure t-LaVO(4) nanorods with uniform diameters about 10 nm could be obtained. But when using La(2)(SO(4))(3) as the lanthanum source, we can get t-LaVO(4) nanowiskers with broomlike morphology. The detailed systematic study had shown that a special dissolution-recrystallization transformation mechanism as well as an Ostwald ripening process was responsible for the phase control and anisotropic morphology evolution of the LaVO(4) nanocrystals. As a result, the controlled synthesis of m- and t-LaVO(4) not only has great theoretical significance in studying the polymorph control and selective synthesis of inorganic materials but also benefits the potential applications based on LaVO(4) nanocrystals owing to the unusual luminescent properties induced by structural transformation.

  12. Anisotropy, phonon modes, and free charge carrier parameters in monoclinic β -gallium oxide single crystals

    NASA Astrophysics Data System (ADS)

    Schubert, M.; Korlacki, R.; Knight, S.; Hofmann, T.; Schöche, S.; Darakchieva, V.; Janzén, E.; Monemar, B.; Gogova, D.; Thieu, Q.-T.; Togashi, R.; Murakami, H.; Kumagai, Y.; Goto, K.; Kuramata, A.; Yamakoshi, S.; Higashiwaki, M.

    2016-03-01

    We derive a dielectric function tensor model approach to render the optical response of monoclinic and triclinic symmetry materials with multiple uncoupled infrared and far-infrared active modes. We apply our model approach to monoclinic β -Ga2O3 single-crystal samples. Surfaces cut under different angles from a bulk crystal, (010) and (2 ¯01 ), are investigated by generalized spectroscopic ellipsometry within infrared and far-infrared spectral regions. We determine the frequency dependence of 4 independent β -Ga2O3 Cartesian dielectric function tensor elements by matching large sets of experimental data using a point-by-point data inversion approach. From matching our monoclinic model to the obtained 4 dielectric function tensor components, we determine all infrared and far-infrared active transverse optic phonon modes with Au and Bu symmetry, and their eigenvectors within the monoclinic lattice. We find excellent agreement between our model results and results of density functional theory calculations. We derive and discuss the frequencies of longitudinal optical phonons in β -Ga2O3 . We derive and report density and anisotropic mobility parameters of the free charge carriers within the tin-doped crystals. We discuss the occurrence of longitudinal phonon plasmon coupled modes in β -Ga2O3 and provide their frequencies and eigenvectors. We also discuss and present monoclinic dielectric constants for static electric fields and frequencies above the reststrahlen range, and we provide a generalization of the Lyddane-Sachs-Teller relation for monoclinic lattices with infrared and far-infrared active modes. We find that the generalized Lyddane-Sachs-Teller relation is fulfilled excellently for β -Ga2O3 .

  13. Polarization states and dielectric responses of elastically clamped ferroelectric nanocrystals

    NASA Astrophysics Data System (ADS)

    Azovtsev, A. V.; Pertsev, N. A.

    2016-12-01

    Polarization states and physical properties of ferroelectrics depend on the mechanical boundary conditions due to electrostrictive coupling between electric polarization and lattice strains. Here, we describe theoretically both equilibrium thermodynamic states and electric permittivities of ferroelectric nanocrystals subjected to the elastic three-dimensional (3D) clamping by a surrounding dielectric material. The problem is solved by the minimization of a special thermodynamic potential that describes the case of an ellipsoidal ferroelectric inclusion embedded into a linear elastic matrix. Numerical calculations are performed for BaTiO3, PbTiO3, and Pb(Zr0.5Ti0.5)O3 nanoparticles surrounded by silica glass. It is shown that, in the case of BaTiO3 and PbTiO3, elastic 3D clamping may change the order of a ferroelectric phase transition from first to second. Furthermore, the mechanical inclusion-matrix interaction shifts the temperatures of structural transitions between different ferroelectric states and even eliminates some ferroelectric phases existing in stress-free BaTiO3 and Pb(Zr0.5Ti0.5)O3 crystals. Another important effect of elastic clamping is the lowering of the symmetry of ferroelectric states in ellipsoidal inclusions, where orthorhombic and monoclinic phases may form instead of the tetragonal and rhombohedral bulk counterparts. Finally, our thermodynamic calculations show that the dielectric responses of studied perovskite ferroelectrics are sensitive to matrix-induced clamping as well. For instance, dielectric peaks occurring at structural transitions between different ferroelectric phases in BaTiO3 appear to be much higher in spherical inclusions than in the freestanding crystal. Predicted clamping-induced enhancement of certain dielectric responses at room temperature indicates that composite materials comprising nanocrystals of perovskite ferroelectrics are promising for device applications requiring the use of high-permittivity dielectrics.

  14. Bone tissue response to experimental zirconia implants.

    PubMed

    Mihatovic, Ilja; Golubovic, Vladimir; Becker, Jürgen; Schwarz, Frank

    2017-03-01

    This study seeks to assess the bone tissue response at experimental zirconia implants in comparison with titanium implants by means of descriptive histology and histomorphometry in a dog model. Experimental zirconia implants with three different surface roughnesses (Z1 < Z2 < Z3) and conventional sandblasted large grit and acid-etched titanium implants were inserted bilaterally in the lower jaws of nine beagle dogs. Tissue biopsies were obtained after 3 and 14 days and 10 weeks of transmucosal healing. The tissue response was investigated by assessing new, old, and total bone-to-implant contact (nBIC, oBIC, and tBIC). After 3 days, histological specimens of all groups showed an intimate contact between the implant threads and pristine bone (tBIC: Ti 42.3 % > Z2 30.1 % > Z3 28.9 % > Z1 25.1 %, p > 0.05, unpaired t test, respectively). A provisional matrix was evident at all implant surfaces. At 14 days, percentages of BIC increased in all groups (tBIC: Ti 62.1 % > Z3 69.2 % < Z2 44.4 % > Z1 42.3 %; nBIC: Z3 58.9 % > Ti 52.2 % > Z2 35.1 % > Z1 32.5 %). Two implants, one of group Z1 and one of group Z2, were lost. At 10 weeks, 13 of 18 zirconia implants were lost, equally distributed between all three surface modifications. The remaining implants revealed increased BIC values (tBIC: Z3 69.5 % > Ti 58.5 % > Z1 49.7 % > Z2 37.1 %; nBIC: Z3 57.2 % > Ti 46.5 % > Z1 32.3 % > Z2 29.3 %). Histomorphometrical analysis showed comparable mean BIC values in all groups at all healing periods without showing statistical differences (p > 0.05, unpaired t test, respectively). The bone tissue response throughout the healing periods was characterized by a constant bone remodeling accompanied by resorption of old bone in favor of new bone formation at both titanium and zirconia implants. Surface roughness had a positive effect on BIC, although not showing statistical significance. Due to the poor survival rate, the

  15. Ternary Silver Halide Nanocrystals.

    PubMed

    Abeyweera, Sasitha C; Rasamani, Kowsalya D; Sun, Yugang

    2017-07-18

    Nanocrystalline silver halides (AgX) such as AgCl, AgBr, and AgI, a class of semiconductor materials with characteristics of both direct and indirect band gaps, represent the most crucial components in traditional photographic processing. The nanocrystal surfaces provide sensitivity specks that can turn into metallic silver, forming an invisible latent image, upon exposure to light. The photographic processing implies that the AgX nanoparticles possess unique properties. First, pristine AgX nanoparticles absorb light only at low efficiency to convert surface AgX into tiny clusters of silver atoms. Second, AgX nanoparticles represent an excellent class of materials to capture electrons efficiently. Third, small metallic silver clusters can catalyze the reduction of AgX nanoparticles to Ag nanoparticles in the presence of mild reducing reagents, known as self-catalytic reduction. These properties indicate that AgX nanoparticles can be partially converted to metallic silver with high precision, leading to the formation of hybrid AgX/Ag nanoparticles. The nanosized metallic Ag usually exhibit intense absorption bands in the visible spectral region due to their strong surface plasmon resonances, which make the AgX/Ag nanoparticles a class of promising visible-light-driven photocatalysts for environmental remediation and CO2 reduction. Despite the less attention paid to their ability of capturing electrons, AgX nanoparticles might be a class of ideal electron shuttle materials to bridge light absorbers and catalysts on which electrons can drive chemical transformations. In this Account, we focus on ternary silver halide alloy (TSHA) nanoparticles, containing two types of halide ions, which increase the composition complexity of the silver halide nanoparticles. Interdiffusion of halide ions between two types of AgX at elevated temperatures has been developed for fabricating ternary silver halide alloy crystals, such as silver chlorobromide optical fibers for infrared

  16. [Microwave sintering of nanometer powder of alumina and zirconia-based dental ceramics].

    PubMed

    Chen, Yi-Fan; Lu, Dong-Mei; Wan, Qian-Bing; Jin, Yong; Zhu, Ju-Mu

    2006-02-01

    The objective of the present study was to investigate the feasibility and reliability of sintering alumina and zirconia-based all-ceramic materials through a recently introduced microwave heating technique. The variation of crystal phases, the growth of grain sizes and microstructural features of these materials were evaluated after sintering. Four different groups of powder (l00%Al2O3, 60%Al2O3+40%ZrO2, 40% Al2O3+60%ZrO2, 100% ZrO2) were respectively press-compacted to fabricate green disk samples, 5 specimen of each group were prepared. All the samples were surrounded by refractory materials for heat containment and processed at 1 600 degrees C in a domestic microwave oven (850 W, 2 450 MHz), 1 600 degrees C/5 min for heating rate, 10 min for holding time. After sintering, the phase composition and average grain size of these ceramics were examined using X-ray diffraction (XRD). Their microstructure characteristics were studied by scanning electron microscopy (SEM). All the specimens were successfully sintered with the application of microwave heating system in combination with a suitable thermal insulator. No phase change was found in alumina while monoclinic-zirconia was found to be transformed to tetragonal-zirconia. A little grain size growth of Al2O3 and ZrO2 has been observed with Al2O3 24.1 nm/before and 51.8 nm/after; ZrO2 25.3 nm/before and 29.7 nm/after. The SEM photos indicated that the microwave-sintered Al2O3-ZrO2 ceramics had a uniform crystal distribution and their crystal sizes could be maintained within the range of nanometers. It is expected that in the near future microwave heating system could be a promising substitute for conventional processing methods due to its unparalled advantages, including more rapid heating rate, shortened sintering time, superfine grain size, improved microstructure and much less expensive equipment.

  17. Assessment and comparison of retention of zirconia copings luted with different cements onto zirconia and titanium abutments: An in vitro study

    PubMed Central

    Menon, Neelima Sreekumar; Kumar, G. P. Surendra; Jnanadev, K. R.; Satish Babu, C. L.; Shetty, Shilpa

    2016-01-01

    Aim: The purpose of this in vitro study was to assess and compare the retention of zirconia copings luted with different luting agents onto zirconia and titanium abutments. Materials and Methods: Titanium and zirconia abutments were torqued at 35 N/cm onto implant analogs. The samples were divided into two groups: Group A consisted of four titanium abutments and 32 zirconia copings and Group B consisted of four zirconia abutments and 32 zirconia copings and four luting agents were used. The cemented copings were subjected to tensile dislodgement forces and subjected to ANOVA test. Results: Zirconia abutments recorded a higher mean force compared to titanium. Among the luting agents, resin cement recorded the highest mean force followed by zinc phosphate, glass ionomer, and noneugenol zinc oxide cement, respectively. Conclusion: Highest mean retention was recorded for zirconia implant abutments compared to titanium abutments when luted with zirconia copings. PMID:27141162

  18. Light transmittance by a multi-coloured zirconia material.

    PubMed

    Ueda, Kazuhiko; Güth, Jan-Frederik; Erdelt, Kurt; Stimmelmayr, Michael; Kappert, Heinrich; Beuer, Florian

    2015-01-01

    Full-contour zirconia restorations are gaining in popularity. Highly translucent zirconia materials and multi-coloured zirconia blocks might help to overcome the aesthetic drawbacks of traditional zirconia. This study evaluated the transmittance of visible light (400-700 nm) through the four different layers (Enamel Layer EL, Transition Layer 1 TL1, Transition Layer 2 TL2, Body Layer BL) of a multi-coloured zirconia block (KATANA™ Zirconia Multi-Layered Disc (ML)) using a spectrophotometer. Forty specimens (thickness of 1±0.05 mm) from each layer were examined and statistically evaluated at a confidence-level of 5%. Light transmittance was expressed as a percentage of the through-passing light. The following mean values (SD) were found: EL 32.8% (1.5), TL1 31.2% (1.3), TL2 25.4% (1.3) and BL 21.7% (1.1). Significant differences were found between all groups (ANOVA, Student-Newman-Keuls). This multi-coloured zirconia block showed four layers with different light transmittance capabilities. It might therefore be useful for enhancing the aesthetic appearance of full-contour zirconia restorations made from this material.

  19. Initial bacterial adhesion on resin, titanium and zirconia in vitro

    PubMed Central

    Lee, Byung-Chul; Jung, Gil-Yong; Kim, Dae-Joon

    2011-01-01

    PURPOSE The aim of this in vitro study was to investigate the adhesion of initial colonizer, Streptococcus sanguis, on resin, titanium and zirconia under the same surface polishing condition. MATERIALS AND METHODS Specimens were prepared from Z-250, cp-Ti and 3Y-TZP and polished with 1 µm diamond paste. After coating with saliva, each specimen was incubated with Streptococcus sanguis. Scanning electron microscope, crystal violet staining and measurement of fluorescence intensity resulting from resazurin reduction were performed for quantifying the bacterial adhesion. RESULTS Surface of resin composite was significantly rougher than that of titanium and zirconia, although all tested specimens are classified as smooth. The resin specimens showed lower value of contact angle compared with titanium and zirconia specimens, and had hydrophilic surfaces. The result of scanning electron microscopy demonstrated that bound bacteria were more abundant on resin in comparison with titanium and zirconia. When total biofilm mass determined by crystal violet, absorbance value of resin was significantly higher than that of titanium or zirconia. The result of relative fluorescence intensities also demonstrated that the highest fluorescence intensity was found on the surface of resin. Absorbance value and fluorescence intensity on titanium was not significantly different from those on zirconia. CONCLUSION Resin specimens showed the roughest surface and have a significantly higher susceptibility to adhere Streptococcus sanguis than titanium and zirconia when surfaces of each specimen were polished under same condition. There was no significant difference in bacteria adhesion between titanium and zirconia in vitro. PMID:21814616

  20. Evidence for anisotropic dielectric properties of monoclinic hafnia using valence electron energy-loss spectroscopy in high-resolution transmission electron microscopy and ab initio time-dependent density-functional theory

    NASA Astrophysics Data System (ADS)

    Guedj, C.; Hung, L.; Zobelli, A.; Blaise, P.; Sottile, F.; Olevano, V.

    2014-12-01

    The effect of nanocrystal orientation on the energy loss spectra of monoclinic hafnia (m-HfO2) is measured by high resolution transmission electron microscopy (HRTEM) and valence energy loss spectroscopy (VEELS) on high quality samples. For the same momentum-transfer directions, the dielectric properties are also calculated ab initio by time-dependent density-functional theory (TDDFT). Experiments and simulations evidence anisotropy in the dielectric properties of m-HfO2, most notably with the direction-dependent oscillator strength of the main bulk plasmon. The anisotropic nature of m-HfO2 may contribute to the differences among VEELS spectra reported in literature. The good agreement between the complex dielectric permittivity extracted from VEELS with nanometer spatial resolution, TDDFT modeling, and past literature demonstrates that the present HRTEM-VEELS device-oriented methodology is a possible solution to the difficult nanocharacterization challenges given in the International Technology Roadmap for Semiconductors.

  1. Evidence for anisotropic dielectric properties of monoclinic hafnia using valence electron energy-loss spectroscopy in high-resolution transmission electron microscopy and ab initio time-dependent density-functional theory

    SciTech Connect

    Guedj, C.; Hung, L.; Sottile, F.; Zobelli, A.; Blaise, P.; Olevano, V.

    2014-12-01

    The effect of nanocrystal orientation on the energy loss spectra of monoclinic hafnia (m-HfO{sub 2}) is measured by high resolution transmission electron microscopy (HRTEM) and valence energy loss spectroscopy (VEELS) on high quality samples. For the same momentum-transfer directions, the dielectric properties are also calculated ab initio by time-dependent density-functional theory (TDDFT). Experiments and simulations evidence anisotropy in the dielectric properties of m-HfO{sub 2}, most notably with the direction-dependent oscillator strength of the main bulk plasmon. The anisotropic nature of m-HfO{sub 2} may contribute to the differences among VEELS spectra reported in literature. The good agreement between the complex dielectric permittivity extracted from VEELS with nanometer spatial resolution, TDDFT modeling, and past literature demonstrates that the present HRTEM-VEELS device-oriented methodology is a possible solution to the difficult nanocharacterization challenges given in the International Technology Roadmap for Semiconductors.

  2. Damage Maps of Veneered Zirconia under Simulated Mastication

    PubMed Central

    Kim, Jae-Won; Kim, Joo-Hyung; Janal, Malvin N.; Zhang, Yu

    2016-01-01

    Zirconia based restorations often fracture from chipping and/or delamination of the porcelain veneers. We hypothesize that veneer chipping/delamination is a result of the propagation of near-contact induced partial cone cracks on the occlusal surface under mastication. Masticatory loading involves the opposing tooth sliding along the cuspal inner incline surface with an applied biting force. To test this hypothesis, flat porcelain veneered zirconia plates were cemented to dental composites and cyclically loaded (contact–slide–liftoff) at an inclination angle as a simplified model of zirconia based restorations under occlusion. In the light of in-situ observation of damage evolution in a transparent glass/zirconia/polycarbonate trilayer, postmortem damage evaluation of porcelain/zirconia/composite trilayers using a sectioning technique revealed that deep penetrating occlusal surface partial cone fracture is the predominant fracture mode of porcelain veneers. Clinical relevance is discussed. PMID:19029080

  3. Damage maps of veneered zirconia under simulated mastication.

    PubMed

    Kim, J-W; Kim, J-H; Janal, M N; Zhang, Y

    2008-12-01

    Zirconia-based restorations often fracture from chipping and/or delamination of the porcelain veneers. We hypothesized that veneer chipping/delamination is a result of the propagation of near-contact-induced partial cone cracks on the occlusal surface under mastication. Masticatory loading involves the opposing tooth sliding along the cuspal inner incline surface with an applied biting force. To test this hypothesis, we cemented flat porcelain-veneered zirconia plates onto dental composites and cyclically loaded them (contact-slide-liftoff) at an inclination angle as a simplified model of zirconia-based restorations under occlusion. In light of in situ observation of damage evolution in a transparent glass/zirconia/polycarbonate trilayer, post mortem damage evaluation of porcelain/zirconia/composite trilayers by a sectioning technique revealed that deep-penetrating occlusal surface partial cone fracture is the predominant fracture mode of porcelain veneers. Clinical relevance is discussed.

  4. "Nanocrystal bilayer for tandem catalysis"

    SciTech Connect

    Yamada, Yusuke; Tsung, Chia Kuang; Huang, Wenyu; Huo, Ziyang; E.Habas, Susan E; Soejima, Tetsuro; Aliaga, Cesar E; Samorjai, Gabor A; Yang, Peidong

    2011-01-24

    Supported catalysts are widely used in industry and can be optimized by tuning the composition and interface of the metal nanoparticles and oxide supports. Rational design of metal-metal oxide interfaces in nanostructured catalysts is critical to achieve better reaction activities and selectivities. We introduce here a new class of nanocrystal tandem catalysts that have multiple metal-metal oxide interfaces for the catalysis of sequential reactions. We utilized a nanocrystal bilayer structure formed by assembling platinum and cerium oxide nanocube monolayers of less than 10 nm on a silica substrate. The two distinct metal-metal oxide interfaces, CeO2-Pt and Pt-SiO2, can be used to catalyse two distinct sequential reactions. The CeO2-Pt interface catalysed methanol decomposition to produce CO and H2, which were subsequently used for ethylene hydroformylation catalysed by the nearby Pt-SiO2 interface. Consequently, propanal was produced selectively from methanol and ethylene on the nanocrystal bilayer tandem catalyst. This new concept of nanocrystal tandem catalysis represents a powerful approach towards designing high-performance, multifunctional nanostructured catalysts

  5. Exciton polarizability in semiconductor nanocrystals.

    PubMed

    Wang, Feng; Shan, Jie; Islam, Mohammad A; Herman, Irving P; Bonn, Mischa; Heinz, Tony F

    2006-11-01

    The response of charge to externally applied electric fields is an important basic property of any material system, as well as one critical for many applications. Here, we examine the behaviour and dynamics of charges fully confined on the nanometre length scale. This is accomplished using CdSe nanocrystals of controlled radius (1-2.5 nm) as prototype quantum systems. Individual electron-hole pairs are created at room temperature within these structures by photoexcitation and are probed by terahertz (THz) electromagnetic pulses. The electronic response is found to be instantaneous even for THz frequencies, in contrast to the behaviour reported in related measurements for larger nanocrystals and nanocrystal assemblies. The measured polarizability of an electron-hole pair (exciton) amounts to approximately 10(4) A(3) and scales approximately as the fourth power of the nanocrystal radius. This size dependence and the instantaneous response reflect the presence of well-separated electronic energy levels induced in the system by strong quantum-confinement effects.

  6. Effect of in vitro aging on the flexural strength and probability to fracture of Y-TZP zirconia ceramics for all-ceramic restorations.

    PubMed

    Siarampi, Eleni; Kontonasaki, Eleana; Andrikopoulos, Konstantinos S; Kantiranis, Nikolaos; Voyiatzis, George A; Zorba, Triantafillia; Paraskevopoulos, Konstantinos M; Koidis, Petros

    2014-12-01

    Dental zirconia restorations should present long-term clinical survival and be in service within the oral environment for many years. However, low temperature degradation could affect their mechanical properties and survival. The aim of this study was to investigate the effect of in vitro aging on the flexural strength of yttrium-stabilized (Y-TZP) zirconia ceramics for ceramic restorations. One hundred twenty bar-shaped specimens were prepared from two ceramics (ZENO Zr (WI) and IPS e.max(®) ZirCAD (IV)), and loaded until fracture according to ISO 6872. The specimens from each ceramic (nx=60) were divided in three groups (control, aged for 5h, aged for 10h). One-way ANOVA was used to assess statistically significant differences among flexural strength values (P<0.05). The variability of the flexural strength values was analyzed using the two-parameter Weibull distribution function, which was applied for the estimation of Weibull modulus (m) and characteristic strength (σ0). The crystalline phase polymorphs of the materials (tetragonal, t, and monoclinic, m, zirconia) were investigated by X-ray diffraction (XRD) analysis, Raman spectroscopy and Fourier transform infrared (FTIR) spectroscopy. A slight increase of the flexural strength after 5h, and a decrease after 10h of aging, was recorded for both ceramics, however statistically significant was for the WI group (P<0.05). Both ceramics presented a t→m phase transformation, with the m-phase increasing from 4 to 5% at 5h to around 15% after 10h. The significant reduction of the flexural strength after 10h of in vitro aging, suggests high fracture probability for one of the zirconia ceramics tested. Copyright © 2014 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  7. Effect of heat treatment and in vitro aging on the microstructure and mechanical properties of cold isostatic-pressed zirconia ceramics for dental restorations.

    PubMed

    Vatali, Anna; Kontonasaki, Eleana; Kavouras, Panagiotis; Kantiranis, Nikolaos; Papadopoulou, Lambrini; Paraskevopoulos, Konstantinos K M; Koidis, Petros

    2014-10-01

    The temperature variations during the veneering firing cycles of a zirconia dental ceramic can negatively affect its mechanical properties. A possible synergistic effect of both heat-treatment and aging while exposed to the oral environment could result to catastrophic failure. The aim of the present study was to investigate the effect of heat treatment followed during veneering and in vitro aging on the mechanical and microstructural properties of zirconia dental ceramics. Three specimens from each of two zirconia blocks (Ivoclar IPS e.max ZirCAD (IV) and Wieland ZENO Zr (WI)) were cut by CAD/CAM technology, fully sintered and polished. Each one was cut in four equal parts. One part was used as control (C), one was heat-treated (H), one was aged (A) (134°C, 2bar, 10h) and one was heat-treated and subsequently aged (HA). The mechanical properties (nano-hardness (H) and elastic modulus (E*)) were investigated by nano-indentation tests while the surface characterization was carried out with XRD, FTIR and SEM. Different treatments on IV and WI samples resulted in a reduction of both H and E* values, however the differences were not statistically significant (p>0.05). The combination of treatments imposes an overall effect (p<0.001), enhancing the influence on both H and E* values. This reduction in mechanical properties was followed by an increase of monoclinic content. Greater variations in both H and E* values were recorded for WI samples. The clinical performance of zirconia dental ceramics may be affected during firing and aging resulting in increased probability of failure. Copyright © 2014 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  8. Nanocrystals Research for Energy Efficient and Clean Energy Technologies:

    SciTech Connect

    Rosenthal, Sandra J

    2013-12-17

    Efforts centered on: nanocrystal photovoltaic fabrication, ultrafast dynamics and aberration-corrected STEM characterization of II-VI core, core/shell and alloyed nanocrystals, and fundamental investigation and applications of ultrasmall white light-emitting CdSe nanocrystal.

  9. Comparison of fracture resistance and fit accuracy of customized zirconia abutments with prefabricated zirconia abutments in internal hexagonal implants.

    PubMed

    Park, Jong-Il; Lee, Yoon; Lee, Jin-Han; Kim, Yu-Lee; Bae, Ji-Myung; Cho, Hye-Won

    2013-10-01

    Customized zirconia abutments are increasingly applied for the fabrication of esthetic implant restorations aimed at imitating the natural situation. These abutments are individually shaped according to the anatomical needs of the respective implant site. This study sought to compare the fracture resistance and fit accuracy of prefabricated and customized zirconia abutments using an internal hexagonal implant system (TSV®, Zimmer, Carlsbad, CA, USA). Two zirconia abutment groups were tested: prefabricated zirconia abutments (ZirAce, Acucera, Seoul, Korea) and customized zirconia abutments milled by the Zirkonzahn milling system. Twenty zirconia abutments per group were connected to implants on an acrylic resin base with 30-Ncm torque. The fracture resistance of zirconia abutments was measured with an angle of 30° at a crosshead speed of 1 mm/min using the universal testing machine (Z020, Zwick, Ulm, Germany). Marginal and internal gaps between implants and zirconia abutments were measured after sectioning the embedded specimens using a digital microhardness tester (MXT70, Matsuzawa, Tokyo, Japan). The customized abutments were significantly stronger (1,430.2 N) than the prefabricated abutments (1,064.1 N). The mean marginal adaptation of customized abutments revealed a microgap that was increased (11.5 µm) over that in prefabricated abutments (4.3 µm). Within the limitations of this study, the customized abutments are significantly stronger than prefabricated abutments, but the fit is less accurate. The strength and fit of both abutments are within clinically acceptable limit. © 2012 Wiley Periodicals, Inc.

  10. Clinical assessment of enamel wear caused by monolithic zirconia crowns.

    PubMed

    Stober, T; Bermejo, J L; Schwindling, F S; Schmitter, M

    2016-08-01

    The purpose of this study was to measure enamel wear caused by antagonistic monolithic zirconia crowns and to compare this with enamel wear caused by contralateral natural antagonists. Twenty monolithic zirconia full molar crowns were placed in 20 patients. Patients with high activity of the masseter muscle at night (bruxism) were excluded. For analysis of wear, vinylpolysiloxane impressions were prepared after crown incorporation and at 6-, 12-, and 24-month follow-up. Wear of the occlusal contact areas of the crowns, of their natural antagonists, and of two contralateral natural antagonists (control teeth) was measured by use of plaster replicas and a 3D laser-scanning device. Differences of wear between the zirconia crown antagonists and the control teeth were investigated by means of two-sided paired Student's t-tests and linear regression analysis. After 2 years, mean vertical loss was 46 μm for enamel opposed to zirconia, 19-26 μm for contralateral control teeth and 14 μm for zirconia crowns. Maximum vertical loss was 151 μm for enamel opposed to zirconia, 75-115 μm for control teeth and 60 μm for zirconia crowns. Statistical analysis revealed significant differences between wear of enamel by zirconia-opposed teeth and by control teeth. Gender, which significantly affected wear, was identified as a possible confounder. Monolithic zirconia crowns generated more wear of opposed enamel than did natural teeth. Because of the greater wear caused by other dental ceramics, the use of monolithic zirconia crowns may be justified.

  11. On the relation between steep monoclinal flexure zones and steep hydraulic gradients.

    PubMed

    Yechieli, Y; Kafri, U; Wollman, S; Lyakhovsky, V; Weinberger, R

    2007-01-01

    Steep hydraulic gradients are found in association with steep monoclinal flexures. However, the physics of the reduction of the hydraulic conductivity, which is responsible for the steep gradients, has seldom been studied. We present results of hydrological and mechanical modeling aiming to study the effect of such steep hydraulic gradients demonstrated in the Judea Group Aquifer system, Israel. The hydrological configuration of steep dips and anisotropy between flows parallel and perpendicular to the bedding planes was simulated using the FEFLOW code. It exhibited a situation whereby part of the flow is oblique to the bedding planes and therefore some steepening of the hydraulic gradients occurred due to actual conductivity reduction. However, this reduction is not enough to account for the steeper gradients observed. The effect of a deep-seated reverse fault under the monocline on the permeability distribution within the structure was examined by numerical mechanical simulations. It exhibited a compressional stress distribution in the steep part of the monocline, which, due to shortening and closure of joints and voids, is presumably responsible for a significant pressure-induced permeability reduction. This process by itself in a layered structure, including interlayering of thin marl layers, could be responsible for the steep hydraulic gradients in the steep part of the monocline.

  12. Influence of multimode universal adhesives and zirconia primer application techniques on zirconia repair.

    PubMed

    Seabra, Bruno; Arantes-Oliveira, Sofia; Portugal, Jaime

    2014-08-01

    More information is needed on the efficacy of the new universal adhesives and on the best 10-methacryloyloxydecyl dihydrogen phosphate- (MDP)-containing primer protocol to promote adhesion to zirconia. The aim of this study was to evaluate the influence of 2 new multimode MDP-containing adhesives and several application protocols of a zirconia primer on the shear bond strength (SBS) of composite resin to zirconia. Sixty zirconia (3Y-TZP) blocks were abraded (50 μm Al2O3) and divided into 6 experimental groups (n=10): one Z-Prime Plus coat without light polymerization; one Z-Prime Plus light-polymerized coat; two Z-Prime Plus coats without light polymerization; two Z-Prime Plus light-polymerized coats; All-Bond Universal; and ScotchBond Universal Adhesive. Multimode adhesives were applied according to the manufacturers' recommendations. After composite resin (Filtek Z250) light polymerization, the specimens were stored in distilled water (37°C/48 hours) and tested in shear (1 mm/min). Failure mode was classified as adhesive or mixed. Statistical analysis of the SBS data was performed with 1-way ANOVA followed by the Student-Newman-Keuls post hoc tests. Nonparametric tests (Kruskal-Wallis) were used to analyze the failure mode data (α=.05). The ScotchBond Universal Adhesive, All-Bond Universal, and two Z-Prime Plus light-polymerized coats groups showed a higher mean SBS than the other experimental groups (P<.05). The 3 groups with the lowest mean SBS registered 100% of adhesive failures. The new multimode adhesives tested were effective in promoting adhesion between composite resin and zirconia. Z-Prime Plus should be applied in 2 light-polymerized coats to promote SBS values similar to those of the new multimode adhesives. Copyright © 2014 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.

  13. Microstructure and mechanical properties of bulk yttria-partially-stabilized zirconia

    NASA Technical Reports Server (NTRS)

    Valentine, P. G.; Maier, R. D.; Mitchell, T. E.

    1981-01-01

    A commercially available bulk 4.5 mole percent yttria-Y2O3)-partially-stabilized zirconia (PSZ) was studied by light microscopy, X-ray analysis, microhardness measurement, and fracture toughness testing. The growth of the precipitates and the phase transformations were studied as a function of aging in air at 1500 C. Aging cuves were constructed for both the as-received and the solution-annealed-and-quenched materials; the curves showed hardness peaks at 1397 and 1517 kg/sq mm, respectively. A total of twelve different types of tetragonal precipitates were found. The rectangular plate-shaped tetragonal precipitates were found to have a (110) habit plane. Grinding of the Y2O3 PSZ into powder did not cause a significant amount of metastable tetragonal precipitates to transform into the monoclinic phase, thus indicating that transformation toughening is not a significant mechanism for the material. The fracture toughness of the aged and of the unaged solution-annealed-and-quenched PSZ was found to be between 2 and 3 MN/cu m/2.

  14. Sem analysis zirconia-ceramic adhesion interface

    PubMed Central

    CARDELLI, P.; VERTUCCI, V.; MONTANI, M.; ARCURI, C.

    2015-01-01

    SUMMARY Objectives Modern dentistry increasingly tends to use materials aesthetically acceptable and biomimetic. Among these are zirconia and ceramics for several years, a combination that now has becoming synonym of aesthetic; however, what could be the real link between these two materials and especially its nature, remains a controversial topic debated in the literature. The aim of our study was to “underline” the type of bonding that could exist between these materials. Materials and methods To investigate the nature of this bond we used a SEM microscopy (Zeiss SUPRA 25). Different bilaminar specimens: “white” zirconia Zircodent® and ceramic “Noritake®”, after being tested with loading test in bending (three-point-bending) and FEM analysis, were analyzed by SEM. Fragments’ analysis in closeness of the fracture’s point has allowed us to be able to “see” if at large magnifications between these two materials, and without the use of linear, could exist a lasting bond and the possible type of failure that could incur. Results From our analysis of the specimens’ fragments analyzed after test Equipment, it is difficult to highlight a clear margin and no-adhesion zones between the two materials, although the analysis involving fragments adjacent to the fracture that has taken place at the time of Mechanical test Equipment. Conclusions According to our analysis and with all the clarification of the case, we can assume that you can obtain a long and lasting bond between the zirconia and ceramics. Agree to the data present in the literature, we can say that the type of bond varies according to the type of specimens and of course also the type of failure. In samples where the superstructure envelops the ceramic framework Zirconium we are in the presence of a cohesive failure, otherwise in a presence of adhesive failure. PMID:27555905

  15. Thermal conductivity of zirconia thermal barrier coatings

    NASA Technical Reports Server (NTRS)

    Dinwiddie, R. B.; Beecher, S. C.; Nagaraj, B. A.; Moore, C. S.

    1995-01-01

    Thermal barrier coatings (TBC's) applied to the hot gas components of turbine engines lead to enhanced fuel efficiency and component reliability. Understanding the mechanisms which control the thermal transport behavior of the TBC's is of primary importance. Physical vapor deposition (PVD) and plasma spraying (PS) are the two most commonly used coating techniques. These techniques produce coatings with unique microstructures which control their performance and stability. The PS coatings were applied with either standard powder or hollow sphere particles. The hollow sphere particles yielded a lower density and lower thermal conductivity coating. The thermal conductivity of both fully and partially stabilized zirconia, before and after thermal aging, will be compared. The thermal conductivity of the coatings permanently increases upon exposed to high temperatures. These increases are attributed to microstructural changes within the coatings. Sintering of the as-fabricated plasma sprayed lamellar structure is observed by scanning electron microscopy of coatings isothermally heat treated at temperatures greater than 1100 C. During this sintering process the planar porosity between lamella is converted to a series of small spherical pores. The change in pore morphology is the primary reason for the observed increase in thermal conductivity. This increase in thermal conductivity can be modeled using a relationship which depends on both the temperature and time of exposure. Although the PVD coatings are less susceptible to thermal aging effects, preliminary results suggest that they have a higher thermal conductivity than PS coatings, both before and after thermal aging. The increases in thermal conductivity due to thermal aging for partially stabilized plasma sprayed zirconia have been found to be less than for fully stabilized plasma sprayed zirconia coatings. The high temperature thermal diffusivity data indicate that if these coatings reach a temperature above 1100 C

  16. Thermal conductivity of zirconia thermal barrier coatings

    NASA Technical Reports Server (NTRS)

    Dinwiddie, R. B.; Beecher, S. C.; Nagaraj, B. A.; Moore, C. S.

    1995-01-01

    Thermal barrier coatings (TBC's) applied to the hot gas components of turbine engines lead to enhanced fuel efficiency and component reliability. Understanding the mechanisms which control the thermal transport behavior of the TBC's is of primary importance. Physical vapor description (PVD) and plasma spraying (PS) are the two most commonly used coating techniques. These techniques produce coatings with unique microstructures which control their performance and stability. The PS coatings were applied with either standard power or hollow sphere particles. The hollow sphere particles yielded a lower density and lower thermal conductivity coating. The thermal conductivity of both fully and partially stabilized zirconia, before and after thermal aging, will be compared. The thermal conductivity of the coatings permanently increase upon being exposed to high temperatures. These increases are attributed to microstructural changes within the coatings. Sintering of the as fabricated plasma sprayed lamellar structure is observed by scanning electron microscopy of coatings isothermally heat treated at temperatures greater than 1100 C. During this sintering process the planar porosity between lamella is converted to a series of small spherical pores. The change in pore morphology is the primary reason for the observed increase in thermal conductivity. This increase in thermal conductivity can be modeled using a relationship which depends on both the temperature and time of exposure. Although the PVD coatings are less susceptible to thermal aging effects, preliminary results suggest that they have a higher thermal conductivity than PS coatings, both before and after thermal aging. The increases in thermal conductivity due to thermal aging for partially stabilized plasma sprayed zirconia have been found to be less than for fully stabilized plasma sprayed zirconia coatings. The high temperature thermal diffusivity data indicates that if these coatings reach a temperature above

  17. Sem analysis zirconia-ceramic adhesion interface.

    PubMed

    Cardelli, P; Vertucci, V; Montani, M; Arcuri, C

    2015-01-01

    Modern dentistry increasingly tends to use materials aesthetically acceptable and biomimetic. Among these are zirconia and ceramics for several years, a combination that now has becoming synonym of aesthetic; however, what could be the real link between these two materials and especially its nature, remains a controversial topic debated in the literature. The aim of our study was to "underline" the type of bonding that could exist between these materials. To investigate the nature of this bond we used a SEM microscopy (Zeiss SUPRA 25). Different bilaminar specimens: "white" zirconia Zircodent® and ceramic "Noritake®", after being tested with loading test in bending (three-point-bending) and FEM analysis, were analyzed by SEM. Fragments' analysis in closeness of the fracture's point has allowed us to be able to "see" if at large magnifications between these two materials, and without the use of linear, could exist a lasting bond and the possible type of failure that could incur. From our analysis of the specimens' fragments analyzed after test Equipment, it is difficult to highlight a clear margin and no-adhesion zones between the two materials, although the analysis involving fragments adjacent to the fracture that has taken place at the time of Mechanical test Equipment. According to our analysis and with all the clarification of the case, we can assume that you can obtain a long and lasting bond between the zirconia and ceramics. Agree to the data present in the literature, we can say that the type of bond varies according to the type of specimens and of course also the type of failure. In samples where the superstructure envelops the ceramic framework Zirconium we are in the presence of a cohesive failure, otherwise in a presence of adhesive failure.

  18. Structural, microstructural and vibrational analyses of the monoclinic tungstate BiLuWO{sub 6}

    SciTech Connect

    Ait Ahsaine, H.; Taoufyq, A.; Patout, L.; Ezahri, M.; Benlhachemi, A.; Bakiz, B.; Villain, S.; Guinneton, F.; Gavarri, J.-R.

    2014-10-15

    The bismuth lutetium tungstate phase BiLuWO{sub 6} has been prepared using a solid state route with stoichiometric mixtures of oxide precursors. The obtained polycrystalline phase has been characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and Raman spectroscopy. In the first step, the crystal structure has been refined using Rietveld method: the crystal cell was resolved using monoclinic system (parameters a, b, c, β) with space group A2/m. SEM images showed the presence of large crystallites with a constant local nominal composition (BiLuW). TEM analyses showed that the actual local structure could be better represented by a superlattice (a, 2b, c, β) associated with space groups P2 or P2/m. The Raman spectroscopy showed the presence of vibrational bands similar to those observed in the compounds BiREWO{sub 6} with RE=Y, Gd, Nd. However, these vibrational bands were characterized by large full width at half maximum, probably resulting from the long range Bi/Lu disorder and local WO{sub 6} octahedron distortions in the structure. - Graphical abstract: The average structure of BiLuWO{sub 6} determined from X-ray diffraction data can be represented by A2/m space group. Experimental Electron Diffraction patterns along the [0vw] zone axes of the monoclinic structure and associated simulated patterns show the existence of a monoclinic superstructure with space group P2 or P2/m. - Highlights: • A new monoclinic BiLuWO{sub 6} phase has been elaborated from solid-state reaction. • The space group of the monoclinic disordered average structure should be A2/m. • Transmission electron microscopy leads to a superlattice with P2/m space group. • Raman spectroscopy suggests existence of local disorder.

  19. Microwave sintering of continuous zirconia ceramic fibers

    SciTech Connect

    Vogt, G.J.; Unruh, W.P.; Plovnick, R.H.

    1994-04-01

    Continuous yttria-stabilized zirconia ceramic fibers approximately 10-15 {mu}m in diameter have been rapidly sintered by pulling them through a tuned, 2.45 GHz single-mode TE{sub 103} microwave cavity in ambient air. The resulting fibers were analyzed by X-ray diffraction, scanning electron microscopy, and single-filament tensile tests. They were found to be unsplit, to have a submicron grain structure and a tetragonal crystal structure, and to exhibit considerable strength and flexibility.

  20. Hafnia-rich mixed oxide ceramics of the system HfO2-ZrO2-TiO2 for heaters and heat exchangers in electrothermal thrusters: The effects of titania on selected electrical and mechanical properties of Hafnia-rich mixed oxides in the system Hafnia-Zirconia-Titania, volume 1

    NASA Technical Reports Server (NTRS)

    Staszak, Paul Russell; Wirtz, G. P.; Berg, M.; Brown, S. D.

    1988-01-01

    A study of the effects of titania on selected properties of hafnia-rich mixed oxides in the system hafnia-zirconia-titania (HZT) was made in the region 5 to 20 mol percent titania. The studied properties included electrical conductivity, thermal expansion, and fracture strength and toughness. The effects of titania on the properties were studied for the reduced state as well as the oxidized state of the sintered mixed oxides. X-ray analysis showed that the materials were not always single phase. The oxidized compositions went from being monoclinic solid solutions at low titania additions to having three phases (two monoclinic and a titanate phase) at high additions of titania. The reduced compositions showed an increasing cubic phase presence mixed with the monoclinic phase as titania was added. The electrical conductivity increased with temperature at approximately 0.1 mhos/cm at 1700 C for all compositions. The thermal expansion coefficient decreased with increasing titania as did the monoclinic to tetragonal transformation temperature. The fracture strength of the oxidized bars tended to decrease with the addition of titania owing to the presence of the second phase titania. The fracture strength of the reduced bars exhibited a minimum corresponding to a two-phase region of monoclinic and cubic phases. When the second phases were suppressed, the titania tended to increase the fracture strength slightly in both the oxidized and reduced states. The fracture toughness followed similar trends.

  1. Cellulose nanocrystals: synthesis, functional properties, and applications

    PubMed Central

    George, Johnsy; Sabapathi, SN

    2015-01-01

    Cellulose nanocrystals are unique nanomaterials derived from the most abundant and almost inexhaustible natural polymer, cellulose. These nanomaterials have received significant interest due to their mechanical, optical, chemical, and rheological properties. Cellulose nanocrystals primarily obtained from naturally occurring cellulose fibers are biodegradable and renewable in nature and hence they serve as a sustainable and environmentally friendly material for most applications. These nanocrystals are basically hydrophilic in nature; however, they can be surface functionalized to meet various challenging requirements, such as the development of high-performance nanocomposites, using hydrophobic polymer matrices. Considering the ever-increasing interdisciplinary research being carried out on cellulose nanocrystals, this review aims to collate the knowledge available about the sources, chemical structure, and physical and chemical isolation procedures, as well as describes the mechanical, optical, and rheological properties, of cellulose nanocrystals. Innovative applications in diverse fields such as biomedical engineering, material sciences, electronics, catalysis, etc, wherein these cellulose nanocrystals can be used, are highlighted. PMID:26604715

  2. Phase transitions and doping in semiconductor nanocrystals

    NASA Astrophysics Data System (ADS)

    Sahu, Ayaskanta

    Colloidal semiconductor nanocrystals are a promising technological material because their size-dependent optical and electronic properties can be exploited for a diverse range of applications such as light-emitting diodes, bio-labels, transistors, and solar cells. For many of these applications, electrical current needs to be transported through the devices. However, while their solution processability makes these colloidal nanocrystals attractive candidates for device applications, the bulky surfactants that render these nanocrystals dispersible in common solvents block electrical current. Thus, in order to realize the full potential of colloidal semiconductor nanocrystals in the next-generation of solid-state devices, methods must be devised to make conductive films from these nanocrystals. One way to achieve this would be to add minute amounts of foreign impurity atoms (dopants) to increase their conductivity. Electronic doping in nanocrystals is still very much in its infancy with limited understanding of the underlying mechanisms that govern the doping process. This thesis introduces an innovative synthesis of doped nanocrystals and aims at expanding the fundamental understanding of charge transport in these doped nanocrystal films. The list of semiconductor nanocrystals that can be doped is large, and if one combines that with available dopants, an even larger set of materials with interesting properties and applications can be generated. In addition to doping, another promising route to increase conductivity in nanocrystal films is to use nanocrystals with high ionic conductivities. This thesis also examines this possibility by studying new phases of mixed ionic and electronic conductors at the nanoscale. Such a versatile approach may open new pathways for interesting fundamental research, and also lay the foundation for the creation of novel materials with important applications. In addition to their size-dependence, the intentional incorporation of

  3. Intermetallic Nanocrystals: Syntheses and Catalytic Applications.

    PubMed

    Yan, Yucong; Du, Jingshan S; Gilroy, Kyle D; Yang, Deren; Xia, Younan; Zhang, Hui

    2017-02-24

    At the forefront of nanochemistry, there exists a research endeavor centered around intermetallic nanocrystals, which are unique in terms of long-range atomic ordering, well-defined stoichiometry, and controlled crystal structure. In contrast to alloy nanocrystals with no elemental ordering, it is challenging to synthesize intermetallic nanocrystals with a tight control over their size and shape. Here, recent progress in the synthesis of intermetallic nanocrystals with controllable sizes and well-defined shapes is highlighted. A simple analysis and some insights key to the selection of experimental conditions for generating intermetallic nanocrystals are presented, followed by examples to highlight the viable use of intermetallic nanocrystals as electrocatalysts or catalysts for various reactions, with a focus on the enhanced performance relative to their alloy counterparts that lack elemental ordering. Within the conclusion, perspectives on future developments in the context of synthetic control, structure-property relationships, and applications are discussed.

  4. Phase stability of thermal barrier oxides based on t'-zirconia with trivalent oxide additions

    NASA Astrophysics Data System (ADS)

    Rebollo Franco, Noemi Rosa

    Zirconia stabilized with 7+/-1 wt.% addition of yttria (7YSZ) is widely used for thermal barrier coatings (TBC's) on actively cooled gas turbine components, selected partly because of its superior durability under thermal cyclic conditions. As deposited, 7YSZ occurs as a metastable single-phase tetragonal solid solution (t') that is thermodynamically stable against the deleterious transformation to monoclinic upon cooling. However, at high temperatures t' is driven to decompose diffusionally into an equilibrium mixture of high-Y cubic and low-Y tetragonal; the latter becomes transformable to monoclinic compromising the mechanical integrity of the system. This dissertation explores the effects of trivalent stabilizers, including Y, Sc and selected rare-earth oxides (REO's), on the phase stability of the resulting solid solutions in zirconia. The REO additions are of interest because they can potentially enhance the insulation efficiency on the coating allowing higher operating temperatures. However, understanding of their effects on phase stability and potentially on cyclic durability at the projected use temperature in next generation engines (1200-1400°C) is insufficient to guide the design of coatings with the desirable combination of lower thermal conductivity and acceptable durability. Sc was also investigated because of previous reports on the higher phase stability of materials doped with Sc, and Y served as the baseline. The experimental approach is based on powders synthesized by reverse co-precipitation of precursor solutions, usually compacted and then subjected to a variety of heat treatments, following their evolution by means of X-ray diffractometry, dilatometry, transmission electron microscopy and Raman spectroscopy. The use of powders facilitated the synthesis of a wider range of compositions that would not have been possible by coating deposition approaches, and because the synthesis occurs at low temperature, it also enabled the starting

  5. Osteogenic responses to zirconia with hydroxyapatite coating by aerosol deposition.

    PubMed

    Cho, Y; Hong, J; Ryoo, H; Kim, D; Park, J; Han, J

    2015-03-01

    Previously, we found that osteogenic responses to zirconia co-doped with niobium oxide (Nb2O5) or tantalum oxide (Ta2O5) are comparable with responses to titanium, which is widely used as a dental implant material. The present study aimed to evaluate the in vitro osteogenic potential of hydroxyapatite (HA)-coated zirconia by an aerosol deposition method for improved osseointegration. Surface analysis by scanning electron microscopy and x-ray diffraction proved that a thin as-deposited HA film on zirconia showed a shallow, regular, crater-like surface. Deposition of dense and uniform HA films was measured by SEM, and the contact angle test demonstrated improved wettability of the HA-coated surface. Confocal laser scanning microscopy indicated that MC3T3-E1 pre-osteoblast attachment did not differ notably between the titanium and zirconia surfaces; however, cells on the HA-coated zirconia exhibited a lower proliferation than those on the uncoated zirconia late in the culture. Nevertheless, ALP, alizarin red S staining, and bone marker gene expression analysis indicated good osteogenic responses on HA-coated zirconia. Our results suggest that HA-coating by aerosol deposition improves the quality of surface modification and is favorable to osteogenesis. © International & American Associations for Dental Research 2015.

  6. Osteogenic Responses to Zirconia with Hydroxyapatite Coating by Aerosol Deposition

    PubMed Central

    Cho, Y.; Hong, J.; Ryoo, H.; Kim, D.; Park, J.

    2015-01-01

    Previously, we found that osteogenic responses to zirconia co-doped with niobium oxide (Nb2O5) or tantalum oxide (Ta2O5) are comparable with responses to titanium, which is widely used as a dental implant material. The present study aimed to evaluate the in vitro osteogenic potential of hydroxyapatite (HA)-coated zirconia by an aerosol deposition method for improved osseointegration. Surface analysis by scanning electron microscopy and x-ray diffraction proved that a thin as-deposited HA film on zirconia showed a shallow, regular, crater-like surface. Deposition of dense and uniform HA films was measured by SEM, and the contact angle test demonstrated improved wettability of the HA-coated surface. Confocal laser scanning microscopy indicated that MC3T3-E1 pre-osteoblast attachment did not differ notably between the titanium and zirconia surfaces; however, cells on the HA-coated zirconia exhibited a lower proliferation than those on the uncoated zirconia late in the culture. Nevertheless, ALP, alizarin red S staining, and bone marker gene expression analysis indicated good osteogenic responses on HA-coated zirconia. Our results suggest that HA-coating by aerosol deposition improves the quality of surface modification and is favorable to osteogenesis. PMID:25586588

  7. Germanium Nanocrystal Solar Cells

    NASA Astrophysics Data System (ADS)

    Holman, Zachary Charles

    Greenhouse gas concentrations in the atmosphere are approaching historically unprecedented levels from burning fossil fuels to meet the ever-increasing world energy demand. A rapid transition to clean energy sources is necessary to avoid the potentially catastrophic consequences of global warming. The sun provides more than enough energy to power the world, and solar cells that convert sunlight to electricity are commercially available. However, the high cost and low efficiency of current solar cells prevent their widespread implementation, and grid parity is not anticipated to be reached for at least 15 years without breakthrough technologies. Semiconductor nanocrystals (NCs) show promise for cheap multi-junction photovoltaic devices. To compete with photovoltaic materials that are currently commercially available, NCs need to be inexpensively cast into dense thin films with bulk-like electrical mobilities and absorption spectra that can be tuned by altering the NC size. The Group II-VI and IV-VI NC communities have had some success in achieving this goal by drying and then chemically treating colloidal particles, but the more abundant and less toxic Group IV NCs have proven more challenging. This thesis reports thin films of plasma-synthesized Ge NCs deposited using three different techniques, and preliminary solar cells based on these films. Germanium tetrachloride is dissociated in the presence of hydrogen in a nonthermal plasma to nucleate Ge NCs. Transmission electron microscopy and X-ray diffraction indicate that the particles are nearly monodisperse (standard deviations of 10-15% the mean particle diameter) and the mean diameter can be tuned from 4-15 nm by changing the residence time of the Ge NCs in the plasma. In the first deposition scheme, a Ge NC colloid is formed by reacting nanocrystalline powder with 1-dodecene and dispersing the functionalized NCs in a solvent. Films are then formed on substrates by drop-casting the colloid and allowing it to dry

  8. Synthesis and characterizations of zirconia nanofiltration membranes

    SciTech Connect

    Vacassy, R.; Mouchet, C.; Guizard, C.

    1994-12-31

    In recent years inorganic membranes are being considered in microfiltration and ultrafiltration applications. A significant number of commercial processes utilizing inorganic membranes already exist. Nanofiltration has recently arisen as a new technique with a high application potential in the separation of organics and multivalent ions from water and effluents. Presently, polymer nanofiltration membranes are commercialized with a limited temperature and pH application range. New developments are expected with the aim of providing ceramic nanofilters suitable for harsh working conditions at high pH and high temperature, as well as with organic solvents. Here, the authors report a well adapted method based on the latest developments in sol-gel chemistry in order to prepare a microporous zirconia membrane. Zirconium propoxide used as a ceramic precursor is reacted with acetylacetone in an organic solvent. The use of acetylacetone ligands allows the control of particle growth along the process Loading a nanophase ceramic exhibiting connected micropores with pore diameter in 1 to 2 nm range. A tetragonal zirconia layer coated on a KERASEP{trademark} multichannel has been obtained at 400{degrees}C with pore diameter centered on 1 nm.

  9. Biological reactivity of zirconia-hydroxyapatite composites.

    PubMed

    Silva, Viviane V; Lameiras, Fernando S; Lobato, Zélia I P

    2002-01-01

    Materials and devices intended for end-use applications as implants and medical devices must be evaluated to determine their biocompatibility potential in contact with physiological systems. The use of standard practices of biological testing provides a reasonable level of confidence concerning the response of a living organism to a given material or device, as well as guidance in selecting the proper procedures to be carried out for the screening of new or modified materials. This article presents results from cytotoxicity assays of cell culture, skin irritation, and acute toxicity by systemic and intracutaneous injections for powders, ceramic bodies, and extract liquids of hydroxyapatite (HA), calcia partially stabilized zirconia (ZO), and two types of zirconia-hydroxyapatite composites (Z4H6 and Z6H4) with potential for future use as orthopedic and dental implants. They indicate that these materials present potential for this type of application because they meet the requirements of the standard practices recommended for evaluating the biological reactivity of ATCC cell cultures (CCL1 NCTC clone 929 of mouse connective tissue and CCL 81 of monkey connective tissue) and animals (rabbit and mouse) with direct or indirect patient contact, or by the injection of specific extracts prepared from the material under test. In addition, studies involving short-term intramuscular and long-term implantation assays to estimate the reaction of living tissue to the composites studied, and investigations on long-term effects that these materials can cause on the cellular metabolism, are already in progress.

  10. Quantitative tunneling spectroscopy of nanocrystals

    SciTech Connect

    First, Phillip N; Whetten, Robert L; Schaaff, T Gregory

    2007-05-25

    The proposed goals of this collaborative work were to systematically characterize the electronic structure and dynamics of 3-dimensional metal and semiconducting nanocrystals using scanning tunneling microscopy/spectroscopy (STM/STS) and ballistic electron emission spectroscopy (BEES). This report describes progress in the spectroscopic work and in the development of methods for creating and characterizing gold nanocrystals. During the grant period, substantial effort also was devoted to the development of epitaxial graphene (EG), a very promising materials system with outstanding potential for nanometer-scale ballistic and coherent devices ("graphene" refers to one atomic layer of graphitic, sp2 -bonded carbon atoms [or more loosely, few layers]). Funding from this DOE grant was critical for the initial development of epitaxial graphene for nanoelectronics

  11. Lead sulphide nanocrystal photodetector technologies

    NASA Astrophysics Data System (ADS)

    Saran, Rinku; Curry, Richard J.

    2016-02-01

    Light detection is the underlying principle of many optoelectronic systems. For decades, semiconductors including silicon carbide, silicon, indium gallium arsenide and germanium have dominated the photodetector industry. They can show excellent photosensitivity but are limited by one or more aspects, such as high production cost, high-temperature processing, flexible substrate incompatibility, limited spectral range or a requirement for cryogenic cooling for efficient operation. Recently lead sulphide (PbS) nanocrystals have emerged as one of the most promising new materials for photodetector fabrication. They offer several advantages including low-cost manufacturing, solution processability, size-tunable spectral sensitivity and flexible substrate compatibility, and they have achieved figures of merit outperforming conventional photodetectors. We review the underlying concepts, breakthroughs and remaining challenges in photodetector technologies based on PbS nanocrystals.

  12. An in vitro evaluation of the zirconia surface treatment by mesoporous zirconia coating on its bonding to resin cement.

    PubMed

    Zhang, Yanli; Sun, Ting; Liu, Ruoyu; Feng, Xiaoli; Chen, Aijie; Shao, Longquan

    2014-01-01

    The effect of zirconia surface treatment by mesoporous zirconia coating on the microtensile bond strength (MTBS) between zirconia and resin cement was investigated in this work. 160 zirconia specimens were prepared and divided into four groups according to surface treatments: (1) airborne-particle-abrasion treatment (APA); (2) glass infiltration and hydrofluoric acid treatment (GI+HF); (3) mesoporous zirconia coating (MZ); and (4) no treatment (C). The as-prepared zirconia specimens were bonded using Panavia F2.0 and RelyX Unicem. The MTBS values were tested using a universal testing machine, and data were analyzed using ANOVA and SNK methods (a=0.05). The MTBS values obtained after GI+HF and MZ treatments were significantly higher than those obtained after APA and C treatments (P<0.05), especially for samples cemented with Panavia F2.0. The results reveal that zirconia surface treatments using GI+HF and MZ yield higher bond strength than those using APA or C, regardless of the resin cements.

  13. The Surface Chemistry of Metal Chalcogenide Nanocrystals

    NASA Astrophysics Data System (ADS)

    Anderson, Nicholas Charles

    The surface chemistry of metal chalcogenide nanocrystals is explored through several interrelated analytical investigations. After a brief discussion of the nanocrystal history and applications, molecular orbital theory is used to describe the electronic properties of semiconductors, and how these materials behave on the nanoscale. Quantum confinement plays a major role in dictating the optical properties of metal chalcogenide nanocrystals, however surface states also have an equally significant contribution to the electronic properties of nanocrystals due to the high surface area to volume ratio of nanoscale semiconductors. Controlling surface chemistry is essential to functionalizing these materials for biological imaging and photovoltaic device applications. To better understand the surface chemistry of semiconducting nanocrystals, three competing surface chemistry models are presented: 1.) The TOPO model, 2.) the Non-stoichiometric model, and 3.) the Neutral Fragment model. Both the non-stoichiometric and neutral fragment models accurately describe the behavior of metal chalcogenide nanocrystals. These models rely on the covalent bond classification system, which divides ligands into three classes: 1.) X-type, 1-electron donating ligands that balance charge with excess metal at the nanocrystal surface, 2.) L-type, 2-electron donors that bind metal sites, and 3.) Z-type, 2-electron acceptors that bind chalcogenide sites. Each of these ligand classes is explored in detail to better understand the surface chemistry of metal chalcogenide nanocrystals. First, chloride-terminated, tri-n-butylphosphine (Bu 3P) bound CdSe nanocrystals were prepared by cleaving carboxylate ligands from CdSe nanocrystals with chlorotrimethylsilane in Bu3P solution. 1H and 31P{1H} nuclear magnetic resonance spectra of the isolated nanocrystals allowed assignment of distinct signals from several free and bound species, including surface-bound Bu3P and [Bu3P-H]+[Cl]- ligands as well as a Bu

  14. Bulk and Interface Thermodynamics of Calcia-, and Yttria-doped Zirconia Ceramics: Nanograined Phase Stability

    NASA Astrophysics Data System (ADS)

    Drazin, John Walter

    Calcia-, and yttria- doped zirconia powders and samples are essential systems in academia and industry due to their observed bulk polymorphism. Pure zirconia manifests as Baddeleyite, a monoclinic structured mineral with 7-fold coordination. This bulk form of zirconia has little application due to its asymmetry. Therefore dopants are added to the grain in-order to induce phase transitions to either a tetragonal or cubic polymorph with the incorporation of oxygen vacancies due to the dopant charge mis-match with the zirconia matrix. The cubic polymorph has cubic symmetry such that these samples see applications in solid oxide fuel cells (SOFCs) due to the high oxygen vacancy concentrations and high ionic mobility at elevated temperatures. The tetragonal polymorph has slight asymmetry in the c-axis compared to the a-axis such that the tetragonal samples have increased fracture toughness due to an impact induced phase transformation to a cubic structure. These ceramic systems have been extensively studied in academia and used in various industries, but with the advent of nanotechnology one can wonder whether smaller grain samples will see improved characteristics similar to their bulk grain counterparts. However, there is a lack of data and knowledge of these systems in the nano grained region which provides us with an opportunity to advance the theory in these systems. The polymorphism seen in the bulk grains samples is also seen in the nano-grained samples, but at slightly distinct dopant concentrations. The current theory hypothesizes that a surface excess, gamma (J/m 2), can be added to the Gibbs Free energy equation to account for the additional free energy of the nano-grain atoms. However, these surface energies have been difficult to measure and therefore thermodynamic data on these nano-grained samples have been sparse. Therefore, in this work, I will use a well established water adsorption microcalorimetry apparatus to measure the water coverage isotherms

  15. On the interfacial fracture of porcelain/zirconia and graded zirconia dental structures

    PubMed Central

    Chai, Herzl; Lee, James J.-W; Mieleszko, Adam J.; Chu, Stephen J.; Zhang, Yu

    2014-01-01

    Porcelain fused to zirconia (PFZ) restorations are widely used in prosthetic dentistry. However, their susceptibility to fracture remains a practical problem. The failure of PFZ prostheses often involves crack initiation and growth in the porcelain, which may be followed by fracture along the porcelain/zirconia (P/Z) interface. In this work, we characterized the process of fracture in two PFZ systems, as well as a newly developed graded glass-zirconia structure with emphases placed on resistance to interfacial cracking. Thin porcelain layers were fused onto Y-TZP plates with or without the presence of a glass binder. The specimens were loaded in a four-point-bend fixture with the thin porcelain veneer in tension, simulating the lower portion of the connectors and marginal areas of a fixed dental prosthesis (FDP) during occlusal loading. The evolution of damage was observed by a video camera. The fracture was characterized by unstable growth of cracks perpendicular to the P/Z interface (channel cracks) in the porcelain layer, which was followed by stable cracking along the P/Z interface. The interfacial fracture energy GC was determined by a FEA taking into account stress shielding effects due to the presence of adjacent channel cracks. The resulting GC was well less than commonly reported values for similar systems. Fracture in the graded Y-TZP samples occurred by a single channel crack at a much greater stress than for PFZ. No delamination between the residual glass layer and graded zirconia occurred in any of the tests. Combined with its enhanced resistance to edge chipping and good esthetic quality, graded Y-TZP emerges as a viable material concept for dental restorations. PMID:24769152

  16. On the interfacial fracture of porcelain/zirconia and graded zirconia dental structures.

    PubMed

    Chai, Herzl; Lee, James J-W; Mieleszko, Adam J; Chu, Stephen J; Zhang, Yu

    2014-08-01

    Porcelain fused to zirconia (PFZ) restorations are widely used in prosthetic dentistry. However, their susceptibility to fracture remains a practical problem. The failure of PFZ prostheses often involves crack initiation and growth in the porcelain, which may be followed by fracture along the porcelain/zirconia (P/Z) interface. In this work, we characterized the process of fracture in two PFZ systems, as well as a newly developed graded glass-zirconia structure with emphases placed on resistance to interfacial cracking. Thin porcelain layers were fused onto Y-TZP plates with or without the presence of a glass binder. The specimens were loaded in a four-point-bending fixture with the thin porcelain veneer in tension, simulating the lower portion of the connectors and marginal areas of a fixed dental prosthesis (FDP) during occlusal loading. The evolution of damage was observed by a video camera. The fracture was characterized by unstable growth of cracks perpendicular to the P/Z interface (channel cracks) in the porcelain layer, which was followed by stable cracking along the P/Z interface. The interfacial fracture energy GC was determined by a finite-element analysis taking into account stress-shielding effects due to the presence of adjacent channel cracks. The resulting GC was considerably less than commonly reported values for similar systems. Fracture in the graded Y-TZP samples occurred via a single channel crack at a much greater stress than for PFZ. No delamination between the residual glass layer and graded zirconia occurred in any of the tests. Combined with its enhanced resistance to edge chipping and good esthetic quality, graded Y-TZP emerges as a viable material concept for dental restorations.

  17. Irradiation induced dislocations and vacancy generation in single crystal yttria stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Johnsen, Jill Noel

    A determination of the most effective method of introducing defect clusters and forming nanocrystals in single crystal Yttria Stabilized Zirconia (YSZ) to increase its oxygen ion conductivity for use in solid oxide fuel cell has been investigated using several techniques. High-energy particle irradiation using 800 keV electrons and 20 MeV protons and Ar+ and Xe ++ ion implantation promote the introduction of defects. Thermal annealing and temperature cycling were performed both ex-situ and in-situ in a TEM to study the dynamic recovery behavior of the defects introduced by irradiation and the nucleation and growth of nanocrystals. This analysis found multiple outcomes to both light particle irradiation, with electrons and protons, and heavy charged particle irradiation, including Ar+ and Xe++. Electron irradiation produced very few vacancies, and therefore a very low dislocation density after high temperature annealing. The Xe++ and Ar+ irradiated samples show a high density of vacancy clusters. Evidence also shows nanocrystalline formation in Xe++ irradiated YSZ after a 20 minute anneal at 1040°C with grain sizes on the order of 10--50nm. Defect clusters formed in samples exposed to 20.4 MeV protons with a fluence of 1.00 x 1013 p/cm2 and thermally annealed at temperatures between 800°C and 1000°C. The samples became polycrystalline after a 75 minute anneal with a grain size of approximately 20nm and remained polycrystalline throughout the 120 minute anneal. Impedance spectroscopy measurements were conducted on proton irradiated samples with various annealing conditions. From the impedance results it is concluded that the minimum annealing conditions for a noticeable improvement in ionic conductivity are 1000°C for 2 hours and the 1200°C for 1 hour. These annealing conditions correspond to the conditions for nanocrystal formation as show by microstructural characterization. The proton irradiated YSZ ceramic samples annealed under these conditions were found

  18. Raman analysis of monoclinic Cu2SnS3 thin films

    NASA Astrophysics Data System (ADS)

    Berg, Dominik M.; Djemour, Rabie; Gütay, Levent; Siebentritt, Susanne; Dale, Phillip J.; Fontane, Xavier; Izquierdo-Roca, Victor; Pérez-Rodriguez, Alejandro

    2012-05-01

    Secondary phases like Cu2SnS3 are major obstacles for kesterite thin film solar cell applications. We prepare Cu2SnS3 using identical annealing conditions as used for the kesterite films. By x-ray diffraction, the crystal structure of Cu2SnS3 was identified as monoclinic. Polarization-dependent Raman investigations allowed the identification of the dominant peaks at 290 cm-1 and 352 cm-1 with the main A' symmetry vibrational modes from the monoclinic Cu2SnS3 phase. Furthermore, micro-resolved Raman investigations revealed local variations in the spectra that are attributed to a secondary phase (possibly Cu2Sn3S7). This exemplifies the abilities of micro-resolved Raman measurements in the detection of secondary phases.

  19. Fabrication and photoelectrocatalytic properties of nanocrystalline monoclinic BiVO4 thin-film electrode.

    PubMed

    Zhou, Bin; Qu, Jiuhui; Zhao, Xu; Liu, Huijuan

    2011-01-01

    Monoclinic bismuth vanadate (BiVO4) thin film was fabricated on indium-tin oxide glass from an amorphous heteronuclear complex via dip-coating. After annealation at 400, 500, and 600 degrees C, the thin films were characterized by X-ray diffraction, field emission scanning electron microscopy, X-ray photoelectron spectroscopy, and UV-Vis spectrophotometry. The BiVO4 particles on the ITO glass surface had a monoclinic structure. The UV-Visible diffuse reflection spectra showed the BiVO4 thin film had photoabsorption properties, with a band gap around 2.5 eV. In addition, the thin film showed high visible photocatalytic activities towards 2,4-dichlorophenol and Bisphenol A degradation under visible light irradiation (lambda > 420 nm). Over 90% of the two organic pollutants were removed in 5 hr. A possible degradation mechanism of 2,4-dichlorophenol were also studied.

  20. Evidence for photo-induced monoclinic metallic VO{sub 2} under high pressure

    SciTech Connect

    Hsieh, Wen-Pin Mao, Wendy L.; Trigo, Mariano; Reis, David A.; Andrea Artioli, Gianluca; Malavasi, Lorenzo

    2014-01-13

    We combine ultrafast pump-probe spectroscopy with a diamond-anvil cell to decouple the insulator-metal electronic transition from the lattice symmetry changing structural transition in the archetypal strongly correlated material vanadium dioxide. Coherent phonon spectroscopy enables tracking of the photo-excited phonon vibrational frequencies of the low temperature, monoclinic (M{sub 1})-insulating phase that transforms into the metallic, tetragonal rutile structured phase at high temperature or via non-thermal photo-excitations. We find that in contrast with ambient pressure experiments where strong photo-excitation promptly induces the electronic transition along with changes in the lattice symmetry, at high pressure, the coherent phonons of the monoclinic (M{sub 1}) phase are still clearly observed upon the photo-driven phase transition to a metallic state. These results demonstrate the possibility of synthesizing and studying transient phases under extreme conditions.

  1. Identification of monoclinic calcium pyrophosphate dihydrate and hydroxyapatite in human sclera using Raman microspectroscopy

    PubMed Central

    Chen, Ko-Hua; Li, Mei-Jane; Cheng, Wen-Ting; Balic-Zunic, Tonci; Lin, Shan-Yang

    2009-01-01

    Raman microspectroscopy was first used to determine the composition of a calcified plaque located at the pterygium-excision site of a 51-year-old female patient's left nasal sclera after surgery. It was unexpectedly found that the Raman spectrum of the calcified sample at 1149, 1108, 1049, 756, 517, 376 and 352/cm was similar to the Raman spectrum of monoclinic form of calcium pyrophosphate dihydrate (CPPD) crystal, but differed from the Raman spectrum of triclinic form of CPPD. An additional peak at 958/cm was also observed in the Raman spectrum of the calcified plaque, which was identical to the characteristic peak at 958/cm of hydroxyapatite (HA). This is the first study to report the spectral biodiagnosis of both monoclinic CPPD and HA co-deposited in the calcified plaque of a patient with sclera dystrophic calcification using Raman microspectroscopy. PMID:19200254

  2. Structural Discrimination via DFT: Monoclinic Mg2NiH4

    NASA Astrophysics Data System (ADS)

    Herbst, Jan; Hector, Louis, Jr.

    2009-03-01

    Mg2NiH4 is a semiconductor and forms an ordered low temperature monoclinic phase and a disordered high temperature cubic modification. Two distinct structures for the monoclinic phase from neutron diffraction studies of the deuterated analog, which we designate as LTI and LTII, are available in the published literature. We calculate the enthalpy of formation δH with density functional theory (DFT) for both using three different approximations for the exchange-correlation energy functional. Phonon spectra are calculated as well. DFT unequivocally identifies LTII as preferable since δH obtained for it is in better agreement with experiment and its phonon spectrum contains no anomalies. Structures approximating LTII derived from analyses of soft modes in LTI and in Mg-substituted CaMgNiH4 are also discussed.

  3. Ultrasonic cleaning of silica-coated zirconia influences bond strength between zirconia and resin luting material.

    PubMed

    Nishigawa, Goro; Maruo, Yukinori; Irie, Masao; Oka, Morihiko; Yoshihara, Kumiko; Minagi, Shogo; Nagaoka, Noriyuki; Yoshida, Yasuhiro; Suzuki, Kazuomi

    2008-11-01

    The purpose of this study was to evaluate how ultrasonic cleaning of silica-coated zirconia surfaces would influence the latter's bond strength to resin luting material. Forty zirconia specimens were divided into four groups: one air abrasion group and three silica-coated groups. Silica-coated specimens were cleaned with distilled water using an ultrasonic cleaner after tribochemical silica coating and then divided into three groups according to cleaning durations: 1 minute, 5 minutes, or without cleaning. Following which, resin luting material was polymerized against the specimens. After storage in water for 24 hours, the specimens were subjected to shear bond strength test. Shear bond strength of silica-coated group without cleaning was significantly higher than the other three groups, but there were no statistically significant differences among the three latter groups. SEM images suggested visible differences among the treatment methods. With EDXS analysis, it was revealed that ultrasonic cleaning decreased the silica content on the treated surfaces. Therefore, results showed that ultrasonic cleaning of tribochemically silica-coated zirconia surfaces decreased the adhesion efficacy to resin luting material.

  4. The role of Nb in intensity increase of Er ion upconversion luminescence in zirconia

    SciTech Connect

    Smits, K. Sarakovskis, A.; Grigorjeva, L.; Millers, D.; Grabis, J.

    2014-06-07

    It is found that Nb co-doping increases the luminescence and upconversion luminescence intensity in rare earth doped zirconia. Er and Yb-doped nanocrystalline samples with or without Nb co-doping were prepared by sol-gel method and thermally annealed to check for the impact of phase transition on luminescence properties. Phase composition and grain sizes were examined by X-ray diffraction; the morphology was checked by scanning- and high-resolution transmission electron microscopes. Both steady-state and time-resolved luminescence were studied. Comparison of samples with different oxygen vacancy concentrations and different Nb concentrations confirmed the known assumption that oxygen vacancies are the main agents for tetragonal or cubic phase stabilization. The oxygen vacancies quench the upconversion luminescence; however, they also prevent agglomeration of rare-earth ions and/or displacement of rare-earth ions to grain surfaces. It is found that co-doping with Nb ions significantly (>20 times) increases upconversion luminescence intensity. Hence, ZrO{sub 2}:Er:Yb:Nb nanocrystals may show promise for upconversion applications.

  5. First-principles study of structural and elastic properties of monoclinic and orthorhombic BiMnO3.

    PubMed

    Mei, Zhi-Gang; Shang, Shun-Li; Wang, Yi; Liu, Zi-Kui

    2010-07-28

    The structural and elastic properties of BiMnO(3) with monoclinic (C 2/c) and orthorhombic (Pnma) ferromagnetic (FM) structures have been studied by first-principles calculations within LDA + U and GGA + U approaches. The equilibrium volumes and bulk moduli of BiMnO(3) phases are evaluated by equation of state (EOS) fittings, and the bulk properties predicted by LDA + U calculations are in better agreement with experiment. The orthorhombic phase is found to be more stable than the monoclinic phase at ambient pressure. A monoclinic to monoclinic phase transition is predicted to occur at a pressure of about 10 GPa, which is ascribed to magnetism versus volume instability of monoclinic BiMnO(3). The single-crystal elastic stiffness constants c(ij)s of the monoclinic and orthorhombic phases are investigated using the stress-strain method. The c(46) of the monoclinic phase is predicted to be negative. In addition, the polycrystalline elastic properties including bulk modulus, shear modulus, Young's modulus, bulk modulus-shear modulus ratio, Poisson's ratio, and elastic anisotropy ratio are determined based on the calculated elastic constants. The presently predicted phase transition and elastic properties open new directions for investigation of the phase transitions in BiMnO(3), and provide helpful guidance for the future elastic constant measurements.

  6. Changes in mobility of plastic crystal ethanol during its transformation into the monoclinic crystal state

    SciTech Connect

    Sanz, Alejandro Nogales, Aurora; Ezquerra, Tiberio A.; Puente-Orench, Inés; Jiménez-Ruiz, Mónica

    2014-02-07

    Transformation of deuterated ethanol from the plastic crystal phase into the monoclinic one is investigated by means of a singular setup combining simultaneously dielectric spectroscopy with neutron diffraction. We postulate that a dynamic transition from plastic crystal to supercooled liquid-like configuration through a deep reorganization of the hydrogen-bonding network must take place as a previous step of the crystallization process. Once these precursor regions are formed, subsequent crystalline nucleation and growth develop with time.

  7. Dehydration and crystallization kinetics of zirconia-yttria gels

    SciTech Connect

    Ramanathan, S.; Muraleedharan, R.V.; Roy, S.K.; Nayar, P.K.K.

    1995-02-01

    Zirconia and zirconia-yttria gels containing 4 and 8 mol% yttria were obtained by coprecipitation and drying at 373 K. The dehydration and crystallization behavior of the dried gels was studied by DSC, TG, and XRD. The gels undergo elimination of water over a wide temperature range of 373--673 K. The peak temperature of the endotherm corresponding to dehydration and the kinetic constants for the process were not influenced by the yttria content of the gel. The enthalpy of dehydration observed was in good agreement with the heat of vaporization data. The dehydration was followed by a sharp exothermic crystallization process. The peak temperature of the exotherm and the activation energy of the process increased with an increase in yttria content, while the enthalpy of crystallization showed a decrease. The ``glow effect`` reduced with increasing yttria content. Pure zirconia crystallizes in the tetragonal form while the zirconia containing 4 and 8 mol% yttria appears to crystallize in the cubic form.

  8. Enhanced structural stability of nanoporous zirconia under irradiation of He

    SciTech Connect

    Yang, Tengfei; Huang, Xuejun; Wang, Chenxu; Zhang, Yanwen; Xue, Jianming; Yan, Sha; Wang, Yuguang

    2012-01-01

    This work reports a greatly enhanced tolerance for He irradiation-induced swelling in nanocrystalline zirconia film with interconnected nanoporous structure (hereinafter referred as to NC-C). Compared to bulk yttria-stabilized zirconia (YSZ) and another nanocrystalline zirconia film only with discrete nano voids (hereinafter referred as to NC-V), the NC-C film reveals good tolerance for irradiation of high-fluence He. No appreciable surface blistering can be found even at the highest fluence of 6 1017 cm2 in NCC film. From TEM analysis of as-irradiated samples, the enhanced tolerance for volume swelling in NCC film is attributed to the enhanced diffusion mechanism of deposited He via widely distributed nano channels. Furthermore, the growth of grain size is quite small for both nanocrystalline zirconia films after irradiation, which is ascribed to the decreasing of area of grain boundary due to loose structure and low energy of primary knock-on atoms for He ions.

  9. Hollow nanocrystals and method of making

    DOEpatents

    Alivisatos, A Paul [Oakland, CA; Yin, Yadong [Moreno Valley, CA; Erdonmez, Can Kerem [Berkeley, CA

    2011-07-05

    Described herein are hollow nanocrystals having various shapes that can be produced by a simple chemical process. The hollow nanocrystals described herein may have a shell as thin as 0.5 nm and outside diameters that can be controlled by the process of making.

  10. Pinned emission from ultrasmall cadmium selenide nanocrystals.

    PubMed

    Dukes, Albert D; Schreuder, Michael A; Sammons, Jessica A; McBride, James R; Smith, Nathanael J; Rosenthal, Sandra J

    2008-09-28

    We report pinning of the emission spectrum in ultrasmall CdSe nanocrystals with a diameter of 1.7 nm and smaller. It was observed that the first emission feature ceased to blueshift once the band edge absorption reached 420 nm, though the band edge absorption continued to blueshift with decreasing nanocrystal diameter.

  11. Structure Map for Embedded Binary Alloy Nanocrystals

    SciTech Connect

    Yuan, C.W.; Shin, S.J.; Liao, C.Y.; Guzman, J.; Stone, P.R.; Watanabe, M.; Ager III, J.W.; Haller, E.E.; Chrzan, D.C.

    2008-09-20

    The equilibrium structure of embedded nanocrystals formed from strongly segregating binary-alloys is considered within a simple thermodynamic model. The model identifies two dimensionlessinterface energies that dictate the structure, and allows prediction of the stable structure for anychoice of these parameters. The resulting structure map includes three distinct nanocrystal mor-phologies: core/shell, lobe/lobe, and completely separated spheres.

  12. Electronic displays using optically pumped luminescent semiconductor nanocrystals

    DOEpatents

    Weiss, Shimon; Schlamp, Michael C.; Alivisatos, A. Paul

    2010-04-13

    A multicolor electronic display is based on an array of luminescent semiconductor nanocrystals. Nanocrystals which emit light of different colors are grouped into pixels. The nanocrystals are optically pumped to produce a multicolor display. Different sized nanocrystals are used to produce the different colors. A variety of pixel addressing systems can be used.

  13. Electronic displays using optically pumped luminescent semiconductor nanocrystals

    DOEpatents

    Weiss, Shimon; Schlam, Michael C; Alivisatos, A. Paul

    2014-03-25

    A multicolor electronic display is based on an array of luminescent semiconductor nanocrystals. Nanocrystals which emit tight of different colors are grouped into pixels. The nanocrystals are optically pumped to produce a multicolor display. Different sized nanocrystals are used to produce the different colors. A variety of pixel addressing systems can be used.

  14. Electronic displays using optically pumped luminescent semiconductor nanocrystals

    SciTech Connect

    Weiss, Shimon; Schlamp, Michael C.; Alivisatos, Paul A.

    2015-11-10

    A multicolor electronic display is based on an array of luminescent semiconductor nanocrystals. Nanocrystals which emit tight of different colors are grouped into pixels. The nanocrystals are optically pumped to produce a multicolor display. Different sized nanocrystals are used to produce the different colors. A variety of pixel addressing systems can be used.

  15. Electronic displays using optically pumped luminescent semiconductor nanocrystals

    DOEpatents

    Weiss, Shimon; Schlamp, Michael C; Alivisatos, A. Paul

    2014-02-11

    A multicolor electronic display is based on an array of luminescent semiconductor nanocrystals. Nanocrystals which emit light of different colors are grouped into pixels. The nanocrystals are optically pumped to produce a multicolor display. Different sized nanocrystals are used to produce the different colors. A variety of pixel addressing systems can be used.

  16. Electronic displays using optically pumped luminescent semiconductor nanocrystals

    DOEpatents

    Weiss, Shimon; Schlamp, Michael C.; Alivisatos, A. Paul

    2011-09-27

    A multicolor electronic display is based on an array of luminescent semiconductor nanocrystals. Nanocrystals which emit light of different colors are grouped into pixels. The nanocrystals are optically pumped to produce a multicolor display. Different sized nanocrystals are used to produce the different colors. A variety of pixel addressing systems can be used.

  17. Electronic displays using optically pumped luminescent semiconductor nanocrystals

    DOEpatents

    Weiss, Shimon; Schlamp, Michael C.; Alivisatos, A. Paul

    2005-03-08

    A multicolor electronic display is based on an array of luminescent semiconductor nanocrystals. Nanocrystals which emit light of different colors are grouped into pixels. The nanocrystals are optically pumped to produce a multicolor display. Different sized nanocrystals are used to produce the different colors. A variety of pixel addressing systems can be used.

  18. Electronic displays using optically pumped luminescent semiconductor nanocrystals

    DOEpatents

    Weiss, Shimon; Schlamp, Michael C.; Alivisatos, A. Paul

    2015-06-23

    A multicolor electronic display is based on an array of luminescent semiconductor nanocrystals. Nanocrystals which emit light of different colors are grouped into pixels. The nanocrystals are optically pumped to produce a multicolor display. Different sized nanocrystals are used to produce the different colors. A variety of pixel addressing systems can be used.

  19. Evaluation of physicochemical properties, and antimicrobial efficacy of monoclinic sulfur-nanocolloid

    NASA Astrophysics Data System (ADS)

    Roy Choudhury, Samrat; Mandal, Amrita; Chakravorty, Dipankar; Gopal, Madhuban; Goswami, Arunava

    2013-04-01

    Stable nanocolloids of monoclinic sulfur (β-SNPs) were prepared through `water-in-oil microemulsion technique' at room temperature after suitable modifications of the surface. The morphology (rod shaped; 50 nm in diameter) and allotropic nature (monoclinic) of the SNPs were investigated with Transmission Electron Microscopy and X-ray Diffraction technique. The surface modification, colloidal stability, and surface topology of β-SNPs were evaluated with Fourier Transform Infrared Spectroscopy, zeta potential analysis, and Atomic Force Microscopy. Thermal decomposition pattern of these nanosized particles was determined by Thermo Gravimetric Analysis (TGA). β-SNPs-colloids expressed excellent antimicrobial activities against a series of fungal and bacterial isolates with prominent deformities at their surface. In contrast, insignificant cytotoxicity was achieved against the human derived hepatoma (HepG2) cell line upon treatment with β-SNPs. A simultaneous study was performed to determine the stock concentration of β-SNP-colloids using a novel high phase liquid chromatographic method. Cumulative results of this study hence, elucidate the stabilization of nanosized monoclinic sulfur at room temperature and their potential antimicrobial efficacy over micron-sized sulfur.

  20. The creation of modulated monoclinic aperiodic composites in n-alkane/urea compounds

    DOE PAGES

    Mariette, Céline; Guérin, Laurent; Rabiller, Philippe; ...

    2014-09-12

    n-Dodecane/urea is a member of the prototype series of n-alkane/urea inclusion compounds. At room temperature, it presents a quasi-one dimensional liquid-like state for the confined guest molecules within the rigid, hexagonal framework of the urea host. At lower temperatures, we report the existence of two other phases. Below Tc=248 K there appears a phase with rank four superspace group P6122(00γ), the one typically observed at room temperature in n-alkane/urea compounds with longer guest molecules. A misfit parameter, defined by the ratio γ=ch/cg (chost/cguest), is found to be 0.632±0.005. Below Tc1=123 K, a monoclinic modulated phase is created with a constantmore » shift along c of the guest molecules in adjacent channels. The maximal monoclinic space group for this structure is P1211(α0γ). We discuss analogies and differences with n-heptane/urea, which also presents a monoclinic, modulated low-temperature phase.« less

  1. The creation of modulated monoclinic aperiodic composites in n-alkane/urea compounds

    SciTech Connect

    Mariette, Céline; Guérin, Laurent; Rabiller, Philippe; Chen, Yu-Sheng; Bosak, Alexei; Popov, Alexander; Hollingsworth, Mark D.; Toudic, Bertrand

    2014-09-12

    n-Dodecane/urea is a member of the prototype series of n-alkane/urea inclusion compounds. At room temperature, it presents a quasi-one dimensional liquid-like state for the confined guest molecules within the rigid, hexagonal framework of the urea host. At lower temperatures, we report the existence of two other phases. Below Tc=248 K there appears a phase with rank four superspace group P6122(00γ), the one typically observed at room temperature in n-alkane/urea compounds with longer guest molecules. A misfit parameter, defined by the ratio γ=ch/cg (chost/cguest), is found to be 0.632±0.005. Below Tc1=123 K, a monoclinic modulated phase is created with a constant shift along c of the guest molecules in adjacent channels. The maximal monoclinic space group for this structure is P1211(α0γ). We discuss analogies and differences with n-heptane/urea, which also presents a monoclinic, modulated low-temperature phase.

  2. Critical Role of Monoclinic Polarization Rotation in High-Performance Perovskite Piezoelectric Materials.

    PubMed

    Liu, Hui; Chen, Jun; Fan, Longlong; Ren, Yang; Pan, Zhao; Lalitha, K V; Rödel, Jürgen; Xing, Xianran

    2017-07-07

    High-performance piezoelectric materials constantly attract interest for both technological applications and fundamental research. The understanding of the origin of the high-performance piezoelectric property remains a challenge mainly due to the lack of direct experimental evidence. We perform in situ high-energy x-ray diffraction combined with 2D geometry scattering technology to reveal the underlying mechanism for the perovskite-type lead-based high-performance piezoelectric materials. The direct structural evidence reveals that the electric-field-driven continuous polarization rotation within the monoclinic plane plays a critical role to achieve the giant piezoelectric response. An intrinsic relationship between the crystal structure and piezoelectric performance in perovskite ferroelectrics has been established: A strong tendency of electric-field-driven polarization rotation generates peak piezoelectric performance and vice versa. Furthermore, the monoclinic M_{A} structure is the key feature to superior piezoelectric properties as compared to other structures such as monoclinic M_{B}, rhombohedral, and tetragonal. A high piezoelectric response originates from intrinsic lattice strain, but little from extrinsic domain switching. The present results will facilitate designing high-performance perovskite piezoelectric materials by enhancing the intrinsic lattice contribution with easy and continuous polarization rotation.

  3. Metastable monoclinic ZnMoO4: hydrothermal synthesis, optical properties and photocatalytic performance.

    PubMed

    Lv, Li; Tong, Wenming; Zhang, Yanbing; Su, Yiguo; Wang, Xiaojing

    2011-11-01

    Metastable monoclinic ZnMoO4 was successfully synthesized via a hydrothermal route with variation of reaction temperatures and time at pH value of 5.7. Systematic sample characterizations were carried out, including X-ray powder diffraction, scanning electron microscopy, Fourier transformed infrared spectra, UV-visible diffuse reflectance spectra, and photoluminescence spectra. The results show that all as-prepared ZnMoO4 samples were demonstrated to crystallize in a pure-phase of monoclinic wolframite structure. All samples were formed in plate-like morphology. Six IR active vibrational bands were observed in the wave number range of 400-900 cm(-1). The band gap of as-prepared ZnMoO4 was estimated to be 2.86 eV by Tauc equation. Photoluminescence measurement indicates that as-prepared ZnMoO4 exhibits a broad blue-green emission under excitation wavelength of 280 nm at room temperature. Photocatalytic activity of as-prepared ZnMoO4 was examined by monitoring the degradation of methyl orange dye in an aqueous solution under UV radiation of 365 nm. The as-prepared ZnMoO4 obtained at 180 degrees C for 40 h showed the best photocatalytic activity with completing degradation of MO in irradiation time of 120 min. Consequently, monoclinic ZnMoO4 proved to be an efficient near visible light photocatalyst.

  4. Critical Role of Monoclinic Polarization Rotation in High-Performance Perovskite Piezoelectric Materials

    NASA Astrophysics Data System (ADS)

    Liu, Hui; Chen, Jun; Fan, Longlong; Ren, Yang; Pan, Zhao; Lalitha, K. V.; Rödel, Jürgen; Xing, Xianran

    2017-07-01

    High-performance piezoelectric materials constantly attract interest for both technological applications and fundamental research. The understanding of the origin of the high-performance piezoelectric property remains a challenge mainly due to the lack of direct experimental evidence. We perform in situ high-energy x-ray diffraction combined with 2D geometry scattering technology to reveal the underlying mechanism for the perovskite-type lead-based high-performance piezoelectric materials. The direct structural evidence reveals that the electric-field-driven continuous polarization rotation within the monoclinic plane plays a critical role to achieve the giant piezoelectric response. An intrinsic relationship between the crystal structure and piezoelectric performance in perovskite ferroelectrics has been established: A strong tendency of electric-field-driven polarization rotation generates peak piezoelectric performance and vice versa. Furthermore, the monoclinic MA structure is the key feature to superior piezoelectric properties as compared to other structures such as monoclinic MB , rhombohedral, and tetragonal. A high piezoelectric response originates from intrinsic lattice strain, but little from extrinsic domain switching. The present results will facilitate designing high-performance perovskite piezoelectric materials by enhancing the intrinsic lattice contribution with easy and continuous polarization rotation.

  5. Remarkable features in lattice-parameter ratios of crystals. II. Monoclinic and triclinic crystals.

    PubMed

    de Gelder, R; Janner, A

    2005-06-01

    The frequency distributions of monoclinic crystals as a function of the lattice-parameter ratios resemble the corresponding ones of orthorhombic crystals: an exponential component, with more or less pronounced sharp peaks, with in general the most important peak at the ratio value 1. In addition, the distribution as a function of the monoclinic angle beta has a sharp peak at 90 degrees and decreases sensibly at larger angles. Similar behavior is observed for the three triclinic angular parameters alpha, beta and gamma, with characteristic differences between the organic and metal-organic, bio-macromolecular and inorganic crystals, respectively. The general behavior observed for the hexagonal, tetragonal, orthorhombic, monoclinic and triclinic crystals {in the first part of this series [de Gelder & Janner (2005). Acta Cryst. B61, 287-295] and in the present case} is summarized and commented. The data involved represent 366 800 crystals, with lattice parameters taken from the Cambridge Structural Database, CSD (294 400 entries), the Protein Data Bank, PDB (18 800 entries), and the Inorganic Crystal Structure Database, ICSD (53 600 entries). A new general structural principle is suggested.

  6. Synthesis and characterization of embedded germanium nanocrystals

    NASA Astrophysics Data System (ADS)

    Xu, Qing

    Isotopically pure Ge nanocrystals have been synthesized by ion implantation followed by thermal annealing in amorphous silica and crystalline sapphire matrix. The structure, and the mechanical and thermal properties of the two systems are studied and compared. Ge cluster nucleation during implantation is observed in as-implanted silica samples. It results in the wide size distribution observed after thermal annealing. Theoretical calculations predict that if the nucleation during implantation can be suppressed, a much narrower size distribution is achievable. As-grown Ge nanocrystals are under large compressive stress, 1.2GPa for nanocrystals embedded in silica, and 4GPa for those embedded in sapphire. The stress can be gradually relieved by vapor etching, liberating the nanocrystals from the matrix as well as post-growth thermal treatments. One of the main sources of the stress observed in the sapphire system is the volume expansion of Ge clusters in the liquid/solid phase transformation which occurs during the cooling process from annealing temperature to room temperature, as the density of liquid Ge is larger by 4.6% than that of solid Ge. The large stress and damage in the sapphire matrix lead to a unique double-peak size distribution of the Ge nanocrystals. However, the in situ transmission electron microscopy (TEM) experiments indicate that the Ge nanocrystals embedded in silica are already in their solid phase at the annealing temperature. Therefore, the stress originates from other sources. Vapor etching with HF solutions enables a gradual exposure of embedded Ge nanocrystals in SiO2, while the liquid etching in HF solution leaves fully liberated Ge nanocrystals loosely packed on the Si substrate. Transfer of liberated Ge nanocrystals to other surfaces is achieved by solution dispersion and subsequent evaporation. The patterning of nanocrystals has been achieved by a combination of lithography, coimplantation and electron irradiation. The latter one will

  7. Biaxial flexural strength of bilayered zirconia using various veneering ceramics

    PubMed Central

    Chantranikul, Natravee

    2015-01-01

    PURPOSE The aim of this study was to evaluate the biaxial flexural strength (BFS) of one zirconia-based ceramic used with various veneering ceramics. MATERIALS AND METHODS Zirconia core material (Katana) and five veneering ceramics (Cerabien ZR; CZR, Lava Ceram; LV, Cercon Ceram Kiss; CC, IPS e.max Ceram; EM and VITA VM9; VT) were selected. Using the powder/liquid layering technique, bilayered disk specimens (diameter: 12.50 mm, thickness: 1.50 mm) were prepared to follow ISO standard 6872:2008 into five groups according to veneering ceramics as follows; Katana zirconia veneering with CZR (K/CZR), Katana zirconia veneering with LV (K/LV), Katana zirconia veneering with CC (K/CC), Katana zirconia veneering with EM (K/EM) and Katana zirconia veneering with VT (K/VT). After 20,000 thermocycling, load tests were conducted using a universal testing machine (Instron). The BFS were calculated and analyzed with one-way ANOVA and Tukey HSD (α=0.05). The Weibull analysis was performed for reliability of strength. The mode of fracture and fractured surface were observed by SEM. RESULTS It showed that K/CC had significantly the highest BFS, followed by K/LV. BFS of K/CZR, K/EM and K/VT were not significantly different from each other, but were significantly lower than the other two groups. Weibull distribution reported the same trend of reliability as the BFS results. CONCLUSION From the result of this study, the BFS of the bilayered zirconia/veneer composite did not only depend on the Young's modulus value of the materials. Further studies regarding interfacial strength and sintering factors are necessary to achieve the optimal strength. PMID:26576251

  8. Metal stain on monolithic zirconia restoration: A case report

    PubMed Central

    2017-01-01

    In restorative treatment using fixed dental prostheses, dentists should select appropriate restoration material among various types of dental materials. The strength, marginal fit, esthetics, wear resistance, biocompatibility, and cost are important factors in the choice of restoration materials. The present case showed a surface stain on a monolithic zirconia restoration that was due to wear between the monolithic zirconia restoration and the base metal alloy restoration. This phenomenon was confirmed by surface roughness measurement and electron probe micro-analysis. PMID:28435624

  9. Zirconia crowns - the new standard for single-visit dentistry?

    PubMed

    Wiedhahn, Klaus; Fritzsche, Günter; Wiedhahn, Claudine; Schenk, Olaf

    2016-01-01

    Zirconia crowns combine the advantages of metal restorations, such as minimally invasive tooth preparation and ease of cementation, with those of full ceramic crowns, such as low thermal conductivity and tooth color. With the introduction of a high-speed sintering procedure, it is possible to produce and cement zirconia crowns and small monolithic bridges in a Cerec Single Visit procedure. This new procedure is compared to established chairside methods.

  10. Metal stain on monolithic zirconia restoration: A case report.

    PubMed

    Cha, Min-Sang; Lee, Sang-Woon; Huh, Yoon-Hyuk; Cho, Lee-Ra; Park, Chan-Jin

    2017-04-01

    In restorative treatment using fixed dental prostheses, dentists should select appropriate restoration material among various types of dental materials. The strength, marginal fit, esthetics, wear resistance, biocompatibility, and cost are important factors in the choice of restoration materials. The present case showed a surface stain on a monolithic zirconia restoration that was due to wear between the monolithic zirconia restoration and the base metal alloy restoration. This phenomenon was confirmed by surface roughness measurement and electron probe micro-analysis.

  11. Nanocrystal technology, drug delivery and clinical applications

    PubMed Central

    Junghanns, Jens-Uwe A H; Müller, Rainer H

    2008-01-01

    Nanotechnology will affect our lives tremendously over the next decade in very different fields, including medicine and pharmacy. Transfer of materials into the nanodimension changes their physical properties which were used in pharmaceutics to develop a new innovative formulation principle for poorly soluble drugs: the drug nanocrystals. The drug nanocrystals do not belong to the future; the first products are already on the market. The industrially relevant production technologies, pearl milling and high pressure homogenization, are reviewed. The physics behind the drug nanocrystals and changes of their physical properties are discussed. The marketed products are presented and the special physical effects of nanocrystals explained which are utilized in each market product. Examples of products in the development pipelines (clinical phases) are presented and the benefits for in vivo administration of drug nanocrystals are summarized in an overview. PMID:18990939

  12. Copper Selenide Nanocrystals for Photothermal Therapy

    PubMed Central

    Hessel, Colin M.; Pattani, Varun; Rasch, Michael; Panthani, Matthew G.; Koo, Bonil; Tunnell, James W.; Korgel, Brian A.

    2011-01-01

    Ligand-stabilized copper selenide (Cu2−xSe) nanocrystals, approximately 16 nm in diameter, were synthesized by a colloidal hot injection method and coated with amphiphilic polymer. The nanocrystals readily disperse in water and exhibit strong near infrared (NIR) optical absorption with a high molar extinction coefficient of 7.7 × 107 cm−1 M−1 at 980 nm. When excited with 800 nm light, the Cu2−xSe nanocrystals produce significant photothermal heating with a photothermal transduction efficiency of 22%, comparable to nanorods and nanoshells of gold (Au). In vitro photothermal heating of Cu2−xSe nanocrystals in the presence of human colorectal cancer cell (HCT-116) led to cell destruction after 5 minutes of laser irradiation at 33 W/cm2, demonstrating the viabilitiy of Cu2−xSe nanocrystals for photothermal therapy applications. PMID:21553924

  13. Copper selenide nanocrystals for photothermal therapy.

    PubMed

    Hessel, Colin M; Pattani, Varun P; Rasch, Michael; Panthani, Matthew G; Koo, Bonil; Tunnell, James W; Korgel, Brian A

    2011-06-08

    Ligand-stabilized copper selenide (Cu(2-x)Se) nanocrystals, approximately 16 nm in diameter, were synthesized by a colloidal hot injection method and coated with amphiphilic polymer. The nanocrystals readily disperse in water and exhibit strong near-infrared (NIR) optical absorption with a high molar extinction coefficient of 7.7 × 10(7) cm(-1) M(-1) at 980 nm. When excited with 800 nm light, the Cu(2-x)Se nanocrystals produce significant photothermal heating with a photothermal transduction efficiency of 22%, comparable to nanorods and nanoshells of gold (Au). In vitro photothermal heating of Cu(2-x)Se nanocrystals in the presence of human colorectal cancer cell (HCT-116) led to cell destruction after 5 min of laser irradiation at 33 W/cm(2), demonstrating the viabilitiy of Cu(2-x)Se nanocrystals for photothermal therapy applications.

  14. Measuring the Valence of Nanocrystal Surfaces

    SciTech Connect

    Owen, Jonathan Scharle

    2016-11-30

    The goal of this project is to understand and control the interplay between nanocrystal stoichiometry, surface ligand binding and exchange, and the optoelectronic properties of semiconductor nanocrystals in solution and in thin solid films. We pursued three research directions with this goal in mind: 1) We characterized nanocrystal stoichiometry and its influence on the binding of L-type and X-type ligands, including the thermodynamics of binding and the kinetics of ligand exchange. 2) We developed a quantitative understanding of the relationship between surface ligand passivation and photoluminescence quantum yield. 3) We developed methods to replace the organic ligands on the nanocrystal with halide ligands and controllably deposit these nanocrystals into thin films, where electrical measurements were used to investigate the electrical transport and internanocrystal electronic coupling.

  15. Partially stabilized zirconia piston bowl reliability

    SciTech Connect

    Hartsock, D.L.

    1987-10-01

    The Weibull based ''Simplified Structural Ceramic Design Technique'' was used to calculate the reliability of a partially stabilized zirconia (PSZ) piston bowl design. The details of the method and a set of sample calculations are presented. Test results of the piston bowl showed cracks in regions which had a high calculated probability of failure. In addition cracks developed in a region of high compressive/shear stress. Since Weibull reliability analysis only uses tensile stresses this area did not have a high calculated probability of failure. Several hypotheses are presented for the mode of failure in this region. The simplified technique was used to predict what the necessary material properties would have to be for successful PSZ insert of the design shown.

  16. Exploiting the colloidal nanocrystal library to construct electronic devices

    NASA Astrophysics Data System (ADS)

    Choi, Ji-Hyuk; Wang, Han; Oh, Soong Ju; Paik, Taejong; Sung, Pil; Sung, Jinwoo; Ye, Xingchen; Zhao, Tianshuo; Diroll, Benjamin T.; Murray, Christopher B.; Kagan, Cherie R.

    2016-04-01

    Synthetic methods produce libraries of colloidal nanocrystals with tunable physical properties by tailoring the nanocrystal size, shape, and composition. Here, we exploit colloidal nanocrystal diversity and design the materials, interfaces, and processes to construct all-nanocrystal electronic devices using solution-based processes. Metallic silver and semiconducting cadmium selenide nanocrystals are deposited to form high-conductivity and high-mobility thin-film electrodes and channel layers of field-effect transistors. Insulating aluminum oxide nanocrystals are assembled layer by layer with polyelectrolytes to form high-dielectric constant gate insulator layers for low-voltage device operation. Metallic indium nanocrystals are codispersed with silver nanocrystals to integrate an indium supply in the deposited electrodes that serves to passivate and dope the cadmium selenide nanocrystal channel layer. We fabricate all-nanocrystal field-effect transistors on flexible plastics with electron mobilities of 21.7 square centimeters per volt-second.

  17. Chemical interaction mechanism of 10-MDP with zirconia

    PubMed Central

    Nagaoka, Noriyuki; Yoshihara, Kumiko; Feitosa, Victor Pinheiro; Tamada, Yoshiyuki; Irie, Masao; Yoshida, Yasuhiro; Van Meerbeek, Bart; Hayakawa, Satoshi

    2017-01-01

    Currently, the functional monomer 10-methacryloyloxy-decyl-dihydrogen-phosphate (10-MDP) was documented to chemically bond to zirconia ceramics. However, little research has been conducted to unravel the underlying mechanisms. This study aimed to assess the chemical interaction and to demonstrate the mechanisms of coordination between 10-MDP and zirconium oxide using 1H and 31P magic angle spinning (MAS) nuclear magnetic resonance (NMR) and two dimensional (2D) 1H → 31P heteronuclear correlation (HETCOR) NMR. In addition, shear bond-strength (SBS) tests were conducted to determine the effect of 10-MDP concentration on the bonding effectiveness to zirconia. These SBS tests revealed a 10-MDP concentration-dependent SBS with a minimum of 1-ppb 10-MDP needed. 31P-NMR revealed that one P-OH non-deprotonated of the PO3H2 group from 10-MDP chemically bonded strongly to zirconia. 1H-31P HETCOR NMR indicated that the 10-MDP monomer can be adsorbed onto the zirconia particles by hydrogen bonding between the P=O and Zr-OH groups or via ionic interactions between partially positive Zr and deprotonated 10-MDP (P-O−). The combination of 1H NMR and 2D 1H-31P HETCOR NMR enabled to describe the different chemical states of the 10-MDP bonds with zirconia; they not only revealed ionic but also hydrogen bonding between 10-MDP and zirconia. PMID:28358121

  18. Porous alumina and zirconia ceramics with tailored thermal conductivity

    NASA Astrophysics Data System (ADS)

    Gregorová, E.; Pabst, W.; Sofer, Z.; Jankovský, O.; Matějíček, J.

    2012-11-01

    The thermal conductivity of porous ceramics can be tailored by slip casting and uniaxial dry pressing, using either fugitive pore formers (saccharides) or partial sintering. Porous alumina and zirconia ceramics have been prepared using appropriate powder types (ungranulated for casting, granulated for pressing) and identical firing regimes (but different maximum temperatures in the case of partial sintering). Thermal diffusivities have been measured by the laser- and xenon-flash method and transformed into relative thermal conductivities, which enable a temperature-independent comparison between different materials. While the porosity can be controlled in a similar way for both materials when using pore formers, partial sintering exhibits characteristic differences between alumina and zirconia (for alumina porosities below 45 %, full density above 1600 °C, for zirconia porosities below 60 %, full density above 1300 °C). The different compaction behavior of alumina and zirconia (porosity after pressing 0.465 and 0.597, respectively) is reflected in the fact that for alumina the relative conductivity data of partially sintered materials are below the exponential prediction, while for zirconia they coincide with the latter. Notwithstanding these characteristic differences, for both alumina and zirconia it is possible to tailor the thermal conductivity from 100 % down to approx. 15 % of the solid phase value.

  19. Synthesis and catalytic activity of polysaccharide templated nanocrystalline sulfated zirconia

    NASA Astrophysics Data System (ADS)

    Sherly, K. B.; Rakesh, K.

    2014-01-01

    Nanoscaled materials are of great interest due to their unique enhanced optical, electrical and magnetic properties. Sulfate-promoted zirconia has been shown to exhibit super acidic behavior and high activity for acid catalyzed reactions. Nanocrystalline zirconia was prepared in the presence of polysaccharide template by interaction between ZrOCl2ṡ8H2O and chitosan template. The interaction was carried out in aqueous phase, followed by the removal of templates by calcination at optimum temperature and sulfation. The structural and textural features were characterized by powder XRD, TG, SEM and TEM. XRD patterns showed the peaks of the diffractogram were in agreement with the theoretical data of zirconia with the catalytically active tetragonal phase and average crystalline size of the particles was found to be 9 nm, which was confirmed by TEM. TPD using ammonia as probe, FTIR and BET surface area analysis were used for analyzing surface features like acidity and porosity. The BET surface area analysis showed the sample had moderately high surface area. FTIR was used to find the type species attached to the surface of zirconia. UV-DRS found the band gap of the zirconia was found to be 2.8 eV. The benzylation of o-xylene was carried out batchwise in atmospheric pressure and 433K temperature using sulfated zirconia as catalyst.

  20. Sliding Contact Fatigue of Graded Zirconia with External Esthetic Glass

    PubMed Central

    Ren, L.; Janal, M.N.; Zhang, Y.

    2011-01-01

    Veneer chipping and fracture are common failure modes for porcelain-veneered zirconia dental restorations. We hypothesized that the graded glass/zirconia/glass with external esthetic glass (e-GZG) can increase the lifetime and improve resistance to veneer chipping and fracture relative to porcelain-veneered zirconia, while providing necessary esthetics. Previously, we have demonstrated that a graded glass-zirconia surface possesses excellent resistance to occlusal-like sliding contact fatigue. Here, we investigated the sliding contact fatigue response of this graded glass-zirconia surface with external esthetic glass. This external glass is essential for shade options, for preventing excessive wear of opposing dentition, and for protecting Y-TZP from hydrothermal degradation. e-GZG plates were bonded to composite blocks and subjected to prolonged sliding contact up to 10 million cycles at 200 N in water. The resistance to sliding contact fatigue of e-GZG matches that of monolithic Y-TZP, and both of these materials demonstrated lifetimes that were orders of magnitude longer than that of porcelain-veneered zirconia. Graded e-GZG is a promising restorative material. PMID:21666105

  1. Fusion sputtering for bonding to zirconia-based materials.

    PubMed

    Aboushelib, Moustafa N

    2012-08-01

    To evaluate the influence of fusion sputtering on zirconia-resin microtensile bond strength after 6 months of water storage. Zirconia disks received one of the following surface treatments: particle abrasion with 50-µm aluminum oxide particles or fusion sputtering, while as-sintered specimens served as a control. The prepared zirconia disks (Lava Zirconia) were bonded to pre-aged composite disks (Filtek Z250) using a phosphatemonomer- containing resin cement (RelyX Unicem), and the bonded specimens were sectioned into micro-bars (1 x 1 x 6 mm) which were either immediately tested or after 6 months of water storage (n = 25). Scanning electron microscopy (SEM) and surface roughness were performed for the prepared specimens. Data were analyzed using two-way ANOVA (α = 0.05). Particle abrasion (33.1 MPa) and fusion sputtering (42.5 MPa) produced significantly higher MTBS values and resisted degradation after 6 months of water storage, while as-sintered specimens (12.4 MPa) demonstrated a significant reduction in bond strength after water storage (2.9 MPa). SEM examination indicated that fusion sputtering resulted in the creation of retentive zirconia beads on the treated surface, which enhanced micromechanical retention with adhesive resin and prevented interfacial failure. Fusion sputtering is a new and a simple method suitable for enhancing the bond strength of adhesive resins to zirconia-based frameworks.

  2. Synthesis and catalytic activity of polysaccharide templated nanocrystalline sulfated zirconia

    SciTech Connect

    Sherly, K. B.; Rakesh, K.

    2014-01-28

    Nanoscaled materials are of great interest due to their unique enhanced optical, electrical and magnetic properties. Sulfate-promoted zirconia has been shown to exhibit super acidic behavior and high activity for acid catalyzed reactions. Nanocrystalline zirconia was prepared in the presence of polysaccharide template by interaction between ZrOCl{sub 2}⋅8H{sub 2}O and chitosan template. The interaction was carried out in aqueous phase, followed by the removal of templates by calcination at optimum temperature and sulfation. The structural and textural features were characterized by powder XRD, TG, SEM and TEM. XRD patterns showed the peaks of the diffractogram were in agreement with the theoretical data of zirconia with the catalytically active tetragonal phase and average crystalline size of the particles was found to be 9 nm, which was confirmed by TEM. TPD using ammonia as probe, FTIR and BET surface area analysis were used for analyzing surface features like acidity and porosity. The BET surface area analysis showed the sample had moderately high surface area. FTIR was used to find the type species attached to the surface of zirconia. UV-DRS found the band gap of the zirconia was found to be 2.8 eV. The benzylation of o-xylene was carried out batchwise in atmospheric pressure and 433K temperature using sulfated zirconia as catalyst.

  3. Chemical interaction mechanism of 10-MDP with zirconia.

    PubMed

    Nagaoka, Noriyuki; Yoshihara, Kumiko; Feitosa, Victor Pinheiro; Tamada, Yoshiyuki; Irie, Masao; Yoshida, Yasuhiro; Van Meerbeek, Bart; Hayakawa, Satoshi

    2017-03-30

    Currently, the functional monomer 10-methacryloyloxy-decyl-dihydrogen-phosphate (10-MDP) was documented to chemically bond to zirconia ceramics. However, little research has been conducted to unravel the underlying mechanisms. This study aimed to assess the chemical interaction and to demonstrate the mechanisms of coordination between 10-MDP and zirconium oxide using (1)H and (31)P magic angle spinning (MAS) nuclear magnetic resonance (NMR) and two dimensional (2D) (1)H → (31)P heteronuclear correlation (HETCOR) NMR. In addition, shear bond-strength (SBS) tests were conducted to determine the effect of 10-MDP concentration on the bonding effectiveness to zirconia. These SBS tests revealed a 10-MDP concentration-dependent SBS with a minimum of 1-ppb 10-MDP needed. (31)P-NMR revealed that one P-OH non-deprotonated of the PO3H2 group from 10-MDP chemically bonded strongly to zirconia. (1)H-(31)P HETCOR NMR indicated that the 10-MDP monomer can be adsorbed onto the zirconia particles by hydrogen bonding between the P=O and Zr-OH groups or via ionic interactions between partially positive Zr and deprotonated 10-MDP (P-O(-)). The combination of (1)H NMR and 2D (1)H-(31)P HETCOR NMR enabled to describe the different chemical states of the 10-MDP bonds with zirconia; they not only revealed ionic but also hydrogen bonding between 10-MDP and zirconia.

  4. Yield strength of zirconia and glass fibre-reinforced posts.

    PubMed

    Pfeiffer, P; Schulz, A; Nergiz, I; Schmage, P

    2006-01-01

    The aim of this in vitro study was to evaluate the yield strengths of glass fibre-reinforced composite (FRC) posts and zirconia dioxide ceramic (ZDC) posts. Tapered glass FRC posts (DentinPost) and ZDC posts (Cerapost) of three sizes in diameter (ISO 50, 90, 110) were used for bending tests. Conventional prefabricated titanium posts of the same sizes served as control groups. The 0.2% yield strengths (R(0.2)) were tested on a universal testing machine. As zirconia posts fractured before they were yielded 0.2%, the fracture strength instead of the yield strength was recorded for these posts. One-way and two-way anova and Bonferroni-Dunn's multiple comparison tests were performed for the statistical analysis. The mean 0.2% yield strengths of the posts were 27 +/- 1 N for glass fibre-reinforced posts and 58 +/- 4 N for zirconia posts of ISO 50 (control group: 54 +/- 3 N). For ISO 90 yield strengths of 52 +/- 4 N for glass fibre-reinforced posts, 117 +/- 20 N for zirconia posts and 117 +/- 11 N for the control group were obtained. For ISO 110 mean yield strengths amounted to 73 +/- 5 N for glass fibre-reinforced posts, 166 +/- 23 N for zirconia posts and 141 +/- 12 N for the control group. Significantly higher yield strength was recorded for the zirconia and the titanium posts compared with the glass fibre-reinforced posts for the tested ISO sizes.

  5. Evaluation of structure and material properties of RF magnetron sputter-deposited yttria-stabilized zirconia thin films

    NASA Astrophysics Data System (ADS)

    Piascik, Jeffrey Robert

    Over the past several decades, research has focused on utilizing ceramic materials in new technological applications. Their uses have been primarily in applications that involve high temperatures or corrosive environments. Unfortunately, ceramic materials have been limited especially since they can be brittle, failing in a sudden and catastrophic manner. A strong emphasis on understanding mechanical properties of ceramics and ways to improving their strength and toughness, has led to many new technologies. The present work is part of a larger research initiative that is aimed at using RF magnetron sputter deposition of yttria-stabilized zirconia to improve the fracture toughness of brittle substrates (more specifically dental ceramics). Partially-stabilized zirconia (PSZ) has been studied extensively, due to its high temperature stability and stress-induced tetragonal to monoclinic (T⇒M) martensitic phase transformation. RF magnetron sputtering was chosen as the deposition method because of its versatility, especially the ability to deposit oxides at low temperatures. Initial investigations focused on the development of process-structure-properties of YSZ sputtered deposited thin films. The YSZ thin films were deposited over a range of temperatures (22--300°C), pressures (5--25 mTorr), and gas compositions (Ar:O2 ratio). Initial studies characterized a select set of properties in relation to deposition parameters including: refractive index, structure, and film stress. X-ray Diffraction (XRD) showed that the films are comprised of mainly monoclinic and tetragonal crystal phases. The film refractive index determined by prism coupling, depends strongly on deposition conditions and ranged from 1.959 to 2.223. Wafer bow measurements indicate that the sputtered YSZ films can have initial stress ranging from 86 MPa tensile to 192 MPa compressive, depending on the deposition parameters. Exposure to ambient conditions (25°C, 75% relative humidity) led to large increase

  6. Monoclinic pseudosymmetry in 2-phenoxybenzenesulfonamide, a triclinic structure having Z' = 4, and spontaneous resolution in monoclinic N-methyl-2-phenoxybenzenesulfonamide.

    PubMed

    Glidewell, Christopher; Low, John N; Skakle, Janet M S; Wardell, James L

    2004-05-01

    2-Phenoxybenzenesulfonamide, C(12)H(11)NO(3)S, (I), crystallizes in space group P-1 with Z' = 4, but the structure closely mimics the monoclinic space group P2(1)/b with Z' = 2. The molecules of (I) are linked by a combination of N-H...O and C-H...O hydrogen bonds into two independent chains of centrosymmetric edge-fused R(2)(2)(18) and R(6)(6)(34) rings. N-Methyl-2-phenoxybenzenesulfonamide, C(13)H(13)NO(3)S, (II), crystallizes in space group P2(1) with Z' = 1, and is an example of spontaneous resolution. The molecules are linked by N-H...O and C-H...O hydrogen bonds into chains of spiro-fused R(2)(2)(12) rings, and these chains are linked into sheets by a single C-H...pi(arene) hydrogen bond.

  7. Testing Monoclines for Dextral Shear: Paleomagnetic Results From the Nacimiento Uplift, Northern New Mexico

    NASA Astrophysics Data System (ADS)

    Tetreault, J.; Jones, C. H.

    2001-12-01

    Dextral shear along the eastern margin of the Colorado Plateau has been inferred to have occurred in the Laramide orogeny by many workers. Some shear has been suggested to have occurred on exposed faults, but the limited strike extent of these faults presents a difficulty for advocates of large strike-slip Laramide motion. One possibility is that that shear is expressed as vertical-axis rotations along monoclinal folds that extend beyond the surface traces of the mapped faults. We examine one such monocline bounded to the west by the Nacimiento Fault in northern New Mexico. The Nacimiento Uplift is a north-south trending vertical structure along the eastern boundary of the San Juan Basin formed by Laramide reactivation of a Late Paleozoic uplift. Previous investigations have interpreted Laramide dextral slip along the Nacimiento Fault from minor fault data (Erslev, 2001), Proterozoic piercing lines (Cather, 1999), and related strike slip structures (Woodward, 1987). Paleomagnetic analysis was conducted to determine if the monocline accomodated strike-slip motion through vertical axis rotations. Preliminary results from the Late Cretaceous Mesaverde, Paleocene Nacimiento, and Paleocene Ojo Alamo formations north of the Nacimiento Fault establish an absence of vertical-axis rotation along the fold. The Mesaverde sandstone yields the most favorable results. Antipodal directions in the Mesaverde samples imply that a primary magnetization penecontemporaneous with deposition has been isolated. The tilt-corrected direction is D= 332+/- 11° , I = 53+/- 7° , α 95 = 8° , N = 24. The results are indistinguishable from the expected Late Cretaceous direction (D= 339+/- 8° , I = 63+/- 11° ) with a rotation of R = -7 +/- 14° . The Nacimiento and Ojo Alamo sandstones produced more scattered directions, yet still consistent with the virtual absence of rotation. Thus either (1) right-lateral shear does not occur along the Nacimiento monocline or (2) it does not produce

  8. Optoelectronic sensitization of carbon nanotubes by CdTe nanocrystals

    NASA Astrophysics Data System (ADS)

    Zebli, B.; Vieyra, H. A.; Carmeli, I.; Hartschuh, A.; Kotthaus, J. P.; Holleitner, A. W.

    2009-05-01

    We investigate the photoconductance of single-walled carbon nanotube-nanocrystal hybrids. The nanocrystals are bound to the nanotubes via molecular recognition. We find that the photoconductance of the hybrids can be adjusted by the absorption characteristics of the nanocrystals. In addition, the photoconductance of the hybrids surprisingly exhibits a slow time constant of about 1 ms after excitation of the nanocrystals. The data are consistent with a bolometrically induced current increase in the nanotubes caused by photon absorption in the nanocrystals.

  9. Light transmittance of zirconia as a function of thickness and microhardness of resin cements under different thicknesses of zirconia

    PubMed Central

    Egilmez, Ferhan; Ergun, Gulfem; Kaya, Bekir M.

    2013-01-01

    Objective: The objective of this study was to compare microhardness of resin cements under different thicknesses of zirconia and the light transmittance of zirconia as a function of thickness. Study design: A total of 126 disc-shaped specimens (2 mm in height and 5 mm in diameter) were prepared from dual-cured resin cements (RelyX Unicem, Panavia F and Clearfil SA cement). Photoactivation was performed by using quartz tungsten halogen and light emitting diode light curing units under different thicknesses of zirconia. Then the specimens (n=7/per group) were stored in dry conditions in total dark at 37°C for 24 h. The Vicker’s hardness test was performed on the resin cement layer with a microhardness tester. Statistical significance was determined using multifactorial analysis of variance (ANOVA) (alpha=.05). Light transmittance of different thicknesses of zirconia (0.3, 0.5 and 0.8 mm) was measured using a hand-held radiometer (Demetron, Kerr). Data were analyzed using one-way ANOVA test (alpha=.05). Results: ANOVA revealed that resin cement and light curing unit had significant effects on microhardness (p < 0.001). Additionally, greater zirconia thickness resulted in lower transmittance. There was no correlation between the amount of light transmitted and microhardness of dual-cured resin cements (r = 0.073, p = 0.295). Conclusion: Although different zirconia thicknesses might result in insufficient light transmission, dual-cured resin cements under zirconia restorations could have adequate microhardness. Key words:Zirconia, microhardness, light transmittance, resin cement. PMID:23385497

  10. pH control of the structure, composition, and catalytic activity of sulfated zirconia

    SciTech Connect

    Ivanov, Vladimir K.; Baranchikov, Alexander Ye.; Kopitsa, Gennady P.; Lermontov, Sergey A.; Yurkova, Lyudmila L.; Gubanova, Nadezhda N.; Ivanova, Olga S.; Lermontov, Anatoly S.; Rumyantseva, Marina N.; Vasilyeva, Larisa P.; Sharp, Melissa; Pranzas, P. Klaus; Tretyakov, Yuri D.

    2013-02-15

    We report a detailed study of structural and chemical transformations of amorphous hydrous zirconia into sulfated zirconia-based superacid catalysts. Precipitation pH is shown to be the key factor governing structure, composition and properties of amorphous sulfated zirconia gels and nanocrystalline sulfated zirconia. Increase in precipitation pH leads to substantial increase of surface fractal dimension (up to {approx}2.7) of amorphous sulfated zirconia gels, and consequently to increase in specific surface area (up to {approx}80 m{sup 2}/g) and simultaneously to decrease in sulfate content and total acidity of zirconia catalysts. Complete conversion of hexene-1 over as synthesized sulfated zirconia catalysts was observed even under ambient conditions. - Graphical abstract: Surface fractal dimension of amorphous sulfated zirconia and specific surface area and catalytic activity of crystalline sulfated zirconia as a function of precipitation pH. Highlights: Black-Right-Pointing-Pointer Structural transformation of amorphous hydrous zirconia into sulfated zirconia is studied. Black-Right-Pointing-Pointer Precipitation pH controls surface fractal dimension of amorphous zirconia gels. Black-Right-Pointing-Pointer Precipitation pH is the key factor governing properties of sulfated zirconia.

  11. Effects of aqueous and acid-based coloring liquids on the hardness of zirconia restorations.

    PubMed

    Nam, Ji-Young; Park, Mi-Gyoung

    2017-05-01

    The effects of the application of aqueous coloring liquids on the mechanical properties of zirconia have not yet been investigated. The purpose of this in vitro study was to evaluate the effects of 3 different coloring techniques and the number of coloring liquid applications on the hardness of zirconia. Eighty specimens were divided into 8 groups (n=10); nonshaded zirconia, preshaded zirconia, acid-based coloring liquid zirconia, and aqueous coloring liquid zirconia (1, 3, 6). Vickers hardness was measured. Data were analyzed via 1-way and 2-way ANOVAs. Multiple comparisons were performed using a Scheffé test (α=.05). Statistically significant differences in hardness were found between acid-based coloring liquid zirconia and aqueous coloring liquid zirconia (P<.001). Increasing the number of coloring liquid applications decreased the hardness value of acid-based coloring liquid zirconia (P<.001) but had no effect on the hardness of aqueous coloring liquid zirconia (P>.05). Within the limitations of this study, the hardness of zirconia was influenced to differing degrees depending on coloring technique. The number of coloring liquid applications affected the hardness of zirconia colored with the acid-based coloring liquid but not the hardness of zirconia colored with the aqueous coloring liquid. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.

  12. Coordinate-Invariant Lyddane-Sachs-Teller Relationship for Polar Vibrations in Materials with Monoclinic and Triclinic Crystal Systems

    NASA Astrophysics Data System (ADS)

    Schubert, Mathias

    2016-11-01

    A coordinate-invariant generalization of the Lyddane-Sachs-Teller relation is presented for polar vibrations in materials with monoclinic and triclinic crystal systems. The generalization is derived from an eigendielectric displacement vector summation approach, which is equivalent to the microscopic Born-Huang description of polar lattice vibrations in the harmonic approximation. An expression for a general oscillator strength is also described for materials with monoclinic and triclinic crystal systems. A generalized factorized form of the dielectric response characteristic for monoclinic and triclinic materials is proposed. The generalized Lyddane-Sachs-Teller relation is found valid for monoclinic β -Ga2O3 , where accurate experimental data became available recently from a comprehensive generalized ellipsometry investigation [Phys. Rev. B 93, 125209 (2016)]. Data for triclinic crystal systems can be measured by generalized ellipsometry as well, and are anticipated to become available soon and results can be compared with the generalized relations presented here.

  13. Monoclinic and Tetragonal Plagioclase (An54) in Shock Veins from the Central Uplift of the Manicouagan Impact Structure

    NASA Astrophysics Data System (ADS)

    Spray, J. G.; Boonsue, S.

    2016-08-01

    This work documents the discovery of monoclinic- and tetragonal-structured plagioclase. Critically, the high-pressure polymorphs possess the same composition as the non-shocked triclinic phase (An54).

  14. Coordinate-Invariant Lyddane-Sachs-Teller Relationship for Polar Vibrations in Materials with Monoclinic and Triclinic Crystal Systems.

    PubMed

    Schubert, Mathias

    2016-11-18

    A coordinate-invariant generalization of the Lyddane-Sachs-Teller relation is presented for polar vibrations in materials with monoclinic and triclinic crystal systems. The generalization is derived from an eigendielectric displacement vector summation approach, which is equivalent to the microscopic Born-Huang description of polar lattice vibrations in the harmonic approximation. An expression for a general oscillator strength is also described for materials with monoclinic and triclinic crystal systems. A generalized factorized form of the dielectric response characteristic for monoclinic and triclinic materials is proposed. The generalized Lyddane-Sachs-Teller relation is found valid for monoclinic β-Ga_{2}O_{3}, where accurate experimental data became available recently from a comprehensive generalized ellipsometry investigation [Phys. Rev. B 93, 125209 (2016)]. Data for triclinic crystal systems can be measured by generalized ellipsometry as well, and are anticipated to become available soon and results can be compared with the generalized relations presented here.

  15. Polymer grafting onto starch nanocrystals.

    PubMed

    Labet, Marianne; Thielemans, Wim; Dufresne, Alain

    2007-09-01

    Monocrystalline starch nanoparticles were successfully grafted with poly(tetrahydrofuran), poly(caprolactone), and poly(ethylene glycol) monobutyl ether chains using toluene 2,4-diisocyanate as a linking agent. Surface grafting was confirmed using Fourier transform infrared and X-ray photoelectron spectroscopies, differential scanning calorimetry, elemental analysis, and contact angle measurements. Transmission electron microscopy observations of modified starch nanocrystals showed either the individualization of nanoparticles or the formation of a film, depending on the polymer used. It was shown that grafting efficiency decreased with the length of the polymeric chains, as expected. The resulting modified nanoparticles can find applications in the field of co-continuous nanocomposite materials.

  16. A novel method of surface modification by electrochemical deoxidation: Effect on surface characteristics and initial bioactivity of zirconia.

    PubMed

    Liu, Juan; Hong, Guang; Wu, Yu-Han; Endo, Kosei; Han, Jian-Min; Kumamoto, Hiroyuki; Wada, Takeshi; Kato, Hidemi; Gao, Ping; Sasaki, Keiichi

    2017-11-01

    The aim of this study was to investigate and compare the surface characteristics and initial bioactivity of ceria-stabilized zirconia/alumina nanocomposite (NANOZR) with those of yttria-stabilized zirconia (3Y-TZP) and pure titanium (CpTi) following the use of three surface modification methods; polishing, sandblasting/acid-etching (SB-E) and electrochemical deoxidation (ECD). Physical properties including surface morphology, chemical composition, X-ray diffraction, surface wettability, surface roughness, and hardness were measured. Osteoblast-like MC3T3-E1 cells were used to examine cell morphology and attachment to the surfaces of the materials. ECD treated NANOZR (NANOZR-E) showed a well-arranged, self-organized microporous surface structure with significantly low contact angles when compared with the other specimens (p < 0.05). NANOZR-E also demonstrated a slight decrease in monoclinic phase content (-4.4 wt %). The morphology and attachment of MC3T3-E1 cells on NANOZR-E were similar to those on polished and SBE-treated CpTi surfaces. Higher cell affinity was observed on NANOZR-E when compared with ECD treated 3Y-TZP. The findings of this study indicate the effectiveness of the novel technique, ECD, in the formation of a microporous surface on NANOZR when compared with both CpTi and 3Y-TZP. Moreover, this method also appears to improve the biological activity of NANOZR during the initial stage. © 2016 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater, 105B: 2641-2652, 2017. © 2016 Wiley Periodicals, Inc.

  17. Preparation of macroporous zirconia monoliths from ionic precursors via an epoxide-mediated sol-gel process accompanied by phase separation

    PubMed Central

    Song, Jie; Lvlin, Yixiu; Nakanishi, Kazuki; Kanamori, Kazuyoshi; Yang, Hui

    2015-01-01

    Monolithic macroporous zirconia (ZrO2) derived from ionic precursors has been successfully fabricated via the epoxide-mediated sol-gel route accompanied by phase separation in the presence of propylene oxide (PO) and poly(ethylene oxide) (PEO). The addition of PO used as an acid scavenger mediates the gelation, whereas PEO enhances the polymerization-induced phase separation. The appropriate choice of the starting compositions allows the production of a macroporous zirconia monolith with a porosity of 52.9% and a Brunauer–Emmett–Teller (BET) surface area of 171.9 m2 · g−1. The resultant dried gel is amorphous, whereas tetragonal ZrO2 and monoclinic ZrO2 are precipitated at 400 and 600 °C, respectively, without spoiling the macroporous morphology. After solvothermal treatment with an ethanol solution of ammonia, tetragonal ZrO2 monoliths with smooth skeletons and well-defined mesopores can be obtained, and the BET surface area is enhanced to 583.8 m2 · g−1. PMID:27877772

  18. Preparation of macroporous zirconia monoliths from ionic precursors via an epoxide-mediated sol-gel process accompanied by phase separation

    NASA Astrophysics Data System (ADS)

    Guo, Xingzhong; Song, Jie; Lvlin, Yixiu; Nakanishi, Kazuki; Kanamori, Kazuyoshi; Yang, Hui

    2015-04-01

    Monolithic macroporous zirconia (ZrO2) derived from ionic precursors has been successfully fabricated via the epoxide-mediated sol-gel route accompanied by phase separation in the presence of propylene oxide (PO) and poly(ethylene oxide) (PEO). The addition of PO used as an acid scavenger mediates the gelation, whereas PEO enhances the polymerization-induced phase separation. The appropriate choice of the starting compositions allows the production of a macroporous zirconia monolith with a porosity of 52.9% and a Brunauer-Emmett-Teller (BET) surface area of 171.9 m2 · g-1. The resultant dried gel is amorphous, whereas tetragonal ZrO2 and monoclinic ZrO2 are precipitated at 400 and 600 °C, respectively, without spoiling the macroporous morphology. After solvothermal treatment with an ethanol solution of ammonia, tetragonal ZrO2 monoliths with smooth skeletons and well-defined mesopores can be obtained, and the BET surface area is enhanced to 583.8 m2 · g-1.

  19. Preparation of macroporous zirconia monoliths from ionic precursors via an epoxide-mediated sol-gel process accompanied by phase separation.

    PubMed

    Guo, Xingzhong; Song, Jie; Lvlin, Yixiu; Nakanishi, Kazuki; Kanamori, Kazuyoshi; Yang, Hui

    2015-04-01

    Monolithic macroporous zirconia (ZrO2) derived from ionic precursors has been successfully fabricated via the epoxide-mediated sol-gel route accompanied by phase separation in the presence of propylene oxide (PO) and poly(ethylene oxide) (PEO). The addition of PO used as an acid scavenger mediates the gelation, whereas PEO enhances the polymerization-induced phase separation. The appropriate choice of the starting compositions allows the production of a macroporous zirconia monolith with a porosity of 52.9% and a Brunauer-Emmett-Teller (BET) surface area of 171.9 m(2) · g(-1). The resultant dried gel is amorphous, whereas tetragonal ZrO2 and monoclinic ZrO2 are precipitated at 400 and 600 °C, respectively, without spoiling the macroporous morphology. After solvothermal treatment with an ethanol solution of ammonia, tetragonal ZrO2 monoliths with smooth skeletons and well-defined mesopores can be obtained, and the BET surface area is enhanced to 583.8 m(2) · g(-1).

  20. Modeling of Zircon (ZrSiO{sub 4}) and Zirconia (ZrO{sub 2}) using ADF-GUI Software

    SciTech Connect

    Lwin, Maung Tin Moe; Amin, Yusoff Mohd; Kassim, Hasan Abu; Kamaluddin, Burhanuddin

    2010-07-07

    Natural zircon (ZrSiO{sub 4}) has very high concentration of Uranium and Thorium of up to 5000 ppm. Radioactive decay process of alpha particles from these impurities affects some changes like several atomic displacements in the crystalline structure of zircon. The amount of track density caused by alpha particles decay process of these radioactive materials in zircon can be decreased with annealing temperatures from 700 deg. C to 980 deg. C. Recently it has been extensively studied as the possible candidate material for immobilization of fission products and actinides. Besides, zirconia (ZrO{sub 2}), product from natural zircon, is widely used in industrial field because it has excellent chemical and mechanical properties at high temperature. Dielectric constant of monoclinic, cubic and tetragonal ZrO{sub 2} can be found in the range of 22, 35 and 50 by computer simulation works. In recent years, atomistic simulations and modeling have been studied, because a lot of computational techniques can offer atomic-level approaching with minimum errors in estimations. One favorite methods is Density Functional Theory (DFT). In this study, ADF-GUI software from DFT will be used to calculate the frequency and absorption Intensity of zircon and zirconia molecules. The data from calculations will be verified with experimental works such as Raman Spectroscopy, AFM and XRD.

  1. Orthodontic bracket bonding to glazed full-contour zirconia

    PubMed Central

    Kwak, Ji-Young; Jung, Hyo-Kyung; Choi, Il-Kyung

    2016-01-01

    Objectives This study evaluated the effects of different surface conditioning methods on the bond strength of orthodontic brackets to glazed full-zirconia surfaces. Materials and Methods Glazed zirconia (except for the control, Zirkonzahn Prettau) disc surfaces were pre-treated: PO (control), polishing; BR, bur roughening; PP, cleaning with a prophy cup and pumice; HF, hydrofluoric acid etching; AA, air abrasion with aluminum oxide; CJ, CoJet-Sand. The surfaces were examined using profilometry, scanning electron microscopy, and electron dispersive spectroscopy. A zirconia primer (Z-Prime Plus, Z) or a silane primer (Monobond-S, S) was then applied to the surfaces, yielding 7 groups (PO-Z, BR-Z, PP-S, HF-S, AA-S, AA-Z, and CJ-S). Metal bracket-bonded specimens were stored in water for 24 hr at 37℃, and thermocycled for 1,000 cycles. Their bond strengths were measured using the wire loop method (n = 10). Results Except for BR, the surface pre-treatments failed to expose the zirconia substructure. A significant difference in bond strengths was found between AA-Z (4.60 ± 1.08 MPa) and all other groups (13.38 ± 2.57 - 15.78 ± 2.39 MPa, p < 0.05). For AA-Z, most of the adhesive remained on the bracket. Conclusions For bracket bonding to glazed zirconia, a simple application of silane to the cleaned surface is recommended. A zirconia primer should be used only when the zirconia substructure is definitely exposed. PMID:27200278

  2. Bioactive and thermally compatible glass coating on zirconia dental implants.

    PubMed

    Kirsten, A; Hausmann, A; Weber, M; Fischer, J; Fischer, H

    2015-02-01

    The healing time of zirconia implants may be reduced by the use of bioactive glass coatings. Unfortunately, existing glasses are either bioactive like Bioglass 45S5 but thermally incompatible with the zirconia substrate, or they are thermally compatible but exhibit only a very low level of bioactivity. In this study, we hypothesized that a tailored substitution of alkaline earth metals and alkaline metals in 45S5 can lead to a glass composition that is both bioactive and thermally compatible with zirconia implants. A novel glass composition was analyzed using x-ray fluorescence spectroscopy, dilatometry, differential scanning calorimetry, and heating microscopy to investigate its chemical, physical, and thermal properties. Bioactivity was tested in vitro using simulated body fluid (SBF). Smooth and microstructured glass coatings were applied using a tailored spray technique with subsequent thermal treatment. Coating adhesion was tested on implants that were inserted in bovine ribs. The cytocompatibility of the coating was analyzed using L929 mouse fibroblasts. The coefficient of thermal expansion of the novel glass was shown to be slightly lower (11.58 · 10(-6) K(-1)) than that of the zirconia (11.67 · 10(-6) K(-1)). After storage in SBF, the glass showed reaction layers almost identical to the bioactive glass gold standard, 45S5. A process window between 800 °C and 910 °C was found to result in densely sintered and amorphous coatings. Microstructured glass coatings on zirconia implants survived a minimum insertion torque of 60 Ncm in the in vitro experiment on bovine ribs. Proliferation and cytotoxicity of the glass coatings was comparable with the controls. The novel glass composition showed a strong adhesion to the zirconia substrate and a significant bioactive behavior in the SBF in vitro experiments. Therefore, it holds great potential to significantly reduce the healing time of zirconia dental implants. © International & American Associations for Dental

  3. Bioactive and Thermally Compatible Glass Coating on Zirconia Dental Implants

    PubMed Central

    Kirsten, A.; Hausmann, A.; Weber, M.; Fischer, J.

    2015-01-01

    The healing time of zirconia implants may be reduced by the use of bioactive glass coatings. Unfortunately, existing glasses are either bioactive like Bioglass 45S5 but thermally incompatible with the zirconia substrate, or they are thermally compatible but exhibit only a very low level of bioactivity. In this study, we hypothesized that a tailored substitution of alkaline earth metals and alkaline metals in 45S5 can lead to a glass composition that is both bioactive and thermally compatible with zirconia implants. A novel glass composition was analyzed using x-ray fluorescence spectroscopy, dilatometry, differential scanning calorimetry, and heating microscopy to investigate its chemical, physical, and thermal properties. Bioactivity was tested in vitro using simulated body fluid (SBF). Smooth and microstructured glass coatings were applied using a tailored spray technique with subsequent thermal treatment. Coating adhesion was tested on implants that were inserted in bovine ribs. The cytocompatibility of the coating was analyzed using L929 mouse fibroblasts. The coefficient of thermal expansion of the novel glass was shown to be slightly lower (11.58·10–6 K–1) than that of the zirconia (11.67·10–6 K–1). After storage in SBF, the glass showed reaction layers almost identical to the bioactive glass gold standard, 45S5. A process window between 800 °C and 910 °C was found to result in densely sintered and amorphous coatings. Microstructured glass coatings on zirconia implants survived a minimum insertion torque of 60 Ncm in the in vitro experiment on bovine ribs. Proliferation and cytotoxicity of the glass coatings was comparable with the controls. The novel glass composition showed a strong adhesion to the zirconia substrate and a significant bioactive behavior in the SBF in vitro experiments. Therefore, it holds great potential to significantly reduce the healing time of zirconia dental implants. PMID:25421839

  4. Size quantization in Cu2Se nanocrystals

    NASA Astrophysics Data System (ADS)

    Govindraju, S.; Kalenga, M. P.; Airo, M.; Moloto, M. J.; Sikhwivhilu, L. M.; Moloto, N.

    2014-12-01

    Herein we report on the synthesis of size quantized copper selenide nanocrystals via the colloidal method. Different colours of the sample were obtained at different time intervals indicative of the sizes of the nanocrystals. The absorption band edges were blue-shifted from bulk indicative of quantum confinement. This was corroborated by the TEM results that showed very small particles ranging from 2 nm to 7 nm. This work therefore shows a phenomenon readily observed in cadmium chalcogenide nanocrystals but has never been reported for copper based chalcogenides.

  5. Quantum theory of electroabsorption in semiconductor nanocrystals.

    PubMed

    Tepliakov, Nikita V; Leonov, Mikhail Yu; Baranov, Alexander V; Fedorov, Anatoly V; Rukhlenko, Ivan D

    2016-01-25

    We develop a simple quantum-mechanical theory of interband absorption by semiconductor nanocrystals exposed to a dc electric field. The theory is based on the model of noninteracting electrons and holes in an infinitely deep quantum well and describes all the major features of electroabsorption, including the Stark effect, the Franz-Keldysh effect, and the field-induced spectral broadening. It is applicable to nanocrystals of different shapes and dimensions (quantum dots, nanorods, and nanoplatelets), and will prove useful in modeling and design of electrooptical devices based on ensembles of semiconductor nanocrystals.

  6. Photoluminescent semiconductor nanocrystals for fingerprint detection.

    PubMed

    Menzel, E R; Savoy, S M; Ulvick, S J; Cheng, K H; Murdock, R H; Sudduth, M R

    2000-05-01

    The concept of utilizing photoluminescent semiconductor nanocrystals for latent fingerprint detection, especially in concert with phase-resolved imaging for background fluorescence suppression, is reduced to practice with CdS nanocrystals that are capped with dioctyl sulfosuccinate. The nanocrystals are dissolved in heptane or hexane and are applied in much the same way as staining with fluorescent dye, on articles that have been pre-fumed with cyanoacrylate ester and also on the sticky side of electrical tape without pre-fuming. Since CdS can form a photoluminescent nanocomposite with dendrimers, a feasibility examination of dendrimer tagging of fingerprints has also been conducted.

  7. Controlling upconversion nanocrystals for emerging applications

    NASA Astrophysics Data System (ADS)

    Zhou, Bo; Shi, Bingyang; Jin, Dayong; Liu, Xiaogang

    2015-11-01

    Lanthanide-doped upconversion nanocrystals enable anti-Stokes emission with pump intensities several orders of magnitude lower than required by conventional nonlinear optical techniques. Their exceptional properties, namely large anti-Stokes shifts, sharp emission spectra and long excited-state lifetimes, have led to a diversity of applications. Here, we review upconversion nanocrystals from the perspective of fundamental concepts and examine the technical challenges in relation to emission colour tuning and luminescence enhancement. In particular, we highlight the advances in functionalization strategies that enable the broad utility of upconversion nanocrystals for multimodal imaging, cancer therapy, volumetric displays and photonics.

  8. Controlling upconversion nanocrystals for emerging applications.

    PubMed

    Zhou, Bo; Shi, Bingyang; Jin, Dayong; Liu, Xiaogang

    2015-11-01

    Lanthanide-doped upconversion nanocrystals enable anti-Stokes emission with pump intensities several orders of magnitude lower than required by conventional nonlinear optical techniques. Their exceptional properties, namely large anti-Stokes shifts, sharp emission spectra and long excited-state lifetimes, have led to a diversity of applications. Here, we review upconversion nanocrystals from the perspective of fundamental concepts and examine the technical challenges in relation to emission colour tuning and luminescence enhancement. In particular, we highlight the advances in functionalization strategies that enable the broad utility of upconversion nanocrystals for multimodal imaging, cancer therapy, volumetric displays and photonics.

  9. Application of Monolithic Zirconia Ceramics in Dental Practice: A Case History Report.

    PubMed

    Kim, Hee-Kyung; Kim, Sung-Hun; Lee, Jai-Bong; Han, Jung-Suk; Yeo, In-Sung

    2016-01-01

    Monolithic zirconia restorations increasingly have been used in dental practice in recent years and demonstrate superior mechanical performance compared with porcelain-veneered zirconia restorations. Recent advances in manufacturing technology have made possible the fabrication of translucent monolithic zirconia ceramics. This case report describes three clinical examples of monolithic zirconia fixed dental prostheses being used in the anterior and posterior regions and exhibiting acceptable esthetic results.

  10. Three generations of zirconia: 
From veneered to monolithic. Part I.

    PubMed

    Stawarczyk, Bogna; Keul, Christin; Eichberger, Marlis; Figge, David; Edelhoff, Daniel; Lümkemann, Nina

    2017-01-01

    This article presents the historical development of the different generations of zirconia and their range of indications, from veneered to monolithic zirconia restorations. Because of the large extent of this topic, it is divided into two parts. In Part I, the mechanical and optical properties of the three generations of zirconia materials are discussed critically and theoretically. A short summary is given of the current scientific literature, investigating the third generation of zirconia comparatively regarding the properties discussed.

  11. Multiexciton fluorescence from semiconductor nanocrystals

    NASA Astrophysics Data System (ADS)

    Fisher, Brent; Caruge, Jean-Michel; Chan, Yin-Thai; Halpert, Jonathan; Bawendi, Moungi G.

    2005-11-01

    We use transient photoluminescence to spectrally resolve the emission from 1, 2, and 3 electron-hole pairs states in CdSe colloidal nanocrystals with radii ranging between 2.3 and 5.2 nm. Temporally and spectrally resolved multiexciton emission from single NCs is also observed. The observation of multiexciton emission enables new experiments and potential applications at both the single NC level and using ensembles of NCs. First we discuss the use of single CdSe(CdZnS) core(shell) colloidal NCs (spheres and rods) to generate triggered photon pair emission at room temperature, with specific ordering of the pair's constituent photons. Second, we incorporate CdSe/ZnS core-shell nanocrystals into a TiO 2 host matrix and observe simultaneous two-state amplified spontaneous emission and lasing from both multiexcitonic transitions (1S 3/2-1S e and 1P 3/2-1P e) in a surface-emitting distributed feedback CdSe NC laser. From our data we deduce radiative lifetimes, quantum yields, stimulated emission gain, and power dependencies for the multiexciton transitions.

  12. Seismic transpressive basement faults and monocline development in a foreland basin (Eastern Guadalquivir, SE Spain)

    NASA Astrophysics Data System (ADS)

    Pedrera, A.; Ruiz-Constán, A.; Marín-Lechado, C.; Galindo-Zaldívar, J.; González, A.; Peláez, J. A.

    2013-12-01

    We examine the late Tortonian to present-day deformation of an active seismic sector of the eastern Iberian foreland basement of the Betic Cordillera, in southern Spain. Transpressive faults affecting Paleozoic basement offset up to Triassic rocks. Late Triassic clays and evaporites constitute a décollement level decoupling the basement rocks and a ~100 m thick cover of Jurassic carbonates. Monoclines trending NE-SW to ENE-WSW deform the Jurassic cover driven by the propagation of high-angle transpressive right-lateral basement faults. They favor the migration of clays and evaporites toward the propagated fault tip, i.e., the core of the anticline, resulting in fluid overpressure, fluid flow, and precipitation of fibrous gypsum parallel to a vertical σ3. The overall geometry of the studied monoclines, as well as the intense deformation within the clays and evaporites, reproduces three-layer discrete element models entailing a weak middle unit sandwiched between strong layers. Late Tortonian syn-folding sediments recorded the initial stages of the fault-propagation folding. Equivalent unexposed transpressive structures and associated monoclines reactivated under the present-day NW-SE convergence are recognized and analyzed in the Sabiote-Torreperogil region, using seismic reflection, gravity, and borehole data. A seismic series of more than 2100 low-magnitude earthquakes was recorded within a very limited area of the basement of this sector from October 2012 to May 2013. Seismic activity within a major NE-SW trending transpressive basement fault plane stimulated rupture along a subsidiary E-W (~N95°E) strike-slip relay fault. The biggest event (mbLg 3.9, MW 3.7) occurred at the junction between them in a transpressive relay sector.

  13. Low temperature magnetic properties of monoclinic pyrrhotite with particular relevance to the Besnus transition

    NASA Astrophysics Data System (ADS)

    Volk, M.; Gilder, S.; Feinberg, J. M.

    2016-12-01

    Monoclinic pyrrhotite (Fe7S8) is an important mineral on earth as well as in some meteorites. It owes its ferrimagnetism to an ordered array of Fe vacancies. Its magnetic properties change markedly around 30 K, in what is known as the Besnus transition. Plausible explanations for the Besnus transition are either due to changes in crystalline anisotropy from a transformation in crystal symmetry or from the establishment of a two-phase system with magnetic interaction between the two phases. To help resolve this discrepancy, we measured hysteresis loops every 5° and back field curves every 10° in the basal plane of an oriented single crystal of monoclinic pyrrhotite at 300 K and at 21 temperature steps from 50 K through the Besnus transition until 20 K. Between 50 and 30 K, hysteresis loops possess double inflections between crystallographic a-axes and only a single inflection parallel to the a-axes. The second inflection phenomenon and relative differences of the loops show a six-fold symmetry in this temperature range. The Besnus transition is best characterized by changes in magnetic remanence and coercivity over a 6° temperature span with a maximum rate of change at 30 K. A surprising yet puzzling finding is that the coercivity ratio becomes less than unity below the transition when four-fold symmetry arises. The saturation magnetization of natural pyrrhotite cycled from room temperature to successively lower temperatures through the Besnus transition decreases 2-4 times less than equivalent grain sizes of magnetite, with less than a 10% loss in remanence between 300 K and 150 K in pseudo-single domain pyrrhotite. As pseudo-single domain monoclinic pyrrhotite carries the magnetic remanence in some meteorites, it is likely that low temperature cycling in space to the Earth's surface will have only a minor influence on paleointensity values derived from those meteorites.

  14. Structure of a monoclinic polymorph of human carbonic anhydrase II with a doubled a axis

    SciTech Connect

    Robbins, Arthur H.; Domsic, John F.; Agbandje-McKenna, Mavis; McKenna, Robert

    2010-05-01

    The crystal structure of human carbonic anhydrase II with a doubled a axis from that of the usually observed monoclinic cell has been determined and refined to 1.4 Å resolution. The two molecules comprising the asymmetric unit are related by a noncrystallographic translation of ½ along a, but one of the molecules has two alternate orientations related by a rotation of approximately 2°. The crystal structure of human carbonic anhydrase II with a doubled a axis from that of the usually observed monoclinic unit cell has been determined and refined to 1.4 Å resolution. The diffraction data with h = 2n + 1 were systematically weaker than those with h = 2n. Consequently, the scaling of the data, structure solution and refinement were challenging. The two molecules comprising the asymmetric unit are related by a noncrystallographic translation of ½ along a, but one of the molecules has two alternate positions related by a rotation of approximately 2°. This rotation axis is located near the edge of the central β-sheet, causing a maximum distance disparity of 1.7 Å between equivalent atoms on the diametrically opposite side of the molecule. The crystal-packing contacts are similar to two sequential combined unit cells along a of the previously determined monoclinic unit cell. Abnormally high final R{sub cryst} and R{sub free} values (20.2% and 23.7%, respectively) are not unusual for structures containing pseudo-translational symmetry and probably result from poor signal to noise in the weak h-odd data.

  15. Anisotropy, phonon modes, and lattice anharmonicity from dielectric function tensor analysis of monoclinic cadmium tungstate

    NASA Astrophysics Data System (ADS)

    Mock, A.; Korlacki, R.; Knight, S.; Schubert, M.

    2017-04-01

    We determine the frequency dependence of four independent Cartesian tensor elements of the dielectric function for CdWO4 using generalized spectroscopic ellipsometry within mid-infrared and far-infrared spectral regions. Different single crystal cuts, (010) and (001), are investigated. From the spectral dependencies of the dielectric function tensor and its inverse we determine all long-wavelength active transverse and longitudinal optic phonon modes with Au and Bu symmetry as well as their eigenvectors within the monoclinic lattice. We thereby demonstrate that such information can be obtained completely without physical model line-shape analysis in materials with monoclinic symmetry. We then augment the effect of lattice anharmonicity onto our recently described dielectric function tensor model approach for materials with monoclinic and triclinic crystal symmetries [M. Schubert et al., Phys. Rev. B 93, 125209 (2016), 10.1103/PhysRevB.93.125209], and we obtain an excellent match between all measured and modeled dielectric function tensor elements. All phonon mode frequency and broadening parameters are determined in our model approach. We also perform density functional theory phonon mode calculations, and we compare our results obtained from theory, from direct dielectric function tensor analysis, and from model line-shape analysis, and we find excellent agreement between all approaches. We also discuss and present static and above reststrahlen spectral range dielectric constants. Our data for CdWO4 are in excellent agreement with a recently proposed generalization of the Lyddane-Sachs-Teller relation for materials with low crystal symmetry [M. Schubert, Phys. Rev. Lett. 117, 215502 (2016), 10.1103/PhysRevLett.117.215502].

  16. A monoclinic form of dendocarbin A: a borderline case of one-dimensional isostructural polymorphism.

    PubMed

    Paz, Cristian; Burgos, Viviana; Suarez, Sebastián; Baggio, Ricardo

    2015-04-01

    The title compound, dendocarbin A [systematic name: (1R,5aS,9aS,9bR)-1-hydroxy-6,6,9a-trimethyldodecahydronaphtho[1,2-c]furan-3-one], C15H22O3, is a sesquiterpene lactone isolated from Drimys winteri var chilensis. The monoclinic phase described herein displays an identical molecular structure to the orthorhombic phase that we reported previously [Paz Robles et al. (2014). Acta Cryst. C70, 1007-1010], while varying significantly in chain pitch, and can thus be considered as a borderline case of one-dimensional isostructural polymorphism.

  17. Temperature-dependent index of refraction of monoclinic Ga2O3 single crystal.

    PubMed

    Bhaumik, Indranil; Bhatt, R; Ganesamoorthy, S; Saxena, A; Karnal, A K; Gupta, P K; Sinha, A K; Deb, S K

    2011-11-01

    We present temperature-dependent refractive index along crystallographic b[010] and a direction perpendicular to (100)-plane for monoclinic phase (β) Ga(2)O(3) single crystal grown by the optical floating zone technique. The experimental results are consistent with the theoretical result of Litimein et al.1. Also, the Sellmeier equation for wavelengths in the range of 0.4-1.55 μm is formulated at different temperatures in the range of 30-175 °C. The thermal coefficient of refractive index in the above specified range is ~10(-5)/°C. © 2011 Optical Society of America

  18. Instantaneous band gap collapse in photoexcited monoclinic VO2 due to photocarrier doping.

    PubMed

    Wegkamp, Daniel; Herzog, Marc; Xian, Lede; Gatti, Matteo; Cudazzo, Pierluigi; McGahan, Christina L; Marvel, Robert E; Haglund, Richard F; Rubio, Angel; Wolf, Martin; Stähler, Julia

    2014-11-21

    Using femtosecond time-resolved photoelectron spectroscopy we demonstrate that photoexcitation transforms monoclinic VO2 quasi-instantaneously into a metal. Thereby, we exclude an 80 fs structural bottleneck for the photoinduced electronic phase transition of VO2. First-principles many-body perturbation theory calculations reveal a high sensitivity of the VO2 band gap to variations of the dynamically screened Coulomb interaction, supporting a fully electronically driven isostructural insulator-to-metal transition. We thus conclude that the ultrafast band structure renormalization is caused by photoexcitation of carriers from localized V 3d valence states, strongly changing the screening before significant hot-carrier relaxation or ionic motion has occurred.

  19. In vivo wear performance of highly cross-linked polyethylene vs. yttria stabilized zirconia and alumina stabilized zirconia at a mean seven-year follow-up

    PubMed Central

    2013-01-01

    Background Zirconia was introduced as an alternative to alumina for use in the femoral head. The yttria stabilized zirconia material was improved by adding alumina. We evaluated highly cross-linked polyethylene wear performance of zirconia in total hip arthroplasty. The hypothesis was that alumina stabilized zirconia could decrease highly cross-linked polyethylene wear. Methods Highly cross-linked polyethylene wear was measured with a computerized method (PolyWare) in 91 hips. The steady-state wear rates were measured based on the radiographs from the first year postoperatively to the final follow-up and were compared between hips with yttria stabilized zirconia and alumina stabilized zirconia. Results The steady-state wear rate of highly cross-linked polyethylene against zirconia was 0.02 mm/year at a mean follow-up of 7 years. No significant difference was observed between groups with yttria stabilized zirconia and alumina stabilized zirconia. Conclusions Addition of alumina to the zirconia material failed to show further reduction of highly cross-linked polyethylene wear and our hypothesis was not verified. PMID:23634809

  20. CAD/CAM Zirconia vs. slip-cast glass-infiltrated Alumina/Zirconia all-ceramic crowns: 2-year results of a randomized controlled clinical trial.

    PubMed

    Cehreli, Murat Cavit; Kökat, Ali Murat; Akça, Kivanç

    2009-01-01

    The aim of this randomized controlled clinical trial was to compare the early clinical outcome of slip-cast glass-infiltrated Alumina/Zirconia and CAD/CAM Zirconia all-ceramic crowns. A total of 30 InCeram Zirconia and Cercon Zirconia crowns were fabricated and cemented with a glass ionomer cement in 20 patients. At baseline, 6-month, 1-year, and 2-year recall appointments, Californian Dental Association (CDA) quality evaluation system was used to evaluate the prosthetic replacements, and plaque and gingival index scores were used to explore the periodontal outcome of the treatments. No clinical sign of marginal discoloration, persistent pain and secondary caries was detected in any of the restorations. All InCeram Zirconia crowns survived during the 2-year period, although one nonvital tooth experienced root fracture coupled with the fracture of the veneering porcelain of the restoration. One Cercon Zirconia restoration fractured and was replaced. According to the CDA criteria, marginal integrity was rated excellent for InCeram Zirconia (73%) and Cercon Zirconia (80%) restorations, respectively. Slight color mismatch rate was higher for InCeram Zirconia restorations (66%) than Cercon Zirconia (26%) restorations. Plaque and gingival index scores were mostly zero and almost constant over time. Time-dependent changes in plaque and gingival index scores within and between groups were statistically similar (p>0.05). This clinical study demonstrates that single-tooth InCeram Zirconia and Cercon Zirconia crowns have comparable early clinical outcome, both seem as acceptable treatment modalities, and most importantly, all-ceramic alumina crowns strengthened by 25% zirconia can sufficiently withstand functional load in the posterior zone.

  1. CAD/CAM ZIRCONIA VS. SLIP-CAST GLASS-INFILTRATED ALUMINA/ZIRCONIA ALL-CERAMIC CROWNS: 2-YEAR RESULTS OF A RANDOMIZED CONTROLLED CLINICAL TRIAL

    PubMed Central

    Çehreli, Murat Cavit; Kökat, Ali Murat; Akça, Kivanç

    2009-01-01

    The aim of this randomized controlled clinical trial was to compare the early clinical outcome of slip-cast glass-infiltrated Alumina/Zirconia and CAD/CAM Zirconia all-ceramic crowns. A total of 30 InCeram® Zirconia and Cercon® Zirconia crowns were fabricated and cemented with a glass ionomer cement in 20 patients. At baseline, 6-month, 1-year, and 2-year recall appointments, Californian Dental Association (CDA) quality evaluation system was used to evaluate the prosthetic replacements, and plaque and gingival index scores were used to explore the periodontal outcome of the treatments. No clinical sign of marginal discoloration, persistent pain and secondary caries was detected in any of the restorations. All InCeram® Zirconia crowns survived during the 2-year period, although one nonvital tooth experienced root fracture coupled with the fracture of the veneering porcelain of the restoration. One Cercon® Zirconia restoration fractured and was replaced. According to the CDA criteria, marginal integrity was rated excellent for InCeram® Zirconia (73%) and Cercon® Zirconia (80%) restorations, respectively. Slight color mismatch rate was higher for InCeram® Zirconia restorations (66%) than Cercon® Zirconia (26%) restorations. Plaque and gingival index scores were mostly zero and almost constant over time. Time-dependent changes in plaque and gingival index scores within and between groups were statistically similar (p>0.05). This clinical study demonstrates that single-tooth InCeram® Zirconia and Cercon® Zirconia crowns have comparable early clinical outcome, both seem as acceptable treatment modalities, and most importantly, all-ceramic alumina crowns strengthened by 25% zirconia can sufficiently withstand functional load in the posterior zone. PMID:19148406

  2. Effect of multistep processing technique on the formation of micro-defects and residual stresses in zirconia dental restorations.

    PubMed

    Jing, Zhao; Ke, Zhang; Yihong, Liu; Zhijian, Shen

    2014-04-01

    The clinical failures of zirconia dental restorations are often caused by extrinsic artifacts introduced by processing. The aim of this study was to investigate the micro-defects and residual stresses generated during the multistep process of zirconia dental restorations. Thermal spray granulated 3Y-TZP powders were dry pressed by two tools exhibiting distinctly different Young's moduli, cold isostatic pressed (CIP-ed), and pressure-less fully sintered. The green bodies pressed by a stiff tool were treated with different procedures: direct milling (green milling) followed by fully sintering; half-sintering and milling (raw milling) with or without fully sintering; and fully sintering followed by grinding. The fully sintered 3Y-TZP crowns were clinically adjusted using both a diamond bur and SiC bur, respectively. Phase composition and microstructure of the pressed, milled, and ground surfaces were studied by XRD and SEM. Tetragonal phase was the main phase of all detected 3Y-TZP specimens. Excessive residual stresses introduced by raw milling and grinding were confirmed by a strained T (111) peak, monoclinic phase, and obviously changed I(002)t /I(200)t ratio. The residual stresses would form a compressive stress layer, while it was too shallow to inhibit crack propagation even for ground specimens. Large voids with high-coordination numbers were the common packing micro-defects. Once formed, they were barely healed by CIP-ing and sintering. A stiff pressing tool was confirmed to be useful for reducing the surface packing voids. Milling removed the surface voids, but was no help for the interior ones. Raw milling introduced more serious chippings, most originating from the existing packing voids, than green milling due to its brittle failure and was less recommended for production. Grinding dense 3Y-TZP caused surface grain refinement and much more severe micro-defects, especially when clinical adjustment was applied by diamond bur compared to SiC bur. Micro

  3. High-temperature zirconia insulation and method for making same

    DOEpatents

    Wrenn, G.E. Jr.; Holcombe, C.E. Jr.; Lewis, J. Jr.

    1988-05-10

    The present invention is directed to a highly pure, partially stabilized, fibrous zirconia composite for use as thermal insulation in environments where temperatures up to about 2,000 C are utilized. The composite of the present invention is fabricated into any suitable configuration such as a cone, cylinder, dome or the like by vacuum molding an aqueous slurry of partially stabilized zirconia fibers into a desired configuration on a suitably shaped mandrel. The molded fibers are infiltrated with zirconyl nitrate and the resulting structure is then dried to form a rigid structure which may be removed and placed in a furnace. The structure is then heated in air to a temperature of about 600 C for driving off the nitrate from the structure and for oxidizing the zirconyl ion to zirconia. Thereafter, the structure is heated to about 950 to 1,250 C to fuse the zirconia fibers at their nexi in a matrix of zirconia. The composite produced by the present invention is self-supporting and can be readily machined to desired final dimensions. Additional heating to about 1,800 to 2,000 C further improves structural rigidity.

  4. High-temperature zirconia insulation and method for making same

    DOEpatents

    Wrenn, G.E. Jr.; Holcombe, C.E. Jr.; Lewis, J. Jr.

    The present invention is directed to a highly pure, partially stabilized, fibrous zirconia composite for use as thermal insulation in environments where temperatures up to about 2,000/sup 0/C are utilized. The composite of the present invention is fabricated into any suitable configuration such as a cone, cylinder dome or the like by vacuum molding an aqueous slurry of partially stabilized zirconia fibers into a desired configuration on a suitably shaped mandrel. The molded fibers are infiltrated with zirconyl nitrate and the resulting structure is then dried to form a rigid structure which may be removed and placed in a furnace. The structure is then heated in air to a temperature of about 600/sup 0/C for driving off the nitrate from the structure and for oxidizing the zirconyl ion to zirconia. Thereafter, the structure is heated to about 950/sup 0/ to 1,250/sup 0/C to fuse the zirconia fibers at their nexi in a matrix of zirconia. The composite produced by the present invention is self-supporting and can be readily machined to desired final dimensions. Additional heating to about 1800/sup 0/ to 2000/sup 0/C further improves structural rigidity.

  5. High-temperature zirconia insulation and method for making same

    DOEpatents

    Wrenn, Jr., George E.; Holcombe, Jr., Cressie E.; Lewis, Jr., John

    1988-01-01

    The present invention is directed to a highly pure, partially stabilized, fibrous zirconia composite for use as thermal insulation in environments where temperatures up to about 2000.degree. C. are utilized. The composite of the present invention is fabricated into any suitable configuration such as a cone, cylinder, dome or the like by vacuum molding an aqueous slurry of partially stabilized zirconia fibers into a desired configuration on a suitably shaped mandrel. The molded fibers are infiltrated with zirconyl nitrate and the resulting structure is then dried to form a rigid structure which may be removed and placed in a furnace. The structure is then heated in air to a temperature of about 600.degree. C. for driving off the nitrate from the structure and for oxidizing the zirconyl ion to zirconia. Thereafter, the structure is heated to about 950.degree. to 1,250.degree. C. to fuse the zirconia fibers at their nexi in a matrix of zirconia. The composite produced by the present invention is self-supporting and can be readily machined to desired final dimensions. Additional heating to about 1800.degree. to 2000.degree. C. further improves structural rigidity.

  6. Shear bond strength of indirect composite material to monolithic zirconia.

    PubMed

    Sari, Fatih; Secilmis, Asli; Simsek, Irfan; Ozsevik, Semih

    2016-08-01

    This study aimed to evaluate the effect of surface treatments on bond strength of indirect composite material (Tescera Indirect Composite System) to monolithic zirconia (inCoris TZI). Partially stabilized monolithic zirconia blocks were cut into with 2.0 mm thickness. Sintered zirconia specimens were divided into different surface treatment groups: no treatment (control), sandblasting, glaze layer & hydrofluoric acid application, and sandblasting + glaze layer & hydrofluoric acid application. The indirect composite material was applied to the surface of the monolithic zirconia specimens. Shear bond strength value of each specimen was evaluated after thermocycling. The fractured surface of each specimen was examined with a stereomicroscope and a scanning electron microscope to assess the failure types. The data were analyzed using one-way analysis of variance (ANOVA) and Tukey LSD tests (α=.05). Bond strength was significantly lower in untreated specimens than in sandblasted specimens (P<.05). No difference between the glaze layer and hydrofluoric acid application treated groups were observed. However, bond strength for these groups were significantly higher as compared with the other two groups (P<.05). Combined use of glaze layer & hydrofluoric acid application and silanization are reliable for strong and durable bonding between indirect composite material and monolithic zirconia.

  7. Corrosion behavior of zirconia in acidulated phosphate fluoride

    PubMed Central

    Thomas, Anie; Sridhar, Sathyanarayanan; Aghyarian, Shant; Watkins-curry, Pilanda; Chan, Julia Y.; Pozzi, Alessandro; Rodrigues, Danieli C.

    2016-01-01

    ABSTRACT Objective The corrosion behavior of zirconia in acidulated phosphate fluoride (APF) representing acidic environments and fluoride treatments was studied. Material and Methods Zirconia rods were immersed in 1.23% and 0.123% APF solutions and maintained at 37°C for determined periods of time. Surfaces of all specimens were imaged using digital microscopy and scanning electron microscopy (SEM). Sample mass and dimensions were measured for mass loss determination. Samples were characterized by powder X-ray diffraction (XRD) to detect changes in crystallinity. A biosensor based on electrochemical impedance spectroscopy (EIS) was used to detect ion dissolution of material into the immersion media. Results Digital microscopy revealed diminishing luster of the materials and SEM showed increased superficial corrosion of zirconia submerged in 1.23% APF. Although no structural change was found, the absorption of salts (sodium phosphate) onto the surface of the materials bathed in 0.123% APF was significant. EIS indicated a greater change of impedance for the immersion solutions with increasing bathing time. Conclusion Immersion of zirconia in APF solutions showed deterioration limited to the surface, not extending to the bulk of the material. Inferences on zirconia performance in acidic oral environment can be elucidated from the study. PMID:27008257

  8. Strength of zirconia fixed partial dentures: review of the literature

    PubMed Central

    GARGARI, M.; GLORIA, F.; CAPPELLO, A.; OTTRIA, L.

    2011-01-01

    SUMMARY Objective The aim of this study is a systematic review of the literature on the strength and long-term behavior of zirconia FPDs. Methods The literature search was performed using as the primary source the Medline database. Were also imposed a set of inclusion and exclusion criteria in order to narrow the search to differentiate the two distinct parts in which it was structured the review. In addition, MeSH terms were applied to further refine the choice of articles more relevant to the review. In the part of the review concerning the long-term behavior of zirconia fixed partial dentures were considered useful only those studies with a minimum follow-up of one year. Results The search provided a total of 813 articles, but only 25 were considered for the review because they were the only ones who satisfied search criteria. In particular, 13 items relate to the mechanical strength of zirconia prostheses and 12 regarding the long term behavior of zirconia FPDs. The resistance values also exceed the 2000 N while the survival rate reaches to almost 94%. Conclusions Based on this review, Zirconia FPDs can be considered reliable products in both the anterior and posterior fields with survival rates comparable to traditional metal-ceramic prostheses. PMID:23285392

  9. Multinuclear NMR study of silica fiberglass modified with zirconia.

    PubMed

    Lapina, O B; Khabibulin, D F; Terskikh, V V

    2011-01-01

    Silica fiberglass textiles are emerging as uniquely suited supports in catalysis, which offer unprecedented flexibility in designing advanced catalytic systems for chemical and auto industries. During manufacturing fiberglass materials are often modified with additives of various nature to improve glass properties. Glass network formers, such as zirconia and alumina, are known to provide the glass fibers with higher strength and to slow down undesirable devitrification processes. In this work multinuclear (1)H, (23)Na, (29)Si, and (91)Zr NMR spectroscopy was used to characterize the effect of zirconia on the molecular-level fiberglass structure. (29)Si NMR results help in understanding why zirconia-modified fiberglass is more stable towards devitrification comparing with pure silica glass. Internal void spaces formed in zirconia-silica glass fibers after acidic leaching correlate with sodium and water distributions in the starting bulk glass as probed by (23)Na and (1)H NMR. These voids spaces are important for stabilization of catalytically active species in the supported catalysts. Potentials of high-field (91)Zr NMR spectroscopy to study zirconia-containing glasses and similarly disordered systems are illustrated. Copyright © 2011 Elsevier Inc. All rights reserved.

  10. Shear bond strength of indirect composite material to monolithic zirconia

    PubMed Central

    2016-01-01

    PURPOSE This study aimed to evaluate the effect of surface treatments on bond strength of indirect composite material (Tescera Indirect Composite System) to monolithic zirconia (inCoris TZI). MATERIALS AND METHODS Partially stabilized monolithic zirconia blocks were cut into with 2.0 mm thickness. Sintered zirconia specimens were divided into different surface treatment groups: no treatment (control), sandblasting, glaze layer & hydrofluoric acid application, and sandblasting + glaze layer & hydrofluoric acid application. The indirect composite material was applied to the surface of the monolithic zirconia specimens. Shear bond strength value of each specimen was evaluated after thermocycling. The fractured surface of each specimen was examined with a stereomicroscope and a scanning electron microscope to assess the failure types. The data were analyzed using one-way analysis of variance (ANOVA) and Tukey LSD tests (α=.05). RESULTS Bond strength was significantly lower in untreated specimens than in sandblasted specimens (P<.05). No difference between the glaze layer and hydrofluoric acid application treated groups were observed. However, bond strength for these groups were significantly higher as compared with the other two groups (P<.05). CONCLUSION Combined use of glaze layer & hydrofluoric acid application and silanization are reliable for strong and durable bonding between indirect composite material and monolithic zirconia. PMID:27555895

  11. Size-Dependent Raman Shifts for nanocrystals

    PubMed Central

    Gao, Yukun; Zhao, Xinmei; Yin, Penggang; Gao, Faming

    2016-01-01

    Raman spectroscopy is a very sensitive tool for probing semiconductor nanocrystals. The underlying mechanism behind the size-dependent Raman shifts is still quite controversial. Here we offer a new theoretical method for the quantum confinement effects on the Raman spectra of semiconductor nanocrystals. We propose that the shift of Raman spectra in nanocrystals can result from two overlapping effects: the quantum effect shift and surface effect shift. The quantum effect shift is extracted from an extended Kubo formula, the surface effect shift is determined via the first principles calculations. Fairly good prediction of Raman shifts can be obtained without the use of any adjustable parameter. Closer analysis shows that the size-dependent Raman shifts in Si nanocrystals mainly result from the quantum effect shifts. For nanodiamond, the proportion of surface effect shift in Raman shift is up to about 40%. Such model can also provide a good baseline for using Raman spectroscopy as a tool to measure size. PMID:27102066

  12. Semiconductor-nanocrystal/conjugated polymer thin films

    DOEpatents

    Alivisatos, A. Paul; Dittmer, Janke J.; Huynh, Wendy U.; Milliron, Delia

    2014-06-17

    The invention described herein provides for thin films and methods of making comprising inorganic semiconductor-nanocrystals dispersed in semiconducting-polymers in high loading amounts. The invention also describes photovoltaic devices incorporating the thin films.

  13. Semiconductor-nanocrystal/conjugated polymer thin films

    DOEpatents

    Alivisatos, A. Paul; Dittmer, Janke J.; Huynh, Wendy U.; Milliron, Delia

    2010-08-17

    The invention described herein provides for thin films and methods of making comprising inorganic semiconductor-nanocrystals dispersed in semiconducting-polymers in high loading amounts. The invention also describes photovoltaic devices incorporating the thin films.

  14. Nanocrystals: Shedding new light on silicon

    NASA Astrophysics Data System (ADS)

    Gösele, Ulrich

    2008-03-01

    Experiments in magnetic fields suggest that defects are responsible for light emission from silicon nanocrystals. However, when these defects are passivated with hydrogen, quantum effects become responsible for the emission.

  15. Colloidal nanocrystals and method of making

    DOEpatents

    Kahen, Keith

    2015-10-06

    A tight confinement nanocrystal comprises a homogeneous center region having a first composition and a smoothly varying region having a second composition wherein a confining potential barrier monotonically increases and then monotonically decreases as the smoothly varying region extends from the surface of the homogeneous center region to an outer surface of the nanocrystal. A method of producing the nanocrystal comprises forming a first solution by combining a solvent and at most two nanocrystal precursors; heating the first solution to a nucleation temperature; adding to the first solution, a second solution having a solvent, at least one additional and different precursor to form the homogeneous center region and at most an initial portion of the smoothly varying region; and lowering the solution temperature to a growth temperature to complete growth of the smoothly varying region.

  16. Solar induced growth of silver nanocrystals

    NASA Astrophysics Data System (ADS)

    Thøgersen, Annett; Muntingh, Georg

    2013-04-01

    The effect of solar irradiation on plasmonic silver nanocrystals has been investigated using transmission electron microscopy and size distribution analysis, in the context of solar cell applications for light harvesting. Starting from an initial collection of spherical nanocrystals on a carbon film whose sizes are log-normally distributed, solar irradiation causes the nanocrystals to grow, with one particle reaching a diameter of 638 nm after four hours of irradiation. In addition some of the larger particles lose their spherical shape. The average nanocrystal diameter was found to grow as predicted by the Ostwald ripening model, taking into account the range of area fractions of the samples. The size distribution stays approximately log-normal and does not reach one of the steady-state size distributions predicted by the Ostwald ripening model. This might be explained by the system being in a transient state.

  17. Tunable mid IR plasmon in GZO nanocrystals.

    PubMed

    Hamza, M K; Bluet, J-M; Masenelli-Varlot, K; Canut, B; Boisron, O; Melinon, P; Masenelli, B

    2015-07-28

    Degenerate metal oxide nanoparticles are promising systems to expand the significant achievements of plasmonics into the infrared (IR) range. Among the possible candidates, Ga-doped ZnO nanocrystals are particularly suited for mid IR, considering their wide range of possible doping levels and thus of plasmon tuning. In the present work, we report on the tunable mid IR plasmon induced in degenerate Ga-doped ZnO nanocrystals. The nanocrystals are produced by a plasma expansion and exhibit unprotected surfaces. Tuning the Ga concentration allows tuning the localized surface plasmon resonance. Moreover, the plasmon resonance is characterized by a large damping. By comparing the plasmon of nanocrystal assemblies to that of nanoparticles dispersed in an alumina matrix, we investigate the possible origins of such damping. We demonstrate that it partially results from the self-organization of the naked particles and also from intrinsic inhomogeneity of dopants.

  18. Self-assembly of lead chalcogenide nanocrystals.

    PubMed

    Quan, Zewei; Valentin-Bromberg, Loriana; Loc, Welley Siu; Fang, Jiye

    2011-05-02

    This review focuses on recent developments in the self-assembly of lead chalcogenide nanocrystals into two- and three-dimensional superstructures. Self-assembly is categorized by the shapes of building blocks, including nanospheres, nanocubes, nano-octahedra, and nanostars. In the section on nanospheres, rapid assemblies of lead chalcogenide-based multicomponent nanocrystals with additional components, such as semiconductors, noble metals, and magnetic nanocrystals, are further highlighted. In situ self-assembly of lead chalcogenide nanocrystals into one-dimensional nanostructures at elevated temperatures is also covered. Each section of this paper highlights examples extracted from recent publications. Finally, relatively novel properties and applications arising from lead chalcogenide superlattices as typical examples are also discussed.

  19. Composite material including nanocrystals and methods of making

    DOEpatents

    Bawendi, Moungi G.; Sundar, Vikram C.

    2010-04-06

    Temperature-sensing compositions can include an inorganic material, such as a semiconductor nanocrystal. The nanocrystal can be a dependable and accurate indicator of temperature. The intensity of emission of the nanocrystal varies with temperature and can be highly sensitive to surface temperature. The nanocrystals can be processed with a binder to form a matrix, which can be varied by altering the chemical nature of the surface of the nanocrystal. A nanocrystal with a compatibilizing outer layer can be incorporated into a coating formulation and retain its temperature sensitive emissive properties.

  20. Composite material including nanocrystals and methods of making

    DOEpatents

    Bawendi, Moungi G [Boston, MA; Sundar, Vikram C [New York, NY

    2008-02-05

    Temperature-sensing compositions can include an inorganic material, such as a semiconductor nanocrystal. The nanocrystal can be a dependable and accurate indicator of temperature. The intensity of emission of the nanocrystal varies with temperature and can be highly sensitive to surface temperature. The nanocrystals can be processed with a binder to form a matrix, which can be varied by altering the chemical nature of the surface of the nanocrystal. A nanocrystal with a compatibilizing outer layer can be incorporated into a coating formulation and retain its temperature sensitive emissive properties

  1. Zirconia-silica based mesoporous desulfurization adsorbents

    NASA Astrophysics Data System (ADS)

    Palomino, Jessica M.; Tran, Dat T.; Kareh, Ana R.; Miller, Christopher A.; Gardner, Joshua M. V.; Dong, Hong; Oliver, Scott R. J.

    2015-03-01

    We report a series of mesoporous silicate sorbent materials templated by long-chain primary alkylamines that display record level of desulfurization of the jet fuel JP-8. Pure silica frameworks and those with a Si:Zr synthesis molar ratio ranging from 44:1 to 11:1 were investigated. The optimum sorbent was identified as dodecylamine-templated silica-zirconia synthesized from a gel with Si:Zr molar ratio of 15:1. With an optimized silver loading of 11 wt.%, a saturation adsorption capacity of 39.4 mgS g-1 and a silver efficiency of 1.21 molS mol Ag-1 were observed for JP-8. This sorbent displayed exceptional regenerability, maintaining 86% of its initial capacity in model fuel after solvent regeneration with diethyl ether. Low-cost, portable and reusable sorbents for the desulfurization of JP-8 jet fuel are needed to make solid oxide fuel cells (SOFCs) a reality for military power needs. SOFCs require ultra-low sulfur content fuel, which traditional desulfurization methods cannot achieve.

  2. Mechanical behavior of mullite-zirconia composites

    NASA Astrophysics Data System (ADS)

    Sahnoune, F.; Saheb, N.

    2010-06-01

    In this work, mechanical properties of mullite-zirconia composites synthesised through reaction sintering of Algerian kaolin, α-Al2O3, and ZrO2 were characterized. Phases present and their transformations were characterized using x-ray diffraction. Hardness H and fracture toughness KIC were measured by Vickers indentation using a Zwick microhardness tester. The flexural strength was measured through three point bending test using an Instron Universal Testing Machine. It was found that the increase of ZrO2 content (from 0 to 32wt.%) decreased the microhardness of the composites from 14 to 10.8 GPa. However, the increase of ZrO2 content (from 0 to 24wt.%) increased the flexural strength of the composites from 142 to 390 MPa then decreased it with further increase of ZrO2 content. Also, the fracture toughness increased from 1.8 to 2.9 MPa.m1/2 with the increase of ZrO2 content from 0 to 32 wt.%; and the rate of the increase decreased at higher fractions of ZrO2 content. The average linear coefficient of thermal expansion (within the range 50 to 1450°C) for samples containing 0 and 16 wt.% ZrO2 sintered at 1600°C for 2 hours was 4.7 x10-6 K-1 and 5.2 x 10-6 K-1 respectively.

  3. Radiation damage in cubic-stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Costantini, Jean-Marc; Beuneu, François; Weber, William J.

    2013-09-01

    Cubic yttria-stabilized zirconia (YSZ) can be used for nuclear applications as an inert matrix for actinide immobilization or transmutation. Indeed, the large amount of native oxygen vacancies leads to a high radiation tolerance of this material owing to defect recombination occurring in the atomic displacement cascades induced by fast neutron irradiation or ion implantations, as showed by molecular dynamics (MD) simulations. Amorphization cannot be obtained in YSZ either by nuclear-collision or electronic-excitation damage, just like in urania. A kind of polygonization structure with slightly disoriented crystalline domains is obtained in both cases. In the first steps of damage, specific isolated point defects (like F+-type color centers) and point-defect clusters are produced by nuclear collisions with charged particles or neutrons. Further increase of damage leads to dislocation-loop formation then to collapse of the dislocation network into a polygonization structure. For swift heavy ion irradiations, a similar polygonization structure is obtained above a threshold stopping power value of about 20-30 keV nm-1.

  4. Crystallization of zirconia based thin films.

    PubMed

    Stender, D; Frison, R; Conder, K; Rupp, J L M; Scherrer, B; Martynczuk, J M; Gauckler, L J; Schneider, C W; Lippert, T; Wokaun, A

    2015-07-28

    The crystallization kinetics of amorphous 3 and 8 mol% yttria stabilized zirconia (3YSZ and 8YSZ) thin films grown by pulsed laser deposition (PLD), spray pyrolysis and dc-magnetron sputtering are explored. The deposited films were heat treated up to 1000 °C ex situ and in situ in an X-ray diffractometer. A minimum temperature of 275 °C was determined at which as-deposited amorphous PLD grown 3YSZ films fully crystallize within five hours. Above 325 °C these films transform nearly instantaneously with a high degree of micro-strain when crystallized below 500 °C. In these films the t'' phase crystallizes which transforms at T > 600 °C to the t' phase upon relaxation of the micro-strain. Furthermore, the crystallization of 8YSZ thin films grown by PLD, spray pyrolysis and dc-sputtering are characterized by in situ XRD measurements. At a constant heating rate of 2.4 K min(-1) crystallization is accomplished after reaching 800 °C, while PLD grown thin films were completely crystallized already at ca. 300 °C.

  5. Indentation of zirconia thermal barrier coatings

    NASA Astrophysics Data System (ADS)

    Kernan, Brian Daniel

    Zirconia Thermal Barrier Coatings (TBCs) are widely used in gas turbine engines to protect metal parts from both heat and oxidation. However, TBCs fail after some time due to build up of stresses caused by microstructural changes, or by damage due to particle ingestion and impact commonly referred to as Foreign Object Damage (FOD). TBC mechanical properties are needed to be able to model stress development and the predication of cracking, particularly at high temperature. A TBC made by Electron Beam Physical Vapor Deposition (EBPVD) was found to be very strain rate sensitive in its hardness response in both the as-deposited and aged conditions from room temperature to 1200°C. The through-thickness hardness of the as-deposited TBC was measured from room temperature to 500°C. A high temperature vacuum displacement sensitive indenter was developed to measure both elastic modulus and hardness, as well as provide simulation of FOD under fast loading conditions. Some solutions to current performance problems of the machine are given.

  6. Radiation damage in cubic-stabilized zirconia

    SciTech Connect

    Costantini, Jean-Marc; Beuneu, Francois; Weber, William J

    2013-01-01

    Cubic yttria-stabilized zirconia (YSZ) can be used for nuclear applications as an inert matrix for actinide immobilization or transmutation. Indeed, the large amount of native oxygen vacancies leads to a high radiation tolerance of this material owing to defect recombination occurring in the atomic displacements cascades induced by fast neutron irradiation or ion implantations, as showed by Molecular dynamics (MD) simulations. Amorphization cannot be obtained in YSZ either by nuclear-collision or electronic-excitation damage, just like in urania. A kind of polygonization structure with slightly disoriented crystalline domains is obtained in both cases. In the first steps of damage, specific isolated point defects (like F+-type color centers) and point-defect clusters are produced by nuclear collisions with charged particles or neutrons. Further increase of damage leads to dislocation-loop formation, then to collapse of the dislocation network into a polygonization structure. For swift heavy ion irradiations, a similar polygonization structure is obtained above a threshold stopping power value of about 20-30 keV nm-1.

  7. Charge transport in semiconductor nanocrystal quantum dots

    NASA Astrophysics Data System (ADS)

    Mentzel, Tamar Shoshana

    In this thesis, we study charge transport in arrays of semiconductor nanocrystal quantum dots. Nanocrystals are synthesized in solution, and an organic ligand on the surface of the nanocrystal creates a potential barrier that confines charges in the nanocrystal. Optical absorption measurements reveal discrete electronic energy levels in the nanocrystals resulting from quantum confinement. When nanocrystals are deposited on a surface, they self-assemble into a close-packed array forming a nanocrystal solid. We report electrical transport measurements of a PbSe nanocrystal solid that serves as the channel of an inverted field-effect transistor. We measure the conductance as a function of temperature, source-drain bias and. gate voltage. The data indicates that holes are the majority carriers; the Fermi energy lies in impurity states in the bandgap of the nanocrystal; and charges hop between the highest occupied valence state in the nanocrystals (the 1S h states). At low source-drain voltages, the activation energy for hopping is given by the energy required to generate holes in the 1Sh state plus activation over barriers resulting from site disorder. The barriers from site disorder are eliminated with a sufficiently high source-drain bias. From the gate effect, we extract the Thomas-Fermi screening length and a density of states that is consistent with the estimated value. We consider variable-range hopping as an alternative model, and find no self-consistent evidence for it. Next, we employ charge sensing as an alternative to current measurements for studying transport in materials with localized sites. A narrow-channel MOSFET serves as a charge sensor because its conductance is sensitive to potential fluctuations in the nearby environment caused by the motion of charge. In particular, it is sensitive to the fluctuation of single electrons at the silicon-oxide interface within the MOSFET. We pattern a strip of amorphous germanium within 100 nm of the transistor. The

  8. Tailorable, Visible Light Emission From Silicon Nanocrystals

    SciTech Connect

    Samara, G.A.; Wilcoxon, J.P.

    1999-07-20

    J. P. Wilcoxon and G. A. Samara Crystalline, size-selected Si nanocrystals in the size range 1.8-10 nm grown in inverse micellar cages exhibit highly structured optical absorption and photoluminescence (PL) across the visible range of the spectrum. The most intense PL for the smallest nanocrystals produced This report was prepared as an account of work sponsored by an agency of the United States Government. Neither the United States Government nor any agency thereof, nor any of their employees, make any warranty, express or implied, or assumes any legal liability or responsibility for the accuracy, completeness, or usefulness of any information, apparatus, product, or process disclosed, or represents that its use would not infringe privately owned rights. Reference herein to any specific commercial product, process, or service by trade name, trademark, manufacturer, or otherwise does not necessarily constitute or imply its endorsement, recommendation, or favoring by the United States Government or any agency thereof. The views and opinions of authors expressed herein do not necessarily state or reflect those of the United States Government or any agency thereof. to induce a useful level of visible photoluminescence (PL) from silicon (Si). The approaches understood. Visible PL has been observed from Si nanocrystals, or quantum dots, produced by a variety of techniques including aerosols,2 colloids,3 and ion implantation.4 However, all of The optical absorption spectra of our nanocrystals are much richer in spectral features spectrum of bulk Si where the spectral features reflect the details of the band structure shown in nanocrystals estimated to have a Si core diameter of 1-2 nm. These measured quantum those in the spectrum of bulk Si in Fig. 1 are striking indicating that nanocrystals of this size 8-Room temperature PL results on an HPLC size-selected, purified 2 nm nanocrystals but blue shifted by -0.4 eV due to quantum confinement. Excitation at 245 nm yields

  9. Synthesis of new nanocrystal materials

    NASA Astrophysics Data System (ADS)

    Hassan, Yasser Hassan Abd El-Fattah

    Colloidal semiconductor nanocrystals (NCs) have sparked great excitement in the scientific community in last two decades. NCs are useful for both fundamental research and technical applications in various fields owing to their size and shape-dependent properties and their potentially inexpensive and excellent chemical processability. These NCs are versatile fluorescence probes with unique optical properties, including tunable luminescence, high extinction coefficient, broad absorption with narrow photoluminescence, and photobleaching resistance. In the past few years, a lot of attention has been given to nanotechnology based on using these materials as building blocks to design light harvesting assemblies. For instant, the pioneering applications of NCs are light-emitting diodes, lasers, and photovoltaic devices. Synthesis of the colloidal stable semiconductor NCs using the wet method of the pyrolysis of organometallic and chalcogenide precursors, known as hot-injection approach, is the chart-topping preparation method in term of high quality and monodisperse sized NCs. The advancement in the synthesis of these artificial materials is the core step toward their applications in a broad range of technologies. This dissertation focuses on exploring various innovative and novel synthetic methods of different types of colloidal nanocrystals, both inorganic semiconductors NCs, also known as quantum dots (QDs), and organic-inorganic metal halide-perovskite materials, known as perovskites. The work presented in this thesis focuses on pursuing fundamental understanding of the synthesis, material properties, photophysics, and spectroscopy of these nanostructured semiconductor materials. This thesis contains 6 chapters and conclusions. Chapters 1?3 focus on introducing theories and background of the materials being synthesized in the thesis. Chapter 4 demonstrates our synthesis of colloidal linker--free TiO2/CdSe NRs heterostructures with CdSe QDs grown in the presence of Ti

  10. Zirconia: Established facts and perspectives for a biomaterial in dental implantology.

    PubMed

    Hisbergues, Michael; Vendeville, Sophie; Vendeville, Philippe

    2009-02-01

    Currently, zirconia is widely used in biomedical area as a material for prosthetic devices because of its good mechanical and chemical properties. Largely employed in clinical area for total hip replacement, zirconia ceramics (ZrO(2)) are becoming a prevalent biomaterial in dentistry and dental implantology. Although titanium is used in dental implantology currently, there is a trend to develop new ceramic-based implants as an alternative to monolithic titanium. This article reviews the evolution and development of zirconia through data published between 1963 and January 2008 in English language. Articles were identified via a MEDLINE search using the following keywords: zirconia, zirconia/biocompatibility, zirconia/osseointegration, zirconia/periointegration, zirconia/review, and zirconia/bacterial adhesion or colonization. This review of the literature aims at highlighting and discussing zirconia properties in biological systems for their future use in dental implantology. In conclusion, zirconia with its interesting microstructural properties has been confirmed to be a material of choice for the "new generation" of implants, thanks to its biocompatibility, osseoconductivity, tendency to reduce plaque accumulation, and interaction with soft tissues, which leads to periointegration. However, scientific studies are promptly needed to fulfill gaps like long-term clinical evaluations of "all zirconia implants," currently leading to propose an alternative use of "hybrid systems" (i.e., titanium screw with zirconia collar) and also bacterial colonization of zirconia. Moreover, there is a permanent need for consistent information about topography and chemistry of zirconia allowing easier cross-product comparisons of clinical devices. Copyright 2008 Wiley Periodicals, Inc.

  11. Thermal stress and end-bulging in monoclinic crystals: the case study of double tungstates.

    PubMed

    Yumashev, Konstantin; Loiko, Pavel

    2017-05-01

    An analytical description of the thermal stress and end-bulging component of thermal lensing is presented for monoclinic laser crystals, taking into account the anisotropy of their optical, thermal, and elastic properties for the first time, to the best of our knowledge. The geometry of longitudinal diode-pumping (plane stress approximation) is considered. The developed approach is applied to the monoclinic double tungstates (MDTs), Yb:KGW, Yb:KYW, and Yb:KLuW, yielding values of normal and shear stresses, tensile stress, and the end-bulging term. We show that for low-symmetry crystals, end-bulging is responsible for the astigmatism of the thermal lens. The geometry of this astigmatism is explained in terms of the principal meridional planes. We show that the crystal cut of the MDTs along the optical indicatrix axis Ng (propagation direction) provides low thermal stress and a purely positive and weakly astigmatic thermal lens, which is a key condition for power scaling and diffraction-limited laser output.

  12. Finite element analysis of the tetragonal to monoclinic phase transformation during oxidation of zirconium alloys

    NASA Astrophysics Data System (ADS)

    Platt, P.; Frankel, P.; Gass, M.; Howells, R.; Preuss, M.

    2014-11-01

    Corrosion is a key limiting factor in the degradation of zirconium alloys in light water reactors. Developing a mechanistic understanding of the corrosion process offers a route towards improving safety and efficiency as demand increases for higher burn-up of fuel. Oxides formed on zirconium alloys are composed of both monoclinic and meta-stable tetragonal phases, and are subject to a number of potential mechanical degradation mechanisms. The work presented investigates the link between the tetragonal to monoclinic oxide phase transformation and degradation of the protective character of the oxide layer. To achieve this, Abaqus finite element analysis of the oxide phase transformation has been carried out. Study of the change in transformation strain energy shows how relaxation of oxidation induced stress and fast fracture at the metal-oxide interface could destabilise the tetragonal phase. Central to this is the identification of the transformation variant most likely to form, and understanding why twinning of the transformed grain is likely to occur. Development of transformation strain tensors and analysis of the strain components allows some separation of dilatation and shear effects. Maximum principal stress is used as an indication of fracture in the surrounding oxide layer. Study of the stress distributions shows the way oxide fracture is likely to occur and the differing effects of dilatation and shape change. Comparison with literature provides qualitative validation of the finite element simulations.

  13. Variable defect structures cause the magnetic low-temperature transition in natural monoclinic pyrrhotite

    NASA Astrophysics Data System (ADS)

    Koulialias, D.; Kind, J.; Charilaou, M.; Weidler, P. G.; Löffler, J. F.; Gehring, A. U.

    2016-02-01

    Non-stoichiometric monoclinic 4C pyrrhotite (Fe7S8) is a major magnetic remanence carrier in the Earth's crust and in extraterrestrial materials. Because of its low-temperature magnetic transition around 30 K also known as Besnus transition, which is considered to be an intrinsic property, this mineral phase is easily detectable in natural samples. Although the physical properties of pyrrhotite have intensively been studied, the mechanism behind the pronounced change in magnetization at the low-temperature transition is still debated. Here we report magnetization experiments on a pyrrhotite crystal (Fe6.6S8) that consists of a 4C and an incommensurate 5C* superstructure that are different in their defect structure. The occurrence of two superstructures is magnetically confirmed by symmetric inflection points in hysteresis measurements above the transition at about 30 K. The disappearance of the inflection points and the associated change of the hysteresis parameters indicate that the two superstructures become strongly coupled to form a unitary magnetic anisotropy system at the transition. From this it follows that the Besnus transition in monoclinic pyrrhotite is an extrinsic magnetic phenomenon with respect to the 4C superstructure and therefore the physics behind it is in fact different from that of the well-known Verwey transition.

  14. Monoclinic Tungsten Oxide with {100} Facet Orientation and Tuned Electronic Band Structure for Enhanced Photocatalytic Oxidations.

    PubMed

    Zhang, Ning; Chen, Chen; Mei, Zongwei; Liu, Xiaohe; Qu, Xiaolei; Li, Yunxiang; Li, Siqi; Qi, Weihong; Zhang, Yuanjian; Ye, Jinhua; Roy, Vellaisamy A L; Ma, Renzhi

    2016-04-27

    Exploring surface-exposed highly active crystal facets for photocatalytic oxidations is promising in utilizing monoclinic WO3 semiconductor. However, the previously reported highly active facets for monoclinic WO3 were mainly toward enhancing photocatalytic reductions. Here we report that the WO3 with {100} facet orientation and tuned surface electronic band structure can effectively enhance photocatalytic oxidation properties. The {100} faceted WO3 single crystals are synthesized via a facile hydrothermal method. The UV-visible diffuse reflectance, X-ray photoelectron spectroscopy valence band spectra, and photoelectrochemical measurements suggest that the {100} faceted WO3 has a much higher energy level of valence band maximum compared with the normal WO3 crystals without preferred orientation of the crystal face. The density functional theory calculations reveal that the shift of O 2p and W 5d states in {100} face induce a unique band structure. In comparison with the normal WO3, the {100} faceted WO3 exhibits an O2 evolution rate about 5.1 times in water splitting, and also shows an acetone evolution rate of 4.2 times as well as CO2 evolution rate of 3.8 times in gaseous degradation of 2-propanol. This study demonstrates an efficient crystal face engineering route to tune the surface electronic band structure for enhanced photocatalytic oxidations.

  15. Monoclinic tridymite in clast-rich impact melt rock from the Chesapeake Bay impact structure

    USGS Publications Warehouse

    Jackson, John C.; Horton, J. Wright; Chou, I-Ming; Belkin, Harvey E.

    2011-01-01

    X-ray diffraction and Raman spectroscopy confirm a rare terrestrial occurrence of monoclinic tridymite in clast-rich impact melt rock from the Eyreville B drill core in the Chesapeake Bay impact structure. The monoclinic tridymite occurs with quartz paramorphs after tridymite and K-feldspar in a microcrystalline groundmass of devitrified glass and Fe-rich smectite. Electron-microprobe analyses revealed that the tridymite and quartz paramorphs after tridymite contain different amounts of chemical impurities. Inspection by SEM showed that the tridymite crystal surfaces are smooth, whereas the quartz paramorphs contain irregular tabular voids. These voids may represent microporosity formed by volume decrease in the presence of fluid during transformation from tridymite to quartz, or skeletal growth in the original tridymite. Cristobalite locally rims spherulites within the same drill core interval. The occurrences of tridymite and cristobalite appear to be restricted to the thickest clast-rich impact melt body in the core at 1402.02–1407.49 m depth. Their formation and preservation in an alkali-rich, high-silica melt rock suggest initially high temperatures followed by rapid cooling.

  16. Conformal Domain Miniaturization and Adaptive Monoclinic (Pseudo-orthorhombic) Ferroelectric States

    NASA Astrophysics Data System (ADS)

    Jin, Y. M.; Wang, Yu; Khachaturyan, A. G.; Li, J. F.; Viehland, D.

    2003-08-01

    Ferroelectric and ferroelastic phases with very low domain wall energies have been shown to form miniaturized microdomain structures. A theory of an adaptive ferroelectric phase has been developed to predict the microdomain-averaged crystal lattice parameters of this structurally inhomogeneous state. The theory is an extension of conventional martensite theory, applied to ferroelectric systems with very low domain wall energies. The cases of ferroelectric microdomains of tetragonal (FEt) symmetry are considered. It is shown that a nano-scale coherent mixture of microdomains can be interpreted as an adaptive ferroelectric phase, whose microdomain-averaged crystal lattice is monoclinic. The crystal lattice parameters of this monoclinic phase are self-adjusting parameters, which minimize the transformation stress. Self-adjustment is achieved by application of the invariant plane strain (IPS) to the parent cubic lattice, and the value of the self-adjusted parameters constitutes a mixture of the lattice constants of the parent and product phases. Experimental investigations of Pb(Mg1/3Nb2/3)O3-PbTiO3 (PMN-PT) and Pb(Zn1/3Nb2/3)O3-PbTiO3 (PZN-PT) single crystals confirm many of the predictions of this theory.

  17. Magnetic structure driven by monoclinic distortions in the double perovskite Sr2YRuO6

    NASA Astrophysics Data System (ADS)

    Bernardo, P. L.; Ghivelder, L.; Amorim, H. S.; Neumeier, J. J.; García, S.

    2015-10-01

    The monoclinic double perovskite Sr2YRuO6 has recently gained a renewed interest in order to get a deeper insight into the exotic magnetic ground states associated with geometric frustration. Striking discrepancies between the spin order derived from the neutron diffraction refinements and the macroscopic magnetic and thermal responses is a major challenge that must be addressed. In this work, detailed neutron diffraction measurements as a function of temperature yield a completely different interpretation of the patterns. We show that at low temperatures a spin structure of the K2NiF4-type is an accessible configuration for the magnetic ground state. In the neighborhood of the magnetic transition, this configuration evolves into a canted superstructure. The deduced temperature dependence of the canting angle exhibits two closely spaced peaks, which are in excellent agreement with the double peaks in the magnetic contribution to the specific heat and in the thermal expansion coefficient. We explain these features in terms of reorientation of the net ferromagnetic moment of the noncollinear spin state, due to the local breaking of the inversion symmetry promoted by the monoclinic distortions, with structural changes acting as the driving force.

  18. Ab initio velocity-field curves in monoclinic β-Ga2O3

    NASA Astrophysics Data System (ADS)

    Ghosh, Krishnendu; Singisetti, Uttam

    2017-07-01

    We investigate the high-field transport in monoclinic β-Ga2O3 using a combination of ab initio calculations and full band Monte Carlo (FBMC) simulation. Scattering rate calculation and the final state selection in the FBMC simulation use complete wave-vector (both electron and phonon) and crystal direction dependent electron phonon interaction (EPI) elements. We propose and implement a semi-coarse version of the Wannier-Fourier interpolation method [Giustino et al., Phys. Rev. B 76, 165108 (2007)] for short-range non-polar optical phonon (EPI) elements in order to ease the computational requirement in FBMC simulation. During the interpolation of the EPI, the inverse Fourier sum over the real-space electronic grids is done on a coarse mesh while the unitary rotations are done on a fine mesh. This paper reports the high field transport in monoclinic β-Ga2O3 with deep insight into the contribution of electron-phonon interactions and velocity-field characteristics for electric fields ranging up to 450 kV/cm in different crystal directions. A peak velocity of 2 × 107 cm/s is estimated at an electric field of 200 kV/cm.

  19. Imaging metal-like monoclinic phase stabilized by surface coordination effect in vanadium dioxide nanobeam

    NASA Astrophysics Data System (ADS)

    Li, Zejun; Wu, Jiajing; Hu, Zhenpeng; Lin, Yue; Chen, Qi; Guo, Yuqiao; Liu, Yuhua; Zhao, Yingcheng; Peng, Jing; Chu, Wangsheng; Wu, Changzheng; Xie, Yi

    2017-06-01

    In correlated systems, intermediate states usually appear transiently across phase transitions even at the femtosecond scale. It therefore remains an open question how to determine these intermediate states--a critical issue for understanding the origin of their correlated behaviour. Here we report a surface coordination route to successfully stabilize and directly image an intermediate state in the metal-insulator transition of vanadium dioxide. As a prototype metal-insulator transition material, we capture an unusual metal-like monoclinic phase at room temperature that has long been predicted. Coordinate bonding of L-ascorbic acid molecules with vanadium dioxide nanobeams induces charge-carrier density reorganization and stabilizes metallic monoclinic vanadium dioxide, unravelling orbital-selective Mott correlation for gap opening of the vanadium dioxide metal-insulator transition. Our study contributes to completing phase-evolution pathways in the metal-insulator transition process, and we anticipate that coordination chemistry may be a powerful tool for engineering properties of low-dimensional correlated solids.

  20. Lithostratigraphy and geochemistry of Upper Vendian‒Lower Cambrian deposits in the northeastern Baltic monocline

    NASA Astrophysics Data System (ADS)

    Podkovyrov, V. N.; Maslov, A. V.; Kuznetsov, A. B.; Ershova, V. B.

    2017-01-01

    The results of investigations of Upper Vendian‒Lower Cambrian deposits in the northeastern part of the Baltic monocline specify views on the evolution of depositional environments of sedimentary successions constituting the basal part of the sedimentary cover in inner areas of the northwestern East European Platform. It is shown that the Late Vendian and initial Cambrian were characterized by the consecutive influx of relatively mature terrigenous detrital material that originated from both the weathering crust of the Baltic Shield and new sources. Its deposition was interrupted by notable, although likely asynchronous, hiatuses, which are registered at the base of the Upper Vendian Vasileostrovskaya and Voronkovo formations and Lower Cambrian Lomonosov Formation. In the Late Vendian, sedimentary material was transported from the Baltic Shield, while beginning from the initial Early Cambrian the additional contribution to the formation of the sedimentary cover of the Baltic monocline was provided by coarse-grained sedimentary material from the Timan margin of the Baltica as follows from U‒Pb isotopic ages obtained for detrital zircons. At the same time, lithogeochemical parameters of fine-grained rocks experienced no substantial changes.

  1. Crystal structure of monoclinic calcium pyrophosphate dihydrate (m-CPPD) involved in inflammatory reactions and osteoarthritis.

    PubMed

    Gras, Pierre; Rey, Christian; André, Gilles; Charvillat, Cédric; Sarda, Stéphanie; Combes, Christèle

    2016-02-01

    Pure monoclinic calcium pyrophosphate dihydrate (m-CPPD) has been synthesized and characterized by synchrotron powder X-ray diffraction and neutron diffraction. Rietveld refinement of complementary diffraction data has, for the first time, allowed the crystal structure of m-CPPD to be solved. The monoclinic system P2(1)/n was confirmed and unit-cell parameters determined: a = 12.60842 (4), b = 9.24278 (4), c = 6.74885 (2) Å and β = 104.9916 (3)°. Neutron diffraction data especially have allowed the precise determination of the position of H atoms in the structure. The relationship between the m-CPPD crystal structure and that of the triclinic calcium pyrophosphate dihydrate (t-CPPD) phase as well as other pyrophosphate phases involving other divalent cations are discussed by considering the inflammatory potential of these phases and/or their involvement in different diseases. These original structural data represent a key step in the understanding of the mechanisms of crystal formation involved in different types of arthritis and to improve early detection of calcium pyrophosphate (CPP) phases in vivo.

  2. Applying analytical ultracentrifugation to nanocrystal suspensions.

    PubMed

    Jamison, Jennifer A; Krueger, Karl M; Mayo, J T; Yavuz, Cafer T; Redden, Jacina J; Colvin, Vicki L

    2009-09-02

    While applied frequently in physical biochemistry to the study of protein complexes, the quantitative use of analytical ultracentrifugation (AUC) for nanocrystal analysis is relatively rare. Its application in nanoscience is potentially very powerful as it provides a measure of nanocrystal density, size and structure directly in the solution phase. Towards that end, this paper examines the best practices for applying data collection and analysis methods for AUC, geared towards the study of biomolecules, to the unique problems of nanoparticle analysis. Using uniform nanocrystals of cadmium selenide, we compared several schemes for analyzing raw sedimentation data. Comparable values of the mean sedimentation coefficients (s-value) were found using several popular analytical approaches; however, the distribution in sample s-values is best captured using the van Holde-Weischt algorithm. Measured s-values could be reproducibly collected if sample temperature and concentration were controlled; under these circumstances, the variability for average sedimentation values was typically 5%. The full shape of the distribution in s-values, however, is not easily subjected to quantitative interpretation. Moreover, the selection of the appropriate sedimentation speed is crucial for AUC of nanocrystals as the density of inorganic nanocrystals is much larger than that of solvents. Quantitative analysis of sedimentation properties will allow for better agreement between experimental and theoretical models of nanocrystal solution behavior, as well as providing deeper insight into the hydrodynamic size and solution properties of nanomaterials.

  3. Thermodynamic properties of some metal oxide-zirconia systems

    NASA Technical Reports Server (NTRS)

    Jacobson, Nathan S.

    1989-01-01

    Metal oxide-zirconia systems are a potential class of materials for use as structural materials at temperatures above 1900 K. These materials must have no destructive phase changes and low vapor pressures. Both alkaline earth oxide (MgO, CaO, SrO, and BaO)-zirconia and some rare earth oxide (Y2O3, Sc2O3, La2O3, CeO2, Sm2O3, Gd2O3, Yb2O3, Dy2O3, Ho2O3, and Er2O3)-zirconia system are examined. For each system, the phase diagram is discussed and the vapor pressure for each vapor species is calculated via a free energy minimization procedure. The available thermodynamic literature on each system is also surveyed. Some of the systems look promising for high temperature structural materials.

  4. Resin cementation of zirconia ceramics with different bonding agents

    PubMed Central

    Tanış, Merve Çakırbay; Akay, Canan; Karakış, Duygu

    2015-01-01

    The aim of this study was to evaluate the effects of sandblasting and different chemical bonding agents on shear bond strength of zirconia and conventional resin cement. In this study, 35 zirconia specimens were treated as follows: Group I: control; Group II: sandblasting; Group III: sandblasting + Monobond S; Group IV: sandblasting + Monobond Plus; Group V: sandblasting + Z-Prime Plus. The specimens in each group were bonded with conventional composite resin cement Variolink II. After cementation, specimens were stored in distilled water (at 37 °C) for 24 h and shear test was performed. The highest shear bond strength values were observed in Groups IV and V. The lowest shear bond strength values were observed in Group I. Using 10-methacryloyloxy-decyl dihydrogenphosphate monomer-containing priming agents, e.g. Monobond Plus and Z-PRIME Plus, combined with sandblasting can be an effective method for resin bonding of zirconia restorations. PMID:26019653

  5. Zirconia-composite bonding after plasma of argon treatment.

    PubMed

    Canullo, Luigi; Micarelli, Costanza; Bettazzoni, Laura; Koçi, Brunilda; Baldissara, Paolo

    2014-01-01

    To compare the shear bond strength (SBS) values of resin cement to zirconia treated with a new activating method. Forty-five zirconia specimens were divided into three groups: no treatment (group 1), plasma of argon cleaning for 375 seconds (group 2), and plasma of argon cleaning for 750 seconds (group 3). Composite cylinders were bonded with a self-adhesive cement. After 40 days of water storage, specimens were subjected to the SBS test. Data were analyzed with one-way analysis of variance and the Neuman-Keuls multiple comparison test. Test groups obtained SBS values significantly higher (101% for group 2 and 81% for group 3) than controls. Plasma of argon appeared to improve bonding between zirconia and resin cement.

  6. Study of Laser Drilled Hole Quality of Yttria Stabilized Zirconia

    NASA Astrophysics Data System (ADS)

    Saini, Surendra K.; Dubey, Avanish K.; Pant, Piyush; Upadhyay, B. N.; Choubey, A.

    2017-09-01

    The Yttria Stabilized Zirconia ceramic is extensively used in aerospace, automotives, medical and microelectronics industries. These applications demand manufacturing of different macro and micro features with close tolerances in this material. To make miniature holes with accurate dimensions in advanced ceramics such as Yttria Stabilized Zirconia is very difficult due to its tailored attributes such as high toughness, hardness, strength, resistance to wear, corrosion and temperature. Due to inherent characteristics of laser drilling, researchers are working to fulfill the requirement of creation of micro holes in advanced ceramics. The present research investigates the laser drilling of 2 mm thick Yttria Stabilized Zirconia with the aim to achieve good micro holes with reduced geometrical inaccuracies and improved hole quality. The results show that multiple quality response comprising hole circularity, hole taper and recast layer thickness has been improved at optimally selected process parameters.

  7. Applicability of zirconia dental prostheses for metal allergy patients.

    PubMed

    Gökçen-Röhlig, Bilge; Saruhanoglu, Alp; Cifter, Ebru Demet; Evlioglu, Gulumser

    2010-01-01

    The aim of this study was to investigate the applicability of zirconium dioxide (zirconia) as a substitute for metal alloys in a group of metal allergy patients. Fourteen patients (eight women, six men) who had been restored with porcelain-fused-to-metal fixed partial dentures (FPDs) and had exhibited hypersensitivity lesions to dental alloys were enrolled in this study. Patients were previously patch-tested using standard testing substances authorized by the International Contact Dermatitis Research Group. Patients received FPDs with zirconia frameworks and occurrences of oral symptoms were evaluated. No hypersensitivity lesions in the mouth or on the skin were encountered during the follow-up period of 3 years. Zirconia FPDs may be an alternative to porcelain-fused-to-metal FPDs in patients with metal allergies.

  8. Resin cementation of zirconia ceramics with different bonding agents.

    PubMed

    Tanış, Merve Çakırbay; Akay, Canan; Karakış, Duygu

    2015-03-04

    The aim of this study was to evaluate the effects of sandblasting and different chemical bonding agents on shear bond strength of zirconia and conventional resin cement. In this study, 35 zirconia specimens were treated as follows: Group I: control; Group II: sandblasting; Group III: sandblasting + Monobond S; Group IV: sandblasting + Monobond Plus; Group V: sandblasting + Z-Prime Plus. The specimens in each group were bonded with conventional composite resin cement Variolink II. After cementation, specimens were stored in distilled water (at 37 °C) for 24 h and shear test was performed. The highest shear bond strength values were observed in Groups IV and V. The lowest shear bond strength values were observed in Group I. Using 10-methacryloyloxy-decyl dihydrogenphosphate monomer-containing priming agents, e.g. Monobond Plus and Z-PRIME Plus, combined with sandblasting can be an effective method for resin bonding of zirconia restorations.

  9. Dynamic annealing of defects in irradiated zirconia-based ceramics

    SciTech Connect

    Devanathan, Ram; Weber, William J.

    2008-03-06

    We have observed self-healing behavior in large scale molecular dynamics simulations of 30 keV Zr recoils in pure zirconia and 10 mole % yttria-stabilized zirconia. Our results reveal that dynamic annealing is highly effective during the first 5 ps of damage evolution, especially in the presence of oxygen structural vacancies introduced by aliovalent doping (Y3+ substitution for Zr4+). The presence of mobile oxygen vacancies results in near complete recovery of damage. Damage recovery on the cation sublattice is assisted by the anion sublattice recovery, which explains the remarkable radiation tolerance of stabilized zirconia. Ceramics engineered to heal themselves in this fashion hold great promise for use in high-radiation environments or for safely encapsulating high-level radioactive waste over geological time scales.

  10. Defect Interactions and Ionic Transport in Scandia Stabilized Zirconia

    SciTech Connect

    Devanathan, Ramaswami; Thevuthasan, Suntharampillai; Gale, Julian D.

    2009-06-24

    Atomistic simulation has been used to study ionic transport in scandia-stabilized zirconia, as well as scandia and yttria-co-doped zirconia, as a function of temperature and composition. The oxygen diffusion coefficient shows a peak at a composition of 6 mole % Sc2O3. Oxygen vacancies prefer to be second nearest neighbours to yttrium ions, but have little preference between first and second neighbour positions with respect to scandium ions. The Sc-O bond length is about 2.17 Å compared to 2.28 Å for the Y-O bond. Oxygen migration between cation tetrahedra is impeded less effectively by Sc-Sc edges than by Y-Y edges. A neutral cluster of two scandium ions with an oxygen vacancy in the common first neighbour position has a binding energy of -0.56 eV. The formation of such clusters may contribute to conductivity degradation of stabilized zirconia at elevated temperature.

  11. High-energy radiation damage in zirconia: Modeling results

    SciTech Connect

    Zarkadoula, E.; Devanathan, R.; Weber, W. J.; Seaton, M. A.; Todorov, I. T.; Nordlund, K.; Dove, M. T.; Trachenko, K.

    2014-02-28

    Zirconia is viewed as a material of exceptional resistance to amorphization by radiation damage, and consequently proposed as a candidate to immobilize nuclear waste and serve as an inert nuclear fuel matrix. Here, we perform molecular dynamics simulations of radiation damage in zirconia in the range of 0.1–0.5 MeV energies with account of electronic energy losses. We find that the lack of amorphizability co-exists with a large number of point defects and their clusters. These, importantly, are largely isolated from each other and therefore represent a dilute damage that does not result in the loss of long-range structural coherence and amorphization. We document the nature of these defects in detail, including their sizes, distribution, and morphology, and discuss practical implications of using zirconia in intense radiation environments.

  12. High-energy radiation damage in zirconia: modeling results

    SciTech Connect

    Zarkadoula, Evangelia; Devanathan, Ram; Weber, William J; Seaton, M; Todorov, I T; Nordlund, Kai; Dove, Martin T; Trachenko, Kostya

    2014-01-01

    Zirconia is viewed as a material of exceptional resistance to amorphization by radiation damage, and consequently proposed as a candidate to immobilize nuclear waste and serve as an inert nuclear fuel matrix. Here, we perform molecular dynamics simulations of radiation damage in zirconia in the range of 0.1-0.5 MeV energies with account of electronic energy losses. We nd that the lack of amorphizability co-exists with a large number of point defects and their clusters. These, importantly, are largely isolated from each other and therefore represent a dilute damage that does not result in the loss of long-range structural coherence and amorphization. We document the nature of these defects in detail, including their sizes, distribution and morphology, and discuss practical implications of using zirconia in intense radiation environments.

  13. High-energy radiation damage in zirconia: Modeling results

    NASA Astrophysics Data System (ADS)

    Zarkadoula, E.; Devanathan, R.; Weber, W. J.; Seaton, M. A.; Todorov, I. T.; Nordlund, K.; Dove, M. T.; Trachenko, K.

    2014-02-01

    Zirconia is viewed as a material of exceptional resistance to amorphization by radiation damage, and consequently proposed as a candidate to immobilize nuclear waste and serve as an inert nuclear fuel matrix. Here, we perform molecular dynamics simulations of radiation damage in zirconia in the range of 0.1-0.5 MeV energies with account of electronic energy losses. We find that the lack of amorphizability co-exists with a large number of point defects and their clusters. These, importantly, are largely isolated from each other and therefore represent a dilute damage that does not result in the loss of long-range structural coherence and amorphization. We document the nature of these defects in detail, including their sizes, distribution, and morphology, and discuss practical implications of using zirconia in intense radiation environments.

  14. Zirconia-germanium interface photoemission spectroscopy using synchrotron radiation

    SciTech Connect

    Chui, Chi On

    2005-04-05

    An ultrathin zirconia gate dielectric had been successfully incorporated into germanium metal-oxide-semiconductor (MOS) devices demonstrating very high permittivity gate stacks with no apparent interfacial layer. In this study, synchrotron radiation photoemission spectroscopy has been applied on the same gate stack to identify and quantify the presence of any interfacial germanium sub-oxide layer. By taking progressive core- level spectra during the layer-by-layer removal of the zirconia film, an oxidized germanium layer with sub-monolayer thickness was found possibly arising from an interfacial Zr-O-Ge bonding configuration. In addition, the offsets in the valence band spectra were also monitored and the energy band diagram of the zirconia-germanium heterostructure was constructed. Compared to high-{kappa} gate stacks on Si, the thinner interfacial layer and larger conduction band offset in high-{kappa} gate stacks on Ge suggest better scalability towards an ultimately higher MOS gate capacitance.

  15. High-energy radiation damage in zirconia: modeling results

    SciTech Connect

    Zarkadoula, Eva; Devanathan, Ram; Weber, William J.; Seaton, Michael; Todorov, Ilian; Nordlund, Kai; Dove, Martin T.; Trachenko, Kostya

    2014-02-28

    Zirconia has been viewed as a material of exceptional resistance to amorphization by radiation damage, and was consequently proposed as a candidate to immobilize nuclear waste and serve as a nuclear fuel matrix. Here, we perform molecular dynamics simulations of radiation damage in zirconia in the range of 0.1-0.5 MeV energies with the account of electronic energy losses. We find that the lack of amorphizability co-exists with a large number of point defects and their clusters. These, importantly, are largely disjoint from each other and therefore represent a dilute damage that does not result in the loss of long-range structural coherence and amorphization. We document the nature of these defects in detail, including their sizes, distribution and morphology, and discuss practical implications of using zirconia in intense radiation environments.

  16. A luminescent nanocrystal stress gauge

    SciTech Connect

    Choi, Charina; Koski, Kristie; Olson, Andrew; Alivisatos, Paul

    2010-10-25

    Microscale mechanical forces can determine important outcomes ranging from the site of material fracture to stem cell fate. However, local stresses in a vast majority of systems cannot be measured due to the limitations of current techniques. In this work, we present the design and implementation of the CdSe/CdS core/shell tetrapod nanocrystal, a local stress sensor with bright luminescence readout. We calibrate the tetrapod luminescence response to stress, and use the luminescence signal to report the spatial distribution of local stresses in single polyester fibers under uniaxial strain. The bright stress-dependent emission of the tetrapod, its nanoscale size, and its colloidal nature provide a unique tool that may be incorporated into a variety of micromechanical systems including materials and biological samples to quantify local stresses with high spatial resolution.

  17. Polyimide Cellulose Nanocrystal Composite Aerogels

    NASA Technical Reports Server (NTRS)

    Nguyen, Baochau N.; Meador, Mary Ann; Rowan, Stuart; Cudjoe, Elvis; Sandberg, Anna

    2014-01-01

    Polyimide (PI) aerogels are highly porous solids having low density, high porosity and low thermal conductivity with good mechanical properties. They are ideal for various applications including use in antenna and insulation such as inflatable decelerators used in entry, decent and landing operations. Recently, attention has been focused on stimuli responsive materials such as cellulose nano crystals (CNCs). CNCs are environmentally friendly, bio-renewable, commonly found in plants and the dermis of sea tunicates, and potentially low cost. This study is to examine the effects of CNC on the polyimide aerogels. The CNC used in this project are extracted from mantle of a sea creature called tunicates. A series of polyimide cellulose nanocrystal composite aerogels has been fabricated having 0-13 wt of CNC. Results will be discussed.

  18. Solution synthesis of germanium nanocrystals

    DOEpatents

    Gerung, Henry [Albuquerque, NM; Boyle, Timothy J [Kensington, MD; Bunge, Scott D [Cuyahoga Falls, OH

    2009-09-22

    A method for providing a route for the synthesis of a Ge(0) nanometer-sized material from. A Ge(II) precursor is dissolved in a ligand heated to a temperature, generally between approximately 100.degree. C. and 400.degree. C., sufficient to thermally reduce the Ge(II) to Ge(0), where the ligand is a compound that can bond to the surface of the germanium nanomaterials to subsequently prevent agglomeration of the nanomaterials. The ligand encapsulates the surface of the Ge(0) material to prevent agglomeration. The resulting solution is cooled for handling, with the cooling characteristics useful in controlling the size and size distribution of the Ge(0) materials. The characteristics of the Ge(II) precursor determine whether the Ge(0) materials that result will be nanocrystals or nanowires.

  19. Study on the neotype zirconia's implant coated nanometer hydroxyapatite ceramics

    NASA Astrophysics Data System (ADS)

    Zhu, J. W.; Yang, D. W.

    2007-07-01

    In recent years, biologic ceramics is a popular material of implants and bioactive surface modification of dental implant became a research emphasis, which aims to improve bioactivity of implants materials and acquire firmer implants-bone interface. The zirconia ceramic has excellent mechanical properties and nanometer HA ceramics is a bioceramic well known for its bioactivity, therefore, nanometer HA ceramics coating on zirconia, allows combining the excellent mechanical properties of zirconia substrates with its bioactivity. This paper shows a new method for implant shape design and bioactive modification of dental implants surface. Zirconia's implant substrate was prepared by sintered method, central and lateral tunnels were drilled in the zirconia hollow porous cylindrical implants by laser processing. The HA powders and needle-like HA crystals were made by a wet precipitation and calcining method. Its surface was coated with nanometer HA ceramics which was used brush HA slurry and vacuum sintering. Mechanical testing results revealed that the attachment strength of nanometer HA ceramics coated zirconia samples is high. SEM and interface observation after inserted experiment indicated that calcium and phosphor content increased and symmetrically around coated implant-bone tissue interface. A significantly higher affinity index was demonstrated in vivo by histomorphometric evaluation in coated versus uncoated implants. SEM analysis demonstrated better bone adhesion to the material in coated implant at any situation. In addition, the hollow porous cylindrical implant coated with nanometer HA ceramics increase the interaction of bone and implant, the new bone induced into the surface of hollow porous cylindrical implant and through the most tunnels filled into central hole. The branch-like structure makes the implant and bone a body, which increased the contact area and decreased elastic ratio. Therefore, the macroscopical and microcosmic nested structure of

  20. 2009 Clusters, Nanocrystals & Nanostructures GRC

    SciTech Connect

    Lai-Sheng Wang

    2009-07-19

    For over thirty years, this Gordon Conference has been the premiere meeting for the field of cluster science, which studies the phenomena that arise when matter becomes small. During its history, participants have witnessed the discovery and development of many novel materials, including C60, carbon nanotubes, semiconductor and metal nanocrystals, and nanowires. In addition to addressing fundamental scientific questions related to these materials, the meeting has always included a discussion of their potential applications. Consequently, this conference has played a critical role in the birth and growth of nanoscience and engineering. The goal of the 2009 Gordon Conference is to continue the forward-looking tradition of this meeting and discuss the most recent advances in the field of clusters, nanocrystals, and nanostructures. As in past meetings, this will include new topics that broaden the field. In particular, a special emphasis will be placed on nanomaterials related to the efficient use, generation, or conversion of energy. For example, we anticipate presentations related to batteries, catalysts, photovoltaics, and thermoelectrics. In addition, we expect to address the controversy surrounding carrier multiplication with a session in which recent results addressing this phenomenon will be discussed and debated. The atmosphere of the conference, which emphasizes the presentation of unpublished results and lengthy discussion periods, ensures that attendees will enjoy a valuable and stimulating experience. Because only a limited number of participants are allowed to attend this conference, and oversubscription is anticipated, we encourage all interested researchers from academia, industry, and government institutions to apply as early as possible. An invitation is not required. We also encourage all attendees to submit their latest results for presentation at the poster sessions. We anticipate that several posters will be selected for 'hot topic' oral

  1. From fullerenes to nanocrystals and nanocrystal arrays: Novel preparation and characterization methods

    NASA Astrophysics Data System (ADS)

    Vezmar, Igor

    1998-09-01

    The success of cluster physics and chemistry and the macroscopic isolation of fullerenes motivated the research of nanometer-size from assemblies based on other elements. In this work an alternative fullerene generation method, utilizing the annealing of an all-carbon precursor formed in the reaction of halocarbons with alkali metals, has been demonstrated. Furthermore, a novel method of nanocrystal processing has been achieved via a compact, well-controlled, multi-stage inert gas flow system operating at near atmospheric pressure. The versatility and adaptability of the nanocrystal flow processor allows for the preparation of various nanostructured materials. Nanocrystal processing in the context of this work means the controlled growth of nanocrystals in a vapor phase environment, their annealing to obtain preferred morphologies, and subsequent full surface stabilization to facilitate collection and handling. The nanocrystal flow processor is coupled in-line to a time-of-flight mass spectrometer for real-time nanocrystal size and composition determination. Continuous sampling and mass analyzing of nanocrystals in the nanometer-diameter size range (up to one million Daltons) at part per billion concentrations has been achieved. Sampling of helium flows bearing benzene, fullerenes, as well as sodium, magnesium, silver, and cesium-iodide nanocrystals has been demonstrated. Using the nanocrystal processing approach, stable silver and gold nanocrystals of uniform size and shape distribution, passivated by self-assembled monolayers of long-chain thiol molecules were successfully prepared. The post-analysis of noble metal nanocrystals included optical spectroscopy, electron microscopy imaging and diffraction, x-ray diffraction and mass spectrometry. Stable and intense cluster beams from gold and silver nanocrystals were produced by laser desorption of molecular films. The mass onset of the desorbed entities corresponds directly to the dimensions of the nanocrystal core

  2. Identification of Tetragonal and Cubic Structures of Zirconia

    DTIC Science & Technology

    1990-05-29

    sample containing 13 mol.% yttria-stabilized zirconia possessed the cubic structure with ao = 0.51420 + 0.00012 nm. A sample containing 6.5 mol.% yttria...spectroscopic data for the crystalline phases. However, Benedetti et al.35 have recently reassigned a cubic structure to a zirconia sample prerarel in a...parameters calculated from the diffraction data using 13 a least-square fle, indicate that Sample A has a cubic structure with ao = 0.51420 + 0.00012 nm. This

  3. Surface quality of yttria-stabilized tetragonal zirconia polycrystal in CAD/CAM milling, sintering, polishing and sandblasting processes.

    PubMed

    Alao, Abdur-Rasheed; Stoll, Richard; Song, Xiao-Fei; Miyazaki, Takashi; Hotta, Yasuhiro; Shibata, Yo; Yin, Ling

    2017-01-01

    This paper studied the surface quality (damage, morphology, and phase transformation) of yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) in CAD/CAM milling, and subsequent polishing, sintering and sandblasting processes applied in dental restorations. X-ray diffraction and scanning electron microscopy (SEM) were used to scan all processed surfaces to determine phase transformations and analyse surface damage morphology, respectively. The average surface roughness (Ra) and maximum roughness (Rz) for all processed surfaces were measured using desk-top SEM-assisted morphology analytical software. X-ray diffraction patterns prove the sintering-induced monoclinic-tetragonal phase transformation while the sandblasting-induced phase transformation was not detected. The CAD/CAM milling of pre-sintered Y-TZP produced very rough surfaces with extensive fractures and cracks. Simply polishing or sintering of milled pre-sintered surfaces did not significantly improve their surface roughness (ANOVA, p>0.05). Neither sintering-polishing of the milled surfaces could effectively improve the surface roughness (ANOVA, p>0.05). The best surface morphology was produced in the milling-polishing-sintering process, achieving Ra=0.21±0.03µm and Rz=1.73±0.04µm, which meets the threshold for bacterial retention. Sandblasting of intaglios with smaller abrasives was recommended as larger abrasive produced visible surface defects. This study provides technical insights into process selection for Y-TZP to achieve the improved restorative quality.

  4. Synthesis of nanocrystals and nanocrystal self-assembly

    NASA Astrophysics Data System (ADS)

    Chen, Zhuoying

    Chapter 1. A general introduction is presented on nanomaterials and nanoscience. Nanoparticles are discussed with respect to their structure and properties. Ferroelectric materials and nanoparticles in particular are highlighted, especially in the case of the barium titanate, and their potential applications are discussed. Different nanocrystal synthetic techniques are discussed. Nanoparticle superlattices, the novel "meta-materials" built from self-assembly at the nanoscale, are introduced. The formation of nanoparticle superlattices and the importance and interest of synthesizing these nanostructures is discussed. Chapter 2. Advanced applications for high k dielectric and ferroelectric materials in the electronics industry continues to demand an understanding of the underlying physics in decreasing dimensions into the nanoscale. The first part of this chapter presents the synthesis, processing, and electrical characterization of nanostructured thin films (thickness ˜100 nm) of barium titanate BaTiO3 built from uniform nanoparticles (<20 nm in diameter) in diameter. Essential to our approach is an understanding of the nanoparticle as a building block, combined with an ability to integrate them into thin films that have uniform and characteristic electrical properties. We observe the BaTiO3 nanocrystals crystallize with evidence of tetragonality. Electric field dependent polarization measurements show spontaneous polarization and hysteresis, indicating ferroelectric behavior for the BaTiO 3 nanocrystalline films with grain sizes in the range of 10--30 nm. Dielectric measurements of the films show dielectic constants in the range of 85--90 over the 1 kHz--100 kHz, with low loss. We present nanocrystals as initial building blocks for the preparation of thin films which exhibit uniform nanostructured morphologies and grain sizes. In the second part of this chapter, a nonhydrolytic alcoholysis route to study the preparation of well-crystallized size-tunable BaTiO3

  5. Study of the Crack Propagation in Alumina Mullite Zirconia and Mullite Zirconia Composites Obtained by Reaction Sintering

    NASA Astrophysics Data System (ADS)

    Gheldane, Farid; Souya, Lotfi Ain; Bouras, Seddik

    2011-12-01

    We studied resistance to the propagation of cracks on composites mullite zirconia and mullite alumina zirconia using the flexure tests SENB. The second nuance presents an R-curve effect interesting compared to mullite zirconia where the effect hardly appears. For understanding the mechanisms toughening, we used the SEM observations which showed that resistance to the propagation is mainly connected to the cracks bridging. The crack lengths are often calculated on the basis of compliance evolution during the R-curve tests. We show that the cracks lengths calculated starting from compliance underestimate in an important way the crack true values. The not fissured ligaments, responsible of the bridging mechanisms, are indeed also the cause of the error induced on compliance.

  6. Identification of peptide motif that binds to the surface of zirconia.

    PubMed

    Hashimoto, Kazuhiko; Yoshinari, Masao; Matsuzaka, Kenichi; Shiba, Kiyotaka; Inoue, Takashi

    2011-01-01

    A zirconia-binding peptide motif was identified using a peptide phage display system. Yttria stabilized zirconia beads and discs were used as the target. Quartz crystal microbalance was used to monitor the binding of phages to zirconia. Starting from a library of phages displaying random sequences of 12-mer peptides, we repeated cycles of biopanning against zirconia beads. After four cycles of biopanning, we isolated a phage clone Φ#17. DNA sequencing of the corresponding portion of Φ#17 unexpectedly revealed that it displayed a 58-mer peptide (amino acid sequence: WMPSDVDINDPQGGGSRPNLHQPKPAAEAASKKKSENRKVPFYSHSWY-SSMSEDKRGW). We found that Φ#17 had a 300-fold, significantly higher binding affinity for zirconia discs than phages displaying no peptide. In quartz crystal microbalance assay, a rapid increase in energy dissipation was observed from Φ#17 but not from the control phages, indicating that Φ#17 binds to the surface of zirconia via its displayed peptide. We successfully identified a peptide motif that binds zirconia.

  7. pH control of the structure, composition, and catalytic activity of sulfated zirconia

    NASA Astrophysics Data System (ADS)

    Ivanov, Vladimir K.; Baranchikov, Alexander Ye.; Kopitsa, Gennady P.; Lermontov, Sergey A.; Yurkova, Lyudmila L.; Gubanova, Nadezhda N.; Ivanova, Olga S.; Lermontov, Anatoly S.; Rumyantseva, Marina N.; Vasilyeva, Larisa P.; Sharp, Melissa; Pranzas, P. Klaus; Tretyakov, Yuri D.

    2013-02-01

    We report a detailed study of structural and chemical transformations of amorphous hydrous zirconia into sulfated zirconia-based superacid catalysts. Precipitation pH is shown to be the key factor governing structure, composition and properties of amorphous sulfated zirconia gels and nanocrystalline sulfated zirconia. Increase in precipitation pH leads to substantial increase of surface fractal dimension (up to ˜2.7) of amorphous sulfated zirconia gels, and consequently to increase in specific surface area (up to ˜80 m2/g) and simultaneously to decrease in sulfate content and total acidity of zirconia catalysts. Complete conversion of hexene-1 over as synthesized sulfated zirconia catalysts was observed even under ambient conditions.

  8. Use of spray-dried zirconia microspheres in the separation of immunoglobulins from cell culture supernatant.

    PubMed

    Subramanian, A; Carr, P W; McNeff, C V

    2000-08-18

    A method suitable for the isolation of monoclonal antibodies (MAbs) on novel zirconia microspheres (20-30 microm) is described. Zirconia microspheres were generated by spray drying colloidal zirconia. Spray-dried zirconia microspheres were further classified and characterized by X-ray diffraction, BET porosimetry and scanning electron microscopy. Spray-dried zirconia microspheres were modified with ethylenediamine-N,N'-tetra(methylenephosphonic) acid (EDTPA) to create a cation-exchange chromatographic support. The chromatographic behavior of a semi-preparative column packed with EDTPA-modified zirconia microspheres was evaluated and implications for scale-up are provided. EDTPA-modified zirconia microspheres were further used to purify MAbs from cell culture supernatant. Analysis by enzyme linked immunosorbent assay and gel electrophoresis demonstrate that MAbs can be recovered from a cell culture supernatant at high yield (92-98%) and high purity (>95%) in a single chromatographic step.

  9. The effect of zirconia thickness on the biaxial flexural strength of zirconiaceramic bilayered discs.

    PubMed

    Sinmazisik, Gulden; Tarcin, Bilge; Demirbas, Bulent; Gulmez, Turgut; Bor, Emire; Ozer, Fusun

    2015-01-01

    The aim of this study was to assess the effect of zirconia core thickness on the biaxial flexural strength values of zirconia-porcelain bilayered discs. A total of 60 discs with 0.3, 0.4, and 0.5 mm thickness were obtained from a fully sintered zirconia block. A 1.5-mm thick layer of veneer porcelain was fired on the zirconia specimens and biaxial flexural strength tests were performed on the bilayered discs. In each group, the loading surface was the veneer porcelain in half of the specimens (core in tension) and the zirconia core surface in the other half (core in compression). The zirconia core thickness had no effect on the biaxial flexural strength of zirconiaporcelain bilayered discs when the core was in tension (p>0.05). Whereas, when the core was in compression, an increase in the zirconia core thickness resulted in an increase in the biaxial flexural strength (p<0.05).

  10. Germanium nanocrystals: Synthesis, characterization, and applications

    NASA Astrophysics Data System (ADS)

    Gerung, Henry

    The aim of this work was to demonstrate a simple synthesis route of Ge nanostructures (nanoparticles and nanowires), to characterize the physical and optical properties of Ge nanocrystal, and to demonstrate their biological and optoelectronics applications. The appropriate organometallic Ge 2+ precursors for the synthesis of Ge nanocrystals were identified. These precursors were used to develop a simple route that produced high quality Ge nanocrystals in high yield under mild conditions without using potentially contaminating catalysts and forming byproducts. The particle size was varied from 1 to 10 nm, depending on the reaction parameters. The relatively low-temperature, low-pressure nanocrystal synthesis condition allowed the use of organic solvents and surfactants. We also demonstrated morphological control over Ge nanocrystals via Ge2+ precursor reactivity modification. During synthesis, the surfactants passivate the nanocrystal surface and minimize surface oxidation. This synthesis method allowed optical characterization of Ge nanocrystals decoupled from contamination and oxidation. When excited with photons, Ge nanoparticles exhibit quantum confinement effect in both infrared and ultraviolet regions, as well as optical nonlinearity by the presence of two-photon absorption. These free-standing Ge nanocrystals could be further become integral elements in various optoelectronic devices. Herein, the production of water-soluble Ge nanoparticles was demonstrated as a proof of the effectiveness of our synthesis method. Addition of secondary layer surfactants such as cationic cetyltrimethylammonium bromide (CTAB) or functionalized polyethylene glycol (PEG), transforms the Ge nanoparticles to become water-soluble. The biocompatible, functionalized, water-soluble Ge nanoparticles were bound to extracellular receptors and also incorporated into the cells as a proof-of-concept demonstration for potential biomarker applications. In expectation of forming a 3-D

  11. Surface treatment of nanocrystal quantum dots after film deposition

    DOEpatents

    Sykora, Milan; Koposov, Alexey; Fuke, Nobuhiro

    2015-02-03

    Provided are methods of surface treatment of nanocrystal quantum dots after film deposition so as to exchange the native ligands of the quantum dots for exchange ligands that result in improvement in charge extraction from the nanocrystals.

  12. The effect of resin cements and primer on retentive force of zirconia copings bonded to zirconia abutments with insufficient retention

    PubMed Central

    Kim, Seung-Mi; Yoon, Ji-Young; Lee, Myung-Hyun

    2013-01-01

    PURPOSE The purpose of this study was to investigate the effect of resin cements and primer on the retentive force of zirconia copings bonded to zirconia abutments with insufficient retention. MATERIALS AND METHODS Zirconia blocks (Lava, 3M ESPE, St. Paul, MN, USA) were obtained and forty sets of zirconia abutments and copings were fabricated using CAD/CAM technology. They were grouped into 4 categories as follows, depending on the types of resin cements used, and whether the primer is applied or not:Panavia F2.0 (P), Panavia F2.0 using Primer (PRIME Plus, Bisco Inc, Schaumburg, IL, USA) (PZ), Superbond C&B (S), and Superbond C&B using Primer (SZ). For each of the groups, the cementation was conducted. The specimens were kept in sterilized water (37℃) for 24 hours. Retentive forces were tested and measured, and a statistical analysis was carried out. The nature of failure was recorded. RESULTS The means and standard deviations of retentive force in Newton for each group were 265.15 ± 35.04 N (P), 318.21 ± 22.24 N (PZ), 445.13 ± 78.54 N (S) and 508.21 ± 79.48 N (SZ). Superbond C&B groups (S & SZ) showed significantly higher retentive force than Panavia F2.0 groups (P & PZ). In Panavia F2.0 groups, the use of primer was found to contribute to the increase of retentive force. On the other hand, in Superbond C&B groups, the use of primer did not influence the retention forces. Adhesive failure was observed in all groups. CONCLUSION This study suggests that cementation of the zirconia abutments and zirconia copings with Superbond C&B have a higher retentive force than Panavia F2.0. When using Panavia F2.0, the use of primer increases the retentive force. PMID:23755347

  13. Low-temperature magnetic properties of monoclinic pyrrhotite with particular relevance to the Besnus transition

    NASA Astrophysics Data System (ADS)

    Volk, Michael W. R.; Gilder, Stuart A.; Feinberg, Joshua M.

    2016-12-01

    Monoclinic pyrrhotite (Fe7S8) owes its ferrimagnetism to an ordered array of Fe vacancies. Its magnetic properties change markedly around 30 K, in what is known as the Besnus transition. Plausible explanations for the Besnus transition are either due to changes in crystalline anisotropy from a transformation in crystal symmetry or from the establishment of a two-phase system with magnetic interaction between the two phases. To help resolve this discrepancy, we measured hysteresis loops every 5° and backfield curves every 10° in the basal plane of an oriented single crystal of monoclinic pyrrhotite at 300 K and every 2 K from 50 K through the Besnus transition until 20 K. Between 50 and 30 K, hysteresis loops possess double inflections between crystallographic a-axes and only a single inflection parallel to the a-axes. Magnetization energy calculations and relative differences of the loops show a sixfold symmetry in this temperature range. We propose that the inflections stem from magnetic axis switching, which is both field and temperature dependent, in a manner somewhat analogous to an isotropic point where magnetocrystalline constants change their sign. The Besnus transition is best characterized by changes in magnetic remanence and coercivity over a 6° temperature span (28-34 K) with a maximum rate of change at 30 K. A surprising yet puzzling finding is that the coercivity ratio becomes less than unity below the transition when fourfold symmetry arises. Because the changes in magnetic parameters are linked to the crystal structure, we conclude the Besnus transition owes its origin to a distortion of the crystallographic axes below 30 K rather than an apparition of a two-phase system. An isothermal magnetization of natural pyrrhotite cycled from room temperature to successively lower temperatures through the Besnus transition decreases 2-4 times less than equivalent grain sizes of magnetite, with less than a 10 per cent loss in remanence between 300 and 150 K

  14. Monoclinic crystal structure of α-RuCl3 and the zigzag antiferromagnetic ground state

    DOE PAGES

    Johnson, R. D.; Williams, S. C.; Haghighirad, A. A.; ...

    2015-12-10

    We have proposed the layered honeycomb magnet α - RuCl 3 as a candidate to realize a Kitaev spin model with strongly frustrated, bond-dependent, anisotropic interactions between spin-orbit entangled j eff = 1/2 Ru 3 + magnetic moments. We report a detailed study of the three-dimensional crystal structure using x-ray diffraction on untwinned crystals combined with structural relaxation calculations. We consider several models for the stacking of honeycomb layers and find evidence for a parent crystal structure with a monoclinic unit cell corresponding to a stacking of layers with a unidirectional in-plane offset, with occasional in-plane sliding stacking faults, inmore » contrast with the currently assumed trigonal three-layer stacking periodicity. We also report electronic band-structure calculations for the monoclinic structure, which find support for the applicability of the j eff = 1/2 picture once spin-orbit coupling and electron correlations are included. Of the three nearest-neighbor Ru-Ru bonds that comprise the honeycomb lattice, the monoclinic structure makes the bond parallel to the b axis nonequivalent to the other two, and we propose that the resulting differences in the magnitude of the anisotropic exchange along these bonds could provide a natural mechanism to explain the previously reported spin gap in powder inelastic neutron scattering measurements, in contrast to spin models based on the three-fold symmetric trigonal structure, which predict a gapless spectrum within linear spin wave theory. Our susceptibility measurements on both powders and stacked crystals, as well as magnetic neutron powder diffraction, show a single magnetic transition upon cooling below T N ≈ 13 K. Our analysis of our neutron powder diffraction data provides evidence for zigzag magnetic order in the honeycomb layers with an antiferromagnetic stacking between layers. Magnetization measurements on stacked single crystals in pulsed field up to 60 T show a single transition

  15. Solid-state NMR study of amyloid nanocrystals and fibrils formed by the peptide GNNQQNY from yeast prion protein Sup35p.

    PubMed

    van der Wel, Patrick C A; Lewandowski, Józef R; Griffin, Robert G

    2007-04-25

    Sup35p is a prion protein found in yeast that contains a prion-forming domain characterized by a repetitive sequence rich in Gln, Asn, Tyr, and Gly amino acid residues. The peptide GNNQQNY7-13 is one of the shortest segments of this domain found to form amyloid fibrils, in a fashion similar to the protein itself. Upon dissolution in water, GNNQQNY displays a concentration-dependent polymorphism, forming monoclinic and orthorhombic crystals at low concentrations and amyloid fibrils at higher concentrations. We prepared nanocrystals of both space groups as well as fibril samples that reproducibly contain three (coexisting) structural forms and examined the specimens with magic angle spinning (MAS) solid-state nuclear magnetic resonance. 13C and 15N MAS spectra of both nanocrystals and fibrils reveal narrow resonances indicative of a high level of microscopic sample homogeneity that permitted resonance assignments of all five species. We observed variations in chemical shift among the three dominant forms of the fibrils which were indicated by the presence of three distinct, self-consistent sets of correlated NMR signals. Similarly, the monoclinic and orthorhombic crystals exhibit chemical shifts that differ from one another and from the fibrils. Collectively, the chemical shift data suggest that the peptide assumes five conformations in the crystals and fibrils that differ from one another in subtle but distinct ways. This includes variations in the mobility of the aromatic Tyr ring. The data also suggest that various structures assumed by the peptide may be correlated to the "steric zipper" observed in the monoclinic crystals.

  16. Nanocrystal Bioassembly: Asymmetry, Proximity, and Enzymatic Manipulation

    SciTech Connect

    Claridge, Shelley A.

    2008-05-01

    Research at the interface between biomolecules and inorganic nanocrystals has resulted in a great number of new discoveries. In part this arises from the synergistic duality of the system: biomolecules may act as self-assembly agents for organizing inorganic nanocrystals into functional materials; alternatively, nanocrystals may act as microscopic or spectroscopic labels for elucidating the behavior of complex biomolecular systems. However, success in either of these functions relies heavily uponthe ability to control the conjugation and assembly processes.In the work presented here, we first design a branched DNA scaffold which allows hybridization of DNA-nanocrystal monoconjugates to form discrete assemblies. Importantly, the asymmetry of the branched scaffold allows the formation of asymmetric2assemblies of nanocrystals. In the context of a self-assembled device, this can be considered a step toward the ability to engineer functionally distinct inputs and outputs.Next we develop an anion-exchange high performance liquid chromatography purification method which allows large gold nanocrystals attached to single strands of very short DNA to be purified. When two such complementary conjugates are hybridized, the large nanocrystals are brought into close proximity, allowing their plasmon resonances to couple. Such plasmon-coupled constructs are of interest both as optical interconnects for nanoscale devices and as `plasmon ruler? biomolecular probes.We then present an enzymatic ligation strategy for creating multi-nanoparticle building blocks for self-assembly. In constructing a nanoscale device, such a strategy would allow pre-assembly and purification of components; these constructs can also act as multi-label probes of single-stranded DNA conformational dynamics. Finally we demonstrate a simple proof-of-concept of a nanoparticle analog of the polymerase chain reaction.

  17. Monoclinic β-MoO(3) nanosheets produced by atmospheric microplasma: application to lithium-ion batteries.

    PubMed

    Mariotti, Davide; Lindström, Henrik; Bose, Arumugam Chandra; Ostrikov, Kostya Ken

    2008-12-10

    Porous high surface area thin films of nanosheet-shaped monoclinic MoO(3) were deposited onto platinized Si substrates using patch antenna-based atmospheric microplasma processing. The films were characterized by high resolution transmission electron microscopy (HRTEM), scanning electron microscopy (SEM) and electrochemical analysis. The electrochemical analysis shows original redox peaks and high charge capacity, and also indicates a reversible electrochemical behaviour particularly beneficial for applications in Li-ion batteries. SEM shows that the films are highly porous and consist of nanosheets 50-100 nm thick with surface dimensions in the micrometre range. HRTEM reveals that the MoO(3) nanosheets consist of the monoclinic beta phase of MoO(3). These intricate nanoarchitectures made of monoclinic MoO(3) nanosheets have not been studied previously in the context of applications in Li-ion batteries and show superior structural and morphological features that enable effective insertion of Li ions.

  18. Monoclinic 122-Type BaIr₂Ge₂ with a Channel Framework: A Structural Connection between Clathrate and Layered Compounds.

    PubMed

    Gui, Xin; Chang, Tay-Rong; Kong, Tai; Pan, Max T; Cava, Robert J; Xie, Weiwei

    2017-07-18

    A new 122-type phase, monoclinic BaIr₂Ge₂ is successfully synthesized by arc melting; X-ray diffraction and scanning electron microscopy are used to purify the phase and determine its crystal structure. BaIr₂Ge₂ adopts a clathrate-like channel framework structure of the monoclinic BaRh₂Si₂-type, with space group P2₁/c. Structural comparisons of clathrate, ThCr₂Si₂, CaBe₂Ge₂, and BaRh₂Si2 structure types indicate that BaIr₂Ge₂ can be considered as an intermediate between clathrate and layered compounds. Magnetic measurements show it to be diamagnetic and non-superconducting down to 1.8 K. Different from many layered or clathrate compounds, monoclinic BaIr₂Ge₂ displays a metallic resistivity. Electronic structure calculations performed for BaIr₂Ge₂ support its observed structural stability and physical properties.

  19. Krypton ion induced structural phase transition in zirconia thin film

    NASA Astrophysics Data System (ADS)

    Balasaritha, P.; Amirthapandian, S.; Magudapathy, P.; Krishnan, R.; Panigrahi, B. K.

    2017-05-01

    The ZrO2 thin film was grown using pulsed laser deposition (PLD) method and irradiated with 60 keV Kr+ ions. The as-prepared and ion irradiated ZrO2 thin films were characterised with high resolution transmission electron microscope(HRTEM). The as-prepared ZrO2 thin film was found to be monoclinic in structure. Upon 60 keV Kr+ ion implantation, the ZrO2 thin films transformed from monoclinic to tetragonal phase along with the formation of krypton bubbles.

  20. Size tunable synthesis of solution processable diamond nanocrystals.

    PubMed

    Mandal, Manik; Haso, Fadi; Liu, Tianbo; Fei, Yingwei; Landskron, Kai

    2014-10-07

    Diamond nanocrystals were synthesized catalyst-free from nanoporous carbon at high pressure and high temperature (HPHT). The synthesized nanocrystals have tunable diameters between 50 and 200 nm. The nanocrystals are dispersible in organic solvents such as acetone and are isotropic in nature as seen by dynamic light scattering.

  1. Metal halide solid-state surface treatment for nanocrystal materials

    DOEpatents

    Luther, Joseph M.; Crisp, Ryan; Beard, Matthew C.

    2016-04-26

    Methods of treating nanocrystal and/or quantum dot devices are described. The methods include contacting the nanocrystals and/or quantum dots with a solution including metal ions and halogen ions, such that the solution displaces native ligands present on the surface of the nanocrystals and/or quantum dots via ligand exchange.

  2. Size Effect of Embedded Nanocrystals in Floating Gate MOSFET Devices

    NASA Astrophysics Data System (ADS)

    Cheng, X. Z.; Jalil, M. B. A.; Samudra, G. S.

    2011-12-01

    We investigate the transport and retention properties of a floating-gate MOSFET memory device incorporating embedded nanocrystals. Of particular interest is the nanocrystal size effect on the retention lifetime of the device. The quantum confinement effects and changes to the electrostatic energy arising from the decrease of the nanocrystal size are analyzed both numerically and analytically.

  3. Calculation of thermodynamic, electronic, and optical properties of monoclinic Mg2NiH4

    SciTech Connect

    Myers, W.R.; Richardson, T.J.; Rubin, M.D.; Wang, L-W.

    2001-10-01

    Ab initio total-energy density functional theory is used to investigate the low temperature (LT) monoclinic form of Mg2NiH4. The calculated minimum energy geometry of LT Mg2NiH4 is close to that determined from neutron diffraction data, and the NiH4 complex is close to a regular tetrahedron. The enthalpies of the phase change to high temperature (HT) pseudo-cubic Mg2NiH4 and of hydrogen absorption by Mg2Ni are calculated and compared with experimental values. LT Mg2NiH4 is found to be a semiconductor with an indirect band gap of 1.4 eV. The optical dielectric function of LT Mg2NiH4 differs somewhat from that of the HT phase. A calculated thin film transmittance spectrum is consistent with an experimental spectrum.

  4. A second monoclinic polymorph of (E)-phen­yl(pyridin-2-yl)methanone oxime

    PubMed Central

    Rodríguez-Mora, Monserrath I.; Reyes-Martínez, Reyna; Flores-Alamo, Marcos; García, Juventino J.; Morales-Morales, David

    2013-01-01

    The title compound, C12H10N2O, a second monoclinic poly­morph of (E)-phen­yl(pyridin-2-yl)methanone oxime crystallizes in the space group P21/n (Z = 4). The previously reported polymorph [Taga et al. (1990 ▶). Acta Cryst. C46, 2241–2243] occurs in the space group C2/c (Z = 8). In the crystal, pairs of bifurcated O—H⋯(N,O) hydrogen bonds link the mol­ecules into inversion dimers. The dimers are linked by C—H⋯π inter­actions, forming a linear arrangement. The dihedral angle between the pyridine and phenyl rings is 67.70 (8)°. PMID:23424575

  5. A monoclinic post-stishovite polymorph of silica in the shergotty meteorite

    PubMed

    El Goresy A; Dubrovinsky; Sharp; Saxena; Chen

    2000-06-02

    A post-stishovite phase of silica was identified in the Shergotty meteorite by x-ray diffraction and field emission scanning electron microscopy. The diffraction pattern revealed a monoclinic lattice, similar to the baddeleyite-structured polymorph with the cell parameters a = 4.375(1) angstroms, b = 4.584(1) angstroms, c = 4. 708(1) angstroms, beta= 99.97(3), rho = 4.30(2) grams per cubic centimeter, where the numbers in parentheses are the maximum deviations. Transmission electron microscopy investigations indicate the presence of the alpha-lead dioxide-like polymorph, stishovite, and secondary cristobalite in the same silica grain. The mixture of high-density polymorphs suggests that several post-stishovite phases were formed during the shock event on the Shergotty parent body.

  6. THE MONOCLINIC PHASE IN PZT: NEW LIGHT ON MORPHOTROPIC PHASE BOUNDARIES

    SciTech Connect

    NOHEDA,B.; GONZALO,J.A.; GUO,R.; PARK,S.E.; CROSS,L.E.; COX,D.E.; SHIRANE,G.

    2000-03-09

    A summary of the work recently carried out on the morphotropic phase boundary (MPB) of PZT is presented. By means of x-ray powder diffraction on ceramic samples of excellent quality, the MPB has been successfully characterized by changing temperature in a series of closely spaced compositions. As a result, an unexpected monoclinic phase has been found to exist in between the well-known tetragonal and rhombohedral PZT phases. A detailed structural analysis, together with the investigation of the field effect in this region of compositions, have led to an important advance in understanding the mechanisms responsible for the physical properties of PZT as well as other piezoelectric materials with similar morphotropic phase boundaries.

  7. Electronic structure and optical properties of monoclinic clinobisvanite BiVO4.

    PubMed

    Zhao, Zongyan; Li, Zhaosheng; Zou, Zhigang

    2011-03-14

    Monoclinic clinobisvanite bismuth vanadate is an important material with wide applications. However, its electronic structure and optical properties are still not thoroughly understood. Density functional theory calculations were adopted in the present work, to comprehend the band structure, density of states, and projected wave function of BiVO(4). In particular, we put more emphasis upon the intrinsic relationship between its structure and properties. Based on the calculated results, its molecular-orbital bonding structure was proposed. And a significant phenomenon of optical anisotropy was observed in the visible-light region. Furthermore, it was found that its slightly distorted crystal structure enhances the lone-pair impact of Bi 6s states, leading to the special optical properties and excellent photocatalytic activities.

  8. Structural discrimination via density functional theory and lattice dynamics: Monoclinic Mg2NiH4

    NASA Astrophysics Data System (ADS)

    Herbst, J. F.; Hector, L. G., Jr.

    2009-04-01

    Two distinct crystal structures for the monoclinic, low-temperature phase of Mg2NiH4 , which we designate as LTI and LTII, are available in the published literature. We demonstrate that density functional theory and lattice dynamics can easily identify LTII as the preferable structure at two levels of inquiry. First, enthalpies of formation ΔH calculated using three different forms for the exchange-correlation energy functional are in better agreement with experiment for LTII. Second, the phonon spectrum calculated for LTII contains no anomalies while that for LTI exhibits a variety of soft modes. By analyzing the soft modes in LTI as well as those we find for the known CaMgNiH4 structure with Ca replaced by Mg we derive a crystal structure that closely approximates LTII.

  9. 1-Nitro-4-(4-nitro-phen-oxy)benzene: a second monoclinic polymorph.

    PubMed

    Naz, Mehwish; Akhter, Zareen; McKee, Vickie; Nadeem, Arif

    2013-11-06

    In the title compound, C12H8N2O5, the aromatic rings are inclined to one another by 56.14 (7)°. The nitro groups are inclined by to the benzene rings to which they are attached by 3.86 (17) and 9.65 (15)°. In the crystal, mol-ecules are linked by C-H⋯O hydrogen bonds, forming a three-dimensional structure. The title compound is a new monoclinic polymorph, crystallizing in space group P21/c. The first polymorph crystallized in space group C2/c and the mol-ecule possesses twofold rotation symmetry. Two low-temperature structures of this polymorph (150 K and 100 K, respectively) have been reported [Meciarova et al. (2004). Private Communication (refcode IXOGAD). CCDC, Cambridge, England, and Dey & Desiraju (2005). Chem. Commun. pp. 2486-2488].

  10. Investigation of the femtosecond optical limiting properties of monoclinic copper niobate

    NASA Astrophysics Data System (ADS)

    Priyadarshani, N.; Venugopal Rao, S.; Sabari Girisun, T. C.

    2016-10-01

    Investigation of the third-order nonlinear optical properties and optical limiting behaviour of microstructured monoclinic phase copper niobate (CuNb2O6) was performed by the Z-scan technique using femtosecond laser pulses (800 nm, 150 fs, 80 MHz). CuNb2O6 was synthesized by solid-state reaction at a sintering temperature of 700 °C maintained at different times of 3, 6, 9 and 12 h. Formation of rods at higher reaction time of 12 h was observed and is attributed to the mass transport and coalescence processes. From the absorption tail of UV-Vis spectrum, the optical band gap was estimated to be 3.5 eV. In the fluorescence spectra, blue emission was observed near 430 nm and was assigned to the charge transfer from oxygen to central niobium of Nb-O6 octahedra. Open-aperture Z-scan data demonstrated the presence of nonlinear absorption in copper niobate and are ascribed to two-photon absorption process. Closed-aperture data indicated a sign reversal in nonlinear refraction as the sintering time increased. Third-order nonlinear optical coefficients were estimated, and the largest coefficient was observed for the rod-structured CuNb2O6. Copper niobate exhibited optical limiting behaviour, and the limiting threshold was found to be lowest for microrod structures (~0.21 µJ/cm2). Due to the top-notch third-order nonlinear optical coefficients and excellent limiting behaviour, monoclinic copper niobate microrods can be used as a potential material for utilization as an optical limiter for femtosecond pulses.

  11. Structural evolution and electrochemistry of monoclinic NaNiO2 upon the first cycling process

    NASA Astrophysics Data System (ADS)

    Han, Man Huon; Gonzalo, Elena; Casas-Cabanas, Montse; Rojo, Teófilo

    2014-07-01

    Electrochemistry and structural evolution of monoclinic NaNiO2 as a cathode material for Na-ion battery is reported. The initial charge capacity reached 160 mA h g-1 and the following discharge capacity of 114.6 mA h g-1, within the voltage range of 4.0-1.5 V at C/10. The multiple phase transition leading to O‧3, P‧3, P″3, O″3, and O‴3 stacking types (NaNiO2, Na0.91NiO2, Na0.84NiO2, Na0.81NiO2 and Na0.79NiO2 transitions, respectively, according to a previous report) during the 1st charge/discharge process is analysed using ex situ and in situ XRD techniques, and the stoichiometry of each phase is herein revised. The charge/discharge profile shows a highly reversible nature of the cathode, except that fully sodiated phase could not be achieved at the subsequent discharge. Two new phases have been discovered: a monoclinic O3 structure (designated as O⁗3) at the beginning of the charge (and end of discharge) and a P3 structure (designated as P‴3) at 3.38 V that appeared only during the charge process. The composition of the new O⁗3-phase corresponds to Na0.83NiO2, which is the closest to the fully sodiated phase at room temperature achieved during the discharge process reported up to date, and the composition of the new P‴3-phase corresponds approximately to Na0.50NiO2.

  12. Crystal structure of 8-hy-droxy-quinoline: a new monoclinic polymorph.

    PubMed

    Castañeda, Raúl; Antal, Sofia A; Draguta, Sergiu; Timofeeva, Tatiana V; Khrustalev, Victor N

    2014-09-01

    In an attempt to grow 8-hy-droxy-quinoline-acetamino-phen co-crystals from equimolar amounts of conformers in a chloro-form-ethanol solvent mixture at room temperature, the title compound, C9H7NO, was obtained. The mol-ecule is planar, with the hy-droxy H atom forming an intra-molecular O-H⋯N hydrogen bond. In the crystal, mol-ecules form centrosymmetric dimers via two O-H⋯N hydrogen bonds. Thus, the hy-droxy H atoms are involved in bifurcated O-H⋯N hydrogen bonds, leading to the formation of a central planar four-membered N2H2 ring. The dimers are bound by inter-molecular π-π stacking [the shortest C⋯C distance is 3.2997 (17) Å] and C-H⋯π inter-actions into a three-dimensional framework. The crystal grown represents a new monoclinic polymorph in the space group P21/n. The mol-ecular structure of the present monoclinic polymorph is very similar to that of the ortho-rhom-bic polymorph (space group Fdd2) studied previously [Roychowdhury et al. (1978 ▶). Acta Cryst. B34, 1047-1048; Banerjee & Saha (1986 ▶). Acta Cryst. C42, 1408-1411]. The structures of the two polymorphs are distinguished by the different geometries of the hydrogen-bonded dimers, which in the crystal of the ortho-rhom-bic polymorph possess twofold axis symmetry, with the central N2H2 ring adopting a butterfly conformation.

  13. Paleomagnetic and structural evidence for oblique slip in a fault-related fold, Grayback monocline, Colorado

    USGS Publications Warehouse

    Tetreault, J.; Jones, C.H.; Erslev, E.; Larson, S.; Hudson, M.; Holdaway, S.

    2008-01-01

    Significant fold-axis-parallel slip is accommodated in the folded strata of the Grayback monocline, northeastern Front Range, Colorado, without visible large strike-slip displacement on the fold surface. In many cases, oblique-slip deformation is partitioned; fold-axis-normal slip is accommodated within folds, and fold-axis-parallel slip is resolved onto adjacent strike-slip faults. Unlike partitioning strike-parallel slip onto adjacent strike-slip faults, fold-axis-parallel slip has deformed the forelimb of the Grayback monocline. Mean compressive paleostress orientations in the forelimb are deflected 15??-37?? clockwise from the regional paleostress orientation of the northeastern Front Range. Paleomagnetic directions from the Permian Ingleside Formation in the forelimb are rotated 16??-42?? clockwise about a bedding-normal axis relative to the North American Permian reference direction. The paleostress and paleomagnetic rotations increase with the bedding dip angle and decrease along strike toward the fold tip. These measurements allow for 50-120 m of fold-axis-parallel slip within the forelimb, depending on the kinematics of strike-slip shear. This resolved horizontal slip is nearly equal in magnitude to the ???180 m vertical throw across the fold. For 200 m of oblique-slip displacement (120 m of strike slip and 180 m of reverse slip), the true shortening direction across the fold is N90??E, indistinguishable from the regionally inferred direction of N90??E and quite different from the S53??E fold-normal direction. Recognition of this deformational style means that significant amounts of strike slip can be accommodated within folds without axis-parallel surficial faulting. ?? 2008 Geological Society of America.

  14. Cadmium Stabilization Efficiency and Leachability by CdAl4O7 Monoclinic Structure.

    PubMed

    Su, Minhua; Liao, Changzhong; Chuang, Kui-Hao; Wey, Ming-Yen; Shih, Kaimin

    2015-12-15

    This study investigated the stabilization efficiencies of using an aluminum-rich precursor to incorporate simulated cadmium-bearing waste sludge and evaluated the leaching performance of the product phase. Cadmium oxide and γ-alumina mixtures with various Cd/Al molar ratios were fired at 800-1000 °C for 3 h. Cadmium could be crystallochemically incorporated by γ-alumina into CdAl4O7 monoclinic phase and the reaction was strongly controlled by the treatment temperature. The crystal structure details of CdAl4O7 were solved and refined with the Rietveld refinement method. According to the structural refinement results, the stabilization efficiencies were quantified and expressed as a transformation ratio (TR) with optimized processing parameters. The preferred treatment temperature was found to be 950 °C for mixtures with a Cd/Al molar ratio of 1/4, as its TR value indicated the cadmium incorporation was nearly completed after a 3 h treatment scheme. Constant-pH leaching tests (CPLT) were conducted by comparing the leachability of the CdO and CdAl4O7 phases in a pH 4.0 environment. A remarkable reduction in cadmium leachability could be achieved via monoclinic CdAl4O7 structure formation to effectively stabilize hazardous cadmium in the waste stream. The CPLT and X-ray photoelectron spectroscopy (XPS) results suggested incongruent dissolution behavior during the leaching of the CdAl4O7 phase.

  15. Solid state dye lasers: rhodamines in silica-zirconia materials.

    PubMed

    Schultheiss, Silke; Yariv, Eli; Reisfeld, Renata; Breuer, Hans Dieter

    2002-05-01

    Silica-zirconia materials as well as silica-zirconia ormosils prepared by the sol-gel technique were doped with the laser dyes Rhodamine B and Rhodamine 6G and used as solid state dye lasers. The photostability and efficiency of the solid state laser samples were measured in a transverse pumping configuration by either a nitrogen laser or the second harmonic of a Nd-YAG laser. Under the excitation of a nitrogen laser the photostability of Rhodamine B in silica-zirconia materials was low and decreased with a growing amount of zirconia. The photophysical properties of the incorporated dyes were studied by time-resolved fluorescence spectroscopy. The fluorescence lifetimes of both dyes increased when the matrix was modified by organic compounds Furthermore, the threshold energy of Rhodamine 6G in two ormosils containing 3 and 50% methylsilica was measured. The results revealed that the threshold energy was lower for the matrix with a higher amount of ormosil while the slope efficiency was higher in the matrix containing 30% ormosil.

  16. Clinical Evaluation and Parental Satisfaction with Pediatric Zirconia Anterior Crowns.

    PubMed

    Holsinger, Daniel M; Wells, Martha H; Scarbecz, Mark; Donaldson, Martin

    2016-01-01

    The purpose of this study was to evaluate the clinical success of and parental satisfaction with anterior pediatric zirconia crowns. A retrospective analysis of maxillary anterior pediatric zirconia crowns was performed. Crowns were evaluated for retention, gingival health, color match, contour, marginal integrity, and opposing tooth wear. Parental satisfaction regarding the esthetics of the crowns and parental perception of the impact of treatment on the child's appearance and oral health were evaluated by questionnaire. Fifty-seven crowns were evaluated in 18 children. Eight teeth were lost to exfoliation, three were extracted due to pathology, and two crowns debonded, leaving 44 available for examination. The average crown age at time of examination was 20.8 months. Sixteen crowns (36 percent) displayed gingival inflammation and color mismatch. No recurrent caries or opposing tooth wear was noted. Parents reported high satisfaction with the color, size, and shape of the crowns. The majority of parents reported that crowns improved the appearance and oral health of their child (78 percent and 83 percent, respectively). Eight-nine percent of parents reported that they would highly recommend these crowns. Zirconia crowns are clinically acceptable restorations in the primary maxillary anterior dentition. Parental satisfaction with zirconia crowns is high.

  17. Dissolution Behavior of Plutonium Containing Zirconia-Magnesia Ceramics

    SciTech Connect

    Kiel Holliday; Thomas Hartmann; Gary Cerefice; Ken Czerwinski

    2012-03-01

    This study explores the dissolution properties of zirconia-magnesia ceramics containing plutonium as the basis of an inert atrix nuclear fuel. The magnesium oxide phase remains pure MgO, while the zirconia incorporates a small amount of magnesium oxide along with all of the plutonium oxide and erbium oxide. The performance of the material under reactor and repository environments was examined. Reactor conditions are examined using a pressure vessel to expose the material to 300 degrees C water. To assess the performance of the material as a waste form it was submerged in 90 degrees C water for 1000 h. In both aqueous dissolution studies there was minimal release of less than 0.8 wt.% of plutonium from the material. To examine the potential for recycling, the dissolution behavior of the fuel matrix was examined in acidic solutions: pure nitric acid and a nitric acid-hydrofluoric acid-peroxide solution. Both acidic media exhibit potential for dissolving plutonium from the zirconia matrix. The experiments performed in this study are meant to lay a foundation for the chemical performance of zirconia-magnesia inert matrix fuel containing fissile material and burnable poison.

  18. Iron Oxide Nanocrystals for Magnetic Hyperthermia Applications

    PubMed Central

    Armijo, Leisha M.; Brandt, Yekaterina I.; Mathew, Dimple; Yadav, Surabhi; Maestas, Salomon; Rivera, Antonio C.; Cook, Nathaniel C.; Withers, Nathan J.; Smolyakov, Gennady A.; Adolphi, Natalie; Monson, Todd C.; Huber, Dale L.; Smyth, Hugh D. C.; Osiński, Marek

    2012-01-01

    Magnetic nanocrystals have been investigated extensively in the past several years for several potential applications, such as information technology, MRI contrast agents, and for drug conjugation and delivery. A specific property of interest in biomedicine is magnetic hyperthermia—an increase in temperature resulting from the thermal energy released by magnetic nanocrystals in an external alternating magnetic field. Iron oxide nanocrystals of various sizes and morphologies were synthesized and tested for specific losses (heating power) using frequencies of 111.1 kHz and 629.2 kHz, and corresponding magnetic field strengths of 9 and 25 mT. Polymorphous nanocrystals as well as spherical nanocrystals and nanowires in paramagnetic to ferromagnetic size range exhibited good heating power. A remarkable 30 °C temperature increase was observed in a nanowire sample at 111 kHz and magnetic field of 25 mT (19.6 kA/m), which is very close to the typical values of 100 kHz and 20 mT used in medical treatments.

  19. Field-effect electroluminescence in silicon nanocrystals.

    PubMed

    Walters, Robert J; Bourianoff, George I; Atwater, Harry A

    2005-02-01

    There is currently worldwide interest in developing silicon-based active optical components in order to leverage the infrastructure of silicon microelectronics technology for the fabrication of optoelectronic devices. Light emission in bulk silicon-based devices is constrained in wavelength to infrared emission, and in efficiency by the indirect bandgap of silicon. One promising strategy for overcoming these challenges is to make use of quantum-confined excitonic emission in silicon nanocrystals. A critical challenge for silicon nanocrystal devices based on nanocrystals embedded in silicon dioxide has been the development of a method for efficient electrical carrier injection. We report here a scheme for electrically pumping dense silicon nanocrystal arrays by a field-effect electroluminescence mechanism. In this excitation process, electrons and holes are both injected from the same semiconductor channel across a tunnelling barrier in a sequential programming process, in contrast to simultaneous carrier injection in conventional pn-junction light-emitting-diode structures. Light emission is strongly correlated with the injection of a second carrier into a nanocrystal that has been previously programmed with a charge of the opposite sign.

  20. Colloidal synthesis of biocompatible iron disulphide nanocrystals.

    PubMed

    Santos-Cruz, J; Nuñez-Anita, R E; Mayén-Hernández, S A; Martínez-Alvarez, O; Acosta-Torres, L S; de la Fuente-Hernández, J; Campos-González, E; Vega-González, M; Arenas-Arrocena, M C

    2017-08-06

    The aim of this research was to synthesis biocompatible iron disulphide nanocrystals at different reaction temperatures using the colloidal synthesis methodology. Synthesis was conducted at the 220-240 °C range of reaction temperatures at intervals of 5 °C in an inert argon atmosphere. The toxicity of iron disulphide nanocrystals was evaluated in vitro using mouse fibroblast cell line. Two complementary assays were conducted: the first to evaluate cell viability of the fibroblast via an MTT assay and the second to determine the preservation of fibroblast nuclei integrity through DAPI staining, which labels nuclear DNA in fluorescence microscopes. Through TEM and HRTEM, we observed a cubic morphology of pyrite iron disulphide nanocrystals ranging in sizes 25-50 nm (225 °C), 50-70 nm (230 °C) and >70 nm (235 °C). Through X-ray diffraction, we observed a mixture of pyrite and pyrrohotite in the samples synthesized at 225 °C and 240 °C, showing the best photocatalytic activity at 80% and 65%, respectively, for the degradation of methylene blue after 120 minutes. In all experimental groups, iron disulphide nanocrystals were biocompatible, i.e. no statistically significant differences were observed between experimental groups as shown in a one-way ANOVA and Tukey's test. Based on all of these results, we recommend non-cytotoxic semiconductor iron sulphide nanocrystals for biomedical applications.