Sample records for paneb tri ja

  1. ADHD: Tips to Try


    ... How Can I Help a Friend Who Cuts? ADHD: Tips to Try KidsHealth > For Teens > ADHD: Tips to Try Print A A A Text Size en español TDAH: Consejos que puedes probar ADHD , or attention deficit hyperactivity disorder, is a medical ...

  2. Trying to Conceive


    ... español ) Trying to conceive Related information Basal body temperature chart (PDF, 555 KB) Ovulation and due date ... of your fertile times. They are: Basal body temperature method – Basal body temperature is your temperature at ...

  3. Try Another Way. Training Manual.

    ERIC Educational Resources Information Center

    Gold, Marc

    Intended for use in training conferences, the manual describes the philosophy and procedures of Try Another Way, an approach for teaching moderately, severely and profoundly mentally retarded persons and developmentally disabled persons difficult to train. An alternative definition of retardation is proposed which stresses level of functioning…

  4. Tri-state logic circuit

    NASA Technical Reports Server (NTRS)

    Pryor, Richard Lee (Inventor)


    A line driver including a pair of complementary transistors having their conduction paths serially connected between an operating and a reference potential and their bases connected through a first switch to a signal input terminal. A second switch is connected between the common base connection and the common connection of the conduction paths. With the second switch open and the first closed, an output voltage, responsive to the input signal, corresponding to first or second binary values is obtained. When the second switch is closed and the first opened, the transistor pair is turned off, disconnecting the line driver from its load, thereby providing tri-state logic operation.

  5. Analysis of bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF exchange rate within the scope of econophysics

    NASA Astrophysics Data System (ADS)

    Deviren, Bayram; Kocakaplan, Yusuf; Keskin, Mustafa; Balcılar, Mehmet; Özdemir, Zeynel Abidin; Ersoy, Ersan


    In this study, we analyze the Turkish Lira/US Dollar (TRY/USD), Turkish Lira/Euro (TRY/EUR), Turkish Lira/Japanese Yen (TRY/JPY) and Turkish Lira/Swiss Franc (TRY/CHF) exchange rates in the global financial crisis period to detect the bubbles and crashes in the TRY by using a mathematical methodology developed by Watanabe et al. (2007). The methodology defines the bubbles and crashes in financial market price fluctuations by considering an exponential fitting of the associated data. This methodology is applied to detect the bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF exchange rates from January, 1, 2005 to December, 20, 2013. In this mathematical methodology, the whole period of bubbles and crashes can be determined purely from past data, and the start of bubbles and crashes can be identified even before its bursts. In this way, the periods of bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF are determined, and the beginning and end points of these periods are detected. The results show that the crashes in the TRY/CHF exchange rate are commonly finished earlier than in the other exchange rates; hence it is probable that the crashes in the other exchange rates would be finished soon when the crashes in the TRY/CHF exchange rate ended. We also find that the periods of crashes in the TRY/EUR exchange rate take longer time than in the other exchange rates. This information can be used in risk management and/or speculative gain. The crashes' periods in the TRY/EUR and TRY/USD exchange rates are observed to be relatively longer than in the other exchange rates.

  6. Technology evaluation: TriGem, Titan.


    Razis, Evangelia; Fountzilas, George


    Titan (formerly Trilex) is developing TriGem, a monoclonal antibody directed against I17, for the potential treatment of advanced cancers that express the GD2 ganglioside, including melanoma, small-cell lung cancer, neuroblastoma and sarcoma. Phase II trials of TriGem for use in advanced melanoma were ongoing by June 2002. TriGem also has potential for the treatment of psoriasis, for which phase II trials had begun by 1996.

  7. TriKota v 1.0

    SciTech Connect



    The TriKota software is a library that allows the Dakota Optimization Toolkit to be easily accessed from a computer code that is already interfaced to the solution algorithms in the Trilinos framework. It is a class of code known as an adapter. TriKota also supplies examples so that new applications can quickly make use of it’s capabilities.The TriKota package is meant to enable more rapid development and a broader use of optimization and uncertainty quantification algorithms. As a general-purpose mathematical software, the uses will span many application areas that seek to perform computational design and analysis.

  8. TriKota v 1.0


    The TriKota software is a library that allows the Dakota Optimization Toolkit to be easily accessed from a computer code that is already interfaced to the solution algorithms in the Trilinos framework. It is a class of code known as an adapter. TriKota also supplies examples so that new applications can quickly make use of it’s capabilities.The TriKota package is meant to enable more rapid development and a broader use of optimization and uncertainty quantificationmore » algorithms. As a general-purpose mathematical software, the uses will span many application areas that seek to perform computational design and analysis.« less

  9. Try This: Umbrella--Materials Testing

    ERIC Educational Resources Information Center

    Preston, Christine


    This article is the second in "Teaching Science's" "Try This" series. These hands-on activities are designed especially for early childhood students to encourage their natural curiosity and promote development of scientific thinking. In this activity, the problem-based learning approach means that the children are engaged in a…

  10. Tri-District Arts Consortium Summer Program.

    ERIC Educational Resources Information Center

    Kirby, Charlotte O.


    The Tri-District Arts Consortium in South Carolina was formed to serve artistically gifted students in grades six-nine. The consortium developed a summer program offering music, dance, theatre, and visual arts instruction through a curriculum of intense training, performing, and hands-on experiences with faculty members and guest artists. (JDD)

  11. Synthesis of di-, tri- and tetracyclopropylhydrazines.


    Shestakov, Aleksandr N; Kuznetsov, Mikhail A


    Previously unknown 1,1-dicyclopropylhydrazine was obtained in two steps starting from dicyclopropylamine. It serves as a convenient starting material to tri- and tetracyclopropylhydrazines, which have not been described in the literature either. Tricyclopropylhydrazine was prepared in an overall four-step sequence featuring the de Meijere-Chaplinski modification of the Kulinkovich reaction as a key step. Tetracyclopropylhydrazine was obtained by the reductive amination of the cyclopropanone ethyl trimethylsilyl acetal with 1,1-dicyclopropylhydrazine or with the parent hydrazine. Synthetic utility of these cyclopropylhydrazine building blocks is presented as well. PMID:26734692

  12. Tri-bimaximal Mixing from Cascades

    SciTech Connect

    Takahashi, Ryo


    We investigate fermion mass matrices of the cascade form which lead to the tri-bimaximal mixing in the lepton sector. The cascade neutrino matrix predicts a parameter-independent relation among the observables, which are the neutrino mixing angles and mass squared differences. The relation predicts that the atmospheric neutrino mixing angle is close to maximal. We also study phenomenological aspect of the cascade form in supersymmetric theory, which are lepton flavor violation and thermal leptogenesis. A dynamical realivation of the cascade mass matrix are also presented in U(1) flavor theory.

  13. A Transgenic Tri-Modality Reporter Mouse

    PubMed Central

    Yan, Xinrui; Ray, Pritha; Paulmurugan, Ramasamy; Tong, Ricky; Gong, Yongquan; Sathirachinda, Ataya; Wu, Joseph C.; Gambhir, Sanjiv S.


    Transgenic mouse with a stably integrated reporter gene(s) can be a valuable resource for obtaining uniformly labeled stem cells, tissues, and organs for various applications. We have generated a transgenic mouse model that ubiquitously expresses a tri-fusion reporter gene (fluc2-tdTomato-ttk) driven by a constitutive chicken β-actin promoter. This “Tri-Modality Reporter Mouse” system allows one to isolate most cells from this donor mouse and image them for bioluminescent (fluc2), fluorescent (tdTomato), and positron emission tomography (PET) (ttk) modalities. Transgenic colonies with different levels of tri-fusion reporter gene expression showed a linear correlation between all three-reporter proteins (R2=0.89 for TdTomato vs Fluc, R2=0.94 for Fluc vs TTK, R2=0.89 for TdTomato vs TTK) in vitro from tissue lysates and in vivo by optical and PET imaging. Mesenchymal stem cells (MSCs) isolated from this transgenics showed high level of reporter gene expression, which linearly correlated with the cell numbers (R2=0.99 for bioluminescence imaging (BLI)). Both BLI (R2=0.93) and micro-PET (R2=0.94) imaging of the subcutaneous implants of Tri-Modality Reporter Mouse derived MSCs in nude mice showed linear correlation with the cell numbers and across different imaging modalities (R2=0.97). Serial imaging of MSCs transplanted to mice with acute myocardial infarction (MI) by intramyocardial injection exhibited significantly higher signals in MI heart at days 2, 3, 4, and 7 (p<0.01). MSCs transplanted to the ischemic hindlimb of nude mice showed significantly higher BLI and PET signals in the first 2 weeks that dropped by 4th week due to poor cell survival. However, laser Doppler perfusion imaging revealed that blood circulation in the ischemic limb was significantly improved in the MSCs transplantation group compared with the control group. In summary, this mouse can be used as a source of donor cells and organs in various research areas such as stem cell research

  14. Try-in Pastes Versus Resin Cements: A Color Comparison.


    Vaz, Edenize Cristina; Vaz, Maysa Magalhães; Rodrigues Gonçalves de Oliveira, Maria Beatriz; Takano, Alfa Emília; de Carvalho Cardoso, Paula; de Torres, Érica Miranda; Gonzaga Lopes, Lawrence


    This study aimed to compare the color of ceramic veneer restorations using different shades of try-in pastes and resin cement. Researchers found no differences between try-in pastes and resin cements after cementation. PMID:27213935

  15. Characterization of Tri-lab Tantalum Plate.

    SciTech Connect

    Buchheit, Thomas E.; Cerreta, Ellen K.; Deibler, Lisa Anne; Chen, Shu-Rong; Michael, Joseph R.


    This report provides a detailed characterization Tri-lab Tantalum (Ta) plate jointly purchased from HCStark Inc. by Sandia, Los Alamos and Lawrence Livermore National Laboratories. Data in this report was compiled from series of material and properties characterization experiments carried out at Sandia (SNL) and Los Alamos (LANL) Laboratories through a leveraged effort funded by the C2 campaign. Results include microstructure characterization detailing the crystallographic texture of the material and an increase in grain size near the end of the rolled plate. Mechanical properties evaluations include, compression cylinder, sub-scale tension specimen, micohardness and instrumented indentation testing. The plate was found to have vastly superior uniformity when compare with previously characterized wrought Ta material. Small but measurable variations in microstructure and properties were noted at the end, and at the top and bottom edges of the plate.

  16. Development and evaluation of WillTry: An instrument for measuring children’s willingness to try fruits and vegetables

    Technology Transfer Automated Retrieval System (TEKTRAN)

    This paper describes the development and evaluation of the WillTry instrument, a psychometric tool, designed to measure children’s willingness to try fruits and vegetables. WillTry surveys were interviewer-administered to 284 children in an elementary school, and in summer day camps located in rura...

  17. Tri-Center Analysis: Determining Measures of Trichotomous Central Tendency for the Parametric Analysis of Tri-Squared Test Results

    ERIC Educational Resources Information Center

    Osler, James Edward


    This monograph provides an epistemological rational for the design of a novel post hoc statistical measure called "Tri-Center Analysis". This new statistic is designed to analyze the post hoc outcomes of the Tri-Squared Test. In Tri-Center Analysis trichotomous parametric inferential parametric statistical measures are calculated from…

  18. Still confusing, TRI reporting requires careful organization

    SciTech Connect

    Costa, R. )


    Since 1988, Sec. 313 of the Emergency Planning and Community Right-to-Know Act (EPCRA) has required manufacturing facilities to report annually on toxic chemical releases and offsite transfers of more than 300 toxic chemicals above certain threshold quantities. EPCRA, a stand-alone regulation that also is incorporated in SARA as Title III, mandates that only facilities whose primary business is manufacturing products for commercial use report under the Toxic Chemical Release Inventory (TRI) program. The list of regulated chemicals is dynamic. A petition process allows anyone to request additions or deletions from the chemical list, based on established toxicity criteria. The criteria involve health effects -- including evidence of reproductive dysfunction, neurological disorders, heritable genetic mutations, cancer, and teratogenic and other effects -- as well as significant adverse impacts to the environment. EPA must respond within 180 days to a petition, and any changes to the list must be promulgated under federal regulatory procedures. A petition submitted by a state governor becomes law if EPA fails to act within 180 days.

  19. Toxic release inventory, (TRI), 1991. Data file

    SciTech Connect


    Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act of 1986 (Public Law 99-499) requires EPA to establish a national inventory of toxic chemical emissions from certain facilities. The final Toxic Chemical Release Form R and regulations for the 1987 reporting year were published in the Federal Register on February 16, 1988 (53 FR 4500-4554). The reporting requirement applies to owners and operators of facilities that have 10 or more full-time employees, that are in Standard Industrial Classification (SIC) codes 20 through 39 (i.e., manufacturing facilities) and that manufacture (including importing), process or otherwise use a listed toxic chemical in excess of specified threshold quantities. The law mandates that the data be made publicly available through a computer database. The online TRI file should appeal to a broad-based user audience including industry, state and local environmental agencies, emergency planning committees, the Federal Government and other regulatory groups.

  20. PyTRiP - a toolbox and GUI for the proton/ion therapy planning system TRiP

    NASA Astrophysics Data System (ADS)

    Toftegaard, J.; Petersen, J. B.; Bassler, N.


    Purpose: Only very few treatment planning systems (TPS) are capable of handling heavy ions. Commercial heavy ion TPS are costly and normally restrict the possibility to implement new functionalities. PyTRiP provides Python bindings and a platform-independent graphical user interface (GUI) for the heavy ion treatment program TRiP, and adds seamless support of DICOM files. We aim to provide a front-end for TRiP which does not require any special computer skills. Methods: PyTRiP is written in Python combined with C for fast computing. Routines for DICOM file import/export to TRiPs native file format are implemented. The GUI comes as an executable with all its dependencies including PyTRiP making it easy to install on Windows, Mac and Linux. Results: PyTRiP is a comprehensive toolbox for handling TRiP. Treatment plans are handled using an object oriented structure. Bindings to TRiP (which only runs on Linux, either locally or on a remote server) are performed through a single function call. GUI users can intuitively create treatment plans without much knowledge about the TRiP user interface. Advanced users still have full access to all TRiP functionality. The user interface comes with a comprehensive plotting tool, which can visualize 2D contours, volume histograms, as well as dose- and linear energy transfer (LET) distributions. Conclusion: We developed a powerful toolbox for ion therapy research using TRiP as backend. The corresponding GUI allows to easily and intuitively create, calculate and visualize treatment plans. TRiP is thereby more accessible and simpler to use.

  1. Bismuth tri-iodide radiation detector development

    NASA Astrophysics Data System (ADS)

    Gokhale, Sasmit S.

    Bismuth tri-iodide is an attractive material for room temperature radiation detection. BiI3 demonstrates a number of properties that are apt for semiconductor radiation detection, especially gamma ray spectroscopy. The high atomic number (ZBi = 83 and ZI = 53) and the relatively high density (5.78 g/cm3) cause the material to have good photon stopping power, while the large band-gap (1.67 eV ) allows it to function as a room temperature radiation detector without any cooling mechanism. This work presents the fabrication and characterization of BiI3 radiation detectors. For the purpose of this research detectors were fabricated by cutting BiI3 crystal boules, followed by mechanical and chemical surface treatments. Detectors with various electrode geometries enabling single polarity charge sensing were fabricated. The electrical characteristics and the radiation response of the detectors were measured. The radiation response measurement was performed at room temperature using a 241Am alpha particle source and a 241Am sealed gamma-ray source. The spectral resolutions of the detectors varied from 2.09% - 6.1% for 59.5 keV gamma-rays and between 26% - 40% for 5.48 MeV alpha particles. Charge carrier properties such as the electron and hole mobility and lifetime were also estimated. The electron mobility for an ultrapure BiI 3 detector was estimated to be approximately 433 cm 2/Vs while that for antimony doped BiI3 was estimated to be around 956 cm2/Vs and the mobility-lifetime product for electrons was estimated to be around 5.44 x 10-4 cm 2/V. Detector simulation was performed using the Monte Carlo simulation code MCNP5. A Matlab script which incorporates charge carrier trapping and statistical variation was written to generate a gamma-ray spectrum from the simulated energy deposition spectra. Measured and simulated spectra were compared to extract the charge carrier mobility-lifetime products, which for electrons and holes were estimated to be 5 x 10-3 cm2/V and 1.3 x

  2. Topological field theory for 2+1 TRI TSC

    NASA Astrophysics Data System (ADS)

    Gu, Yingfei; Qi, Xiaoliang


    Time-reversal invariant topological superconductors (TRI TSC) are gapped TRI superconductors with topologically robust gapless modes on the boundary. In the work by X. L. Qi et al, [PRB, 87, 134519(2013)], a topological field theory description was proposed for 3+1-dimensional TRI TSC, which contains an axionic coupling between superconducting phase and electromagnetic field. In my talk, I will describe a generalization of this theory to the 2+1 dimensional TRI TSC. The 2+1d topological field theory describes a topological coupling between electromagnetic field, superconducting phase fluctuation and magneto-electric polarization. I will also talk about the corresponding physical consequences.

  3. Tri-Cities Index of Innovation and Technology

    SciTech Connect

    Fowler, Richard A.; Scott, Michael J.; Butner, Ryan S.


    In 2001 and 2004, the Economic Development Office of Pacific Northwest National Laboratory published companion reports to the Washington Technology Center Index studies that provided additional information on the Tri-Cities (Kennewick-Richland-Pasco) area of the state, its technology businesses, and important advantages that the Tri-Cities have as places to live and do business. These reports also compared the Tri-Cities area to other technology-based metropolitan areas in the Pacific Northwest and nation along critical dimensions known to be important to technology firms. This report updates the material in these earlier reports, and highlights a growing Tri-Cities metropolitan area.

  4. Case Study: Tri-County Regional Vocational Technical High School.

    ERIC Educational Resources Information Center

    Southern Regional Education Board, Atlanta, GA.

    Tri-County Regional Vocational Technical High School, which is located in the rural New England town of Franklin, Massachusetts, is a school of "choice" that students elect to attend. All of the school's 850 students must have a career/technical focus for their studies. Most of Tri-County's ninth-graders are unprepared for high school, and 38%…

  5. Financial Statement Audit Report of Tri-County Community College.

    ERIC Educational Resources Information Center

    Campbell, Ralph

    This report presents the results of the Tri-County Community College financial statement audit for the fiscal year ending on June 30, 1998. Tri-County Community College is a component of the State of North Carolina, thus the authority to audit is granted by Article 5A of G.S. 147. The accounts and operations of the institution were subject to…

  6. TriBITS (Tribal Build, Integrate, and Test System)

    SciTech Connect


    TriBITS is a configuration, build, test, and reporting system that uses the Kitware open-source CMake/CTest/CDash system. TriBITS contains a number of custom CMake/CTest scripts and python scripts that extend the functionality of the out-of-the-box CMake/CTest/CDash system.

  7. GIS modeling of air toxics releases from TRI-reporting and non-TRI-reporting facilities: impacts for environmental justice.


    Dolinoy, Dana C; Miranda, Marie Lynn


    The Toxics Release Inventory (TRI) requires facilities with 10 or more full-time employees that process > 25,000 pounds in aggregate or use > 10,000 pounds of any one TRI chemical to report releases annually. However, little is known about releases from non-TRI-reporting facilities, nor has attention been given to the very localized equity impacts associated with air toxics releases. Using geographic information systems and industrial source complex dispersion modeling, we developed methods for characterizing air releases from TRI-reporting as well as non-TRI-reporting facilities at four levels of geographic resolution. We characterized the spatial distribution and concentration of air releases from one representative industry in Durham County, North Carolina (USA). Inclusive modeling of all facilities rather than modeling of TRI sites alone significantly alters the magnitude and spatial distribution of modeled air concentrations. Modeling exposure receptors at more refined levels of geographic resolution reveals localized, neighborhood-level exposure hot spots that are not apparent at coarser geographic scales. Multivariate analysis indicates that inclusive facility modeling at fine levels of geographic resolution reveals exposure disparities by income and race. These new methods significantly enhance the ability to model air toxics, perform equity analysis, and clarify conflicts in the literature regarding environmental justice findings. This work has substantial implications for how to structure TRI reporting requirements, as well as methods and types of analysis that will successfully elucidate the spatial distribution of exposure potentials across geographic, income, and racial lines. PMID:15579419

  8. Factors that contribute to the willingness to try "street hypnosis".


    Davis, Orin C; Gao, Xuan


    This study takes a context-specific approach to examine people's willingness to try hypnosis under various conditions and the factors that contribute to their willingness. It examined 378 participants, who completed a web-based hypnosis survey. The results showed that people's willingness to try hypnosis varies by context. Specifically, people are more willing to try hypnosis when it is framed as "peak focus" rather than "hypnosis" and when they perceive the environment as being safer. Moreover, factors including participants' demographics, hypnotists' demographics (relative to the subjects'), participants' control bias, and knowledge of hypnosis affect people's degrees of willingness to try hypnosis, depending on the specific context. The results suggest further analysis of hypnosis occurring in public contexts and the effects it may have on attitudes and therapeutic outcomes.

  9. 77 FR 52309 - Tri County Resource Advisory Committee

    Federal Register 2010, 2011, 2012, 2013, 2014


    .... ACTION: Notice of meeting. SUMMARY: The Tri County Resource Advisory Committee will meet in Deer Lodge... meeting will be held at 1002 Hollenback Road, Deer Lodge, Montana at the USDA Service Center...

  10. Adolescent Males’ Awareness of and Willingness to Try Electronic Cigarettes

    PubMed Central

    Pepper, Jessica K.; Reiter, Paul L.; McRee, Annie-Laurie; Cameron, Linda D.; Gilkey, Melissa B.; Brewer, Noel T.


    Purpose Electronic cigarettes (e-cigarettes) are a new type of device that delivers vaporized nicotine without the tobacco combustion of regular cigarettes. We sought to understand awareness of and willingness to try e-cigarettes among adolescent males, a group that is at risk for smoking initiation and may use e-cigarettes as a “gateway” to smoking. Methods A national sample of 11–19-year-old males (n =228) completed an online survey in November 2011. We recruited participants through their parents, who were members of a panel of U.S. households constructed using random-digit dialing and addressed-based sampling. Results Only two participants (< 1%) had previously tried e-cigarettes. Among those who had not tried e-cigarettes, most (67%) had heard of them. Awareness was higher among older and non- Hispanic adolescents. Nearly 1 in 5 (18%) participants were willing to try either a plain or flavored e-cigarette, but willingness to try plain versus flavored varieties did not differ. Smokers were more willing to try any e-cigarette than nonsmokers (74% vs. 13%; OR 10.25, 95% CI 2.88, 36.46). Nonsmokers who had more negative beliefs about the typical smoker were less willing to try e-cigarettes (OR .58, 95% CI .43, .79). Conclusions Most adolescent males were aware of e-cigarettes, and a substantial minority were willing to try them. Given that even experimentation with e-cigarettes could lead to nicotine dependence and subsequent use of other tobacco products, regulatory and behavioral interventions are needed to prevent “gateway” use by adolescent nonsmokers. Campaigns promoting negative images of smokers or FDA bans on sales to youth may help deter use. PMID:23332477

  11. TriG: Next Generation Scalable Spaceborne GNSS Receiver

    NASA Technical Reports Server (NTRS)

    Tien, Jeffrey Y.; Okihiro, Brian Bachman; Esterhuizen, Stephan X.; Franklin, Garth W.; Meehan, Thomas K.; Munson, Timothy N.; Robison, David E.; Turbiner, Dmitry; Young, Lawrence E.


    TriG is the next generation NASA scalable space GNSS Science Receiver. It will track all GNSS and additional signals (i.e. GPS, GLONASS, Galileo, Compass and Doris). Scalable 3U architecture and fully software and firmware recofigurable, enabling optimization to meet specific mission requirements. TriG GNSS EM is currently undergoing testing and is expected to complete full performance testing later this year.

  12. Tri-Cities research may help biofuels take flight

    SciTech Connect

    Madison, Alison L.


    Monthly economic diversity column for the Tri-City Herald. Excerpt: If you stop and think about it, some pretty interesting stuff has roots in the Tri-Cities, but reaches far beyond. Many Tri-Citians have gone on to be professional athletes, entertainers, scientists and engineers, doctors, lawyers, and humanitarians to name just a few. And a lot of groundbreaking discoveries - many born of strategic collaborations resulting from purposeful economic development efforts - have emerged from work at our local national laboratory. Just recently, Pacific Northwest National Laboratory entered into a $2M collaboration with Seattle biofuel producer Imperium Renewables and other partners to develop a new method to make renewable jet fuels. Successful development of the catalytic process, which converts biomass-based alcohols into renewable drop-in jet fuels, could lead to additional renewable jet fuel production facilities being built and operated in the Pacific Northwest.

  13. A Theoretical Analysis of the English "Try and V" Construction

    ERIC Educational Resources Information Center

    Tsuchida, Takehiro


    Examining grammatically idiosyncratic English expressions often helps reveal not only to ESL (English as a second language) teachers and learners but also to experts on English how intricately language is composed. This paper aims to expound one such idiomatic expression of the "try and V" construction by exploring the phenomenon from diverse…

  14. As Students Scatter Online, Colleges Try to Keep Up

    ERIC Educational Resources Information Center

    Mangan, Katherine


    While e-mail remains the official method of communication on most campuses, colleges are expanding their presence in the virtual world, trying to reach students where they hang out. But without careful planning, that can lead to a scattershot approach as new platforms keep popping up and students' attention becomes increasingly dispersed. The…

  15. The Food Friends: Encouraging Preschoolers to Try New Foods

    ERIC Educational Resources Information Center

    Bellows, Laura; Anderson, Jennifer


    In response to concerns about children's eating behaviors, the Colorado Nutrition Network developed and tested Food Friends--Making New Foods Fun for Kids. The program was designed as a 12-week social marketing campaign aimed at encouraging preschool-age children to try new foods, such as Ugli Fruit, couscous, and daikon radish. Tasting novel…

  16. Queens Tri-School Confederation, 1991-92 Evaluation Report.

    ERIC Educational Resources Information Center

    Hannah, Susan; Dworkowitz, Barbara

    An evaluation was done of the Queens Tri-School Confederation, three high schools in the New York City Public Schools funded by a federal grant from the Magnet Schools Assistance Program. The grant provided Hillcrest, Jamaica, and Thomas A. Edison High Schools with funds to develop or expand emergency technician programs at Hillcrest; a law…

  17. Development and characterization of solid solution tri-carbides

    NASA Astrophysics Data System (ADS)

    Knight, Travis; Anghaie, Samim


    Solid-solution, binary uranium/refractory metal carbide fuels have been shown to be capable of performing at high temperatures for nuclear thermal propulsion applications. More recently, tri-carbide fuels such as (U, Zr, Nb)C1+x with less than 10% metal mole fraction uranium have been studied for their application in ultra-high temperature, high performance space nuclear power systems. These tri-carbide fuels require high processing temperatures greater than 2600 K owing to their high melting points in excess of 3600 K. This paper presents the results of recent studies involving hypostoichiometric, single-phase tri-carbide fuels. Processing techniques of cold uniaxial pressing and sintering were investigated to optimize the processing parameters necessary to produce high density (low porosity), single phase, solid solution mixed carbide nuclear fuels for testing. Scanning electron microscopy and xray diffraction were used to analyze samples. Liquid phase sintering with UC1+x at temperatures near 2700 K was shown to be instrumental in achieving good densification in hyper- and near-stoichiometric mixed carbides. Hypostoichiometric carbides require even higher processing temperatures greater than 2800 K in order to achieve liquid phase sintering with a UC liquid phase and good densification of the final solid solution, tri-carbide fuel. .

  18. Tri-Offer Arbitration as a Bargaining Dispute Resolution Technique.

    ERIC Educational Resources Information Center

    Gallagher, Daniel G.


    Iowa's four-year experience with "tri-offer" final offer arbitration in teacher-school board negotiations--in which an arbitrator chooses among the teachers', the board's, and the factfinder's offers--shows that the process encourages voluntary settlements but does not keep the two sides from taking unrealistic bargaining positions. (RW)

  19. DECS tries out instructional materials on AIDS prevention education.



    A national try-out of the newly developed print and non-print instructional materials on AIDS Education is being conducted by the Department of Education, Culture and Sports (DECS) this school year 1993-to 1994. To determine the effectiveness of these materials, various public and private schools in Region IV (Southern Tagalog), VII (Central Visayas) XI (Southern Mindanao) and National Capital Region (Metro, Manila) were chosen as try-out institutions. The AIDS education materials will be tried out in different subjects in some grade and year levels such as civics and culture (grade one); science and health (grades three and six); home economics and livelihood education (grade five); physical education, health and music (second year) and Pilipino Language (third year). The materials for the elementary level consist of posters, cut-out pictures, voice tapes, jingles, talking books and slides, while the secondary school level utilizes modules. For the tertiary level, a Resource Book on AIDS Prevention Education is used by the Teacher Training Institutions and the Non-Formal Education employs the Facilitator's Guide for Levels I-III. These materials will be tried out in both urban and rural schools, with control school and experimental school at each level.

  20. TRiC’s tricks inhibit huntingtin aggregation

    PubMed Central

    Shahmoradian, Sarah H; Galaz-Montoya, Jesus G; Schmid, Michael F; Cong, Yao; Ma, Boxue; Spiess, Christoph; Frydman, Judith; Ludtke, Steven J; Chiu, Wah


    In Huntington’s disease, a mutated version of the huntingtin protein leads to cell death. Mutant huntingtin is known to aggregate, a process that can be inhibited by the eukaryotic chaperonin TRiC (TCP1-ring complex) in vitro and in vivo. A structural understanding of the genesis of aggregates and their modulation by cellular chaperones could facilitate the development of therapies but has been hindered by the heterogeneity of amyloid aggregates. Using cryo-electron microscopy (cryoEM) and single particle cryo-electron tomography (SPT) we characterize the growth of fibrillar aggregates of mutant huntingtin exon 1 containing an expanded polyglutamine tract with 51 residues (mhttQ51), and resolve 3-D structures of the chaperonin TRiC interacting with mhttQ51. We find that TRiC caps mhttQ51 fibril tips via the apical domains of its subunits, and also encapsulates smaller mhtt oligomers within its chamber. These two complementary mechanisms provide a structural description for TRiC’s inhibition of mhttQ51 aggregation in vitro. DOI: PMID:23853712

  1. Cholesterol complexes with tri-n-butylphosphate, tri-n-octylamine and cyclohexanone in chlorinated hydrocarbon solvents.


    Senegacnik, Marjan; Klofutar, Cveto


    The hydrogen bonding interactions of moderately associated cholesterol with tri-n-butylphosphate, tri-n-octylamine and cyclohexanone in dilute solutions of tetrachloromethane, 1,2-dichloroethane and trichloromethane were studied by conventional IR spectroscopy. Information on the stoichiometry of the complexes formed was derived from least squares plots of the linearized expressions of Bjerrum's degree of system formation. The formation constants of the complexes were also determined in this way. The spectra recorded in the OH region from 3100 to 3700 cm-1 were resolved in to the bands of the cholesterol species and the complexes formed. The complexes responsible for the observed bands were recognized from the dependence of their intensity on cholesterol monomer and free base concentration and from their frequency locations. The presence of the complexes B...HO(R) and B...HO(R)...HO(R) with tri-n-butylphosphate and tri-n-octylamine was established in all of the solutions and also for the system cholesterol+cyclohexanone in 1,2-dichloroethane. On the other hand, for cholesterol bonding to cyclohexanone in tetrachloromethane, the model considering complexes with 3:1 and 1:1 stoichiometry seemed the most appropriate.

  2. Tri-band microstrip antenna design for wireless communication applications

    NASA Astrophysics Data System (ADS)

    Sami, Gehan; Mohanna, Mahmoud; Rabeh, Mohamed L.


    This paper introduces a novel rectangular tri-band patch antenna that is fabricated and measured for wireless communication systems. The introduced antenna is designed for WLAN and WiMAX applications. The desired tri-band operation was obtained by proper loading for a rectangular patch antenna using slots and shorting pins. The optimal location and dimension for the loaded elements were obtained with the aid of interfacing a Genetic Algorithm (GA) model with an Ansoft High Frequency Structural Simulator (HFSS). The results obtained from our simulated antenna show 5.8% impedance matching band width at 2.4 GHz, 3.7% at 3.5 GHz and 1.57% at 5.7 GHz. In addition, an equivalent circuit of the proposed antenna is introduced using the least square curve fitting optimization technique.

  3. Development of the Tri-ATHLETE Lunar Vehicle Prototype

    NASA Technical Reports Server (NTRS)

    Heverly, Matt; Matthews, Jaret; Frost, Matt; Quin, Chris


    The Tri-ATHLETE (All Terrain Hex Limed Extra Terrestrial Explorer) vehicle is the second generation of a wheel-on-limb vehicle being developed to support the return of humans to the lunar surface. This paper describes the design, assembly, and test of the Tri-ATHLETE robotic system with a specific emphasis on the limb joint actuators. The design and implementation of the structural components is discussed, and a novel and low cost approach to approximating flight-like cabling is also presented. The paper concludes with a discussion of the "second system effect" and other lessons learned as well as results from a three week long field trial of the vehicle in the Arizona desert.

  4. 108. Doughton Park Recreation Area Comfort Station. Instead of trying ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    108. Doughton Park Recreation Area Comfort Station. Instead of trying to hide this building, it was decided to let it be seen. A salt box design reflecting a mountain building was chosen, it had a sloping split shingle roof matching the hill side with a front porch placed on the lower side. - Blue Ridge Parkway, Between Shenandoah National Park & Great Smoky Mountains, Asheville, Buncombe County, NC

  5. Decontamination of tried-in orthodontic molar bands.


    Fulford, M R; Ireland, A J; Main, B G


    Molar bands are commonly used to retain orthodontic attachments on posterior teeth and due to the variation in the size of such teeth, it is usually necessary to 'try in' several bands before the correct one is selected. A possible concern with re-using such bands is the lack of cross-infection control, even following autoclaving, due to the presence of one or more small bore lumen (the archwire and headgear tubes). The aim of this experiment was, therefore, to determine whether such bands could be successfully decontaminated so that they could be re-used without a cross-infection risk. Two hundred orthodontic molar bands that had previously been tried in patients' mouths, but not cemented into place, were tested. Each band was decontaminated using an enzymatic cleaner/disinfectant and then sterilized using either a downward displacement (n = 100) or a vacuum cycle autoclave (n = 100). Following autoclaving each band was inoculated into brain heart infusion culture broth and incubated at 37 degrees C for 5 days. None of the decontaminated bands exhibited growth after 5 days. It would appear that, using this methodology, there is little risk of a cross-infection hazard occurring with the re-use of previously tried-in and decontaminated molar bands.

  6. Tri-layered elastomeric scaffolds for engineering heart valve leaflets

    PubMed Central

    Masoumi, Nafiseh; Annabi, Nasim; Assmann, Alexander; Larson, Benjamin L.; Hjortnaes, Jesper; Alemdar, Neslihan; Kharaziha, Mahshid; Manning, Keefe B.; Mayer, John E.; Khademhosseini, Ali


    Tissue engineered heart valves (TEHVs) that can grow and remodel have the potential to serve as permanent replacements of the current non-viable prosthetic valves particularly for pediatric patients. A major challenge in designing functional TEHVs is to mimic both structural and anisotropic mechanical characteristics of the native valve leaflets. To establish a more biomimetic model of TEHV, we fabricated tri-layered scaffolds by combining electrospinning and microfabrication techniques. These constructs were fabricated by assembling microfabricated poly(glycerol sebacate) (PGS) and fibrous PGS/poly(-caprolactone) (PCL) electrospun sheets to develop elastic scaffolds with tunable anisotropic mechanical properties similar to the mechanical characteristics of the native heart valves. The engineered scaffolds supported valvular interstitial cells (VICs) and mesenchymal stem cells (MSCs) growth within the 3D structure and promoted the deposition of heart valve extracellular matrix (ECM). MSCs were also organized and aligned along the anisotropic axes of the engineered tri-layered scaffolds. In addition, the fabricated constructs opened and closed properly in an ex vivo model of porcine heart valve leaflet tissue replacement. The engineered tri-layered scaffolds have the potential for successful translation towards TEHV replacements. PMID:24947233

  7. Breaking Tri-Bimaximal Mixing and Large θ13

    NASA Astrophysics Data System (ADS)

    Shimizu, Y.; Tanimoto, M.; Watanabe, A.


    The long baseline neutrino experiment, T2K, and the reactor experiment, Double Chooz will soon present new data. If we expect sinθ_{13} to be 0.1 - 0.2, which is close to the present experimental upper bound, we should not persist in the paradigm of the tri-bimaximal mixing. We discuss breaking the tri-bimaximal mixing by adding a simple mass matrix, which could be derived from some non-Abelian discrete symmetries. It is found that sinθ_{13} = 0.1 - 0.2 is expected in our model independent analysis of the generalized mass matrix for the normal or inverted hierarchical neutrino mass spectrum. On the other hand, sin^2θ_{23} and sin^2θ_{12} are expected to be not far from 1/2 and 1/3, respectively. As a typical example, we also discuss the A_4 flavor model with the 1 and 1' flavons, which break the tri-bimaximal mixing considerably. In this modified version of the Altarelli and Feruglio model, sinθ_{13} is predicted to be around 0.15 in the case of the normal hierarchical neutrino masses m_3 ≫ m_2, m_1, and 0.2 in the case of the inverted hierarchy m_3 ≪ m_2, m_1. The form of the neutrino mass matrix looks rather interesting -- it is suggestive of other discrete symmetries as well.

  8. Government action on diabetes prevention: time to try something new.


    Kaldor, Jenny C; Magnusson, Roger S; Colagiuri, Stephen


    Type 2 diabetes mellitus, driven by overweight and obesity linked to unhealthy diets, is the fastest-growing non-communicable disease in Australia. Halting the rise of diabetes will require a paradigm shift from personal to shared responsibility, with greater accountability from Australian governments and the food industry. It will also require governments to try something different to the prevailing approaches emphasising education and the provision of information. We propose four priority areas where government regulation could strengthen Australia's response. Those areas relate to mandatory front-of-pack food labelling, regulating junk food advertising, better oversight of food reformulation and taxing sugar-sweetened beverages. PMID:26068689

  9. Tri-functional cannula for retinal endovascular surgery


    Weiss, Jonathan D.


    A tri-functional cannula combines the functions of tissue Plasminogen Activator (tPA) solution delivery, illumination and venous pressure measurement. The cannula utilizes a tapered hollow-core optical fiber having an inlet for tPA solution, an attached fiber optic splitter configured to receive illumination light from an optical source such and a LED. A window in the cannula transmits the light to and from a central retinal vein. The return light is coupled to an optical detector to measure the pressure within the vein and determine whether an occlusion has been removed.

  10. An innovative tri-directional broadband piezoelectric energy harvester

    SciTech Connect

    Su, Wei-Jiun Zu, Jean


    This paper presents a tri-directional piezoelectric energy harvester that is able to harvest vibration energy over a wide bandwidth from three orthogonal directions. The harvester consists of a main beam, an auxiliary beam, and a spring-mass system, with magnets integrated to introduce nonlinear force and couple the three sub-systems. Theoretical analysis and experiments were performed at constant acceleration under frequency sweeps to acquire frequency responses. The experimental results show that the voltage can achieve more than 2 V over more than 5 Hz of bandwidth with 1 MΩ load in the three orthogonal directions.

  11. Tri-Party Agreement databases, access mechanism and procedures

    SciTech Connect

    Brulotte, P.J.; Christensen, K.C.


    This document contains the information required for the Washington State Department of Ecology (Ecology) and the US Environmental Protection Agency (EPA) to access databases related to the Hanford Federal Facility Agreement and Consent Order [also known as the Tri-Party Agreement (TPA)] (Ecology et al. 1992). It identifies the procedure required to obtain access to the Hanford computer networks and the TPA related databases. It addresses security requirements, access methods, database availability dates, database access procedures, and the minimum computer hardware and software configurations required to operate within the Hanford networks.

  12. Parametric design of tri-axial nested Helmholtz coils

    SciTech Connect

    Abbott, Jake J.


    This paper provides an optimal parametric design for tri-axial nested Helmholtz coils, which are used to generate a uniform magnetic field with controllable magnitude and direction. Circular and square coils, both with square cross section, are considered. Practical considerations such as wire selection, wire-wrapping efficiency, wire bending radius, choice of power supply, and inductance and time response are included. Using the equations provided, a designer can quickly create an optimal set of custom coils to generate a specified field magnitude in the uniform-field region while maintaining specified accessibility to the central workspace. An example case study is included.

  13. An innovative tri-directional broadband piezoelectric energy harvester

    NASA Astrophysics Data System (ADS)

    Su, Wei-Jiun; Zu, Jean


    This paper presents a tri-directional piezoelectric energy harvester that is able to harvest vibration energy over a wide bandwidth from three orthogonal directions. The harvester consists of a main beam, an auxiliary beam, and a spring-mass system, with magnets integrated to introduce nonlinear force and couple the three sub-systems. Theoretical analysis and experiments were performed at constant acceleration under frequency sweeps to acquire frequency responses. The experimental results show that the voltage can achieve more than 2 V over more than 5 Hz of bandwidth with 1 MΩ load in the three orthogonal directions.

  14. Design Documentation for JaWE2Openflow Project

    SciTech Connect

    Mehta, N; Barter, R H


    Lawrence Livermore National Laboratory (LLNL) has chosen CIGNEX Technologies, Inc. (CIGNEX) to design and develop the JaWE2Openflow conversion software. This document was created by CIGNEX as a project deliverable.

  15. RuBPCase activase mediates growth-defense tradeoffs: Silencing RCA redirects JA flux from JA-Ile to MeJA to attenuate induced defense responses in Nicotiana attenuata

    PubMed Central

    Mitra, Sirsha; Baldwin, Ian T.


    Summary RuBPCase activase (RCA), an abundant photosynthetic protein is strongly down-regulated in response to Manduca sexta’s oral secretion (OS) in Nicotiana attenuata. RCA-silenced plants are impaired not only in photosynthetic capacity and growth, but also in jasmonic acid (JA)-isoleucine (Ile) signaling, and herbivore resistance mediated by JA-Ile dependent defense traits. These responses are consistent with a resource-based growth-defense trade-off. Since JA+Ile-supplementation of OS restored WT levels of JA-Ile, defenses and resistance to M. sexta, but OS supplemented individually with JA- or Ile did not, the JA-Ile deficiency of RCA-silenced plants could not be attributed to lower JA or Ile pools or JAR4/6 conjugating activity. Similar levels of JA-Ile derivatives after OS elicitation indicated unaltered JA-Ile turnover and lower levels of other JA-conjugates ruled out competition from other conjugation reactions. RCA-silenced plants accumulated more methyl jasmonate (MeJA) after OS elicitation, which corresponded with increased jasmonate methyltransferase (JMT) activity. RCA-silencing phenocopies JMT over-expression, wherein elevated JMT activity redirects OS-elicited JA flux towards inactive MeJA, creating a JA sink which depletes JA-Ile and its associated defense responses. Hence RCA plays an additional non-photosynthetic role in attenuating JA-mediated defenses and their associated costs potentially allowing plants to anticipate resource-based constraints on growth before they actually occur. PMID:24491116

  16. A magnetic tri-enzyme nanobiocatalyst for fruit juice clarification.


    Sojitra, Uttam V; Nadar, Shamraja S; Rathod, Virendra K


    The major complications in fruit juice quality improvement are the presence of polysaccharides components in the form of disrupted fruit cell wall and cell materials. Hence, breakdown of cellulose along with pectin and starch is important for the juice processing. In this context, magnetic tri-enzyme nanobiocatalyst was prepared by simultaneously co-immobilizing three enzymes; α-amylase, pectinase and cellulase onto amino-functionalized magnetic nanoparticle by 60mM glutaraldehyde concentration with 10h cross-linking time for one pot juice clarification. The prepared nanobiocatalyst was characterized by FT-IR, SEM and XRD. The thermal (50-70°C) and pH (3-6) stability studies indicated more than two folds increment in half-life and enhanced tolerance to lower pH. The immobilized enzymes retained up to 75% of residual activity even after eight consecutive cycles of reuse. Finally, the clarification of apple, grapes and pineapple juices using magnetic tri-enzyme showed 41%, 46% and 53% respective reduction in turbidity till 150min treatment.

  17. A magnetic tri-enzyme nanobiocatalyst for fruit juice clarification.


    Sojitra, Uttam V; Nadar, Shamraja S; Rathod, Virendra K


    The major complications in fruit juice quality improvement are the presence of polysaccharides components in the form of disrupted fruit cell wall and cell materials. Hence, breakdown of cellulose along with pectin and starch is important for the juice processing. In this context, magnetic tri-enzyme nanobiocatalyst was prepared by simultaneously co-immobilizing three enzymes; α-amylase, pectinase and cellulase onto amino-functionalized magnetic nanoparticle by 60mM glutaraldehyde concentration with 10h cross-linking time for one pot juice clarification. The prepared nanobiocatalyst was characterized by FT-IR, SEM and XRD. The thermal (50-70°C) and pH (3-6) stability studies indicated more than two folds increment in half-life and enhanced tolerance to lower pH. The immobilized enzymes retained up to 75% of residual activity even after eight consecutive cycles of reuse. Finally, the clarification of apple, grapes and pineapple juices using magnetic tri-enzyme showed 41%, 46% and 53% respective reduction in turbidity till 150min treatment. PMID:27451184

  18. Multimatrix models and tri-Sasaki Einstein spaces

    SciTech Connect

    Herzog, Christopher P.; Pufu, Silviu S.; Tesileanu, Tiberiu; Klebanov, Igor R.


    Localization methods reduce the path integrals in N{>=}2 supersymmetric Chern-Simons gauge theories on S{sup 3} to multimatrix integrals. A recent evaluation of such a two-matrix integral for the N=6 superconformal U(N)xU(N) Aharony-Bergman-Jafferis-Maldacena theory produced detailed agreement with the AdS/CFT correspondence, explaining, in particular, the N{sup 3/2} scaling of the free energy. We study a class of p-matrix integrals describing N=3 superconformal U(N){sup p} Chern-Simons gauge theories. We present a simple method that allows us to evaluate the eigenvalue densities and the free energies in the large N limit keeping the Chern-Simons levels k{sub i} fixed. The dual M-theory backgrounds are AdS{sub 4}xY, where Y are seven-dimensional tri-Sasaki Einstein spaces specified by the k{sub i}. The gravitational free energy scales inversely with the square root of the volume of Y. We find a general formula for the p-matrix free energies that agrees with the available results for volumes of the tri-Sasaki Einstein spaces Y, thus providing a thorough test of the corresponding AdS{sub 4}/CFT{sub 3} dualities. This formula is consistent with the Seiberg duality conjectured for Chern-Simons gauge theories.

  19. Hanford and the Tri-Cities economy 1997

    SciTech Connect

    Scott, M.J.


    The missions of the US Department of Energy`s Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). While the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the local Tri-Cities economy for purposes of this study. In the Federal fiscal year (FY) 1997 (October 1, 1996 through September 30, 1997), the total impact of DOE`s local $1.7 billion budget was felt through payrolls and local purchases of goods and services that totaled about $774 million. Directly or indirectly, the DOE/RL budget sustained an estimated 36% of all local employment (30,300 out of 84,800 jobs) and up to 67% of local wage income.

  20. Experimental Investigation and Modeling of Integrated Tri-generation Systems

    NASA Astrophysics Data System (ADS)

    Cetinkaya, Eda

    Energy demand in the world is increasing with population growth and higher living standards. Today, the need for energy requires a focus on renewable sources without abandoning fossil fuels. Efficient use of energy is one of the most important tasks in modern energy systems to achieve. In addition to the energy need, growing environmental concerns are linked with energy is emerged. Multi-purpose energy generation allows a higher efficiency by generating more outputs with the same input in the same system. Tri-generation systems are expected to provide at least three commodities, such as heating, cooling, desalination, storable fuel production and some other useful outputs, in addition to power generation. In this study, an experimental investigation of gasification is presented and two integrated tri-generation systems are proposed. The first integrated tri-generation system (System 1) utilizes solar energy as input and the outputs are power, fresh water and hot water. It consists of four sub-systems, namely solar power tower system, desalination system, Rankine cycle and organic Rankine cycle (ORC). The second integrated tri-generation system (System 2) utilizes coal and biomass as input and the outputs are power, fuel and hot water. It consists of five sub-systems: gasification plant, Brayton cycle, Rankine cycle, Fischer-Tropsch synthesis plant and an organic Rankine cycle (ORC). Experimental investigation includes coal and biomass gasification, where the experimental results of synthesis gas compositions are utilized in the analysis of the second systems. To maximize efficiency, heat losses from the system should be minimized through a recovery system to make the heat a useful commodity for other systems, such as ORCs which can utilize the low-grade heat. In this respect, ORCs are first analyzed for three different configurations in terms of energy and exergy efficiencies altering working fluids to increase the power output. Among two types of coal and one type

  1. Experimental Validation of the Piezoelectric Triple Hybrid Actuation System (TriHYBAS)

    NASA Technical Reports Server (NTRS)

    Xu, Tian-Bing; Jiang, Xiaoning; Su, Ji


    A piezoelectric triple hybrid actuation system (TriHYBAS) has been developed. In this brief presentation of the validation process the displacement profile of TriHYBAS and findings regarding displacement versus applied voltage are highlighted.

  2. Charge transport in tri-p-tolylamine doped trinaphthalylbenzene glass

    NASA Astrophysics Data System (ADS)

    Lin, Liang-Bih; O'Reilly, James M.; Magin, Edward H.; Weiss, David S.; Jenekhe, Samson A.


    The charge transport properties of tri-p-tolylamine (TTA) doped trinaphthalylbenzene have been measured as a function of electric field and temperature. The charge mobilities of the composite are comparable to but somewhat lower than that of TTA doped polystyrene, a nonpolar polymeric host, at similar weight fractions. We suggest that the difference is due to inhomogeneity between the host and the dopant. The results suggest that, similar to polymer hosts in molecularly doped polymers, the molecular host only functions as an inert diluter and does not directly participate in the charge transport manifold. The results also substantiate the importance of molecular packing to charge hopping in disordered organic materials. The charge mobility data are analyzed with a disorder model due to Bässler and coworkers and a recently modified expression due to Novikov and coworkers [Phys. Rev. Lett. 81, 4472 (1998)]. Both models provide adequate descriptions of charge transport in organic amorphous materials.

  3. Tri-modal microscope for head and neck tissue identification

    PubMed Central

    De Montigny, Etienne; Goulamhoussen, Nadir; Madore, Wendy-Julie; Strupler, Mathias; Gologan, Olguta Ecaterina; Ayad, Tareck; Boudoux, Caroline


    A novel tri-modal microscope combining optical coherence tomography (OCT), spectrally encoded confocal microscopy (SECM) and fluorescence imaging is presented. This system aims at providing a tool for rapid identification of head and neck tissues during thyroid surgery. The development of a dual-wavelength polygon-based swept laser allows for synchronized, co-registered and simultaneous imaging with all three modalities. Further ameliorations towards miniaturization include a custom lens for optimal compromise between orthogonal imaging geometries as well as a double-clad fiber coupler for increased throughput. Image quality and co-registration is demonstrated on freshly excised swine head and neck tissue samples to illustrate the complementarity of the techniques for identifying signature cellular and structural features. PMID:27231585

  4. PLA branching with anhydrides and tri-functional aziridine

    NASA Astrophysics Data System (ADS)

    Gu, Liangliang; Xu, Yuewen; Naredla, Rajasekhar; Hoye, Thomas; Macosko, Christopher

    Branched PLA was prepared by melt blending with tri-functional aziridine (T-Az) and pyromellitic dianhydride (PMDA). 1HNMR, gel permeation chromatography (GPC) and rheology were used to characterize the topological structures of branched PLA. Fast reaction between PLA carboxyl end group and T-Az resulted in 3-arm stars and increased the molecular weight. However, the 3-arm stars did not show strain hardening behavior under extensional flow. After modifying PLA hydroxyl end group with PMDA, PLA can react with T-Az on both chain ends and form long chain branched structure, which showed strain hardening in extension. It was found that that only 10% of the PLA hydroxyl end groups reacted with PMDA. This work is supported by Center for Sustainable Polymers.

  5. Tri-band small monopole antenna based on SRR units

    NASA Astrophysics Data System (ADS)

    Shehata, Gehan; Mohanna, Mahmoud; Rabeh, Mohammed Lotfy


    In this paper a novel design for a tri-band monopole antenna coupled with metamaterial units is introduced. The proposed antenna was designed to cover WiMAX (2.5, 3.5) and WLAN (5.2) bands. In our proposal, a coplanar waveguide (CPW) fed circular-disk monopole antenna is coupled with three split ring resonator (SRR) units which exist on its back side. In our design a monopole antenna and SRR units are designed first to resonate at 5.2 GHz and 2.5 GHz respectively. In addition, antenna is loaded with post to force resonance at 3.5 GHz. SRR units are used for 2.5 GHz resonance to miniaturize antenna size, and our proposed antenna considered an electrically small antenna (ESA) at its first resonance frequency. Simulated and measured results exhibit a good agreement that validate our design.

  6. Physical mechanism of the (tri)critical point generation

    SciTech Connect

    Bugaev, K. A. Ivanytskyi, A. I.; Nikonov, E. G.; Petrov, V. K.; Sorin, A. S.; Zinovjev, G. M.


    We discuss some ideas resulting from a phenomenological relation recently declared between the tension of string connecting the static quark-antiquark pair and surface tension of corresponding cylindrical bag. This relation analysis leads to the temperature of vanishing surface tension coefficient of the QGP bags at zero baryonic charge density as T{sub {sigma}} = 152.9 {+-} 4.5 MeV. We develop the view point that this temperature value is not a fortuitous coincidence with the temperature of (partial) chiral symmetry restoration as seen in the lattice QCD simulations. Besides, we argue that T{sub {sigma}} defines the QCD (tri)critical endpoint temperature and claim that a negative value of surface tension coefficient recently discovered is not a sole result but is quite familiar for ordinary liquids at the supercritical temperatures.

  7. Development of high-performance tri-layer material

    NASA Astrophysics Data System (ADS)

    Owe-Yang, D. C.; Yano, Toshiharu; Ueda, Takafumi; Iwabuchi, Motoaki; Ogihara, Tsutomu; Shirai, Shozo


    As chip size and pattern size continue to shrink, the thickness of photo resist is getting thinner and thinner. One of the major reasons is to prevent the small resist features from collapse. It's very challenging to get enough etch resistance from such thin resist thickness. An approach of Si-tri-layer stack which consists of resist, Si ARC (Si contenting anti-reflection coating), organic underlayer from top to bottom has been adopted by many IC makers in the manufacturing of 45 nm node. Even higher resist etching selectivity is needed for 32 nm node. Si ARC, of Si content as high as 43%, provides good etch selectivity. At the same time, tri-layer also provides good control over reflectivity in high NA immersion lithography. However, there are several well know issues concern Si-rich ARC. Resist compatibility and shelf life are on top of the list. An aim of our development work was to overcome those issues in order to produce manufacturing-worthy Si-rich ARC. Several synthesis methods were investigated to form Si-rich ARC film with different properties. Collapse of resist patterns is used as an indicator of lithographic compatibility. Lithographic performance was checked by accelerated shelf life tests at high temperature in order to predict the shelf life at room temperature. It was found that adhesion between resist and Si-rich ARC is improved when contact angle of Si-rich ARC is increased to more than 60 degree. Certain synthesis methods improve shelf life. After optimization of film properties and synthesis methods of Si-rich ARC, SHB-A940 series have best litho compatibility and shelf life is six months at storage temperature below 10°C.

  8. Do subfertile women adjust their habits when trying to conceive?

    PubMed Central

    Joelsson, Lana Salih; Berglund, Anna; Wånggren, Kjell; Lood, Mikael; Rosenblad, Andreas; Tydén, Tanja


    Aim The aim of this study was to investigate lifestyle habits and lifestyle adjustments among subfertile women trying to conceive. Materials and methods Women (n = 747) were recruited consecutively at their first visit to fertility clinics in mid-Sweden. Participants completed a questionnaire. Data were analyzed using logistic regression, t tests, and chi-square tests. Results The response rate was 62% (n = 466). Mean duration of infertility was 1.9 years. During this time 13.2% used tobacco daily, 13.6% drank more than three cups of coffee per day, and 11.6% consumed more than two glasses of alcohol weekly. In this sample, 23.9% of the women were overweight (body mass index, BMI 25–29.9 kg/m2), and 12.5% were obese (BMI ≥30 kg/m2). Obese women exercised more and changed to healthy diets more frequently than normal-weight women (odds ratio 7.43; 95% confidence interval 3.7–14.9). Six out of ten women (n = 266) took folic acid when they started trying to conceive, but 11% stopped taking folic acid after some time. Taking folic acid was associated with a higher level of education (p < 0.001). Conclusions Among subfertile women, one-third were overweight or obese, and some had other lifestyle factors with known adverse effects on fertility such as use of tobacco. Overweight and obese women adjusted their habits but did not reduce their body mass index. Women of fertile age would benefit from preconception counseling, and the treatment of infertility should routinely offer interventions for lifestyle changes. PMID:27216564

  9. An empirical study of the effect of granting multiple tries for online homework

    NASA Astrophysics Data System (ADS)

    Kortemeyer, Gerd


    When deploying online homework in physics courses, an important consideration is how many tries learners should be allowed to solve numerical free-response problems. While on the one hand, this number should be large enough to allow learners mastery of concepts and avoid copying, on the other hand, granting too many allowed tries encourages counter-productive behavior. We investigate data from an introductory calculus-based physics course that allowed different numbers of tries in different semesters. It turns out that the probabilities for successfully completing or abandoning problems during a particular try are independent of the number of tries already made, which indicates that students do not learn from their earlier tries. We also find that the probability for successfully completing a problem during a particular try decreases with the number of allowed tries, likely due to increased carelessness or guessing, while the probability to give up on a problem after a particular try is largely independent of the number of allowed tries. These findings lead to a mathematical model for learner usage of multiple tries, which predicts an optimum number of five allowed tries.

  10. Synthesis and coordination chemistry of tri-substituted benzamidrazones

    PubMed Central

    Crimmin, Mark R.; Colby, Denise A.


    A series of N1,N1,N3-tri-substituted benzamidrazones of the general formulae [PhC(NHR)=NNMe2] (R = Me, n-Pr, i-Pr, n-Bu, Bn, Ph; 1a–f) was synthesized via condensation of 1,1-dimethylhydrazine with the corresponding imidoyl chloride, [PhC(Cl)=NR]. Multinuclear NMR data, and zero-point energy DFT calculations conducted with the B3LYP functional and 6-31G+(d,p) basis set, suggest that these compounds exist as a single tautomer in solution; possessing a weak intramolecular hydrogen bond and a structure dominated by the localised resonance structure ArC(NHR)=N-NMe2. An X-ray crystallographic study upon PhC(NHPh)=NNMe2 (1f) demonstrated that this compound adopts an identical tautomer in the solid state. Reactions of [PhC(NHMe)=NNMe2] (1a) with [LMCl2]2 (M = Ru, L = cymene; M = Rh, Ir, L = Cp*) results in the stoichiometric formation of products of the formula [LM{PhC(=NMe)NHNMe2}Cl]+Cl− (2a–c) in which the amidrazone chelates the metal in a κ2-N1,N3-coordination mode. Formation of this five-membered chelate occurs with a concomitant tautomerisation of the amidrazone ligand to an alternative tautomer, i.e. [PhC(=NMe)NHNMe2], the latter tautomer is expected to be readily energetically accessible based upon the aforementioned DFT calculations. This series of salts may be deprotonated with lithium hexamethyldisilazide to form the corresponding charge neutral complexes [LM{PhC(NMe)=NNMe2}] (3a–c). In contrast, the reaction of N1,N1,N3-tri-substituted benzamidrazones with [(cymene)RuCl2]2 in the presence of NaOAc yielded a mixture of cyclometallation (C-H activation) and amidrazone chelation/deprotonation (N-H activation) products. Reaction of 1a yielded an inseparable mixture of products, whilst the reaction of 1c resulted in formation of the cyclometallated product [LM{C6H5C(=NiPr)NHNMe2}] (L = cymene, M = Ru; 4a) in a modest 62% yield. This latter complex could be isolated as a crystalline orange solid, full characterisation including single crystal X

  11. Hanford, diversification, and the Tri-Cities Economy FY 1998

    SciTech Connect

    SCOTT, M.J.


    The missions of the U.S. Department of Energy's Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). Although the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the ''local'' Tri-Cities economy for purposes of this study (see Figure 1). In the federal fiscal year (IV) 1998 (October 1, 1997 through September 30, 1998), the total impact of DOEs local $1.6 billion budget was felt through payrolls of $519 million and local purchases of goods and services of $246 million. The total local spending of $765 million was down slightly from the FY 1997 total of $774 million. Taking into account the slightly greater multiplier effects of this spending due to changes in its mix, the DOE/RL budget sustained an estimated 36% of all local employment (31,200 out of 86,000 jobs) and up to 64% of local wage income ($1.55 billion out of $2.40 billion). This was up slightly from the year before (29,500 jobs, $1.49 billion income). DOE budget increases in FY 1999 are expected to result in a net increase of about 200 local DOE contractor jobs over the September 30, 1998 level, or about equal to the FY 1998 average. In addition, economic diversification more than offset the impact of the local DOE losses in FY 1998 and, together with an initial economic boost from privatization of Hanford's tank waste cleanup, is expected to play a significant expansive role in FY 1999

  12. Hanford Diversification and the Tri-Cities Economy FY 1999

    SciTech Connect

    SCOTT, M.J.


    The missions of the U.S. Department of Energy's Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). Although the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the ''local'' Tri-Cities economy for purposes of this study. In the federal fiscal year (FY) 1999 (October 1, 1998 through September 30, 1999), the total impact of DOE'S local $1.59 billion budget was felt through payrolls of $542 million and local purchases of goods and services of $226 million. The total local spending of $768 million was up slightly from the FY 1998 total of $765 million. Taking into account the multiplier effects of this spending, the DOE/RL budget sustained an estimated 32% of all local employment (28,250 out of 88,100 jobs) and about 35% of local earned income (almost $1.08 billion out of $3.08 billion). The decrease in these percentages from last year's report reflects an update of the model's economic structure based on the 1997 economic census year, a correction of a programming error in the model found during the update, and a broader definition of earnings that includes proprietor income, not just wages (see the Appendix for revisions to the previous forecasts). DOE budget increases in FY 2000 are expected to result in no change to the number of local DOE contractor jobs and about a $29 million increase in direct local spending.

  13. Increase in liver nuclear tri-iodothyronine receptors associated with increased deoxyribonucleic acid by long-term administration of tri-iodothyronine in thyroidectomized rats

    PubMed Central

    Nakamura, Hirotoshi; Hamada, Satoshi; Imura, Hiroo


    The effect of long-term administration of small amounts of tri-iodothyronine was examined on the nuclear tri-iodothyronine receptors in rat liver. The maximal binding capacity (Cmax.) and association constant (Ka) of the receptors were determined in thyroidectomized rats given vehicle alone (group A), 2μg of tri-iodothyronine/100g body wt. (group B) or 7μg of tri-iodothyronine/100g body wt. (group C) for 2 weeks. Scatchard analyses with correction for the amount of endogenous tri-iodothyronine revealed that Cmax. values per g of liver were increased to 1.5 and 2.7 times the control value in groups B and C respectively. Since concentrations of DNA per g of liver were significantly increased in the two groups of hormone-treated rats, Cmax. values per mg of DNA were nearly the same in group B, but still increased significantly in group C compared with group A. Ka values remained unchanged in all three groups of animals. Mitochondrial α-glycerophosphate dehydrogenase activity was 9.6 and 28.7 times as high in groups B and C, respectively, as in group A. Concentrations of endogenous tri-iodothyronine bound to non-histone protein were substantially increased in groups B and C, although concentrations of serum tri-iodothyronine remained rather low. The results obtained indicate that the long-term administration of tri-iodothyronine in small doses induces an increase in the nuclear receptors associated with increased DNA with and without accompanying a relative increase in the receptor concentration in thyroidectomized rats. Also the hormonal effect is closely related to the total number of the nuclear receptors and the concentrations of nuclear tri-iodothyronine bound to the receptors rather than the serum tri-iodothyronine concentrations. PMID:230825

  14. What Did You Try Last Semester? How Did It Work?

    NASA Astrophysics Data System (ADS)

    Moore, John W.


    As I write this, the end of the semester is less than a week away. This is a good time to reflect on what I tried this time that I had not done before, how well it worked, and how that applies to the process of change and reform in chemical education. Nearly a year ago, a good friend gave me a copy of a brief note by the Executive Director of the National Science Teachers Association, Gerald Wheeler (1). Its title was "Why doesn't change stick?" Quoting the Red Queen from Alice in Wonderland, Wheeler suggested that it might be taking all the running we could do just to maintain the status quo. He asked readers to look systematically at "the failed reform efforts begun in the 1960s" and questioned whether those efforts had actually changed anything. Although the reform efforts Wheeler questioned were aimed at the pre-college level, his point is a good one for college as well as high school teachers to consider, especially at a time when new projects are aiming to reform science education systemically. (See pages 158-160 and page 163 for more information on these projects.) If reform efforts are typically meteoric, burning brightly for but a short time and then disappearing, what might we do to make them less so? I think that the power to make reform less meteoric lies within all of us. It involves incremental, rather than revolutionary, change. My model for reform is one in which each of us continually experiments with manageable changes in courses and pedagogy, evaluating their effectiveness, casting out the less than successful ones, retaining and refining those that help students learn more effectively, and keeping the rest of the community informed about what works and what does not. This model requires continual work and dedication from all of us, but not superhuman effort that is impossible to sustain over the long term. A meteor shower definitely gets our attention, but far more light is shed by the fixed stars, and they'll still be there next week. The

  15. The Tri-Optic II: Embracing the family voice.


    Fogarty, Colleen T; Mauksch, Larry B


    In June, 2015, for the issue marking the passing of Donald Bloch, the intellectual founder of the collaborative health care movement, we wrote an editorial called, "The Tri-Optic: Next step for Collaborative Family Healthcare" (Mauksch & Fogarty, 2015). Bloch had famously proposed the "dual optic": the partnership of Dr. Biomedicine and Dr. Psychosocial (Bloch, 1988). Our readers, including many Collaborative Family Healthcare Association (CFHA) members, understand the value of a family perspective and are grappling with the next steps to truly integrate family and systems thinking into all levels of health care. A current exploration about the last 10 years of articles published in the journal by Tai Mendenhall, a member or our editorial board (personal communication, 2015), has found that the most common topic of focus is family health and functioning in 28% of the articles. This focus was also evident to varying degrees in all the plenaries at the 2015 CFHA conference held in Portland, Oregon. we pose the following questions to the FSH readership and CFHA community: Where are we, individually and collectively, with our knowledge about families as resources in and influences on health care? How are we teaching our learners about family-oriented care? How do we integrate family thinking into our various models of care? How do models of behavioral health integration include the family context in patient care? PMID:26963776

  16. Tri-layered chitosan scaffold as a potential skin substitute.


    Lin, Hsin-Yi; Chen, Shin-Hung; Chang, Shih-Hsin; Huang, Sheng-Tung


    A tri-layered chitosan-based scaffold was successfully made to replicate the striation of a full-thickness skin more accurately than a single- or bi-layered scaffold, which needed weeks of co-culturing of fibroblasts and keratinocytes to achieve similar striation. Chitosan solution was freeze-dried and made into porous disks. Chitosan or chitosan-pectin in acetic acid solution was electrospun onto the chitosan disk to form a nanofibrous layer and a thin film. Examinations based on scanning electron spectroscopy showed that the scaffold was composed of a porous layer (2 mm) to simulate the dermis, a thin film (25-45 μm) to mimic the basement membrane, and a layer of nanofibers (100-200 μm) to serve as the protective epidermis. The tensile strength and modulus of the composite scaffold were significantly higher than those of the chitosan disk (p < 0.01). The composite was able to quickly absorb water and stayed intact throughout the course of the 14-day cell culture tests. The fibroblast cells seeded on both sides of the scaffolds were able to proliferate and stayed separated by the thin film. PMID:26155720

  17. Coinage metal complexes supported by the tri- and tetraphosphine ligands.


    Dau, Minh Thuy; Shakirova, Julia R; Karttunen, Antti J; Grachova, Elena V; Tunik, Sergey P; Melnikov, Alexey S; Pakkanen, Tapani A; Koshevoy, Igor O


    A series of tri- and tetranuclear phosphine complexes of d(10) metal ions supported by the polydentate ligands, bis(diphenylphosphinomethyl)phenylphosphine (PPP) and tris(diphenylphosphinomethyl)phosphine (PPPP), were synthesized. All the compounds under study, [AuM2(PPP)2](3+) (M = Au (1), Cu (2), Ag (3)), [M4(PPPP)2](4+) (M = Ag (4), Au (5)), [AuAg3(PPPP)2](4+) (6), and [Au2Cu2(PPPP)2(NCMe)4](4+) (7), were characterized crystallographically. The trinuclear clusters 1-3 contain a linear metal core, while in the isostructural tetranuclear complexes 4-6 the metal framework has a plane star-shaped arrangement. Cluster 7 adopts a structural motif that involves a digold unit bridged by two arms of the PPPP phosphines and decorated two spatially separated Cu(I) ions chelated by the remaining P donors. The NMR spectroscopic investigation in DMSO solution revealed the heterometallic clusters 2, 3, and 6 are stereochemically nonrigid and undergo reversible metal ions redistribution between several species, accompanied by their solvation-desolvation. The complexes 1-3 and 5-7 exhibit room temperature luminescence in the solid state (Φem = 6-64%) in the spectral region from 450 to 563 nm. The phosphorescence observed originates from the triplet excited states, determined by the metal cluster-centered dσ* → pσ transitions. PMID:24750114

  18. Tri-layered chitosan scaffold as a potential skin substitute.


    Lin, Hsin-Yi; Chen, Shin-Hung; Chang, Shih-Hsin; Huang, Sheng-Tung


    A tri-layered chitosan-based scaffold was successfully made to replicate the striation of a full-thickness skin more accurately than a single- or bi-layered scaffold, which needed weeks of co-culturing of fibroblasts and keratinocytes to achieve similar striation. Chitosan solution was freeze-dried and made into porous disks. Chitosan or chitosan-pectin in acetic acid solution was electrospun onto the chitosan disk to form a nanofibrous layer and a thin film. Examinations based on scanning electron spectroscopy showed that the scaffold was composed of a porous layer (2 mm) to simulate the dermis, a thin film (25-45 μm) to mimic the basement membrane, and a layer of nanofibers (100-200 μm) to serve as the protective epidermis. The tensile strength and modulus of the composite scaffold were significantly higher than those of the chitosan disk (p < 0.01). The composite was able to quickly absorb water and stayed intact throughout the course of the 14-day cell culture tests. The fibroblast cells seeded on both sides of the scaffolds were able to proliferate and stayed separated by the thin film.

  19. Tunable Anomalous Supercurrent in a topological tri-junction SQUID

    NASA Astrophysics Data System (ADS)

    Kurter, C.; Finck, A. D. K.; Ghaemi, P.; Hor, Y. S.; van Harlingen, D. J.


    There has been intense interest in realizing Majorana fermions (MFs) in solid-state systems. Circuits of Josephson junctions (JJs) made of closely spaced s-wave superconductors on 3D topological insulators have been proposed to host zero energy Andreev bound states (ABSs) that act like MFs. Here, we present signatures of an anomalous supercurrent carried by topologically non-trivial low energy ABSs in a Nb/Bi2Se3/Nb tri-junction SQUID where two of the three superconducting leads are connected by a loop. An electrostatic top gate allows strong modulation of the supercurrent despite a high bulk contribution to the normal state conductance. In response to a magnetic field threading flux within the superconducting loop, we find unconventional SQUID oscillations enclosed by an envelope associated with a clear diffraction pattern, indicating spatially uniform and symmetric JJs. At a critical gate voltage, when the trivial 2DEG at the surface is nearly depleted, we observe a sharp drop in the critical current, signaling a topological phase transition in which the nature of the supercurrent-carrying states is transformed. This transition is accompanied by qualitative changes in the SQUID oscillations, magnetic diffraction pattern, and temperature dependence of the critical current. We acknowledge funding from Microsoft Station-Q.

  20. Minimal modifications to the Tri-Bimaximal neutrino mixing

    NASA Astrophysics Data System (ADS)

    Zhao, Zhen-hua


    In light of the observation of a relatively large θ 13, the ever popular Tri-Bimaximal (TBM) neutrino mixing which predicts a vanishing θ 13 needs modifications. In this paper, we shall discuss the possibility of modifying it in a minimal way to fulfil this task. In the first part, a neutrino mass matrix with three independent parameters, which leads to the TM2 mixing, is obtained by analogy with that for the TBM mixing. In the second part, a model that can realize the TM2 mixing is constructed with flavor symmetries A 4 × U(1) × Z 2 × Z 2 × Z 2. It is the variant of a model that gives the TBM mixing, with only one more flavon field included. Furthermore, the imaginary vacuum expectation value (VEV) of this flavon breaks the imposed CP symmetry and results in θ 23 = 45° and the maximal CP violation. Besides, this model building approach can be generalized to the TM1 mixing in a straightforward way.

  1. TRY – a global database of plant traits

    PubMed Central

    Kattge, J; Díaz, S; Lavorel, S; Prentice, I C; Leadley, P; Bönisch, G; Garnier, E; Westoby, M; Reich, P B; Wright, I J; Cornelissen, J H C; Violle, C; Harrison, S P; Van Bodegom, P M; Reichstein, M; Enquist, B J; Soudzilovskaia, N A; Ackerly, D D; Anand, M; Atkin, O; Bahn, M; Baker, T R; Baldocchi, D; Bekker, R; Blanco, C C; Blonder, B; Bond, W J; Bradstock, R; Bunker, D E; Casanoves, F; Cavender-Bares, J; Chambers, J Q; Chapin, F S; Chave, J; Coomes, D; Cornwell, W K; Craine, J M; Dobrin, B H; Duarte, L; Durka, W; Elser, J; Esser, G; Estiarte, M; Fagan, W F; Fang, J; Fernández-Méndez, F; Fidelis, A; Finegan, B; Flores, O; Ford, H; Frank, D; Freschet, G T; Fyllas, N M; Gallagher, R V; Green, W A; Gutierrez, A G; Hickler, T; Higgins, S I; Hodgson, J G; Jalili, A; Jansen, S; Joly, C A; Kerkhoff, A J; Kirkup, D; Kitajima, K; Kleyer, M; Klotz, S; Knops, J M H; Kramer, K; Kühn, I; Kurokawa, H; Laughlin, D; Lee, T D; Leishman, M; Lens, F; Lenz, T; Lewis, S L; Lloyd, J; Llusià, J; Louault, F; Ma, S; Mahecha, M D; Manning, P; Massad, T; Medlyn, B E; Messier, J; Moles, A T; Müller, S C; Nadrowski, K; Naeem, S; Niinemets, Ü; Nöllert, S; Nüske, A; Ogaya, R; Oleksyn, J; Onipchenko, V G; Onoda, Y; Ordoñez, J; Overbeck, G; Ozinga, W A; Patiño, S; Paula, S; Pausas, J G; Peñuelas, J; Phillips, O L; Pillar, V; Poorter, H; Poorter, L; Poschlod, P; Prinzing, A; Proulx, R; Rammig, A; Reinsch, S; Reu, B; Sack, L; Salgado-Negret, B; Sardans, J; Shiodera, S; Shipley, B; Siefert, A; Sosinski, E; Soussana, J-F; Swaine, E; Swenson, N; Thompson, K; Thornton, P; Waldram, M; Weiher, E; White, M; White, S; Wright, S J; Yguel, B; Zaehle, S; Zanne, A E; Wirth, C


    Plant traits – the morphological, anatomical, physiological, biochemical and phenological characteristics of plants and their organs – determine how primary producers respond to environmental factors, affect other trophic levels, influence ecosystem processes and services and provide a link from species richness to ecosystem functional diversity. Trait data thus represent the raw material for a wide range of research from evolutionary biology, community and functional ecology to biogeography. Here we present the global database initiative named TRY, which has united a wide range of the plant trait research community worldwide and gained an unprecedented buy-in of trait data: so far 93 trait databases have been contributed. The data repository currently contains almost three million trait entries for 69 000 out of the world's 300 000 plant species, with a focus on 52 groups of traits characterizing the vegetative and regeneration stages of the plant life cycle, including growth, dispersal, establishment and persistence. A first data analysis shows that most plant traits are approximately log-normally distributed, with widely differing ranges of variation across traits. Most trait variation is between species (interspecific), but significant intraspecific variation is also documented, up to 40% of the overall variation. Plant functional types (PFTs), as commonly used in vegetation models, capture a substantial fraction of the observed variation – but for several traits most variation occurs within PFTs, up to 75% of the overall variation. In the context of vegetation models these traits would better be represented by state variables rather than fixed parameter values. The improved availability of plant trait data in the unified global database is expected to support a paradigm shift from species to trait-based ecology, offer new opportunities for synthetic plant trait research and enable a more realistic and empirically grounded representation of terrestrial

  2. Try-A Global Database of Plant Traits

    SciTech Connect

    Thornton, Peter E


    Plant traits the morphological, anatomical, physiological, biochemical and phenological characteristics of plants and their organs determine how primary producers respond to environmental factors, affect other trophic levels, influence ecosystem processes and services and provide a link from species richness to ecosystem functional diversity. Trait data thus represent the raw material for a wide range of research from evolutionary biology, community and functional ecology to biogeography. Here we present the global database initiative named TRY, which has united a wide range of the plant trait research community worldwide and gained an unprecedented buy-in of trait data: so far 93 trait databases have been contributed. The data repository currently contains almost three million trait entries for 69 000 out of the world s 300 000 plant species, with a focus on 52 groups of traits characterizing the vegetative and regeneration stages of the plant life cycle, including growth, dispersal, establishment and persistence. A first data analysis shows that most plant traits are approximately log-normally distributed, with widely differing ranges of variation across traits. Most trait variation is between species (interspecific), but significant intraspecific variation is also documented, up to 40% of the overall variation. Plant functional types (PFTs), as commonly used in vegetation models, capture a substantial fraction of the observed variation but for several traits most variation occurs within PFTs, up to 75% of the overall variation. In the context of vegetation models these traits would better be represented by state variables rather than fixed parameter values. The improved availability of plant trait data in the unified global database is expected to support a paradigm shift from species to trait-based ecology, offer new opportunities for synthetic plant trait research and enable a more realistic and empirically grounded representation of terrestrial vegetation in

  3. Tri-Laboratory Linux Capacity Cluster 2007 SOW

    SciTech Connect

    Seager, M


    well, the budget demands are extreme and new, more cost effective ways of fielding these systems must be developed. This Tri-Laboratory Linux Capacity Cluster (TLCC) procurement represents the ASC first investment vehicle in these capacity systems. It also represents a new strategy for quickly building, fielding and integrating many Linux clusters of various sizes into classified and unclassified production service through a concept of Scalable Units (SU). The programmatic objective is to dramatically reduce the overall Total Cost of Ownership (TCO) of these 'capacity' systems relative to the best practices in Linux Cluster deployments today. This objective only makes sense in the context of these systems quickly becoming very robust and useful production clusters under the crushing load that will be inflicted on them by the ASC and SSP scientific simulation capacity workload.

  4. Network of nano-droplets by a tri-block polymer

    NASA Astrophysics Data System (ADS)

    Sharifi, Soheil; Doodman, Esmaeil


    Mixtures of oil in water nano-droplets with two molecular weights of a tri-block polymer was studied by quasi elastic light scattering and small angle X-ray scattering. The results showed that the size and interaction of droplets didn't change with increase of the tri-block polymer length but the order parameters increased. The increase of length of the tri-block biopolymer changed the dynamics of the droplets. A network formation is resulted with increase of the amount of tri-block polymer in the microemulsions.

  5. Modulation of STAT3 Folding and Function by TRiC/CCT Chaperonin

    PubMed Central

    Kasembeli, Moses; Lau, Wilson Chun Yu; Roh, Soung-Hun; Eckols, T. Kris; Frydman, Judith; Chiu, Wah; Tweardy, David J.


    Signal transducer and activator of transcription 3 (Stat3) transduces signals of many peptide hormones from the cell surface to the nucleus and functions as an oncoprotein in many types of cancers, yet little is known about how it achieves its native folded state within the cell. Here we show that Stat3 is a novel substrate of the ring-shaped hetero-oligomeric eukaryotic chaperonin, TRiC/CCT, which contributes to its biosynthesis and activity in vitro and in vivo. TRiC binding to Stat3 was mediated, at least in part, by TRiC subunit CCT3. Stat3 binding to TRiC mapped predominantly to the β-strand rich, DNA-binding domain of Stat3. Notably, enhancing Stat3 binding to TRiC by engineering an additional TRiC-binding domain from the von Hippel-Lindau protein (vTBD), at the N-terminus of Stat3, further increased its affinity for TRiC as well as its function, as determined by Stat3's ability to bind to its phosphotyrosyl-peptide ligand, an interaction critical for Stat3 activation. Thus, Stat3 levels and function are regulated by TRiC and can be modulated by manipulating its interaction with TRiC. PMID:24756126

  6. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2010 CFR


    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  7. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2012 CFR


    ... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  8. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2014 CFR


    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  9. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2011 CFR


    ... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  10. 1973-74 Annual Report of the Tri-College University Libraries Coordinator's Office.

    ERIC Educational Resources Information Center

    Tri-College Univ., Inc., Fargo, ND. Libraries.

    The organization, staffing, finance, and projected budget for the North Dakota Tri-College University Libraries are discussed. All the activities and recent developments of the Tri-College University Libraries are reviewed and particular attention is paid to personnel changes, administration, financing, acquisitions, and expansions. (WH)

  11. Trying Physics: Analyzing the Motion of the Quickest Score in International Rugby

    ERIC Educational Resources Information Center

    Goff, John Eric; Lipscombe, Trevor Davis


    The hearts of sports fans were stirred recently by the fastest-ever try scored in international rugby. Welsh winger Dafydd Howells crossed the Fijian try line to score a mere six seconds after Angus O'Brien had started the game with a kickoff, in one of the fixtures in rugby's Junior World Cup played on June 2, 2014, in New Zealand. This…

  12. 76 FR 60781 - Toxics Release Inventory (TRI) Reporting for Facilities Located in Indian Country and...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... the Federal Register (FR) requiring facilities in Indian country to submit annual TRI reports to EPA... 1990, EPA finalized regulations in the Federal Register (FR) requiring facilities in Indian country to submit annual TRI reports to EPA and the appropriate Tribal government (55 FR 30632). EPA's...

  13. Testing of the TriP Chip Running at 132 nsec Using a Modified AFE Board

    SciTech Connect

    Juan Estrada et al.


    In this note we describe the first set of tests done with a sample of TriP chips that were mounted on a modified AFE board. The modifications consisted of different firmware and the replacement of one power supply switch. The board used was a standard AFEIc board (red type) on which new MCMs (MCMIIs) were mounted. The new MCMs were designed to support the TriP and emulate the SVX for readout when mounted on an AFEIc board. The TriP and the MCMs are described in Ref. [1]. Two versions of the MCMII were designed and built: one (MCMIIb) supports two TriP chips wirebonded directly to the MCM substrate. The other, (MCMIIc) supports one TriP which can be either wirebonded directly or packaged into a standard TQFP surface mount package. Due to space constraints, this MCM can support only 1 TriP. We tested 6 TriP chips on 3 different MCMIIb (MCMIIb-1, MCMIIb-2 and MCMIIb-3) and 2 other TriPs were tested on MCMIIc, one of them with an unpackaged TriP (MCMIIc-1) and the other with a packaged TriP (MCMIIc-2). A set of 10 programable internal registers control the TriP operation, the description of these registers can be found in [1]. Table 1 shows the values used for the tests described in this note. In Ref. [1] there is a description of the signals that are needed to operate the TriP chip. We implemented in a Field Programable Gate Array (FPGA), also part of the MCM, a set of shift registers that allow us to download via the 1553 interface to the AFE board, any desired timing for the signals that the FPGA has to send to the TriP chip. These registers are run with a 121.21 MHz clock (which is 16x the crossing clock and phase locked to it), which means that each bit corresponds to a time interval of 8.25 nsec. Finer control of timing is possible, but this changing the programing of the FPGA and recompiling. The bits downloaded to these shift registers inside the TriP are listed in Table 2.

  14. Technology transfer and commercialization initiatives at TRI/Austin: Resources and examples

    SciTech Connect

    Matzkanin, G.A.; Dingus, M.L.


    Located at TRI/Austin, and operated under a Department of Defense contract, is the Nondestructive Testing Information Analysis Center (NTIAC). This is a full service Information Analysis Center sponsored by the Defense Technical Information Center (DTIC), although services of NTIAC are available to other government agencies, government contractors, industry and academia. The principal objective of NTIAC is to help increase the productivity of the nation`s scientists, engineers, and technical managers involved in, or requiring, nondestructive testing by providing broad information analysis services of technical excellence. TRI/Austin is actively pursuing commercialization of several products based on results from outside funded R and D programs. As a small business, TRI/Austin has limited capabilities for large scale fabrication, production, marketing or distribution. Thus, part of a successful commercialization process involves making appropriate collaboration arrangements with other organizations to augment TRI/Austin`s capabilities. Brief descriptions are given here of two recent commercialization efforts at TRI/Austin.

  15. What Did You Try Last Semester? How Did It Work?

    NASA Astrophysics Data System (ADS)

    Moore, John W.


    As I write this, the end of the semester is less than a week away. This is a good time to reflect on what I tried this time that I had not done before, how well it worked, and how that applies to the process of change and reform in chemical education. Nearly a year ago, a good friend gave me a copy of a brief note by the Executive Director of the National Science Teachers Association, Gerald Wheeler (1). Its title was "Why doesn't change stick?" Quoting the Red Queen from Alice in Wonderland, Wheeler suggested that it might be taking all the running we could do just to maintain the status quo. He asked readers to look systematically at "the failed reform efforts begun in the 1960s" and questioned whether those efforts had actually changed anything. Although the reform efforts Wheeler questioned were aimed at the pre-college level, his point is a good one for college as well as high school teachers to consider, especially at a time when new projects are aiming to reform science education systemically. (See pages 158-160 and page 163 for more information on these projects.) If reform efforts are typically meteoric, burning brightly for but a short time and then disappearing, what might we do to make them less so? I think that the power to make reform less meteoric lies within all of us. It involves incremental, rather than revolutionary, change. My model for reform is one in which each of us continually experiments with manageable changes in courses and pedagogy, evaluating their effectiveness, casting out the less than successful ones, retaining and refining those that help students learn more effectively, and keeping the rest of the community informed about what works and what does not. This model requires continual work and dedication from all of us, but not superhuman effort that is impossible to sustain over the long term. A meteor shower definitely gets our attention, but far more light is shed by the fixed stars, and they'll still be there next week. The

  16. Crystal structure of nitridobis(tri­methyl­silanolato)[1,1,1-trimethyl-N-(tri­methyl­sil­yl)silanaminato]molybdenum(VI)

    PubMed Central

    Geng, Caiwei; Hao, Xiang; Jiao, Peng


    In the title compound, [Mo(C6H18NSi2)(C3H9OSi)2N], the MoVI cation is located on a mirror plane and is coordinated by a nitride anion, a 1,1,1-trimethyl-N-(tri­methyl­sil­yl)silanaminate anion and two tri­methyl­silanolate anions in a distorted tetra­hedral geometry; the N atom and two Si atoms of the 1,1,1-trimethyl-N-(tri­methyl­sil­yl)silanaminato anionic ligand are also located on the mirror plane. The Mo N bond length of 1.633 (6) Å is much shorter than the Mo—N single-bond length of 1.934 (7) Å. No hydrogen bonding is observed in the crystal structure. PMID:26870413

  17. Coordinate expression of AOS genes and JA accumulation: JA is not required for initiation of closing layer in wound healing tubers

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Wounding induces a series of coordinated physiological responses essential for protection and healing of the damaged tissue. Wound-induced formation of jasmonic acid (JA) is important in defense responses in leaves, but comparatively little is known about the induction of JA biosynthesis and its ro...

  18. Tri-allelic pattern at the TPOX locus: a familial study.


    Picanço, Juliane Bentes; Raimann, Paulo Eduardo; Paskulin, Giorgio Adriano; Alvarez, Luís; Amorim, António; Batista Dos Santos, Sidney Emanuel; Alho, Clarice Sampaio


    Alleles at the TPOX STR locus have 6-14 different numbers of a four-nucleotide (AATG) repeat motif arranged in tandem. Although tri-allelic genotypes are generally rare, the TPOX tri-allelic pattern has a higher frequency, varying widely among populations. Despite this, there are few accurate reports to disclose the nature of the TPOX third allele. In this work we present data obtained from 45 individuals belonging to the same pedigree, in which there are cases of tri-allelic TPOX genotypes. The subjects were apparently healthy with a normal biological development. We noticed six tri-allelic cases in this family, and all of them were women. Karyotype analysis showed no occurrence of partial 2p trisomy. All the tri-allelic cases had the genotype 8-10-11, probably due to three copies of the TPOX STR sequence in all cells (Type 2 tri-allelic pattern). Based on previous data we assumed the allele 10 as the TPOX third allele. The pedigree analyses show evidences that the TPOX extra-allele was the allele10, it is placed far from the main TPOX locus, and that there is a potential linkage of the TPOX extra-allele-10 with Xq. This was the first study that included a large pedigree analysis in order to understand the nature TPOX tri-allelic pattern.

  19. TriLoNet: Piecing Together Small Networks to Reconstruct Reticulate Evolutionary Histories.


    Oldman, James; Wu, Taoyang; van Iersel, Leo; Moulton, Vincent


    Phylogenetic networks are a generalization of evolutionary trees that can be used to represent reticulate processes such as hybridization and recombination. Here, we introduce a new approach called TriLoNet (Trinet Level- one Network algorithm) to construct such networks directly from sequence alignments which works by piecing together smaller phylogenetic networks. More specifically, using a bottom up approach similar to Neighbor-Joining, TriLoNet constructs level-1 networks (networks that are somewhat more general than trees) from smaller level-1 networks on three taxa. In simulations, we show that TriLoNet compares well with Lev1athan, a method for reconstructing level-1 networks from three-leaved trees. In particular, in simulations we find that Lev1athan tends to generate networks that overestimate the number of reticulate events as compared with those generated by TriLoNet. We also illustrate TriLoNet's applicability using simulated and real sequence data involving recombination, demonstrating that it has the potential to reconstruct informative reticulate evolutionary histories. TriLoNet has been implemented in JAVA and is freely available at

  20. Structural and functional characterization of TRI3 trichothecene 15-O-acetyltransferase from Fusarium sporotrichioides

    PubMed Central

    Garvey, Graeme S; McCormick, Susan P; Alexander, Nancy J; Rayment, Ivan


    Fusarium head blight is a devastating disease of cereal crops whose worldwide incidence is increasing and at present there is no satisfactory way of combating this pathogen or its associated toxins. There is a wide variety of trichothecene mycotoxins and they all contain a 12,13-epoxytrichothecene skeleton but differ in their substitutions. Indeed, there is considerable variation in the toxin profile across the numerous Fusarium species that has been ascribed to differences in the presence or absence of biosynthetic enzymes and their relative activity. This article addresses the source of differences in acetylation at the C15 position of the trichothecene molecule. Here, we present the in vitro structural and biochemical characterization of TRI3, a 15-O-trichothecene acetyltransferase isolated from F. sporotrichioides and the “in vivo” characterization of Δtri3 mutants of deoxynivalenol (DON) producing F. graminearum strains. A kinetic analysis shows that TRI3 is an efficient enzyme with the native substrate, 15-decalonectrin, but is inactive with either DON or nivalenol. The structure of TRI3 complexed with 15-decalonectrin provides an explanation for this specificity and shows that Tri3 and Tri101 (3-O-trichothecene acetyltransferase) are evolutionarily related. The active site residues are conserved across all sequences for TRI3 orthologs, suggesting that differences in acetylation at C15 are not due to differences in Tri3. The tri3 deletion mutant shows that acetylation at C15 is required for DON biosynthesis even though DON lacks a C15 acetyl group. The enzyme(s) responsible for deacetylation at the 15 position of the trichothecene mycotoxins have not been identified. PMID:19319932

  1. Apolar distal pocket mutants of yeast cytochrome c peroxidase: Binding of imidazole, 1-methylimidazole and 4-nitroimidazole to the triAla, triVal, and triLeu variants

    PubMed Central

    Bidwai, Anil; Ayala, Caitlan; Vitello, Lidia B.; Erman, James E.


    Imidazole binding to three apolar distal heme pocket mutants of yeast cytochrome c peroxidase (CcP) has been investigated between pH 4 and 8. The three CcP variants have Arg-48, Trp-51, and His-52 mutated to either all alanine, CcP(triAla), all valine, CcP(triVal), or all leucine residues, CcP(triLeu). The imidazole binding curves for all three mutants are biphasic indicating that each of the mutants exist in at least two conformational states with different affinities for imidazole. At pH 7, the high-affinity conformations of the three CcP mutants bind imidazole between 3.8 and 4.7 orders of magnitude stronger than that of wild-type CcP while the low-affinity conformations have binding affinities about 2.5 orders of magnitude larger than wild-type CcP. Imidazole binding to the three CcP mutants is pH dependent with the strongest binding observed at high pH. Apparent pKa values for the transition in binding vary between 5.6 and 7.5 for the high-affinity conformations and between 6.2 and 6.8 for the low-affinity conformations of the CcP triple mutants. The kinetics of imidazole binding are also biphasic. The fast phase of imidazole binding to CcP(triAla) and CcP(triLeu) is linearly dependent on the imidazole concentration while the slow phase is independent of imidazole concentration. Both phases of imidazole binding to CcP(triVal) have a hyperbolic dependence on the imidazole concentration. The apparent association rate constants vary between 30 and 170 M−1s−1 while the apparent dissociation rate constants vary between 0.05 and 0.43 s−1. The CcP triple mutants have higher binding affinities for 1-methylimidazole and 4-nitroimidazole than does wild-type CcP. PMID:25900360

  2. The molecular architecture of the eukaryotic chaperonin TRiC/CCT

    PubMed Central

    Leitner, Alexander; Joachimiak, Lukasz A.; Bracher, Andreas; Mönkemeyer, Leonie; Walzthoeni, Thomas; Chen, Bryan; Pechmann, Sebastian; Holmes, Susan; Cong, Yao; Ma, Boxue; Ludtke, Steve; Chiu, Wah; Hartl, F. Ulrich; Aebersold, Ruedi; Frydman, Judith


    Summary TRiC/CCT is a highly conserved and essential chaperonin that uses ATP cycling to facilitate folding of approximately 10% of the eukaryotic proteome. This 1 MDa hetero-oligomeric complex consists of two stacked rings of eight paralogous subunits each. Previously proposed TRiC models differ substantially in their subunit arrangements and ring register. Here, we integrate chemical crosslinking, mass spectrometry and combinatorial modeling to reveal the definitive subunit arrangement of TRiC. In vivo disulfide mapping provided additional validation for the crosslinking-derived arrangement as the definitive TRiC topology. This subunit arrangement allowed the refinement of a structural model using existing X-ray diffraction data. The new structure explains all available crosslink experiments, provides a rationale for previously unexplained structural features and reveals a surprising asymmetry of charges within the chaperonin folding chamber. PMID:22503819

  3. Spin and valley resolved Landau level crossing in tri-layer ABA stacked graphene

    NASA Astrophysics Data System (ADS)

    Datta, Biswajit; Gupta, Vishakha; Borah, Abhinandan; Watanabe, Kenji; Taniguchi, Takashi; Deshmukh, Mandar

    We present quantum Hall measurements on a high quality encapsulated tri-layer graphene device. Low temperature field effect mobility of this device is around 500,000 cm2/Vs and we see SdH oscillations at a magnetic field as low as 0.3 T. Quantum Hall measurements confirm that the chosen tri layer graphene is Bernal (ABA) stacked. Due to the presence of both mass-less monolayer like Dirac fermions and massive bi-layer like Dirac fermions in Bernal stacked tri-layer graphene, there are Landau level crossings between monolayer and bi-layer bands in quantum Hall regime. Although most of the Landau Level crossings are predominantly present on the electron sides, we also observe signatures of the crossings on the hole side. This behaviour is consistent with the asymmetry of electron and hole in ABA tri-layer graphene. We observe a series of crossings of the spin and valley resolved Landau Levels.

  4. Lithium cell technology and safety report of the Tri-Service Lithium Safety Committee

    NASA Technical Reports Server (NTRS)

    Reiss, E.


    The organization of the Tri-Service Lithium Safety Committee is described. The following areas concerning lithium batteries are discussed: transportation--DOT Exemption 7052, FAA; disposal; storage; individual testing/test results; and battery design and usage.

  5. 77 FR 65545 - Tri-State Generation and Transmission Association, Inc. v. Western Electric Coordinating Council...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Energy Regulatory Commission Tri-State Generation and Transmission Association, Inc. v. Western Electric Coordinating Council and North American Electric Reliability Corporation; Notice of Complaint Take notice that... petition requesting resolution of the conflict between Western Electric Coordinating Council and...

  6. Structural and functional characterization of TRI3 trichothecene 15-O-acetyltransferase from Fusarium sporotrichioides

    SciTech Connect

    Garvey, Graeme S.; McCormick, Susan P.; Alexander, Nancy J.; Rayment, Ivan


    Fusarium head blight is a devastating disease of cereal crops whose worldwide incidence is increasing and at present there is no satisfactory way of combating this pathogen or its associated toxins. There is a wide variety of trichothecene mycotoxins and they all contain a 12,13-epoxytrichothecene skeleton but differ in their substitutions. Indeed, there is considerable variation in the toxin profile across the numerous Fusarium species that has been ascribed to differences in the presence or absence of biosynthetic enzymes and their relative activity. This article addresses the source of differences in acetylation at the C15 position of the trichothecene molecule. Here, we present the in vitro structural and biochemical characterization of TRI3, a 15-O-trichothecene acetyltransferase isolated from F. sporotrichioides and the 'in vivo' characterization of Deltatri3 mutants of deoxynivalenol (DON) producing F. graminearum strains. A kinetic analysis shows that TRI3 is an efficient enzyme with the native substrate, 15-decalonectrin, but is inactive with either DON or nivalenol. The structure of TRI3 complexed with 15-decalonectrin provides an explanation for this specificity and shows that Tri3 and Tri101 (3-O-trichothecene acetyltransferase) are evolutionarily related. The active site residues are conserved across all sequences for TRI3 orthologs, suggesting that differences in acetylation at C15 are not due to differences in Tri3. The tri3 deletion mutant shows that acetylation at C15 is required for DON biosynthesis even though DON lacks a C15 acetyl group. The enzyme(s) responsible for deacetylation at the 15 position of the trichothecene mycotoxins have not been identified.

  7. Colour matching of composite resin cements with their corresponding try-in pastes.


    Kampouropoulos, D; Gaintantzopoulou, M; Papazoglou, E; Kakaboura, A


    Two shades of four resin cements (Calibra, Clearfil Esthetic, Insure, Variolink II), in light- and dual-curing modes, were tested for colour matching with their corresponding try-in pastes, immediately after photopolymerization and after 24-hour dry and dark storage. Colour measurements were performed for 0.8 mm-thick specimens through a 0.8mm-thick ceramic plate. For each resin cement, colour differences (deltaE) were calculated between the two curing modes, and between the corresponding try-in paste, at baseline and after 24h. deltaE>0 values were detected between all resin cements and their try-in pastes, which were brand/shade/curing mode depended. The try-in pastes of the Variolink II system demonstrated the best colour matching (deltaE<2). Try-in pastes of Calibra and Insure, at both curing modes, did not match at an acceptable value, the shade of their corresponding resin cements (deltaE>3.3). Calibra presented the highest colour differences. deltaE values of the Clearfil Esthetic system immediately after photo-activation ranged between 2 and 3 units. A ceramic restoration may fail aesthetically as a result of not acceptable colour match (deltaE>3.3) between the shade of certain resin cements and their relevant try-in pastes. PMID:25134367

  8. The structural basis of substrate recognition by the eukaryotic chaperonin TRiC/CCT.


    Joachimiak, Lukasz A; Walzthoeni, Thomas; Liu, Corey W; Aebersold, Ruedi; Frydman, Judith


    The eukaryotic chaperonin TRiC (also called CCT) is the obligate chaperone for many essential proteins. TRiC is hetero-oligomeric, comprising two stacked rings of eight different subunits each. Subunit diversification from simpler archaeal chaperonins appears linked to proteome expansion. Here, we integrate structural, biophysical, and modeling approaches to identify the hitherto unknown substrate-binding site in TRiC and uncover the basis of substrate recognition. NMR and modeling provided a structural model of a chaperonin-substrate complex. Mutagenesis and crosslinking-mass spectrometry validated the identified substrate-binding interface and demonstrate that TRiC contacts full-length substrates combinatorially in a subunit-specific manner. The binding site of each subunit has a distinct, evolutionarily conserved pattern of polar and hydrophobic residues specifying recognition of discrete substrate motifs. The combinatorial recognition of polypeptides broadens the specificity of TRiC and may direct the topology of bound polypeptides along a productive folding trajectory, contributing to TRiC's unique ability to fold obligate substrates. PMID:25416944

  9. Trying versus liking fruits and vegetables: correspondence between mothers and preschoolers.


    Worobey, Harriet; Ostapkovich, Kathleen; Yudin, Kristin; Worobey, John


    Extensive research indicates that a diet rich in fruits and vegetables (F&V) protects against numerous illnesses in adulthood, but that most individuals, including children, consume far fewer F&V per day than is recommended. Since evidence suggests that eating habits in childhood track into adulthood, more research is necessary to learn about how parental F&V intake and opportunities influence child F&V consumption. The purpose of this study was to examine the relationship between mothers' F&V preferences and those of their preschool-age children to determine if greater maternal "liking" of fruits and vegetables was associated with their reports of their children's "trying" more fruits and vegetables. Eighty-three mothers completed a questionnaire that assessed whether they and their preschoolers had tried or liked a variety of F&V. Mothers liked 86% of the fruits they tried, girls 76%, and boys 69%. Mothers liked 81% of the vegetables they tried; boys and girls liked 55%. Mothers' likes correlated with F&V that their children tried, but mothers' likes also limited the number of F&V that their children tried. Mothers reported preferences for F&V are associated with estimates of their preschoolers' preferences for F&V. Relative to girls, boys may need additional opportunities for F&V exposure. PMID:21883082

  10. Colour matching of composite resin cements with their corresponding try-in pastes.


    Kampouropoulos, D; Gaintantzopoulou, M; Papazoglou, E; Kakaboura, A


    Two shades of four resin cements (Calibra, Clearfil Esthetic, Insure, Variolink II), in light- and dual-curing modes, were tested for colour matching with their corresponding try-in pastes, immediately after photopolymerization and after 24-hour dry and dark storage. Colour measurements were performed for 0.8 mm-thick specimens through a 0.8mm-thick ceramic plate. For each resin cement, colour differences (deltaE) were calculated between the two curing modes, and between the corresponding try-in paste, at baseline and after 24h. deltaE>0 values were detected between all resin cements and their try-in pastes, which were brand/shade/curing mode depended. The try-in pastes of the Variolink II system demonstrated the best colour matching (deltaE<2). Try-in pastes of Calibra and Insure, at both curing modes, did not match at an acceptable value, the shade of their corresponding resin cements (deltaE>3.3). Calibra presented the highest colour differences. deltaE values of the Clearfil Esthetic system immediately after photo-activation ranged between 2 and 3 units. A ceramic restoration may fail aesthetically as a result of not acceptable colour match (deltaE>3.3) between the shade of certain resin cements and their relevant try-in pastes.

  11. The mealybug Phenacoccus solenopsis suppresses plant defense responses by manipulating JA-SA crosstalk.


    Zhang, Peng-Jun; Huang, Fang; Zhang, Jin-Ming; Wei, Jia-Ning; Lu, Yao-Bin


    Induced plant defenses against herbivores are modulated by jasmonic acid-, salicylic acid-, and ethylene-signaling pathways. Although there is evidence that some pathogens suppress plant defenses by interfering with the crosstalk between different signaling pathways, such evidence is scarce for herbivores. Here, we demonstrate that the mealybug Phenacoccus solenopsis suppresses the induced defenses in tomato. We found that exogenous JA, but not SA, significantly decreased mealybug feeding time and reduced nymphal performance. In addition, constitutive activation of JA signaling in 35s::prosys plants reduced mealybug survival. These data indicate that the JA signaling pathway plays a key role in mediating the defense responses against P. solenopsis. We also found that mealybug feeding decreased JA production and JA-dependent defense gene expression, but increased SA accumulation and SA-dependent gene expression. In SA-deficient plants, mealybug feeding did not suppress but activated JA accumulation, indicating that the suppression of JA-regulated defenses depends on the SA signaling pathway. Mealybugs benefit from suppression of JA-regulated defenses by exhibiting enhanced nymphal performance. These findings confirm that P. solenopsis manipulates plants for its own benefits by modulating the JA-SA crosstalk and thereby suppressing induced defenses.

  12. The mealybug Phenacoccus solenopsis suppresses plant defense responses by manipulating JA-SA crosstalk

    PubMed Central

    Zhang, Peng-Jun; Huang, Fang; Zhang, Jin-Ming; Wei, Jia-Ning; Lu, Yao-Bin


    Induced plant defenses against herbivores are modulated by jasmonic acid-, salicylic acid-, and ethylene-signaling pathways. Although there is evidence that some pathogens suppress plant defenses by interfering with the crosstalk between different signaling pathways, such evidence is scarce for herbivores. Here, we demonstrate that the mealybug Phenacoccus solenopsis suppresses the induced defenses in tomato. We found that exogenous JA, but not SA, significantly decreased mealybug feeding time and reduced nymphal performance. In addition, constitutive activation of JA signaling in 35s::prosys plants reduced mealybug survival. These data indicate that the JA signaling pathway plays a key role in mediating the defense responses against P. solenopsis. We also found that mealybug feeding decreased JA production and JA-dependent defense gene expression, but increased SA accumulation and SA-dependent gene expression. In SA-deficient plants, mealybug feeding did not suppress but activated JA accumulation, indicating that the suppression of JA-regulated defenses depends on the SA signaling pathway. Mealybugs benefit from suppression of JA-regulated defenses by exhibiting enhanced nymphal performance. These findings confirm that P. solenopsis manipulates plants for its own benefits by modulating the JA-SA crosstalk and thereby suppressing induced defenses. PMID:25790868

  13. Tri-Squared Mean Cross Comparative Analysis: An Advanced Post Hoc Qualitative and Quantitative Metric for a More In-Depth Examination of the Initial Research Outcomes of the Tri-Square Test

    ERIC Educational Resources Information Center

    Osler, James Edward


    This monograph provides an epistemological rational for the design of an advanced novel analysis metric. The metric is designed to analyze the outcomes of the Tri-Squared Test. This methodology is referred to as: "Tri-Squared Mean Cross Comparative Analysis" (given the acronym TSMCCA). Tri-Squared Mean Cross Comparative Analysis involves…

  14. Tri-Gas Pressurization System Testing and Modeling for Cryogenic Applications

    NASA Technical Reports Server (NTRS)

    Taylor, B.; Polsgrove, R.; Stephens, J.; Hedayat, A.


    The use of Tri-gas in rocket propulsion systems is somewhat of a new technology. This paper defines Tri-gas as a mixture of gases composed largely of helium with a small percentage of a stoichiometric mixture of hydrogen and oxygen. When exposed to a catalyst the hydrogen and oxygen in the mixture combusts, significantly raising the temperature of the mixture. The increase in enthalpy resulting from the combustion process significantly decreases the required quantity of gas needed to pressurize the ullage of the vehicle propellant tanks. The objective of this effort was to better understand the operating characteristics of Tri-gas in a pressurization system with low temperature applications. In conjunction with ongoing programs at NASA Marshall Space Flight Center, an effort has been undertaken to evaluate the operating characteristics of Tri-gas through modeling and bench testing. Through improved understanding of the operating characteristics, the risk of using this new technology in a launch vehicle propulsion system was reduced. Bench testing of Tri-gas was a multistep process that targeted gas characteristics and performance aspects that pose a risk to application in a pressurization system. Pressurization systems are vital to propulsion system performance. Keeping a target ullage pressure in propulsions tanks is necessary to supply propellant at the conditions and flow rates required to maintain desired engine functionality. The first component of testing consisted of sampling Tri-gas sources that had been stagnant for various lengths of time in order to determine the rate at which stratification takes place. Second, a bench test was set up in which Tri-gas was sent through a catalyst bed. This test was designed to evaluate the performance characteristics of Tri-gas, under low temperature inlet temperatures, in a flight-like catalyst bed reactor. The third, most complex, test examined the performance characteristics of Tri-gas at low temperature temperatures

  15. Tri-party agreement databases, access mechanism and procedures. Revision 2

    SciTech Connect

    Brulotte, P.J.


    This document contains the information required for the Washington State Department of Ecology (Ecology) and the U.S. Environmental Protection Agency (EPA) to access databases related to the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement). It identifies the procedure required to obtain access to the Hanford Site computer networks and the Tri-Party Agreement related databases. It addresses security requirements, access methods, database availability dates, database access procedures, and the minimum computer hardware and software configurations required to operate within the Hanford Site networks. This document supersedes any previous agreements including the Administrative Agreement to Provide Computer Access to U.S. Environmental Protection Agency (EPA) and the Administrative Agreement to Provide Computer Access to Washington State Department of Ecology (Ecology), agreements that were signed by the U.S. Department of Energy (DOE), Richland Operations Office (RL) in June 1990, Access approval to EPA and Ecology is extended by RL to include all Tri-Party Agreement relevant databases named in this document via the documented access method and date. Access to databases and systems not listed in this document will be granted as determined necessary and negotiated among Ecology, EPA, and RL through the Tri-Party Agreement Project Managers. The Tri-Party Agreement Project Managers are the primary points of contact for all activities to be carried out under the Tri-Party Agreement. Action Plan. Access to the Tri-Party Agreement related databases and systems does not provide or imply any ownership on behalf of Ecology or EPA whether public or private of either the database or the system. Access to identified systems and databases does not include access to network/system administrative control information, network maps, etc.

  16. TriAnnot: A Versatile and High Performance Pipeline for the Automated Annotation of Plant Genomes

    PubMed Central

    Leroy, Philippe; Guilhot, Nicolas; Sakai, Hiroaki; Bernard, Aurélien; Choulet, Frédéric; Theil, Sébastien; Reboux, Sébastien; Amano, Naoki; Flutre, Timothée; Pelegrin, Céline; Ohyanagi, Hajime; Seidel, Michael; Giacomoni, Franck; Reichstadt, Mathieu; Alaux, Michael; Gicquello, Emmanuelle; Legeai, Fabrice; Cerutti, Lorenzo; Numa, Hisataka; Tanaka, Tsuyoshi; Mayer, Klaus; Itoh, Takeshi; Quesneville, Hadi; Feuillet, Catherine


    In support of the international effort to obtain a reference sequence of the bread wheat genome and to provide plant communities dealing with large and complex genomes with a versatile, easy-to-use online automated tool for annotation, we have developed the TriAnnot pipeline. Its modular architecture allows for the annotation and masking of transposable elements, the structural, and functional annotation of protein-coding genes with an evidence-based quality indexing, and the identification of conserved non-coding sequences and molecular markers. The TriAnnot pipeline is parallelized on a 712 CPU computing cluster that can run a 1-Gb sequence annotation in less than 5 days. It is accessible through a web interface for small scale analyses or through a server for large scale annotations. The performance of TriAnnot was evaluated in terms of sensitivity, specificity, and general fitness using curated reference sequence sets from rice and wheat. In less than 8 h, TriAnnot was able to predict more than 83% of the 3,748 CDS from rice chromosome 1 with a fitness of 67.4%. On a set of 12 reference Mb-sized contigs from wheat chromosome 3B, TriAnnot predicted and annotated 93.3% of the genes among which 54% were perfectly identified in accordance with the reference annotation. It also allowed the curation of 12 genes based on new biological evidences, increasing the percentage of perfect gene prediction to 63%. TriAnnot systematically showed a higher fitness than other annotation pipelines that are not improved for wheat. As it is easily adaptable to the annotation of other plant genomes, TriAnnot should become a useful resource for the annotation of large and complex genomes in the future. PMID:22645565

  17. Radiation measurement platform for balloon flights based on the TriTel silicon detector telescope

    NASA Astrophysics Data System (ADS)

    Zabori, Balazs; Hirn, Attila; Pazmandi, Tamas; Apathy, Istvan; Szanto, Peter; Deme, Sandor

    Several measurements have been performed on the cosmic radiation field from the surface of the Earth up to the maximum altitudes of research airplanes. However the cosmic radiation field is not well known between 15 km and 30 km. Our experiment idea based on to study the radiation environment in the stratosphere. The main technical goals of our experiment were to test at first time the TriTel 3D silicon detector telescope system for future ISS missons and to develop a balloon technology platform for advanced cosmic radiation and dosimetric measurements. The main scientific goals were to give an assessment of the cosmic radiation field at the altitude of the BEXUS balloons, to use the TriTel system to determine dosimetric and radiation quantities during the ballon flight and to intercompare the TriTel and Pille results to provide a correction factor definition method for the Pille ISS measurements. To fulfil the scientific and technological objectives several different dosimeter systems were included in the experiment: an advanced version of the TriTel silicon detector telescope, Geiger-Müller counters, Pille passive thermoluminescent dosimeters and Solid State Nuclear Track Detectors. The experiment was built by students from Hungarian universities and flew on board the BEXUS stratospheric balloon in Northern Sweden (from ESRANGE Space Center). The float altitude was approximately 28.6 km and the total flight time was about 4 hours. The active instruments measured in real time and the ground team received the collected data continuously during the mission. The main technical goals were received since the operation of the TriTel experienced no failures and the experiment worked as it expected. This paper presents the scientific goals and results. From the TriTel measurements the deposited energy spectra, the Linear Energy Transfer spectra, the average quality factor of the cosmic radiation as well as the absorbed dose and the dose equivalent were determined for the

  18. Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1

    PubMed Central

    Freund, Adam; Zhong, Franklin L.; Venteicher, Andrew S.; Meng, Zhaojing; Veenstra, Timothy D.; Frydman, Judith; Artandi, Steven E.


    SUMMARY Telomere maintenance by telomerase is impaired in the stem cell disease dyskeratosis congenita and during human aging. Telomerase depends upon a complex pathway for enzyme assembly, localization in Cajal bodies and association with telomeres. Here, we identify the chaperonin CCT/TRiC as a critical regulator of telomerase trafficking, using a high content genome-wide siRNA screen in human cells for factors required for Cajal body-localization. We find that TRiC is required for folding the telomerase cofactor TCAB1, which controls trafficking of telomerase and small Cajal body RNAs (scaRNAs). Depletion of TRiC causes loss of TCAB1 protein, mislocalization of telomerase and scaRNAs to nucleoli, and failure of telomere elongation. DC patient-derived mutations in TCAB1 impair folding by TRiC, disrupting telomerase function and leading to severe disease. Our findings establish a critical role for TRiC-mediated protein folding in the telomerase pathway and link proteostasis, telomere maintenance and human disease. PMID:25467444

  19. Toxics Release Inventory Expansion Rule Phase 3 (TRI-P3)

    SciTech Connect

    Evans, R.A.; Saunders, A.D.; Worley, G.G.


    The ORR [East Tennessee Technology Park (ETTP), Y-12 Plant, and Oak Ridge National Laboratory (ORNL)] is considered a single facility for reporting by the DOE prime contractors. The processing, manufacturing, or "otherwise use" Section313 chemicals are combined to determine TRI reportability. Such is the case with lead metal, which is one of two chemicals for which reportin~ forms were prepared in this pilot study (Task 2;1. The lead shop at ORNL exceeded the reporting threshold, causing a lead activity at a Y-1 2 machine shop and lead in waste at ETTP to be reportable. TRI-P3 report preparation time for lead totaled 36.5 hours. The second chemical investigated and reported (chromium) also required nearly a man-week for report preparation and documentation by experienced TRI personnel. The ORR TRI report typically includes about six chemicals, so an estimate of the TRI-P3 incremental reporting burden for ORR would be six weeks for experienced personnel axI d two/three man-months for first-time ORR preparers.

  20. Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.


    Freund, Adam; Zhong, Franklin L; Venteicher, Andrew S; Meng, Zhaojing; Veenstra, Timothy D; Frydman, Judith; Artandi, Steven E


    Telomere maintenance by telomerase is impaired in the stem cell disease dyskeratosis congenita and during human aging. Telomerase depends upon a complex pathway for enzyme assembly, localization in Cajal bodies, and association with telomeres. Here, we identify the chaperonin CCT/TRiC as a critical regulator of telomerase trafficking using a high-content genome-wide siRNA screen in human cells for factors required for Cajal body localization. We find that TRiC is required for folding the telomerase cofactor TCAB1, which controls trafficking of telomerase and small Cajal body RNAs (scaRNAs). Depletion of TRiC causes loss of TCAB1 protein, mislocalization of telomerase and scaRNAs to nucleoli, and failure of telomere elongation. DC patient-derived mutations in TCAB1 impair folding by TRiC, disrupting telomerase function and leading to severe disease. Our findings establish a critical role for TRiC-mediated protein folding in the telomerase pathway and link proteostasis, telomere maintenance, and human disease. PMID:25467444

  1. The structural basis of substrate recognition by the eukaryotic chaperonin TRiC/CCT

    PubMed Central

    Joachimiak, Lukasz A.; Walzthoeni, Thomas; Liu, Corey; Aebersold, Ruedi; Frydman, Judith


    Summary The eukaryotic chaperonin TRiC (also called CCT) is the obligate chaperone for many essential proteins. TRiC is hetero-oligomeric, comprising two stacked rings of eight different subunits each. Subunit diversification from simpler archaeal chaperonins appears linked to proteome expansion. Here, we integrate structural, biophysical and modeling approaches to identify the hitherto unknown substrate-binding site in TRiC and uncover the basis of substrate recognition. NMR and modeling provided a structural model of a chaperonin-substrate complex. Mutagenesis and crosslinking-mass spectrometry validated the identified substrate binding interface and demonstrate that TRiC contacts full-length substrates combinatorially in a subunit-specific manner. The binding site of each subunit has a distinct, evolutionarily conserved, pattern of polar and hydrophobic residues specifying recognition of discrete substrate motifs. The combinatorial recognition of polypeptides broadens the specificity of TRiC and may direct the topology of bound polypeptides along a productive folding trajectory, contributing to its unique ability to fold obligate substrates. PMID:25416944

  2. TriAnd and its siblings: satellites of satellites in the Milky Way halo

    NASA Astrophysics Data System (ADS)

    Deason, A. J.; Belokurov, V.; Hamren, K. M.; Koposov, S. E.; Gilbert, K. M.; Beaton, R. L.; Dorman, C. E.; Guhathakurta, P.; Majewski, S. R.; Cunningham, E. C.


    We explore the Triangulum-Andromeda (TriAnd) overdensity in the SPLASH (Spectroscopic and Photometric Landscape of Andromeda's Stellar Halo) and SEGUE (the Sloan Extension for Galactic Understanding and Exploration) spectroscopic surveys. Milky Way main-sequence turn-off stars in the SPLASH survey reveal that the TriAnd overdensity and the recently discovered Pan-Andromeda Archaeological Survey (PAndAS) stream share a common heliocentric distance (D ˜ 20 kpc), position on the sky, and line-of-sight velocity (VGSR ˜ 50 km s-1). Similarly, A-type, giant, and main-sequence turn-off stars selected from the SEGUE survey in the vicinity of the Segue 2 satellite show that TriAnd is prevalent in these fields, with a velocity and distance similar to Segue 2. The coincidence of the PAndAS stream and Segue 2 satellite in positional and velocity space to TriAnd suggests that these substructures are all associated, and may be a fossil record of group-infall on to the Milky Way halo. In this scenario, the Segue 2 satellite and PAndAS stream are `satellites of satellites', and the large, metal-rich TriAnd overdensity is the remains of the group central.

  3. The TriBeam system: Femtosecond laser ablation in situ SEM

    SciTech Connect

    Echlin, McLean P.; Straw, Marcus; Randolph, Steven; Filevich, Jorge; Pollock, Tresa M.


    Femtosecond laser ablation offers the unique ability to remove material at rates that are orders of magnitude faster than existing ion beam technologies with little or no associated damage. By combining ultrafast lasers with state-of-the-art electron microscopy equipment, we have developed a TriBeam system capable of targeted, in-situ tomography providing chemical, structural, and topographical information in three dimensions of near mm{sup 3} sized volumes. The origins, development, physics, current uses, and future potential for the TriBeam system are described in this tutorial review. - Graphical abstract: Display Omitted - Highlights: • An emerging tool, the TriBeam, for in situ femtosecond (fs) laser ablation is presented. • Fs laser ablation aided tomography at the mm{sup 3}-scale is demonstrated. • Fs laser induced deposition of Pt is demonstrated at sub-diffraction limit resolution. • Fs laser surface structuring is reviewed as well as micromachining applications.

  4. Temperature dependent Raman spectroscopic study of mono-, bi-, and tri-layer molybdenum ditelluride

    NASA Astrophysics Data System (ADS)

    Park, June; Kim, Younghee; Jhon, Young In; Jhon, Young Min


    We investigate the thermal properties of mono-, bi- and tri-layer MoTe2 by using temperature-dependent Raman spectroscopy ranging from 90 K to 300 K. The E2g 1 and B2g 1 modes of MoTe2 blueshift as the temperature decreases. The temperature dependence of the peak positions obtained from mono- to tri-layer MoTe2 is analyzed using the Grüneisen model. The first order temperature coefficients of E2g 1 and B2g 1 Raman modes of mono- to tri-layer MoTe2 are extracted. This study provides the fundamental information about the thermal properties of MoTe2 layers, which is crucial for developing thermal and electronic applications of MoTe2 based devices.

  5. Characterization of new glycolipid biosurfactants, tri-acylated mannosylerythritol lipids, produced by Pseudozyma yeasts.


    Fukuoka, Tokuma; Morita, Tomotake; Konishi, Masaaki; Imura, Tomohiro; Kitamoto, Dai


    Mannosylerythritol lipids (MELs) are glycolipid biosurfactants produced by Pseudozyma yeasts. They show not only the excellent interfacial properties but also versatile biochemical actions. In the course of MEL production from soybean oil by P. antarctica and P. rugulosa, some new extracellular glycolipids (more hydrophobic than the previously reported di-acylated MELs) were found in the culture medium. The most hydrophobic one was identified as 1-O-alka(e)noyl-4-O-[(4',6'-di-O-acetyl-2',3'-di-O-alka(e)noyl)-beta-D-mannopyranosyl]-D-erythritol, namely tri-acylated MEL. Others were tri-acylated MELs bearing only one acetyl group. The tri-acylated MEL could be prepared by the lipase-catalyzed esterification of a di-acylated MEL with oleic acid implying that the new glycolipids are synthesized from di-acylated MELs in the culture medium containing the residual fatty acids. PMID:17417694

  6. Tri-layer wrinkling as a mechanism for anchoring center initiation in the developing cerebellum.


    Lejeune, Emma; Javili, Ali; Weickenmeier, Johannes; Kuhl, Ellen; Linder, Christian


    During cerebellar development, anchoring centers form at the base of each fissure and remain fixed in place while the rest of the cerebellum grows outward. Cerebellar foliation has been extensively studied; yet, the mechanisms that control anchoring center initiation and position remain insufficiently understood. Here we show that a tri-layer model can predict surface wrinkling as a potential mechanism to explain anchoring center initiation and position. Motivated by the cerebellar microstructure, we model the developing cerebellum as a tri-layer system with an external molecular layer and an internal granular layer of similar stiffness and a significantly softer intermediate Purkinje cell layer. Including a weak intermediate layer proves key to predicting surface morphogenesis, even at low stiffness contrasts between the top and bottom layers. The proposed tri-layer model provides insight into the hierarchical formation of anchoring centers and establishes an essential missing link between gene expression and evolution of shape.

  7. How big is a Cp? Novel cycloheptatrienyl zirconium complexes with tri-, tetra- and pentasubstituted cyclopentadienyl ligands.


    Bauer, Heiko; Glöckner, Andreas; Tagne Kuate, Alain C; Schäfer, Sebastian; Sun, Yu; Freytag, Matthias; Tamm, Matthias; Walter, Marc D; Sitzmann, Helmut


    The new bulky cyclopentadienyl anions 1,2,4-tri(cyclopentyl)cyclopentadienide and 2,3-diisopropyl-1,4-dimethyl-5-trimethylsilyl-cyclopentadienide were prepared. These and the already known 1,2,4-tri(cyclohexyl)-, 1,2,4-tri(isopropyl)-, 2,3-diisopropyl-1,4-dimethyl-, 1,3,4-triisopropyl-2,5-dimethyl-, pentaphenyl-, and p-butylphenyl-tetraphenyl-cyclopentadienide as well as tert-butylindenide were coordinated to the cycloheptatrienylzirconium fragment [(CHT)ZrCl(tmeda)]. The nine zirconium complexes of the [(CHT)Zr(Cp)] type were characterized by elemental analysis and NMR spectroscopy. For five of the sandwich complexes X-ray crystal structure determination could be carried out; structures of the four others were obtained by DFT calculations. The data serve as a basis for cone angle measurements of cyclopentadienyl ligands to evaluate the steric demand of these ligands.

  8. Interferences in photo-detached electron spectra from a non-collinear tri-atomic anion

    NASA Astrophysics Data System (ADS)

    Afaq, A.; Farooq, K.; A. Khan, M.; Yi, Xue-Xi


    The electron flux oscillations in photo-detachment of a non-collinear tri-atomic anion have been studied by taking each atom of the system as a coherent source of detached-electron wave. These electron waves traversing along three different trajectories result in a quantum interference. An analytical expression of detached-electron flux is evaluated for various detached-electron energies and for different geometrical shapes of the system. The results show that the electron flux distributions exhibit molecular shape-induced oscillatory structures. These oscillations are explained using the semi-classical closed-orbit theory; the outgoing electron waves produced from one center are propagated in the vicinity of the sources at other centers. It is also observed that in a particular case our non-collinear tri-atomic system reduces to the collinear tri-atomic system recently published.

  9. A Tri-Factor Model for Integrating Ratings Across Multiple Informants

    PubMed Central

    Bauer, Daniel J.; Howard, Andrea L.; Baldasaro, Ruth E.; Curran, Patrick J.; Hussong, Andrea M.; Chassin, Laurie; Zucker, Robert A.


    Psychologists often obtain ratings for target individuals from multiple informants such as parents or peers. In this paper we propose a tri-factor model for multiple informant data that separates target-level variability from informant-level variability and item-level variability. By leveraging item-level data, the tri-factor model allows for examination of a single trait rated on a single target. In contrast to many psychometric models developed for multitrait-multimethod data, the tri-factor model is predominantly a measurement model. It is used to evaluate item quality in scale development, test hypotheses about sources of target variability (e.g., sources of trait differences) versus informant variability (e.g., sources of rater bias), and generate integrative scores that are purged of the subjective biases of single informants. PMID:24079932

  10. Analysis of weak signal detection based on tri-stable system under Levy noise

    NASA Astrophysics Data System (ADS)

    Li-Fang, He; Ying-Ying, Cui; Tian-Qi, Zhang; Gang, Zhang; Ying, Song


    Stochastic resonance system is an effective method to extract weak signal. However, system output is directly influenced by system parameters. Aiming at this, the Levy noise is combined with a tri-stable stochastic resonance system. The average signal-to-noise ratio gain is regarded as an index to measure the stochastic resonance phenomenon. The characteristics of tri-stable stochastic resonance under Levy noise is analyzed in depth. First, the method of generating Levy noise, the effect of tri-stable system parameters on the potential function and corresponding potential force are presented in detail. Then, the effects of tri-stable system parameters w, a, b, and Levy noise intensity amplification factor D on the resonant output can be explored with different Levy noises. Finally, the tri-stable stochastic resonance system is applied to the bearing fault detection. Simulation results show that the stochastic resonance phenomenon can be induced by tuning the system parameters w, a, and b under different distributions of Levy noise, then the weak signal can be detected. The parameter intervals which can induce stochastic resonances are approximately equal. Moreover, by adjusting the intensity amplification factor D of Levy noise, the stochastic resonances can happen similarly. In bearing fault detection, the detection effect of the tri-stable stochastic resonance system is superior to the bistable stochastic resonance system. Project supported by the National Natural Science Foundation of China (Grant No. 61371164), the Chongqing Municipal Distinguished Youth Foundation, China (Grant No. CSTC2011jjjq40002), and the Research Project of Chongqing Municipal Educational Commission, China (Grant No. KJ130524).

  11. Hanford and the tri-cities economy: Review and outlook, March 1989

    SciTech Connect

    Scott, M.J.; Belzer, D.B.; March, S.J.; Beck, D.M.; Schultz, R.W.; Harkreader, S.A.


    The economy of the Tri-Cities, Washington area (primarily, Benton and Franklin Counties) is in transition due to major changes in two Department of Energy programs at Hanford---the abrupt ending of the Basalt Waste Isolation Project (BWIP) in December 1987 and the placing of the N Reactor in ''cold standby'' status in February 1988. This report reviews the economic situation in the Tri-Cities during 1988 and presents forecasts for key economic indicators for 1989. This report will be updated about every six months to review the changes in the area economy and forecast the near-term outlook. 6 figs., 33 tabs.

  12. More than just great quotes: An introduction to the Canadian Tri-Council’s qualitative requirements

    PubMed Central

    Boffa, Jody; Moules, Nancy; Mayan, Maria; Cowie, Robert L


    Although at times misunderstood by the general research community, qualitative research has developed out of diverse, rich and complex philosophical traditions and theoretical paradigms. In the most recent Canadian Tri-Council policy statement on the ethical conduct of research involving humans, a chapter was devoted to a summary of methods and methodological requirements that characterize robust qualitative research, despite the diversity of approaches. To dispel common misperceptions about qualitative research and introduce the unfamiliar reader to these requirements, the work of a qualitative study on isoniazid preventive therapy for prophylaxis of tuberculosis published in AIDS is critiqued alongside each of the Tri-Council’s nine requirements. PMID:24421811

  13. Trying something new: reform as embracing the possible, the familiar, and the at-hand.


    Young, Patricia K


    Trying something new in the reform of teaching through the use of a new nursing pedagogy, Narrative Pedagogy, is illuminated. Pedagogies are specific approaches to teaching and learning. Narrative Pedagogy is a site-specific approach to teaching and learning that evolves out of present resources and creates new possibilities. Exemplar student, teacher, and nurse preceptor narratives about their experiences of trying something new in precepting junior-level students in the acute care clinical setting were analyzed hermeneutically as an interpretive phenomenological study. Although Narrative Pedagogy is site specific, the processes of using this pedagogy for reform are generalizable. PMID:15301460

  14. More than just great quotes: An introduction to the Canadian Tri-Council's qualitative requirements.


    Boffa, Jody; Moules, Nancy; Mayan, Maria; Cowie, Robert L


    Although at times misunderstood by the general research community, qualitative research has developed out of diverse, rich and complex philosophical traditions and theoretical paradigms. In the most recent Canadian Tri-Council policy statement on the ethical conduct of research involving humans, a chapter was devoted to a summary of methods and methodological requirements that characterize robust qualitative research, despite the diversity of approaches. To dispel common misperceptions about qualitative research and introduce the unfamiliar reader to these requirements, the work of a qualitative study on isoniazid preventive therapy for prophylaxis of tuberculosis published in AIDS is critiqued alongside each of the Tri-Council's nine requirements.

  15. The TriCouncil for Nursing: An Interorganizational Collaboration for Advancing the Profession.


    Bednash, Geraldine Polly


    The TriCouncil for Nursing is a coalition of 4 leading nursing organizations: the American Association of Colleges of Nursing, the American Nurses Association, the American Organization of Nurse Executives, and the National League for Nursing. This informal, yet highly complex, collaboration has endeavored to advance the profession for almost 4 decades despite the inherent challenges in coalition formation and sustainment. Coalition building occurs when organizations seek the potential to advance common issues or protect individual resources or status, and by their very nature have the potential to fail. The history of the TriCouncil for Nursing provides evidence of the challenges associated with the process of developing consensus and the benefits of working to create consensus to achieve common goals. The commitment of the TriCouncil member organizations to sustain this coalition and find consensus across an array of challenging issues and in complex environments has created significant policy advances for the profession, which provides evidence of the benefits associated with this type of collaborative work. This coalition has continued despite the inherent challenges for organizations seeking consensus. The TriCouncil commitment to lead in advocacy for the profession and create significant policy to change health care models the value of this type of effort.

  16. The TRY Project: A Demonstration of a Comprehensive Educational Model for Disadvantaged Youth. Final Report.

    ERIC Educational Resources Information Center

    Sharar, Paul H.; And Others

    Training Resources for Youth, Incorporated (TRY) was formed as an independent membership corporation under the laws of New York State to conduct a demonstration training center for out-of-school, out-of-work, or underemployed male youth, age 17 through 21. The basic goals were to develop sound methods and techniques for producing positive changes…

  17. The TriLab, a Novel ICT Based Triple Access Mode Laboratory Education Model

    ERIC Educational Resources Information Center

    Abdulwahed, Mahmoud; Nagy, Zoltan K.


    This paper introduces a novel model of laboratory education, namely the TriLab. The model is based on recent advances in ICT and implements a three access modes to the laboratory experience (virtual, hands-on and remote) in one software package. A review of the three modes is provided with highlights of advantages and disadvantages of each mode.…

  18. Flexible inverted polymer solar cells with an indium-free tri-layer cathode

    SciTech Connect

    El Hajj, Ahmad; Lucas, Bruno Schirr-Bonnans, Martin; Ratier, Bernard; Kraft, Thomas M.; Torchio, Philippe


    Indium tin oxide (ITO)-free inverted polymer solar cells (PSCs) have been fabricated without the need of an additional electron transport layer. The indium-free transparent electrode consists of a tri-layer stack ZnO (30 nm)/Ag (14 nm)/ZnO (30 nm) deposited on glass and plastic substrates via ion-beam sputtering. The tri-layer electrodes exhibit similar physical properties to its ITO counterpart, specifically yielding high transmittance and low resistivity (76.5% T at 550 nm, R{sub sq} of 8 Ω/◻) on plastic substrates. The novel tri-layer electrode allows for the fabrication of inverted PSCs without the additional ZnO interfacial layer commonly deposited between ITO and the photoactive layer. This allows for the preparation of thinner plastic solar cells using less material than conventional architectures. Initial studies involving the newly realized architecture (tri-layer electrode/P3HT:PCBM/PEDOT:PSS/Ag) have shown great promise for the transition from ITO to other viable electrodes in organic electronics.

  19. Youth Experience of Trying to Get off the Street: What Has Helped and Hindered

    ERIC Educational Resources Information Center

    Brown, Tracy L.; Amundson, Norman E.


    This qualitative study involved 20 youth (18 males, 1 female, 1 transgender, ages 19-24) living in Vancouver, British Columbia, who reported 259 critical incidents of what helped or hindered their experiences as they tried to get off the street. What helped included (a) taking responsibility, (b) engaging in constructive activities, (c) friends…

  20. 78 FR 73822 - Tri-State Generation and Transmission Association, Inc.: Notice of Availability of an...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Procedures (7 CFR Part 1794) in connection with potential impacts related to a proposal by Tri-State... compliance with Section 106 with the steps taken to comply with NEPA and its environmental policies and... requirements as prescribed in RUS's Environmental Policies and Procedures (7 CFR Part 1794). Dated: November...

  1. Tri-substituted acylhydrazines as tertiary amide bioisosteres: HCV NS5B polymerase inhibitors.


    Canales, Eda; Carlson, Joseph S; Appleby, Todd; Fenaux, Martijn; Lee, Johnny; Tian, Yang; Tirunagari, Neeraj; Wong, Melanie; Watkins, William J


    The use of a tri-substituted acylhydrazine as an isostere of a tertiary amide was explored in a series of HCV NS5B thumb site II inhibitors. Direct replacement generated an analog with similar conformational and physicochemical properties. The series was extended to produce compounds with potent binding affinities and encouraging levels of cellular potency.

  2. Exciton Binding Energy in Organic-Inorganic Tri-Halide Perovskites.


    Askar, Abdelrahman M; Shankar, Karthik


    The recent dramatic increase in the power conversion efficiencies of organic-inorganic tri-halide perovskite solar cells has triggered intense research worldwide and created a paradigm shift in the photovoltaics field. It is crucial to develop a solid understanding of the photophysical processes underlying solar cell operation in order to both further improve the photovoltaic performance of perovskite solar cells as well as to exploit the broader optoelectronic applications of the tri-halide perovskites. In this short review, we summarize the main research findings about the binding energy of excitons in tri-halide perovskite materials and find that a value in the range of 2-22 meV at room temperature would be a safe estimate. Spontaneous free carrier generation is the dominant process taking place directly after photoexcitation in organic-inorganic tri-halide perovskites at room temperature, which eliminates the exciton diffusion bottleneck present in organic solar cells and constitutes a major contributing factor to the high photovoltaic performance of this material. PMID:27427650

  3. Factors associated with BMI, weight perceptions and trying to lose weight in African-American smokers.


    Lee, Rebecca E; Harris, Kari Jo; Catley, Delwyn; Shostrom, Valerie; Choi, Simon; Mayo, Matthew S; Okuyemi, Kola; Kaur, Harsohena; Ahluwalia, Jasjit S


    This study examined sociodemographic, behavioral and psychosocial factors associated with BMI, weight perceptions and trying to lose weight among African-American smokers (N=600, M=44.2 years, 70% female). Sixty-eight percent of the sample were overweight or obese (sample BMI M=28.0, SD=6.7). Three separate, simultaneous multivariable regression models were used to determine which factors were associated with BMI, weight perceptions and trying to lose weight. Poorer health, female gender and high-school education or higher were significantly associated with higher BMIs (p<0.05). Being female (OR=5.8, 95% CI=3.6-9.3) and having a higher BMI (OR=0.6, 95% CI=0.5-0.6) was associated with perception of overweight and smoking more cigarettes per day (OR=1.0, 95% CI=1.0-1.1), and perceiving oneself as overweight (OR=14.1, 95% CI=8.2-24.2) was associated with trying to lose weight. Participants somewhat underestimated their BMI in their weight perceptions. Those who perceived themselves as overweight were more likely to be trying to lose weight; therefore, increasing participant awareness of actual BMI status may lead to improved weight-control efforts in African-American smokers. Several expected associations with outcomes were not found, suggesting that BMI and weight constructs are not well-understood in this population.

  4. A Tri-Citation Analysis Exploring the Citation Image of Kurt Lewin.

    ERIC Educational Resources Information Center

    Marion, Linda S.


    Presents the initial phase of a comparison of cocitation and social network analysis methods for the study of scholarly communication, based on a case study of the intellectual contributions of Kurt Lewin, a social psychologist. Highlights include an author tri-citation analysis; cluster analysis; multidimensional scaling; and diffusion of ideas.…

  5. 76. ARAII. After SL1 explosion, operators shielded crane cab try ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    76. ARA-II. After SL-1 explosion, operators shielded crane cab try to open door of SL-1 tank building. January 6, 1961. Ineel photo no. 61-80. Photographer: Holmes. - Idaho National Engineering Laboratory, Army Reactors Experimental Area, Scoville, Butte County, ID

  6. Middle School Learners' Ontological "Trying-on" of Dimensions: A Phenomenological Investigation

    ERIC Educational Resources Information Center

    Valentine, Keri Duncan; Kopcha, Theodore J.


    This paper shares findings from a post-intentional phenomenological study aimed at understanding learners' experience investigating space and dimension concepts in a fifth and sixth grade mathematics class. Findings indicate experiences in this study manifest as an ontological "trying-on" of geometric dimensions (e.g., through…

  7. Using Constructivist Career Development to Improve Career Decision Self-Efficacy in TRiO Students

    ERIC Educational Resources Information Center

    Grier-Reed, Tabitha; Ganuza, Zoila


    Although more high school graduates are attending college, many are not graduating (The Bill and Melinda Gates Foundation, 2004). First-generation, low-income, and underrepresented students are especially at risk for falling through the cracks. To help address this issue, programs such as TRiO Student Support Services (SSS) assist…

  8. Simplifying touch data from tri-axial sensors using a new data visualization tool.


    Salud, Lawrence H; Kwan, Calvin; Pugh, Carla M


    Quantification and evaluation of palpation is a growing field of research in medicine and engineering. A newly developed tri-axial touch sensor has been designed to capture a multi-dimensional profile of touch-loaded forces. We have developed a data visualization tool as a first step in simplifying interpretation of touch for assessing hands-on clinical performance.

  9. Tri-integrable coupling of the Kaup-Newell soliton hierarchy and Liouville integrability

    NASA Astrophysics Data System (ADS)

    Yu, Shuimeng; Ye, Yujian; Zhang, Jun; Song, Junquan


    Based on a matrix Lie algebra consisting of 4 × 4 block matrices, new tri-integrable coupling of the Kaup-Newell soliton hierarchy is constructed. Then, the bi-Hamiltonian structure which leads to Liouville integrability of this coupling is furnished by the variational identity.

  10. Investment in hydrogen tri-generation for wastewater treatment plants under uncertainties

    NASA Astrophysics Data System (ADS)

    Gharieh, Kaveh; Jafari, Mohsen A.; Guo, Qizhong


    In this article, we present a compound real option model for investment in hydrogen tri-generation and onsite hydrogen dispensing systems for a wastewater treatment plant under price and market uncertainties. The ultimate objective is to determine optimal timing and investment thresholds to exercise initial and subsequent options such that the total savings are maximized. Initial option includes investment in a 1.4 (MW) Molten Carbonate Fuel Cell (MCFC) fed by mixture of waste biogas from anaerobic digestion and natural gas, along with auxiliary equipment. Produced hydrogen in MCFC via internal reforming, is recovered from the exhaust gas stream using Pressure Swing Adsorption (PSA) purification technology. Therefore the expansion option includes investment in hydrogen compression, storage and dispensing (CSD) systems which creates additional revenue by selling hydrogen onsite in retail price. This work extends current state of investment modeling within the context of hydrogen tri-generation by considering: (i) Modular investment plan for hydrogen tri-generation and dispensing systems, (ii) Multiple sources of uncertainties along with more realistic probability distributions, (iii) Optimal operation of hydrogen tri-generation is considered, which results in realistic saving estimation.

  11. H.p.l.c. analysis of di- and tri-carboxylic porphyrins in porphyric patients.

    PubMed Central

    Jackson, A H; Rao, K R; Smith, S G; Lash, T D


    New h.p.l.c. methods have been developed for the quantitative determination of di- and tri-carboxylic porphyrin methyl esters, and applied to the analysis of faecal extracts from patients with four different types of porphyria. PMID:3994688

  12. Making Mission Statements Operational: Perceptions of Principals from Tri-Association Schools

    ERIC Educational Resources Information Center

    Fayad, Juan David; Yoshida, Roland K.


    Researchers and theorists in the management and educational leadership fields have debated the importance of mission statements. This study investigated this issue within the context of American schools that are members of the Tri-Association (Mexico, Central America, Colombia, and the Caribbean). The results showed that about the same percentage…

  13. Wake structure of axial-flow hydrokinetic turbines in tri-frame arrangement

    NASA Astrophysics Data System (ADS)

    Chawdhary, Saurabh; Yang, Xiaolei; Hill, Craig; Khosronejad, Ali; Guala, Michele; Sotiropoulos, Fotis


    Marine and hydro-kinetic (MHK) energy hold promise for future of sustainable energy generation. Tri-frame of turbines, three turbines mounted on vertices of a triangle, are an effective way to build a power producing array of hydrokinetic turbines in marine environment. Large eddy simulation (LES) is used to simulate the flow past a tri-frame and characterize its wake. Full geometry of all three turbines in the tri-frame is resolved using the Curvilinear Immersed Boundary (CURVIB) method of Kang et al. (2011). High fidelity solution of flow field is obtained owing to the inclusion of detailed geometry of the turbines. Excellent agreement is obtained with the experiments conducted in a flume at Saint Anthony Falls Laboratory (SAFL). The wake evolution of the three turbines is compared to that of an isolated single turbine. The differences in wake dynamics are highlighted to elucidate the importance of turbine wake interaction in an array. The simulations indicate lower levels of TKE and lower levels of momentum deficit in the wake of the upstream turbine of tri-frame compared to the other turbines. Analysis of the far wake recovery is useful for the optimal MHK array design. This work was supported by NSF grant IIP-1318201. The simulations were carried out at the Minnesota Supercomputing Institute.

  14. Challenges and Mental Health Experiences of Lesbian and Bisexual Women Who Are Trying to Conceive

    ERIC Educational Resources Information Center

    Yager, Christina; Brennan, David; Steele, Leah S.; Epstein, Rachel; Ross, Lori E.


    To date, there is little evidence to inform social work practice with lesbian and bisexual women who are trying to conceive (TTC). The authors report a preliminary examination of the mental health experiences of lesbian and bisexual women who are TTC, through a comparison with lesbian and bisexual women in the postpartum period (PP). Thirty-three…

  15. Metallic conductance at the interface of tri-color titanate superlattices

    SciTech Connect

    Kareev, M. Cao, Yanwei; Liu, Xiaoran; Middey, S.; Meyers, D.; Chakhalian, J.


    Ultra-thin tri-color (tri-layer) titanate superlattices ([3 u.c. LaTiO{sub 3}/2 u.c. SrTiO{sub 3}/3 u.c. YTiO{sub 3}], u.c. = unit cells) were grown in a layer-by-layer way on single crystal TbScO{sub 3} (110) substrates by pulsed laser deposition. High sample quality and electronic structure were characterized by the combination of in-situ photoelectron and ex-situ structure and surface morphology probes. Temperature-dependent sheet resistance indicates the presence of metallic interfaces in both [3 u.c. LaTiO{sub 3}/2 u.c. SrTiO{sub 3}] bi-layers and all the tri-color structures, whereas a [3 u.c. YTiO{sub 3}/2 u.c. SrTiO{sub 3}] bi-layer shows insulating behavior. Considering that in the bulk YTiO{sub 3} is ferromagnetic below 30 K, the tri-color titanate superlattices provide an opportunity to induce tunable spin-polarization into the two-dimensional electron gas with Mott carriers.

  16. The TRY Foundation: A Case Study in Private Community Development Organizations.

    ERIC Educational Resources Information Center

    McClure, Paul T.

    This is a case study of the TRY Foundation, a privately funded non-profit corporation devoting its resources to "community and human development in disadvantaged areas." Activities sponsored by its primate unit, the Willowbrook Chapter of Watts, Los Angeles, include: thrift shop, preventive dentistry clinic, Operation Vegetable Basket--which…

  17. Tri-P-LETS: Changing the Face of High School Computer Science

    ERIC Educational Resources Information Center

    Sherrell, Linda; Malasri, Kriangsiri; Mills, David; Thomas, Allen; Greer, James


    From 2004-2007, the University of Memphis carried out the NSF-funded Tri-P-LETS (Three P Learning Environment for Teachers and Students) project to improve local high-school computer science curricula. The project reached a total of 58 classrooms in eleven high schools emphasizing problem solving skills, programming concepts as opposed to syntax,…

  18. 78 FR 53243 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed Rulemaking A... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... temporary safety zone upon the navigable waters of the San Diego Bay, San Diego, CA, in support of...

  19. 76 FR 55796 - Safety Zone; TriRock Triathlon, San Diego Bay, San Diego, CA

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock Triathlon, San Diego Bay, San Diego... safety zone upon the specified navigable waters of the San Diego Bay, San Diego, California, in support of a bay swim in San Diego Harbor. This safety zone is necessary to provide for the safety of...

  20. 77 FR 54811 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA

    Federal Register 2010, 2011, 2012, 2013, 2014


    .... SUPPLEMENTARY INFORMATION: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... safety zone upon the navigable waters of the San Diego Bay, San Diego, CA, in support of a bay swim...

  1. Coronary Heart Disease Knowledge and Risk Factors among Tri-Ethnic College Students

    ERIC Educational Resources Information Center

    Koutoubi, Samer; Huffman, Fatma G.; Ciccazzo, Michele W.; Himburg, Susan P.; Johnson, Paulette


    Objectives: Coronary heart disease (CHD) is the leading cause of death in the United States and Europe. This study identified and compared nutritional knowledge associated with CHD risk factors among tri-ethnic college students. Design: A quantitative, cross-sectional, observational study using questionnaires. Setting: University laboratory.…

  2. 77 FR 23409 - Toxics Release Inventory (TRI) Reporting for Facilities Located in Indian Country and...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... are located. In 1990, EPA finalized regulations in the Federal Register (FR) requiring facilities in Indian country to submit annual TRI reports to EPA and the appropriate tribal government (55 FR 30632... preambles to the proposed and final rules. Id.; 54 FR 12992 (March 29, 1989). These amendments,...

  3. 78 FR 43971 - Amendment of Class E Airspace; Tri-Cities, TN

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Class D and E airspace in the Tri-Cities, TN, area (78 FR 7993). The line defining the exclusion of...; (2) is not a ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034; February...: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p....

  4. "How To Succeed in Business Without Really Trying." Spotlight on Theater Notes.

    ERIC Educational Resources Information Center

    Carr, John C.

    This booklet presents a variety of materials concerning the current revival of the 1961 play "How to Succeed in Business Without Really Trying." After a brief introduction to the play, the booklet discusses the plot of the play, how it went from best seller to prize-winning musical, biographical information on the lead actor (Matthew Broderick)…


    EPA Science Inventory

    On November 12-13, 1999, Approximately 300 people attended the Delmarva Coastal Bays Conference III: Tri-State Approaches to Preserving Aquatic Resources (CBCIII). The conference was organized by the Assateague Coastal Trust with planning and financial assistance from twenty-one ...

  6. Trying Physics: Analyzing the Motion of the Quickest Score in International Rugby

    NASA Astrophysics Data System (ADS)

    Goff, John Eric; Lipscombe, Trevor Davis


    The hearts of sports fans were stirred recently by the fastest-ever try scored in international rugby. Welsh winger Dafydd Howells crossed the Fijian try line to score a mere six seconds after Angus O'Brien had started the game with a kickoff, in one of the fixtures in rugby's Junior World Cup played on June 2, 2014, in New Zealand. This startlingly quick score, though, is of interest to physics players as well as rugby players. Howells' try serves as an intriguing way to involve students in one of the "core competencies" of physicists—to model events in the real world. And with the Rugby World Cup taking place in 2015 in England, and rugby sevens making its debut in the 2016 Summer Olympics in Brazil (U.S. teams have qualified for both events), rugby is increasing in popularity in America and is even gaining some coverage on television. Thanks to You-Tube, Howells' try is readily available to serve as a laboratory experiment for students to analyze.

  7. A Tri-Reference Point Theory of Decision Making under Risk

    ERIC Educational Resources Information Center

    Wang, X. T.; Johnson, Joseph G.


    The tri-reference point (TRP) theory takes into account minimum requirements (MR), the status quo (SQ), and goals (G) in decision making under risk. The 3 reference points demarcate risky outcomes and risk perception into 4 functional regions: success (expected value of x greater than or equal to G), gain (SQ less than x less than G), loss (MR…

  8. Biochemical, Biophysical and IgE-Epitope Characterization of the Wheat Food Allergen, Tri a 37

    PubMed Central

    Pahr, Sandra; Selb, Regina; Weber, Milena; Focke-Tejkl, Margarete; Hofer, Gerhard; Dordić, Andela; Keller, Walter; Papadopoulos, Nikolaos G.; Giavi, Stavroula; Mäkelä, Mika; Pelkonen, Anna; Niederberger, Verena; Vrtala, Susanne; Valenta, Rudolf


    Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptid were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential Ig

  9. Biochemical, biophysical and IgE-epitope characterization of the wheat food allergen, Tri a 37.


    Pahr, Sandra; Selb, Regina; Weber, Milena; Focke-Tejkl, Margarete; Hofer, Gerhard; Dordić, Andela; Keller, Walter; Papadopoulos, Nikolaos G; Giavi, Stavroula; Mäkelä, Mika; Pelkonen, Anna; Niederberger, Verena; Vrtala, Susanne; Valenta, Rudolf


    Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptide were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential Ig

  10. Shock initiation of the tri-amino-tri-nitro-benzene based explosive PBX 9502 cooled to -55 bold">°C

    NASA Astrophysics Data System (ADS)

    Gustavsen, Richard L.; Gehr, Russell J.; Bucholtz, Scott M.; Alcon, Robert R.; Bartram, Brian D.


    We report a series of shock initiation experiments on PBX 9502 cooled to -55 °C. PBX 9502 consists of 95% dry aminated tri-amino-tri-nitro-benzene (TATB) and 5% poly-chloro-trifluoro-ethylene5 (Kel-F 800) binder. PBX 9502 samples were shock initiated by projectile impact from a two stage gas gun. Buildup to detonation was measured with 10 or more particle velocity gauges embedded at different depths in the sample. Three shock wave trackers measured the position of the shock front with time. Particle velocity vs. time wave-profiles and coordinates for onset of detonation were obtained as a function of the impact stress or pressure. PBX 9502 sample temperatures were monitored using type-E thermocouples, two inside the sample and two on the sample surface. Additional thermocouples were mounted on other parts of the cooling apparatus. Wave profiles from embedded gauges are qualitatively similar to those observed at 23 °C. However, at -55 °C, PBX 9502 is much less sensitive than at 23 °C. For example, at an inpact stress of 15.4 GPa, the distance to detonation at -55 °C is 7.8 mm. At 23 °C, the distance is 4.3 mm.

  11. High Performance Computing for Dsm Extraction from ZY-3 Tri-Stereo Imagery

    NASA Astrophysics Data System (ADS)

    Lu, Shuning; Huang, Shicun; Pan, Zhiqiang; Deng, Huawu; Stanley, David; Xin, Yubin


    ZY-3 has been acquiring high quality imagery since its launch in 2012 and its tri-stereo (three-view or three-line-array) imagery has become one of the top choices for extracting DSM (Digital Surface Model) products in China over the past few years. The ZY-3 tri-stereo sensors offer users the ability to capture imagery over large regions including an entire territory of a country, such as China, resulting in a large volume of ZY-3 tri-stereo scenes which require timely (e.g., near real time) processing, something that is not currently possible using traditional photogrammetry workstations. This paper presents a high performance computing solution which can efficiently and automatically extract DSM products from ZY-3 tri-stereo imagery. The high performance computing solution leverages certain parallel computing technologies to accelerate computation within an individual scene and then deploys a distributed computing technology to increase the overall data throughput in a robust and efficient manner. By taking advantage of the inherent efficiencies within the high performance computing environment, the DSM extraction process can exploit all combinations offered from a set of tri-stereo images (forward-backword, forward-nadir and backword-nadir). The DSM results merged from all of the potential combinations can minimize blunders (e.g., incorrect matches) and also offer the ability to remove potential occlusions which may exist in a single stereo pair, resulting in improved accuracy and quality versus those that are not merged. Accelerated performance is inherent within each of the individual steps of the DSM extraction workflow, including the collection of ground control points and tie points, image bundle adjustment, the creation of epipolar images, and computing elevations. Preliminary experiments over a large area in China have proven that the high performance computing system can generate high quality and accurate DSM products in a rapid manner.

  12. Crystal structures of three complexes of zinc chloride with tri-tert-butyl­phosphane

    PubMed Central

    Finke, Aaron D.; Gray, Danielle L.; Moore, Jeffrey S.


    Under anhydrous conditions and in the absence of a Lewis-base solvent, a zinc chloride complex with tri-tert-butyl­phosphane as the μ-bridged dimer is formed, viz. di-μ-chlorido-bis­[chlorido­bis­(tri-tert-butyl­phosphane)zinc], [ZnCl4(C12H27P)2], (1), which features a nearly square-shaped (ZnCl)2 cyclic core and whose Cl atoms inter­act weakly with C—H groups on the phosphane ligand. In the presence of THF, monomeric di­chlorido­(tetra­hydro­furan-κO)(tri-tert-butyl­phosphane-κP)zinc, [ZnCl2(C4H8O)(C12H27P)] or [P(tBu3)(THF)ZnCl2], (2), is formed. This slightly distorted tetra­hedral Zn complex has weak C—H⋯Cl inter­actions between the Cl atoms and phosphane and THF C—H groups. Under ambient conditions, the hydrolysed complex tri-tert-butyl­phospho­nium aqua­tri­chlorido­zincate 1,2-di­chloro­ethane monosolvate, (C12H28P)[ZnCl3(H2O)]·C2H4Cl2 or [HPtBu3]+ [(H2O)ZnCl3]−·C2H4Cl2, (3), is formed. This complex forms chains of [(H2O)ZnCl3]− anions from hydrogen-bonding inter­actions between the water H atoms and Cl atoms that propagate along the b axis. PMID:26870580

  13. Male injection drug users try new drugs following U.S. deportation to Tijuana, Mexico

    PubMed Central

    Robertson, Angela M.; Rangel, M. Gudelia; Lozada, Remedios; Vera, Alicia; Ojeda, Victoria D.


    Background Among male injection drug users (IDUs) in Tijuana, Mexico, U.S. deportation is associated with HIV transmission. Changing drug use behaviors following deportation, including the use of new drugs, may increase HIV risk but are understudied. We identify correlates of trying new drugs following male IDUs’ most recent U.S. deportation to Mexico. Methods In 2010, we recruited 328 deported male IDUs in Tijuana, Mexico. Questionnaires collected retrospective data on drug use and other HIV risk behaviors throughout migratory events. Logistic regression identified correlates of trying new drugs/combinations following their most recent deportations. Informed consent was obtained from all participants. Results Nearly one in six men (n=52, 16%) tried new drugs following their most recent deportation, including heroin (n=31), methamphetamine (n=5), and heroin/methamphetamine combined (n=17). Trying new drugs following deportation was independently associated with U.S. incarceration (adjusted odds ratio [AOR]= 3.96; 95% confidence interval [C.I.] 1.78, 8.84), increasing numbers of U.S. deportations (AOR=1.11 per deportation; C.I. 1.03, 1.20), feeling sad following deportation (AOR 2.69; C.I. 1.41, 5.14), and perceiving that one’s current lifestyle increases HIV/AIDS risk (AOR 3.91; C.I. 2.05, 7.44). Conclusions Trying new drugs following U.S. deportation may be related to the unique contexts and stressors experienced by drug-abusing migrants as they attempt to reestablish their lives in Mexico. Findings imply an unmet need for health and social programs to alleviate pre-and post-deportation stressors faced by undocumented and return migrants in the U.S.-Mexico context. PMID:21835559

  14. Adaptation and Evaluation of the WillTry Tool Among Children in Guam

    PubMed Central

    Leon Guerrero, Rachael T.; Boushey, Carol J.


    Introduction Fruit and vegetable consumption may reduce risk for chronic disease and obesity. Children’s fruit and vegetable intake is mediated by a preference or willingness to try them. This study’s primary objective was to adapt the previously validated WillTry tool and to evaluate the adapted version among children in Guam. Methods Adaptations to the WillTry tool included both novel fruits and vegetables unique to Guam and common ones. Children aged 3 to 11 years who attended 2 community-based summer day camps in 2013 were shown images matching 14 food questions in an initial interview and in a second interview conducted 3 to 72 hours later. Responses were “no,” “maybe,” or “yes” and were coded as 1, 2, or 3, respectively. A higher score indicated more willingness to try fruits and vegetables. Factor analyses determined components of willingness. Psychometric properties and reliability were analyzed. Results Sixty-five children completed the first interview, and 64 completed the second. Factor analyses revealed 3 components (scales):1) local novel (guava, breadfruit, eggplant, sweet sop, star apple, taro leaves), 2) local common (carrot, papaya, long beans, salad greens), and 3) imported (apple, canned peaches, canned corn). All but the imported scale had sufficient internal consistency (Cronbach’s α > 0.69). Each scale had substantial reliability (ICC > 0.76). We found no significant differences by age, sex, or type of camp for any scale. Mean scores were 2.1 (local novel), 2.4 (local common), and 2.7 (imported), and all were significantly different. Conclusion The adapted WillTry was culturally relevant and had psychometric properties similar to those of the original. An unexpected finding was the tool’s potential for documenting the nutrition transition. PMID:25144677

  15. Maize MeJA-responsive proteins identified by high-resolution 2-DE PAGE.


    Zhang, Yuliang; Pennerman, Kayla K; Yang, Fengshan; Yin, Guohua


    Exogenous methyl jasmonate (MeJA) is well-known to induce plant defense mechanisms effective against a wide variety of insect and microbial pests. High-resolution 2-DE gel electrophoresis was used to discover changes in the leaf proteome of maize exposed to MeJA. We sequenced 62 MeJA-responsive proteins by tandem mass spectroscopy, and deposited the mass spectra and identities in the EMBL-EBI PRIDE repository under reference number PXD001793. An analysis and discussion of the identified proteins in relation to maize defense against Asian corn borer is published by Zhang et al. (2015) [1]. PMID:26509185

  16. Fusarium Tri4 encodes a key multifunctional cytochrome P450 monooxygenase for four consecutive oxygenation steps in trichothecene biosynthesis

    SciTech Connect

    Tokai, Takeshi; Koshino, Hiroyuki; Takahashi-Ando, Naoko; Sato, Masayuki; Fujimura, Makoto; Kimura, Makoto . E-mail:


    Fusarium Tri4 encodes a cytochrome P450 monooxygenase (CYP) for hydroxylation at C-2 of First committed intermediate trichodiene (TDN) in the biosynthesis of trichothecenes. To examine whether this CYP further participates in subsequent oxygenation steps leading to isotrichotriol (4), we engineered Saccharomyces cerevisiae for de novo production of the early intermediates by introducing cDNAs of Fusarium graminearum Tri5 (FgTri5 encoding TDN synthase) and Tri4 (FgTri4). From a culture of the engineered yeast grown on induction medium (final pH 2.7), we identified two intermediates, 2{alpha}-hydroxytrichodiene (1) and 12,13-epoxy-9,10-trichoene-2{alpha}-ol (2), and a small amount of non-Fusarium trichothecene 12,13-epoxytrichothec-9-ene (EPT). Other intermediates isotrichodiol (3) and 4 were identified in the transgenic yeasts grown on phosphate-buffered induction medium (final pH 5.5-6.0). When Trichothecium roseum Tri4 (TrTri4) was used in place of FgTri4, 4 was not detected in the culture. The three intermediates, 1, 2, and 3, were converted to 4,15-diacetylnivalenol (4,15-diANIV) when fed to a toxin-deficient mutant of F. graminearum with the FgTri4 {sup +} genetic background (viz., by introducing a FgTri5 {sup -} mutation), but were not metabolized by an FgTri4 {sup -} mutant. These results provide unambiguous evidence that FgTri4 encodes a multifunctional CYP for epoxidation at C-12,13, hydroxylation at C-11, and hydroxylation at C-3 in addition to hydroxylation at C-2.

  17. Fusarium Tri4 encodes a key multifunctional cytochrome P450 monooxygenase for four consecutive oxygenation steps in trichothecene biosynthesis.


    Tokai, Takeshi; Koshino, Hiroyuki; Takahashi-Ando, Naoko; Sato, Masayuki; Fujimura, Makoto; Kimura, Makoto


    Fusarium Tri4 encodes a cytochrome P450 monooxygenase (CYP) for hydroxylation at C-2 of the first committed intermediate trichodiene (TDN) in the biosynthesis of trichothecenes. To examine whether this CYP further participates in subsequent oxygenation steps leading to isotrichotriol (4), we engineered Saccharomyces cerevisiae for de novo production of the early intermediates by introducing cDNAs of Fusarium graminearum Tri5 (FgTri5 encoding TDN synthase) and Tri4 (FgTri4). From a culture of the engineered yeast grown on induction medium (final pH 2.7), we identified two intermediates, 2alpha-hydroxytrichodiene (1) and 12,13-epoxy-9,10-trichoene-2alpha-ol (2), and a small amount of non-Fusarium trichothecene 12,13-epoxytrichothec-9-ene (EPT). Other intermediates isotrichodiol (3) and 4 were identified in the transgenic yeasts grown on phosphate-buffered induction medium (final pH 5.5-6.0). When Trichothecium roseum Tri4 (TrTri4) was used in place of FgTri4, 4 was not detected in the culture. The three intermediates, 1, 2, and 3, were converted to 4,15-diacetylnivalenol (4,15-diANIV) when fed to a toxin-deficient mutant of F. graminearum with the FgTri4+ genetic background (viz., by introducing a FgTri5- mutation), but were not metabolized by an FgTri4- mutant. These results provide unambiguous evidence that FgTri4 encodes a multifunctional CYP for epoxidation at C-12,13, hydroxylation at C-11, and hydroxylation at C-3 in addition to hydroxylation at C-2. PMID:17188234

  18. Tri6 encodes an unusual zinc finger protein involved in regulation of trichothecene biosynthesis in Fusarium sporotrichioides.

    PubMed Central

    Proctor, R H; Hohn, T M; McCormick, S P; Desjardins, A E


    In Fusarium sporotrichioides, several genes required for biosynthesis of the trichothecene mycotoxin T-2 toxin are closely linked. Further characterization of this gene cluster has revealed a gene, Tri6, that specifies a 217-amino-acid protein with regions similar to Cys2His2 zinc finger proteins. Temporal expression of Tri6 is similar to that of trichothecene biosynthetic pathway genes. Analysis of Tri6 transcripts indicated that transcription is initiated in two regions and that within each region there may be at least four initiation sites. Disruption of Tri6 resulted in a mutant that did not produce trichothecenes but that did accumulate low levels of the trichothecene precursor trichodiene. The Tri6 mutant was unable to convert six trichothecene biosynthetic intermediates to T-2 toxin, and transcription of two biosynthetic genes, Tri4 and Tri5, was greatly reduced in the mutant relative to the wild type. In addition, the product of Tri6 functioned as a transcriptional activator in Saccharomyces cerevisiae when fused to the DNA binding region of GAL4. These results indicate that Tri6 encodes a protein involved in the transcriptional regulation of trichothecene biosynthetic genes in F. sporotrichioides. PMID:7646028

  19. Continuous Dust Formation in SNe 2010jl and 2011ja

    NASA Astrophysics Data System (ADS)

    Krafton, Kelsie; Clayton, Geoffrey; Andrews, Jennifer; Barlow, Michael; De Looze, Ilse


    Studies in the last 10 years of dust formation in core-collapse supernovae (CCSNe) have found only small amounts, ~0.001 solar masses. This is far less than the amount needed to account for the large masses of dust seen in some high redshift galaxies. However, the recent discovery of ~1 solar mass of cold dust in the ejecta of SN 1987A has has caused a complete re-evaluation of dust formation in CCSNe. It has been suggested that the CCSNe are continuously forming dust so that by the time they are about 25 years old they will have dust masses similar to SN 1987A. However, there is a wide time gap between the CCSNe that have been studied recently and SN 1987A. We plan to use the sensitivity of Spitzer to detect dust emission from CCSNe 5 or more years after explosion. Radiative transfer models will be used to estimate the dust masses. This proposal is to continue our study of two interesting SNe 2010jl and 2011ja. These observations are part of a long term study requiring multiple epochs of Spitzer observations to look for evidence of continuous dust formation. These observations will help shed light on the mystery of dust in SN 1987A.

  20. Another JA/COI1-independent role of OPDA detected in tomato embryo development.


    Wasternack, Claus; Goetz, Stephan; Hellwege, Anja; Forner, Susanne; Strnad, Miroslav; Hause, Bettina


    Jasmonates (JAs) are ubiquitously occurring signaling compounds in plants formed in response to biotic and abiotic stress as well as in development. (+)-7-iso-jasmonoyl isoleucine, the bioactive JA, is involved in most JA-dependent processes mediated by the F-box protein COI1 in a proteasome-dependent manner. However, there is an increasing number of examples, where the precursor of JA biosynthesis, cis-(+)-12-oxophytodienoic acid (OPDA) is active in a JA/COI1-independent manner. Here, we discuss those OPDA-dependent processes, thereby giving emphasis on tomato embryo development. Recent data on seed coat-generated OPDA and its role in embryo development is discussed based on biochemical and genetic evidences. PMID:22895103

  1. Measurements of shock initiation in the tri-amino-tri-nitro-benzene based explosive PBX 9502: Wave forms from embedded gauges and comparison of four different material lots

    NASA Astrophysics Data System (ADS)

    Gustavsen, R. L.; Sheffield, S. A.; Alcon, R. R.


    We have completed a series of ambient temperature (23+/-2 °C) shock initiation experiments on four lots (batches) of the insensitive high explosive PBX 9502. PBX 9502 consists by weight of 95% dry-aminated tri-amino-tri-nitro-benzene (TATB) and 5% of the plastic binder Kel-F 800, a 3/1 copolymer of chloro-trifluoro-ethylene and vinylidene-fluoride. Two of the four lots were manufactured using the ``virgin'' process. Both of these lots had few fine TATB particles. One virgin lot was stored the majority of its life (>15 yr) as a molding powder and pressed as a 240 mm diameter by 130 mm thick cylinder. The other virgin lot was stored the majority of its life as a hollow hemispherical pressing. Two lots were manufactured using the ``recycle'' process and had many fine TATB particles. One recycled lot was stored the majority of its life as a molding powder, while the other was stored as a pressed charge. Shock initiation experiments were performed using precisely characterized planar shocks generated by impacting an explosive sample with a projectile accelerated in a two-stage gas gun. The evolution of the shock into a detonation was measured using 10 or 11 embedded electromagnetic particle velocity gauges and three ``shock tracker'' gauges. Results include the following: (1) high quality particle velocity wave forms which should be useful for calibrating reactive burn models, (2) no difference in the sustained shock initiation response between lots regardless of material processing or storage history, (3) responses for all lots equivalent to those measured by Dick et al. [J. Appl. Phys. 63, 4881 (1988)], additional Hugoniot and Pop-plot data for PBX 9502, and (5) the short shock response which, when compared to the sustained shock response, shows no extension in the run distance unless the rarefaction overtakes the shock front prior to the distance it would have run towards a detonation as a sustained shock.

  2. NASA Marshall Space Flight Center Tri-gas Thruster Performance Characterization

    NASA Technical Reports Server (NTRS)

    Dorado, Vanessa; Grunder, Zachary; Schaefer, Bryce; Sung, Meagan; Pedersen, Kevin


    Historically, spacecraft reaction control systems have primarily utilized cold gas thrusters because of their inherent simplicity and reliability. However, cold gas thrusters typically have a low specific impulse. It has been determined that a higher specific impulse can be achieved by passing a monopropellant fluid mixture through a catalyst bed prior to expulsion through the thruster nozzle. This research analyzes the potential efficiency improvements from using tri-gas, a mixture of hydrogen, oxygen, and an inert gas, which in this case is helium. Passing tri-gas through a catalyst causes the hydrogen and oxygen to react and form water vapor, ultimately heating the exiting fluid and generating a higher specific impulse. The goal of this project was to optimize the thruster performance by characterizing the effects of varying several system components including catalyst types, catalyst lengths, and initial catalyst temperatures.

  3. Carbon tri-interstitial defect: A model for the DII center

    NASA Astrophysics Data System (ADS)

    Jiang, Chao; Morgan, Dane; Szlufarska, Izabela


    Using a combination of random configuration sampling, molecular dynamics simulated annealing with empirical potential, and ensuing structural refinement by first-principles density functional calculations, we perform an extensive ground-state search for the most stable configurations of small carbon interstitial clusters in SiC. Our search reveals a “magic” cluster number of three atoms, where the formation energy per interstitial shows a distinct minimum. A carbon tri-interstitial cluster with trigonal C3v symmetry is discovered, in which all carbon atoms are fourfold coordinated. In addition to its special thermodynamic stability, its localized vibrational modes are also in a very good agreement with the experimental photoluminescence spectra of the DII center in both 3C- and 4H-SiC. The DII center is one of the most persistent defects in SiC, and we propose that the discovered carbon tri-interstitial is responsible for this center.

  4. Contribution of the Type II Chaperonin, TRiC/CCT, to Oncogenesis

    PubMed Central

    Roh, Soung-Hun; Kasembeli, Moses; Bakthavatsalam, Deenadayalan; Chiu, Wah; Tweardy, David J.


    The folding of newly synthesized proteins and the maintenance of pre-existing proteins are essential in sustaining a living cell. A network of molecular chaperones tightly guides the folding, intracellular localization, and proteolytic turnover of proteins. Many of the key regulators of cell growth and differentiation have been identified as clients of molecular chaperones, which implies that chaperones are potential mediators of oncogenesis. In this review, we briefly provide an overview of the role of chaperones, including HSP70 and HSP90, in cancer. We further summarize and highlight the emerging the role of chaperonin TRiC (T-complex protein-1 ring complex, also known as CCT) in the development and progression of cancer mediated through its critical interactions with oncogenic clients that modulate growth deregulation, apoptosis, and genome instability in cancer cells. Elucidation of how TRiC modulates the folding and function of oncogenic clients will provide strategies for developing novel cancer therapies. PMID:26561808

  5. The growth and crystallography of bismuth tri-iodide crystals grown by vapor transport

    SciTech Connect

    Nason, D.; Keller, L.


    A single crystal of bismuth tri-iodide (BiI{sub 3}) of dimensions 1.2 {times} 1.2 {times} 0.4 cm{sup 3} has been grown by physical vapor transport. The lattice parameters of the hexagonal crystal and its polycrystaleme powder precursor were measured by x-ray diffraction (XRD) and were in agreement, indicating that the vapor phase growth and sublimation purification processing at temperatures below 330{degree}C did not significantly affect the stoichiometry. X-ray rocking measurements of the single crystal showed low angle boundaries of the order of 0.05{degree}. In tests as gamma radiation detectors, neither melt grown nor vapor grown crystals were satisfactory, but the vapor grown crystals were promising. Several observations suggest that better performance may be achievable with purer bismuth tri-iodide.

  6. Histone acetylation dependent energy landscapes in tri-nucleosome revealed by residue-resolved molecular simulations

    PubMed Central

    Chang, Le; Takada, Shoji


    Histone tail acetylation is a key epigenetic marker that tends to open chromatin folding and activate transcription. Despite intensive studies, precise roles of individual lysine acetylation in chromatin folding have only been poorly understood. Here, we revealed structural dynamics of tri-nucleosomes with several histone tail acetylation states and analyzed histone tail interactions with DNA by performing molecular simulations at an unprecedentedly high resolution. We found versatile acetylation-dependent landscapes of tri-nucleosome. The H4 and H2A tail acetylation reduced the contact between the first and third nucleosomes mediated by the histone tails. The H3 tail acetylation reduced its interaction with neighboring linker DNAs resulting in increase of the distance between consecutive nucleosomes. Notably, two copies of the same histone in a single nucleosome have markedly asymmetric interactions with DNAs, suggesting specific pattern of nucleosome docking albeit high inherent flexibility. Estimated transcription factor accessibility was significantly high for the H4 tail acetylated structures. PMID:27698366

  7. Tri-Gate Normally-Off GaN Power MISFET

    SciTech Connect

    Lu, B; Matioli, E; Palacios, T


    We present a new normally-off GaN transistor-the tri-gate normally-off GaN metal-insulator-semiconductor field-effect transistor (MISFET). Due to the excellent channel control of a new 3-D gate structure, a breakdown voltage of 565 V has been achieved at a drain leakage current of 0.6 mu A/mm and V-gs = 0. The new device has an on/off current ratio of more than eight orders of magnitude and a subthreshold slope of 86 +/- 9 mV/decade. The threshold voltage of the new device is 0.80 +/- 0.06 V with a maximum drain current of 530 mA/mm. These results confirm the great potential of the tri-gate normally-off GaN-on-Si MISFETs for the next generation of power electronics.

  8. Operator Interface and Control Software for the Reconfigurable Surface System Tri-ATHLETE

    NASA Technical Reports Server (NTRS)

    Norris, Jeffrey S.; Vona, Marsette A.; Rus, Daniela


    Graphical operator interface methods have been developed for modular, reconfigurable articulated surface systems in general, and a specific instantiation thereof for JPL's Tri-ATHLETE. The All- Terrain Hex-Limbed Extra-Terrestrial Explorer Robot (ATHLETE) has six limbs with six kinematic degrees of freedom each. The core advancement of this work was the development of a novel set of algorithms for dynamically maintaining a reduced coordinate model of any connected assembly of robot modules.

  9. The tri-Hamiltonian dual system of supersymmetric two boson system

    NASA Astrophysics Data System (ADS)

    Zhang, Mengxia; Tian, Kai; Zhang, Lei


    The dual system of the supersymmetric two boson system is constructed through the approach of tri-Hamiltonian duality, and inferred from this duality, its zero-curvature representation is also figured out. Furthermore, the dual system is shown to be equivalent to a N = 2 supersymmetric Camassa-Holm equation, and this relation results in a new linear spectral problem for the N = 2 supersymmetric Camassa-Holm equation.

  10. Crystal structures of three 3,4,5-tri-meth-oxy-benzamide-based derivatives.


    Gomes, Ligia R; Low, John Nicolson; Oliveira, Catarina; Cagide, Fernando; Borges, Fernanda


    The crystal structures of three benzamide derivatives, viz. N-(6-hy-droxy-hex-yl)-3,4,5-tri-meth-oxy-benzamide, C16H25NO5, (1), N-(6-anilinohex-yl)-3,4,5-tri-meth-oxy-benzamide, C22H30N2O4, (2), and N-(6,6-di-eth-oxy-hex-yl)-3,4,5-tri-meth-oxy-benzamide, C20H33NO6, (3), are described. These compounds differ only in the substituent at the end of the hexyl chain and the nature of these substituents determines the differences in hydrogen bonding between the mol-ecules. In each mol-ecule, the m-meth-oxy substituents are virtually coplanar with the benzyl ring, while the p-meth-oxy substituent is almost perpendicular. The carbonyl O atom of the amide rotamer is trans related with the amidic H atom. In each structure, the benzamide N-H donor group and O acceptor atoms link the mol-ecules into C(4) chains. In 1, a terminal -OH group links the mol-ecules into a C(3) chain and the combined effect of the C(4) and C(3) chains is a ribbon made up of screw related R 2 (2)(17) rings in which the ⋯O-H⋯ chain lies in the centre of the ribbon and the tri-meth-oxy-benzyl groups forms the edges. In 2, the combination of the benzamide C(4) chain and the hydrogen bond formed by the terminal N-H group to an O atom of the 4-meth-oxy group link the mol-ecules into a chain of R 2 (2)(17) rings. In 3, the mol-ecules are linked only by C(4) chains. PMID:27308017

  11. Reverse osmosis performance with solutions containing tri-n-butyl phosphate

    SciTech Connect

    Siler, J.L.


    Tests were conducted to determine whether the reverse osmosis (RO) units at the F/H Effluent Treatment Facility (ETF) at the Savannah River could be made to process solutions containing tri-n-butyl phosphate (TBP). It was desired to test whether operation at a feed pH other than neutral would improve performance. Test results are discussed in this report and indicate that little improvement in the water flux can be expected at other pH values.

  12. Ambipolar Organic Tri-Gate Transistor for Low-Power Complementary Electronics.


    Torricelli, Fabrizio; Ghittorelli, Matteo; Smits, Edsger C P; Roelofs, Christian W S; Janssen, René A J; Gelinck, Gerwin H; Kovács-Vajna, Zsolt M; Cantatore, Eugenio


    Ambipolar transistors typically suffer from large off-current inherently due to ambipolar conduction. Using a tri-gate transistor it is shown that it is possible to electrostatically switch ambipolar polymer transistors from ambipolar to unipolar mode. In unipolar mode, symmetric characteristics with an on/off current ratio of larger than 10(5) are obtained. This enables easy integration into low-power complementary logic and volatile electronic memories. PMID:26573767

  13. Ligands with an NPNPN-framework and their application in chromium catalysed ethene tri-/tetramerization.


    Peulecke, N; Müller, B H; Spannenberg, A; Höhne, M; Rosenthal, U; Wöhl, A; Müller, W; Alqahtani, A; Al Hazmi, M


    Novel Cr(iii) catalysts supported by linear phosph(iii)azanes of the type R(1)R(2)N-P(Ph)-NR(3)-P(Ph)-NR(4)R(5) have been prepared, all of which, upon activation with MMAO-3A, are highly active for ethene tri-/tetramerization with considerable selectivity. The effect of ligand substitution as well as solvent on the catalytic performance has been examined. PMID:27151679

  14. Mono-, di-, and tri- tert-butyl ethers of glycerol . A molecular spectroscopic study

    NASA Astrophysics Data System (ADS)

    Jamróz, Małgorzata E.; Jarosz, Małgorzata; Witowska-Jarosz, Janina; Bednarek, Elżbieta; Tęcza, Witold; Jamróz, Michał H.; Dobrowolski, Jan Cz.; Kijeński, Jacek


    MS, NMR, IR and Raman molecular spectroscopy techniques were applied to characterize 3- tert-butoxy-propane-1,2-diol, 1,3-di- tert-butoxy-propan-2-ol, and 1,2,3-tri- tert-butoxy-propane. These ethers are the main products of glycerol etherification reaction and are excellent oxygen additives for diesel fuel. Computational DFT/ B3LYP/6-31G ** studies were performed to support and rationalize both vibrational spectroscopy analysis and the isomer ratio.

  15. Update from the Japanese Center for the Validation of Alternative Methods (JaCVAM).


    Kojima, Hajime


    The Japanese Center for the Validation of Alternative Methods (JaCVAM) was established in 2005 to promote the use of alternatives to animal testing in regulatory studies, thereby replacing, reducing, or refining the use of animals, according to the Three Rs principles. JaCVAM assesses the utility, limitations and suitability for use in regulatory studies, of test methods needed to determine the safety of chemicals and other materials. JaCVAM also organises and performs validation studies of new test methods, when necessary. In addition, JaCVAM co-operates and collaborates with similar organisations in related fields, both in Japan and internationally, which also enables JaCVAM to provide input during the establishment of guidelines for new alternative experimental methods. These activities help facilitate application and approval processes for the manufacture and sale of pharmaceuticals, chemicals, pesticides, and other products, as well as for revisions to standards for cosmetic products. In this manner, JaCVAM plays a leadership role in the introduction of new alternative experimental methods for regulatory acceptance in Japan. PMID:24512226

  16. Falls classification using tri-axial accelerometers during the five-times-sit-to-stand test.


    Doheny, Emer P; Walsh, Cathal; Foran, Timothy; Greene, Barry R; Fan, Chie Wei; Cunningham, Clodagh; Kenny, Rose Anne


    The five-times-sit-to-stand test (FTSS) is an established assessment of lower limb strength, balance dysfunction and falls risk. Clinically, the time taken to complete the task is recorded with longer times indicating increased falls risk. Quantifying the movement using tri-axial accelerometers may provide a more objective and potentially more accurate falls risk estimate. 39 older adults, 19 with a history of falls, performed four repetitions of the FTSS in their homes. A tri-axial accelerometer was attached to the lateral thigh and used to identify each sit-stand-sit phase and sit-stand and stand-sit transitions. A second tri-axial accelerometer, attached to the sternum, captured torso acceleration. The mean and variation of the root-mean-squared amplitude, jerk and spectral edge frequency of the acceleration during each section of the assessment were examined. The test-retest reliability of each feature was examined using intra-class correlation analysis, ICC(2,k). A model was developed to classify participants according to falls status. Only features with ICC>0.7 were considered during feature selection. Sequential forward feature selection within leave-one-out cross-validation resulted in a model including four reliable accelerometer-derived features, providing 74.4% classification accuracy, 80.0% specificity and 68.7% sensitivity. An alternative model using FTSS time alone resulted in significantly reduced classification performance. Results suggest that the described methodology could provide a robust and accurate falls risk assessment.

  17. Transoral endoscopic thyroidectomy via the tri-vestibular routes: results of a preclinical cadaver feasibility study.


    Park, Jun-Ook; Kim, Choung Soo; Song, Jee-Nam; Kim, Ju-Eun; Nam, Inn-Chul; Lee, So-Yoon; Chun, Byung-Joon; Cho, Jung-Hae; Joo, Young-Hoon; Cho, Kwang-Jae; Park, Young Hak; Kim, Min-Sik; Sun, Dong-Il


    The concept of natural orifice transluminal endoscopic surgery (NOTES) is an emerging experimental alternative to conventional surgery that eliminates skin incisions using an endoscope passed through a natural orifice (e.g., mouth, urethra, or anus). This study was designed to evaluate the feasibility and safety of thyroid resection via an entirely transoral tri-vestibular route using endoscopy, and to introduce NOTES to the head and neck area of medicine. We performed ten complete endoscopic thyroid lobectomies with central lymph node dissection via a tri-vestibular approach in fresh-frozen cadavers. A 5-mm endoscope with a deflectable tip was used to visualize the surgical field. Three cannulas were inserted through the midline and bilateral incision sites in the vestibule to position the instruments and endoscope. We refined and described the surgical technique in each step using video clips. We identified and preserved neighboring critical structures during surgery. We also confirmed that there were no obvious remnant thyroid tissues and no injury to the neighboring structures after exploration. The transoral tri-vestibular approach seems to provide a good view and surgical field for endoscopic thyroidectomy. However, the transoral approach for thyroidectomy remains experimental, and the detailed surgical technique should be refined via further clinical studies.

  18. Prevention of smoking in Middle School Students: psychometric assessment of the Temptations to Try Smoking Scale.


    McGee, Heather A; Babbin, Steven F; Redding, Colleen; Paiva, Andrea; Oatley, Karin; Meier, Kathryn S; Harrington, Magdalena; Velicer, Wayne F


    Establishment of psychometrically sound measures is critical to the development of effective interventions. The current study examined the psychometric properties, including factorial invariance, of a six item Temptations to Try Smoking Scale on a sample of middle school students. The sample of 6th grade students (N=3527) was from 20 Rhode Island middle schools and was 52% male and 84% white. The Temptations to Try Smoking Scale consisted of two correlated subscales: Positive Social and Curiosity/Stress. Structural equation modeling was implemented to evaluate the factorial invariance across four different subgroups defined by gender (male/female), race (white/black), ethnicity (Hispanic/Non-Hispanic), and school size (<200/ >200 6th graders). A model is factorially invariant when the measurement model is the same in each of the subgroups. Three levels of invariance were examined in sequential order: 1) Configural Invariance (unconstrained nonzero factor loadings); 2) Pattern Identity Invariance (equal factor loadings); and 3) Strong Factorial Invariance (equal factor loadings and measurement errors). Strong Factorial Invariance provided a good fit to the model across gender (CFI=.96), race (CFI=.96), ethnicity (CFI=.94), and school size (CFI=.97). Coefficient Alphas for the two subscales, Positive Social and Curiosity/Stress, were .87 and .86, respectively. These findings provide empirical support for the construct validity of the Temptations to Try Smoking Scale in middle school students.

  19. [Factors associated with overweight in students from tri-border region: Argentina, Brazil and Paraguay].


    Legnani, Elto; Legnani, Rosimeide Francisco Santos; Filho, Valter Cordeiro Barbosa; Krinski, Kleverton; Elsangedy, Hassan Muhamed; de Campos, Wagner; da Silva, Sergio Gregório; Lopes, Adair da Silva


    The Tri-Border Region has several social and health problems among young people, however, there are no data about the overweight between adolescents. This study investigated the prevalence of overweight and associated factors in students from Tri-Border Region: Argentina, Brazil and Paraguay. Study participants were 1.183 students, ages from 15 to 18 years. The overweight was identified according to body mass index cut-off points proposed by the World Health Organization. The Global School-Based Student Health Survey questionnaire was used to identify sociodemographic (gender and age) and behavioral factors (physical activity outside of school, commuting to school, time watching TV and fruits, vegetables, sweet, and salty snack consumption) associated with overweight in adolescents. It was used the descriptive statistics, analysis of variance, chi-square and binary logistic regression, adopting p < 0.05. Thirteen percent of students were overweight. Boys were approximately two times more likely to have overweight than girls, independently of nationality. Brazilian students that realized passive commuting to school and Argentineans students with low consumption of vegetables (< 1 time/day) were 2.2 and 2.9 times more likely to have overweight than their counterparts who performed active commuting to school and consumed vegetables daily, respectively. These results suggest that public policies to combat overweight should attention on promoting healthy lifestyle among young people from Tri-Border Region.

  20. Three-wall segment (TriSeg) model describing mechanics and hemodynamics of ventricular interaction.


    Lumens, Joost; Delhaas, Tammo; Kirn, Borut; Arts, Theo


    A mathematical model (TriSeg model) of ventricular mechanics incorporating mechanical interaction of the left and right ventricular free walls and the interventricular septum is presented. Global left and right ventricular pump mechanics were related to representative myofiber mechanics in the three ventricular walls, satisfying the principle of conservation of energy. The walls were mechanically coupled satisfying tensile force equilibrium in the junction. Wall sizes and masses were rendered by adaptation to normalize mechanical myofiber load to physiological standard levels. The TriSeg model was implemented in the previously published lumped closed-loop CircAdapt model of heart and circulation. Simulation results of cardiac mechanics and hemodynamics during normal ventricular loading, acute pulmonary hypertension, and chronic pulmonary hypertension (including load adaptation) agreed with clinical data as obtained in healthy volunteers and pulmonary hypertension patients. In chronic pulmonary hypertension, the model predicted right ventricular free wall hypertrophy, increased systolic pulmonary flow acceleration, and increased right ventricular isovolumic contraction and relaxation times. Furthermore, septal curvature decreased linearly with its transmural pressure difference. In conclusion, the TriSeg model enables realistic simulation of ventricular mechanics including interaction between left and right ventricular pump mechanics, dynamics of septal geometry, and myofiber mechanics in the three ventricular walls.

  1. The architecture of the spliceosomal U4/U6.U5 tri-snRNP

    PubMed Central

    Nguyen, Thi Hoang Duong; Galej, Wojciech P.; Bai, Xiao-chen; Savva, Christos G.; Newman, Andrew J.; Scheres, Sjors H. W.; Nagai, Kiyoshi


    U4/U6.U5 tri-snRNP is a 1.5 MDa pre-assembled spliceosomal complex comprising U5 snRNA, extensively base-paired U4/U6 snRNAs and >30 proteins, including the key components Prp8, Brr2 and Snu114. The tri-snRNP combines with a pre-mRNA substrate bound to U1 and U2 snRNPs and transforms into a catalytically active spliceosome following extensive compositional and conformational changes triggered by unwinding of the U4/U6 snRNAs. CryoEM single-particle reconstruction of yeast tri-snRNP at 5.9Å resolution reveals the essentially complete organization of its RNA and protein components. The single-stranded region of U4 snRNA between its 3′-stem-loop and the U4/U6 snRNA stem I is loaded into the Brr2 helicase active site ready for unwinding. Snu114 and the N-terminal domain of Prp8 position U5 snRNA to insert its Loop I, which aligns the exons for splicing, into the Prp8 active site cavity. The structure provides crucial insights into the activation process and the active site of the spliceosome. PMID:26106855

  2. Influence of nutritional knowledge on perceived healthiness and willingness to try functional foods.


    Ares, Gastón; Giménez, Ana; Gámbaro, Adriana


    In order to assess the influence of nutritional knowledge on perceived healthiness and willingness to try functional foods, 104 consumers filled out a Nutritional Knowledge Questionnaire and answered a conjoint task. Participants had to evaluate 16 concepts consisting of combinations of carrier products (yogurt, milk desserts, pan bread and mayonnaise) and nutritional modifications (regular product, low-fat, enriched with antioxidants, and enriched with fibre). Three groups of consumers were identified with different level of nutritional knowledge. Highly significant differences were found in the healthiness evaluations of the clusters, which mainly depended on nutritional knowledge related to the links of diet and diseases. Highly significant differences in willingness to try functional foods were also found between the clusters. Whereas consumers with the lowest nutritional knowledge were not interested in consuming functional foods, the addition of fibre or antioxidants to healthy products increased the willingness of consumers with the highest level of nutritional knowledge to try the evaluated functional foods. These results suggested that lack of nutritional knowledge might limit the acceptance of functional foods and thus the use of health claims might be necessary to assure that consumers are aware of their health benefits.

  3. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2012 CFR


    .... In accordance with the general regulations in 33 CFR Part 165, Subpart C, no vessel operator may... 33 Navigation and Navigable Waters 2 2012-07-01 2012-07-01 false Safety Zones; TriMet Bridge... Coast Guard District § 165.T13-209 Safety Zones; TriMet Bridge Project, Willamette River; Portland,...

  4. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2014 CFR


    .... In accordance with the general regulations in 33 CFR Part 165, Subpart C, no vessel operator may... 33 Navigation and Navigable Waters 2 2014-07-01 2014-07-01 false Safety Zones; TriMet Bridge... Coast Guard District § 165.T13-209 Safety Zones; TriMet Bridge Project, Willamette River; Portland,...

  5. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2013 CFR


    .... In accordance with the general regulations in 33 CFR Part 165, Subpart C, no vessel operator may... 33 Navigation and Navigable Waters 2 2013-07-01 2013-07-01 false Safety Zones; TriMet Bridge... Coast Guard District § 165.T13-209 Safety Zones; TriMet Bridge Project, Willamette River; Portland,...

  6. The Training and Research Institute for Residential Youth Centers, Inc. (TRI-RYC). Final Report, 1969-1970.

    ERIC Educational Resources Information Center

    Training and Research Inst. for Residential Youth Centers, Inc., New Haven, CT.

    This report describes and details the experiences of the Training and Research Institute for Residential Youth Centers (TRI-RYC) during its first year of operation. The TRI-RYC was established by the Department of Labor, Office of Special Manpower Programs, to provide a capability for initiating, training staff for, and evaluating the…

  7. The Targeted Reading Intervention (TRI): A Classroom Teacher Tier 2 Intervention to Help Struggling Readers in Early Elementary School

    ERIC Educational Resources Information Center

    Vernon-Feagans, Lynne; Amendum, Steve; Kainz, Kirsten; Ginsburg, Marnie


    The two studies presented in this report were designed to test the effectiveness of a new diagnostic-based reading intervention for classroom teachers, called the Targeted Reading Intervention (TRI). This TRI Tier 2 intervention stressed diagnostic teaching as the key to helping struggling readers make rapid progress in reading in the regular…

  8. Plasma immersion ion implantation for sub-22 nm node devices: FD-SOI and Tri-Gate

    SciTech Connect

    Duchaine, J.; Milesi, F.; Coquand, R.; Barraud, S.; Reboh, S.; Gonzatti, F.; Mazen, F.; Torregrosa, Frank


    Here, we present and discuss the electrical characteristics of fully depleted MOSFET transistors of planar and tridimensional architecture, doped by Plasma Immersion Ion Implantation (PIII) or Beam Line Ion Implantation (BLII). Both techniques delivered similar and satisfactory results in considering the planar architecture. For tri-dimensional Tri-Gate transistors, the results obtained with PIII are superior.

  9. 75 FR 24799 - Safety Zone; Tri-City Water Follies Hydroplane Races Practice Sessions, Columbia River, Kennewick...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Tri-City Water Follies Hydroplane Races..., Washington for hydroplane race practice sessions being held in preparation for the Tri-City Water Follies... associated with the hydroplane practice sessions could lead to severe injury, fatalities, and/or...

  10. Overexpression of the trichodiene synthase gene tri5 increases trichodermin production and antimicrobial activity in Trichoderma brevicompactum.


    Tijerino, Anamariela; Cardoza, R Elena; Moraga, Javier; Malmierca, Mónica G; Vicente, Francisca; Aleu, Josefina; Collado, Isidro G; Gutiérrez, Santiago; Monte, Enrique; Hermosa, Rosa


    Trichoderma brevicompactum produces trichodermin, a simple trichothecene-type toxin that shares the first steps of the sesquiterpene biosynthetic pathway with other phytotoxic trichothecenes from Fusarium spp. Trichodiene synthase catalyses the conversion of farnesyl pyrophosphate to trichodiene and it is encoded by the tri5 gene that was cloned and analysed functionally by homologous overexpression in T. brevicompactum. tri5 expression was up-regulated in media with glucose, H(2)O(2) or glycerol. tri5 repression was observed in cultures supplemented with the antioxidants ferulic acid and tyrosol. Acetone extracts of tri5-overexpressing transformants displayed higher antifungal activity than those from the wild-type. Chromatographic and spectroscopic analyses revealed that tri5 overexpression led to an increased production of trichodermin and tyrosol. Agar diffusion assays with these two purified metabolites from the tri5-overexpressing transformant T. brevicompactum Tb41tri5 showed that only trichodermin had antifungal activity against Saccharomyces cerevisiae, Kluyveromyces marxianus, Candida albicans, Candida glabrata, Candida tropicalis and Aspergillus fumigatus, in most cases such activity being higher than that observed for amphotericin B and hygromycin. Our results point to the significant role of tri5 in the production of trichodermin and in the antifungal activity of T. brevicompactum. PMID:21145409

  11. Atomistic Study of the Migration of Di- and Tri-Interstitials in Silicon

    SciTech Connect

    Posselt, Matthias; Gao, Fei; Zwicker, D


    A comprehensive study on the migration of di- and tri-interstitials in silicon is performed using classical molecular dynamics simulations with a Stillinger-Weber potential. At first the structures and energetics of the di- and the tri-interstitial are investigated, and the accuracy of the interatomic potential is tested by comparing the results with literature data obtained by tight-binding and density-functional-theory calculations. Then the migration is investigated for temperatures between 800 and 1600 K. Very long simulation times, large computational cells and different initial conditions are considered. The defect diffusivity, the self-diffusion coefficient per defect and the corresponding effective migration barriers are calculated. Compared to a mono-interstitial, the di-interstitial migrates faster, whereas the tri-interstitial diffuses slower. The mobility of the di- and the mono-interstitial is higher than the mobility of the lattice atoms during the diffusion of these defects. On the other hand, the tri-interstitial mobility is lower than the corresponding atomic mobility. The migration mechanism of the di-interstitial shows a pronounced dependence on the temperature. At low temperature a high mobility on zigzag-like lines along a <110> axis within a {l_brace}110{r_brace} plane is found, whereas the change between equivalent <110> directions or equivalent {l_brace}110{r_brace} planes occurs seldomly and requires a long simulation time, but the rate of directional change increases with increasing temperature. During the diffusion within {l_brace}110{r_brace} planes the di-interstitial moves like a wave packet so that the atomic mobility is lower than that of the defect. On the other hand, the change between equivalent {l_brace}110{r_brace} migration planes is characterized by frequent atomic rearrangements. The visual analysis of the tri-interstitial diffusion reveals complex migration mechanisms and a high atomic mobility. The diffusivities and

  12. Influence factors and gene expression patterns during MeJa-induced gummosis in peach.


    Li, Minji; Liu, Meiyan; Peng, Futian; Fang, Long


    Jasmonates (JAs) play important roles in gummosis in peach. Mechanical damage, methyl jasmonate (MeJa), and ethylene can induce gummosis on peach shoots in the field. In this study, we used MeJa (2%, w/w) to induce gummosis on current-year shoots in peach on high temperature (35°C). Based on the experimental model, we studied the influence of factors on the development of peach gummosis. Our experimental results showed that high temperature could promote gummosis development induced by MeJa. Exogenous CaCl2 treatment reduced the degree of gummosis by increasing the calcium content in shoots, which is conducive to the synthesis and maintenance of the cell wall. Using digital gene expression (DGE), 3831 differentially expressed genes were identified in the MeJa treatment versus the control. By analyzing changes in gene expression associated with cell wall degradation, genes encoding pectin methylesterase (PME) and endo-polygalacturonase (PG) were found to be significantly induced, suggesting that they are key enzymes in cell wall degradation that occurs during MeJa-induced gummosis. Genes for glycosyltransferase (GT) and cellulose synthase (CS) were also significantly upregulated by MeJa. This result suggests that MeJa treatment not only promotes the degradation of polysaccharides to destroy the cell wall, but also promotes the synthesis of new polysaccharides. We also analyzed changes in gene expression associated with sugar metabolism, senescence, and defense. MeJa treatment affected the expression of genes related to sugar metabolism and promoted plant senescence. Among the defense genes, the expression pattern of phenylalanine ammonium lyase (PAL) suggested that PAL may play an important role in protecting against the effects of MeJa treatment. Our experimental results showed that MeJa treatment can promote the biosynthesis and signal transduction of ethylene in peach shoots; they can induce gummosis on peach shoots respectively, and there are overlaps between

  13. First analysis of eight Algol-type systems: V537 And, GS Boo, AM CrB, V1298 Her, EL Lyn, FW Per, RU Tri, and WW Tri

    NASA Astrophysics Data System (ADS)

    Zasche, P.


    Analyzing available photometry from the Super WASP and other databases, we performed the very first light curve analysis of eight eclipsing binary systems V537 And, GS Boo, AM CrB, V1298 Her, EL Lyn, FW Per, RU Tri, and WW Tri. All of these systems were found to be detached ones of Algol-type, having the orbital periods of the order of days. 722 new times of minima for these binaries were derived and presented, trying to identify the period variations caused by the third bodies in these systems.

  14. Permutation tests for analyzing cospeciation in multiple phylogenies: applications in tri-trophic ecology.


    Mramba, Lazarus K; Barber, Stuart; Hommola, Kerstin; Dyer, Lee A; Wilson, Joseph S; Forister, Matthew L; Gilks, Walter R


    There is a need for a reliable statistical test which is appropriate for assessing cospeciation of more than two phylogenies. We have developed an algorithm using a permutation method that can be used to test for and infer tri-trophic evolutionary relationships of organisms given both their phylogenies and pairwise interactions. An overall statistic has been developed based on the dominant eigenvalue of a covariance matrix, and compared to values of the statistic computed when tree labels are permuted. The resulting overall p-value is used to test for the presence or absence of cospeciation in a tri-trophic system. If cospeciation is detected, we propose new test statistics based on partial correlations to uncover more details about the relationships between multiple phylogenies. One of the strengths of our method is that it allows more parasites than hosts or more hosts than parasites, with multiple associations and more than one parasite attached to a host (or one parasite attached to multiple hosts). The new method does not require any parametric assumptions of the distribution of the data, and unlike the old methods, which utilize several pairwise steps, the overall statistic used is obtained in one step. We have applied our method to two published datasets where we obtained detailed information about the strength of associations among species with calculated partial p-values and one overall p-value from the dominant eigenvalue test statistic. Our permutation method produces reliable results with a clear procedure and statistics applied in an intuitive manner. Our algorithm is useful in testing evidence for three-way cospeciation in multiple phylogenies with tri-trophic associations and determining which phylogenies are involved in cospeciation. PMID:24114867

  15. Integrated piezoelectric actuators in deep drawing tools to reduce the try-out

    NASA Astrophysics Data System (ADS)

    Neugebauer, Reimund; Mainda, Patrick; Kerschner, Matthias; Drossel, Welf-Guntram; Roscher, Hans-Jürgen


    Tool making is a very time consuming and expensive operation because many iteration loops are used to manually adjust tool components during the try-out process. That means that trying out deep drawing tools is 30% of the total costs. This is the reason why an active deep drawing tool was developed at the Fraunhofer Institute for Machine Tools and Forming Technology IWU in cooperation with Audi and Volkswagen to reduce the costs and production rates. The main difference between the active and conventional deep drawing tools is using piezoelectric actuators to control the forming process. The active tool idea, which is the main subject of this research, will be presented as well as the findings of experiments with the custom-built deep drawing tool. This experimental tool was designed according to production requirements and has been equipped with piezoelectric actuators that allow active pressure distribution on the sheet metal flange. The disposed piezoelectric elements are similar to those being used in piezo injector systems for modern diesel engines. In order to achieve the required force, the actuators are combined in a cluster that is embedded in the die of the deep drawing tool. One main objective of this work, i.e. reducing the time-consuming try-out-period, has been achieved with the experimental tool which means that the actuators were used to set static pressure distribution between the blankholder and die. We will present the findings of our analysis and the advantages of the active system over a conventional deep drawing tool. In addition to the ability of changing the static pressure distribution, the piezoelectric actuator can also be used to generate a dynamic pressure distribution during the forming process. As a result the active tool has the potential to expand the forming constraints to make it possible to manage forming restrictions caused by light weight materials in future.

  16. Tri-Variate Relationships among Vegetation, Soil, and Topography along Gradients of Fluvial Biogeomorphic Succession

    PubMed Central

    Kim, Daehyun; Kupfer, John A.


    This research investigated how the strength of vegetation–soil–topography couplings varied along a gradient of biogeomorphic succession in two distinct fluvial systems: a forested river floodplain and a coastal salt marsh creek. The strength of couplings was quantified as tri-variance, which was calculated by correlating three singular axes, one each extracted using three-block partial least squares from vegetation, soil, and topography data blocks. Within each system, tri-variance was examined at low-, mid-, and high-elevation sites, which represented early-, intermediate-, and late-successional phases, respectively, and corresponded to differences in ongoing disturbance frequency and intensity. Both systems exhibited clearly increasing tri-variance from the early- to late-successional stages. The lowest-lying sites underwent frequent and intense hydrogeomorphic forcings that dynamically reworked soil substrates, restructured surface landforms, and controlled the colonization of plant species. Such conditions led vegetation, soil, and topography to show discrete, stochastic, and individualistic behaviors over space and time, resulting in a loose coupling among the three ecosystem components. In the highest-elevation sites, in contrast, disturbances that might disrupt the existing biotic–abiotic relationships were less common. Hence, ecological succession, soil-forming processes, and landform evolution occurred in tight conjunction with one another over a prolonged period, thereby strengthening couplings among them; namely, the three behaved in unity over space and time. We propose that the recurrence interval of physical disturbance is important to—and potentially serves as an indicator of—the intensity and mechanisms of vegetation–soil–topography feedbacks in fluvial biogeomorphic systems. PMID:27649497

  17. Tri-Variate Relationships among Vegetation, Soil, and Topography along Gradients of Fluvial Biogeomorphic Succession.


    Kim, Daehyun; Kupfer, John A


    This research investigated how the strength of vegetation-soil-topography couplings varied along a gradient of biogeomorphic succession in two distinct fluvial systems: a forested river floodplain and a coastal salt marsh creek. The strength of couplings was quantified as tri-variance, which was calculated by correlating three singular axes, one each extracted using three-block partial least squares from vegetation, soil, and topography data blocks. Within each system, tri-variance was examined at low-, mid-, and high-elevation sites, which represented early-, intermediate-, and late-successional phases, respectively, and corresponded to differences in ongoing disturbance frequency and intensity. Both systems exhibited clearly increasing tri-variance from the early- to late-successional stages. The lowest-lying sites underwent frequent and intense hydrogeomorphic forcings that dynamically reworked soil substrates, restructured surface landforms, and controlled the colonization of plant species. Such conditions led vegetation, soil, and topography to show discrete, stochastic, and individualistic behaviors over space and time, resulting in a loose coupling among the three ecosystem components. In the highest-elevation sites, in contrast, disturbances that might disrupt the existing biotic-abiotic relationships were less common. Hence, ecological succession, soil-forming processes, and landform evolution occurred in tight conjunction with one another over a prolonged period, thereby strengthening couplings among them; namely, the three behaved in unity over space and time. We propose that the recurrence interval of physical disturbance is important to-and potentially serves as an indicator of-the intensity and mechanisms of vegetation-soil-topography feedbacks in fluvial biogeomorphic systems. PMID:27649497

  18. Tri-Variate Relationships among Vegetation, Soil, and Topography along Gradients of Fluvial Biogeomorphic Succession.


    Kim, Daehyun; Kupfer, John A


    This research investigated how the strength of vegetation-soil-topography couplings varied along a gradient of biogeomorphic succession in two distinct fluvial systems: a forested river floodplain and a coastal salt marsh creek. The strength of couplings was quantified as tri-variance, which was calculated by correlating three singular axes, one each extracted using three-block partial least squares from vegetation, soil, and topography data blocks. Within each system, tri-variance was examined at low-, mid-, and high-elevation sites, which represented early-, intermediate-, and late-successional phases, respectively, and corresponded to differences in ongoing disturbance frequency and intensity. Both systems exhibited clearly increasing tri-variance from the early- to late-successional stages. The lowest-lying sites underwent frequent and intense hydrogeomorphic forcings that dynamically reworked soil substrates, restructured surface landforms, and controlled the colonization of plant species. Such conditions led vegetation, soil, and topography to show discrete, stochastic, and individualistic behaviors over space and time, resulting in a loose coupling among the three ecosystem components. In the highest-elevation sites, in contrast, disturbances that might disrupt the existing biotic-abiotic relationships were less common. Hence, ecological succession, soil-forming processes, and landform evolution occurred in tight conjunction with one another over a prolonged period, thereby strengthening couplings among them; namely, the three behaved in unity over space and time. We propose that the recurrence interval of physical disturbance is important to-and potentially serves as an indicator of-the intensity and mechanisms of vegetation-soil-topography feedbacks in fluvial biogeomorphic systems.

  19. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers.


    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M; Nachon, Florian; Masson, Patrick; Furlong, Clement E; Lockridge, Oksana


    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such "fume events". Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24-48 h after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. PMID:21723309

  20. Function in protein folding of TRiC, a cytosolic ring complex containing TCP-1 and structurally related subunits.

    PubMed Central

    Frydman, J; Nimmesgern, E; Erdjument-Bromage, H; Wall, J S; Tempst, P; Hartl, F U


    T-complex polypeptide 1 (TCP-1) was analyzed as a potential chaperonin (GroEL/Hsp60) equivalent of the eukaryotic cytosol. We found TCP-1 to be part of a hetero-oligomeric 970 kDa complex containing several structurally related subunits of 52-65 kDa. These members of a new protein family are assembled into a TCP-1 ring complex (TRiC) which resembles the GroEL double ring. The main function of TRiC appears to be in chaperoning monomeric protein folding: TRiC binds unfolded polypeptides, thereby preventing their aggregation, and mediates the ATP-dependent renaturation of unfolded firefly luciferase and tubulin. At least in vitro, TRiC appears to function independently of a small co-chaperonin protein such as GroES. Folding of luciferase is mediated by TRiC but not by GroEL/ES. This suggests that the range of substrate proteins interacting productively with TRiC may differ from that of GroEL. We propose that TRiC mediates the folding of cytosolic proteins by a mechanism distinct from that of the chaperonins in specific aspects. Images PMID:1361170

  1. Antimalarial Isocyano and Isothiocyanato Sesquiterpenes with Tri- and Bicyclic Skeletons from the Nudibranch Phyllidia ocellata.


    White, Andrew M; Pierens, Gregory K; Skinner-Adams, Tina; Andrews, Katherine T; Bernhardt, Paul V; Krenske, Elizabeth H; Mollo, Ernesto; Garson, Mary J


    Five new isocyano/isothiocyanato sesquiterpenes (1-5) with tri- or bicyclic carbon skeletons have been characterized from Australian specimens of the nudibranch Phyllidia ocellata. Spectroscopic analyses at 900 MHz were informed by DFT calculations. The 1S, 5S, 8R configuration of 2-isocyanoclovene (1) was determined by X-ray crystallographic analysis of formamide 6. A biosynthetic pathway to clovanes 1 and 2 from epicaryolane precursors is proposed. Isocyanides 1, 2, and 4 showed activity against Plasmodium falciparum (IC50 0.26-0.30 μM), while isothiocyanate 3 and formamide 6 had IC50 values of >10 μM. PMID:26056748

  2. The Algol-Type Eclipsing Binary X Tri: BVRI modeling and O-C Diagram Analysis

    NASA Astrophysics Data System (ADS)

    Liakos, A.; Zasche, P.; Niarchos, P.


    CCD photometric observations of the Algol-type eclipsing binary X Tri have been obtained. The light curves are analyzed with the Wilson-Devinney (WD) code and new geometric and photometric elements are derived. A new O-C analysis of the system, based on the most reliable timings of minima found in the literature, is presented and apparent period changes are discussed with respect to possible and multiple Light-Time Effect (LITE) in the system. Moreover, the results for the existence of additional bodies around the eclipsing pair, derived from the period study, are compared with those for extra luminosity, derived from the light curve analysis.

  3. Use of the TriSpan Coil to Facilitate the Transcatheter Occlusion of Pulmonary Arteriovenous Malformation

    SciTech Connect

    Cil, Barbaros E. E-mail:; Erdogan, Cueneyt; Akmangit, Ilkay; Cekirge, Saruhan; Balkanci, Ferhun


    Pulmonary arteriovenous malformation (PAVM) is a rare vascular malformation of the lung which may occur as an isolated entity or in association with hereditary hemorrhagic telangiectasia (HHT). Because of considerable risk of serious complications such as cerebral embolism, brain abscess and pulmonary hemorrhage, definitive treatment should be considered in most patients. Embolization with coils or detachable balloons is currently the preferred treatment. Paradoxical embolization of coils and balloons may happen, especially in patients with PAVMs with large feeding arteries. In this report we present our initial experience with the use of the TriSpan coil to lower the risk of coil migration during the transcatheter occlusion of PAVMs.

  4. Patient first: a tri-fold approach to health care transformation.


    Swanson, Lisa Tucker; McDonald, Jill; Clough, Megan; McKinnon, Helen Q


    The installation of new technology affords health care facilities the tri-fold opportunity of (1) upgrading processes and systems, (2) launching providers into the forefront of health care, and (3) providing the most advanced quality of care. Redesigning patient care processes to align with new technology further presents opportunities to transform culture, enhance service excellence, increase staff accountability and promote self-esteem. Leveraging each advantage is a significant commitment that requires a comprehensive change strategy. Eastern Maine Medical Center in Bangor, ME serves as a case study for success.

  5. New Developments in TRI{mu}P and RIASH at KVI

    SciTech Connect

    Dendooven, P.


    The status of the TRI{mu}P facility at KVI is reviewed. Recent results on ion catcher devices are described. A thermo-ionizer for use with alkali and earth-alkali elements is close to completion. Concerning the use of superfluid helium as stopping medium, evidence that second sound pulses can be used to extract ions from the helium surface has been obtained. Based on the observation of highly efficient ion transport in helium, neon and argon gas below about 100 K, we propose the operation of noble gas ion catchers at cryogenic temperatures.

  6. Multiple-try Metropolis Hastings for modeling extreme PM10 data

    NASA Astrophysics Data System (ADS)

    Amin, Nor Azrita Mohd; Adam, Mohd Bakri; Ibrahim, Noor Akma


    Awareness of catastrophic events brings the attention to work out the relationship of these events by using statistical analysis of Extreme Value Theory (EVT). This study focused on extreme PM10 data using a Gumbel distribution which is one of the Extreme Value distributions. The parameters were estimated using the new Bayesian approach in extreme called Multiple Try Metropolis-Hastings algorithms. We compared this approach with another Markov Chain Monte Carlo approach which is the classical Metropolis-Hastings algorithm and the frequentist approach, Maximum Likelihood Estimation. It appears that these three approaches provide comparable results. Data are taken for Pasir Gudang station for year 1996 to 2010.

  7. Holmium Nitrate Complexation with Tri-n-butyl Phosphate in Supercritical Carbon Dioxide

    SciTech Connect

    Robert V. Fox; R. Duane Ball; Peter de B. Harrington; Harry W. Rollins; Chien M. Wai


    Holmium nitrate pentahydrate was reacted with tri-n-butyl phosphate in supercritical carbon dioxide at 308 K. The products of the complexation reaction were measured under supercritical fluid conditions using UV-vis spectroscopy. The solubility of the metal complexes in the supercritical fluid phase was measured. The mole-ratio titration method was used to determine the stoichiometry of the soluble complexes. Conditional extraction coefficients were calculated from spectral data using least-squares regression and hard-equilibria models. Data indicate that the holmium nitrate-tributyl phosphate system forms 1:2 and 1:4 holmium-tributyl phosphate complexes.

  8. High frequency clipper like behavior of tri-layer nickel oxide stack

    NASA Astrophysics Data System (ADS)

    Koiry, S. P.; Ratnadurai, R.; Krishnan, S.; Bhansali, S.


    We report on AC propagation in vertically stacked tri-layer nickel oxide (NiO) film with gradient in oxide composition. These studies reveal that the stacked film clips both positive and negative peaks of the AC signals and these clipping characteristics are analogous to a symmetrical clipper. These characteristics are obtained without using any clipper circuit elements like diodes or transistors and DC power source. We propose that the clipping characteristic of NiO stack is a result of space charge generated during signal propagation.

  9. Biological and chemical study of fused tri- and tetracyclic indazoles and analogues with important antiparasitic activity

    NASA Astrophysics Data System (ADS)

    Díaz-Urrutia, Christian A.; Olea-Azar, Claudio A.; Zapata, Gerald A.; Lapier, Michel; Mura, Francisco; Aguilera-Venegas, Benjamín; Arán, Vicente J.; López-Múñoz, Rodrigo A.; Maya, Juan D.

    A series of fused tri- and tetracyclic indazoles and analogues compounds (NID) with potential antiparasitic effects were studied using voltamperometric and spectroscopic techniques. Nitroanion radicals generated by cyclic voltammetry were characterized by electron spin resonance spectroscopy (ESR) and their spectral lines were explained and analyzed using simulated spectra. In addition, we examined the interaction between radical species generated from nitroindazole derivatives and glutathione (GSH). Biological assays such as activity against Trypanosoma cruzi and cytotoxicity against macrophages were carried out. Finally, spin trapping and molecular modeling studies were also done in order to elucidate the potentials action mechanisms involved in the trypanocidal activity.

  10. Biological and chemical study of fused tri- and tetracyclic indazoles and analogues with important antiparasitic activity.


    Díaz-Urrutia, Christian A; Olea-Azar, Claudio A; Zapata, Gerald A; Lapier, Michel; Mura, Francisco; Aguilera-Venegas, Benjamín; Arán, Vicente J; López-Múñoz, Rodrigo A; Maya, Juan D


    A series of fused tri- and tetracyclic indazoles and analogues compounds (NID) with potential antiparasitic effects were studied using voltamperometric and spectroscopic techniques. Nitroanion radicals generated by cyclic voltammetry were characterized by electron spin resonance spectroscopy (ESR) and their spectral lines were explained and analyzed using simulated spectra. In addition, we examined the interaction between radical species generated from nitroindazole derivatives and glutathione (GSH). Biological assays such as activity against Trypanosoma cruzi and cytotoxicity against macrophages were carried out. Finally, spin trapping and molecular modeling studies were also done in order to elucidate the potentials action mechanisms involved in the trypanocidal activity.

  11. Measurement of Creep on the Calaveras Fault at Coyote Dam using Terrestrial Radar Interferometry (TRI).

    NASA Astrophysics Data System (ADS)

    Baker, B.; Cassotto, R.; Fahnestock, M. A.; Werner, C. L.; Boettcher, M. S.


    The Calaveras fault in central California is part of the San Andreas fault system. Coyote Dam, an earthen dam that straddles the fault ~13km northeast of Gilroy, experiences creep style deformation that ranges from 10 to 15 mm/yr. Uncertainty in the location of the fault, coupled with the historic rate of deformation, affect the dam's safety factor. Assessing the impact of fault creep on the dam's stability is paramount to its safety evaluation, but is difficult to resolve due to limited spatial and temporal sampling of conventional methods. Terrestrial radar interferometry (TRI), like satellite-based observations, produces high spatial resolution maps of ground deformation. Unlike space-based sensors, TRI can be readily deployed and the observation geometry selected to get the maximum line of sight (LOS) signal. TRI also benefits from high temporal sampling which can be used to reduce errors related to atmospheric phase delays and high temporal sampling also facilitates tracking rapidly moving features such as landslides and glaciers. GAMMA Portable Radar Interferometer (GPRI) measurements of Coyote Dam rock faces were made from concrete piers built upstream and downstream of the dam. The GPRI operates at a radar frequency of 17.2 GHz with a spatial resolution at the dam of approximately 0.9 m x 2.0 m. Changes in LOS path length smaller than 0.1mm can be measured. Data were acquired approximately every 2 to 3 weeks over a 7-month period to map the fault trace through the dam faces. Our study exploits the dense record of observations obtained, and the relatively short distance of the radar to the dam to minimize atmospheric affects. We investigate how the deformation evolves in time and the orientation of fault through the dam, including the strike and dip as measured along the dam surface. Our results show rates consistent with GPS data and regional satellite observations, but produce a much more detailed map of the fault on the dam than possible with GPS or

  12. Evaluation of the TRI 'dipstick' test for the detection of drugs of abuse in urine.


    Jukofsky, D; Kramer, A; Mulé, S J


    An evaluation of Technology Resources Inc. (TRI) Amphetamine, Barbiturate, Narcotic (G) and Narcotic (S) "Dipsticks" for drugs of abuse in urine was made. The results obtained by six individuals reading the "Dipstick" papers was compared with the analysis of the same urine samples, by a combination of TLC, EMIT, RIA and GLC. The data obtained with "Dipstick" papers, regardless of the drug tested, were clearly unreliable (high percentage of false negatives, low percentage of true positives) and the assay was unsuitable as a technique for screening urines for drugs of abuse.

  13. Fabrication of Planar, Layered Nanoparticles Using Tri-layer Resist Templates

    PubMed Central

    Hu, Wei; Zhang, Mingliang; Wilson, Robert J.; Koh, Ai Leen; Wi, Jung-Sub; Tang, Mary; Sinclair, Robert; Wang, Shan X.


    A simple and universal pathway to produce free multilayer synthetic nanoparticles is developed based on lithography, vapor phase deposition and a tri-layer resist lift off and release process. The fabrication method presented in this work is ideal for production of a broad range of nanoparticles, either free in solution or still attached to an intact release layer, with unique magnetic, optical, radioactive, electronic and catalytic properties. Multi-modal capabilities are implicit in the layered architecture. As an example, directly fabricated magnetic nanoparticles are evaluated to illustrate the structural integrity of thin internal multilayers and the nanoparticle stability in aggressive biological environments, which is highly desired for biomedical applications. PMID:21415483

  14. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers

    SciTech Connect

    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M.; Nachon, Florian; Masson, Patrick; Furlong, Clement E.; Lockridge, Oksana


    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such 'fume events'. Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24-48 h after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. -- Highlights: Black-Right-Pointing-Pointer Travel on jet airplanes is associated with an illness, aerotoxic syndrome. Black-Right-Pointing-Pointer A possible cause is exposure to tricresyl

  15. Admixture of quasi-Dirac and Majorana neutrinos with tri-bimaximal mixing

    NASA Astrophysics Data System (ADS)

    Morisi, S.; Peinado, E.


    We propose a realization of the so-called bimodal/schizophrenic model proposed recently. We assume S4, the permutation group of four objects as flavor symmetry giving tri-bimaximal lepton mixing at leading order. In these models the second massive neutrino state is assumed quasi-Dirac and the remaining neutrinos are Majorana states. In the case of inverse mass hierarchy, the lower bound on the neutrinoless double beta decay parameter mee is about two times that of the usual lower bound, within the range of sensitivity of the next generation of experiments.

  16. Identification of the third/extra allele for forensic application in cases with TPOX tri-allelic pattern.


    Picanço, Juliane Bentes; Raimann, Paulo Eduardo; da Motta, Carlos Henrique Ares Silveira; Rodenbusch, Rodrigo; Gusmão, Leonor; Alho, Clarice Sampaio


    Genotyping of polymorphic short tandem repeats (STRs) loci is widely used in forensic DNA analysis. STR loci eventually present tri-allelic pattern as a genotyping irregularity and, in that situation, the doubt about the tri-allele locus frequency calculation can reduce the analysis strength. In the TPOX human STR locus, tri-allelic genotypes have been reported with a widely varied frequency among human populations. We investigate whether there is a single extra allele (the third allele) in the TPOX tri-allelic pattern, what it is, and where it is, aiming to understand its genomic anatomy and to propose the knowledge of this TPOX extra allele from genetic profile, thus preserving the two standard TPOX alleles in forensic analyses. We looked for TPOX tri-allelic subjects in 75,113 Brazilian families. Considering only the parental generation (mother+father) we had 150,226 unrelated subjects evaluated. From this total, we found 88 unrelated subjects with tri-allelic pattern in the TPOX locus (0.06%; 88/150,226). Seventy three of these 88 subjects (73/88; 83%) had the Clayton's original Type 2 tri-allelic pattern (three peaks of even intensity). The remaining 17% (15/88) show a new Type 2 derived category with heterozygote peak imbalance (one double dose peak plus one regular sized peak). In this paper we present detailed data from 66 trios (mother+father+child) with true biological relationships. In 39 of these families (39/66; 59%) the extra TPOX allele was transmitted either from the mother or from the father to the child. Evidences indicated the allele 10 as the extra TPOX allele, and it is on the X chromosome. The present data, which support the previous Lane hypothesis, improve the knowledge about tri-allelic pattern of TPOX CODIS' locus allowing the use of TPOX profile in forensic analyses even when with tri-allelic pattern. This evaluation is now available for different forensic applications.

  17. Fabrication of C60 Tri-Diethyl Malonate Membrane via an Electrospinning Method and Its Antibacterial Property.


    Li, Hui; Chen, Shou; Peng, Xiaohua; Sun, Jiangning; Shu, Chunying; Jiang, Li; Wang, Chunru


    A homogeneous C60 tri-diethyl malonate membrane was fabricated by a facile electro-spinning method. Comprehensive characterizations of its assembling structure, such as SEM, TEM, TGA, UV-vis, and FTIR, were carried out. Different fullerene derivatives show different assembling characters during the electrospining process. Notably, C60 tri-diethyl malonate with close-knite structures can form a stable structure after removing the assistant polymer of PVP. The antibacterial experiments of C60 tri-diethyl malonate membrane were performed, and the results revealed that this membrane owns excellent antibacterial activity.

  18. Fabrication of C60 Tri-Diethyl Malonate Membrane via an Electrospinning Method and Its Antibacterial Property.


    Li, Hui; Chen, Shou; Peng, Xiaohua; Sun, Jiangning; Shu, Chunying; Jiang, Li; Wang, Chunru


    A homogeneous C60 tri-diethyl malonate membrane was fabricated by a facile electro-spinning method. Comprehensive characterizations of its assembling structure, such as SEM, TEM, TGA, UV-vis, and FTIR, were carried out. Different fullerene derivatives show different assembling characters during the electrospining process. Notably, C60 tri-diethyl malonate with close-knite structures can form a stable structure after removing the assistant polymer of PVP. The antibacterial experiments of C60 tri-diethyl malonate membrane were performed, and the results revealed that this membrane owns excellent antibacterial activity. PMID:27455662

  19. Fuzzy-Based Hybrid Control Algorithm for the Stabilization of a Tri-Rotor UAV.


    Ali, Zain Anwar; Wang, Daobo; Aamir, Muhammad


    In this paper, a new and novel mathematical fuzzy hybrid scheme is proposed for the stabilization of a tri-rotor unmanned aerial vehicle (UAV). The fuzzy hybrid scheme consists of a fuzzy logic controller, regulation pole-placement tracking (RST) controller with model reference adaptive control (MRAC), in which adaptive gains of the RST controller are being fine-tuned by a fuzzy logic controller. Brushless direct current (BLDC) motors are installed in the triangular frame of the tri-rotor UAV, which helps maintain control on its motion and different altitude and attitude changes, similar to rotorcrafts. MRAC-based MIT rule is proposed for system stability. Moreover, the proposed hybrid controller with nonlinear flight dynamics is shown in the presence of translational and rotational velocity components. The performance of the proposed algorithm is demonstrated via MATLAB simulations, in which the proposed fuzzy hybrid controller is compared with the existing adaptive RST controller. It shows that our proposed algorithm has better transient performance with zero steady-state error, and fast convergence towards stability.

  20. Adaptive behaviour, tri-trophic food-web stability and damping of chaos

    PubMed Central

    Visser, André W.; Mariani, Patrizio; Pigolotti, Simone


    We examine the effect of adaptive foraging behaviour within a tri-trophic food web with intra-guild predation. The intra-guild prey is allowed to adjust its foraging effort so as to achieve an optimal per capita growth rate in the face of realized feeding, predation risk and foraging cost. Adaptive fitness-seeking behaviour of the intra-guild prey has a stabilizing effect on the tri-trophic food-web dynamics provided that (i) a finite optimal foraging effort exists and (ii) the trophic transfer efficiency from resource to predator via the intra-guild prey is greater than that from the resource directly. The latter condition is a general criterion for the feasibility of intra-guild predation as a trophic mode. Under these conditions, we demonstrate rigorously that adaptive behaviour will always promote stability of community dynamics in the sense that the region of parameter space in which stability is achieved is larger than for the non-adaptive counterpart of the system. PMID:22090284

  1. A Tri-part Model for Genetics Literacy: Exploring Undergraduate Student Reasoning About Authentic Genetics Dilemmas

    NASA Astrophysics Data System (ADS)

    Shea, Nicole A.; Duncan, Ravit Golan; Stephenson, Celeste


    Genetics literacy is becoming increasingly important as advancements in our application of genetic technologies such as stem cell research, cloning, and genetic screening become more prevalent. Very few studies examine how genetics literacy is applied when reasoning about authentic genetic dilemmas. However, there is evidence that situational features of a reasoning task may influence how students apply content knowledge as they generate and support arguments. Understanding how students apply content knowledge to reason about authentic and complex issues is important for considering instructional practices that best support student thinking and reasoning. In this conceptual report, we present a tri-part model for genetics literacy that embodies the relationships between content knowledge use, argumentation quality, and the role of situational features in reasoning to support genetics literacy. Using illustrative examples from an interview study with early career undergraduate students majoring in the biological sciences and late career undergraduate students majoring in genetics, we provide insights into undergraduate student reasoning about complex genetics issues and discuss implications for teaching and learning. We further discuss the need for research about how the tri-part model of genetics literacy can be used to explore students' thinking and reasoning abilities in genetics.

  2. Wireless portable electrocardiogram and a tri-axis accelerometer implementation and application on sleep activity monitoring.


    Chang, Kang-Ming; Liu, Shin-Hong


    Night-to-night variability of sleep activity requires more home-based portable sleep monitoring instead of clinical polysomnography examination in the laboratory. In this article, a wireless sleep activity monitoring system is described. The system is light and small for the user. Sleep postures, such as supine or left/right side, were observed by a signal from a tri-axis accelerometer. An overnight electrocardiogram was also recorded with a single lead. Using an MSP430 as microcontroller, both physiological signals were transmitted by a Bluetooth chip. A Labview-based interface demonstrated the recorded signal and sleep posture. Three nights of sleep recordings were used to examine night-to-night variability. The proposed system can record overnight heart rate. Results show that sleep posture and posture change can be precisely detected via tri-axis accelerometer information. There is no significant difference within subject data sets, but there are statistically significant differences among subjects, both for heart rate and for sleep posture distribution. The wireless transmission range is also sufficient for home-based users. PMID:21413872

  3. Effective detection method for falls according to the distance between two tri-axial accelerometers

    NASA Astrophysics Data System (ADS)

    Kim, Jae-Hyung; Park, Geun-Chul; Kim, Soo-Hong; Kim, Soo-Sung; Lee, Hae-Rim; Jeon, Gye-Rok


    Falls and fall-related injuries are a significant problem in the elderly population. A number of different approaches for detecting falls and activities of daily living (ADLs) have been conducted in recent years. However, distinguishing between real falls and certain fall-like ADL is often difficult. The aim of this study is to discriminate falls from fall-like ADLs such as jogging, jumping, and jumping down. The distance between two tri-axial accelerometers attached to the abdomen and the sternum was increased from 10 to 30 cm in 10-cm intervals. Experiments for falls and ADLs were performed to investigate the feasibility of the detection system for falls developed in this study. When the distances between the two tri-axial electrometers were 20 and 30 cm, fall-like ADLs were effectively distinguished from falls. The thresholds for three parameters — SVM, Diff Z, and Sum_diff_Z — were set; falls could be distinguished from ADL action sequences when the SVM value was larger than 4 g (TH1), the Diff_Z parameter was larger than 1.25 g (TH2), and the Sum_diff_Z parameter was larger than 15 m/s (TH3). In particular, when the SVM, Diff_Z, and Sum_diff_Z parameter were sequentially applied to thresholds (TH1, TH2, and TH3), fall-like ADL action sequences were accurately discriminated from falls.

  4. Biomechanical and metabolic responses to seat-tube angle variation during cycling in tri-athletes.


    Bisi, Maria Cristina; Ceccarelli, Mattia; Riva, Federico; Stagni, Rita


    One of the most physically demanding parts of triathlon is the transition from cycling to running. Many tri-athletes believe that increasing seat-tube angle (STA) can bring advantages in the following running part. The aim of this study was to evaluate the effects of inverting the support of the seat, for increasing STA, on the metabolic response and on the muscle activation pattern, maintaining a controlled kinematic. Moreover, a muscle-skeletal model was applied to evaluate the hypothesis that increasing STA changes force-producing capabilities of muscles crossing the hip. Ten tri-athletes cycled at two different power levels and with two different STA's. Gas exchange data, kinematics and surface electromyography (sEMG) were acquired during the tests. sEMG was measured from eight muscles of the right side of the body. A model of muscle mechanics and energy expenditure was applied to estimate variations of force production capabilities and muscle energy consumption between the two STA configurations. Inverting the support of the seat showed no significant effects on kinematic, Oxygen consumption, muscle activations and muscle power production capabilities. Nevertheless, an interesting advantage can be the tendency to less activate gastrocnemius and biceps femoris: this could lead to minor muscle fatigue during the following running phase. PMID:22595701

  5. Three coordination polymers based on different carboxylates, metals and a tri(4-imidazolylphenyl)amine ligand

    NASA Astrophysics Data System (ADS)

    Wu, Hua; Shi, Chenjie; Zhao, Yanqing; Jiang, Yutong; Tao, Yuehong


    In this paper, three new coordination complexes based on a flexible tri(4-imidazolylphenyl)amine (Tipa) ligand, namely [Co(Tipa)(L1)2]·H2O (1), [Zn2(Tipa)(L1)4(H2O)]·2H2O (2) and [Mn(Tipa)(L2)]·2H2O (3), where HL1 = benzoic acid H2L2 = 5-OH-1,3-benzenedicarboxylic acid and Tipa = tri(4-imidazolylphenyl)amine, have been synthesized under the hydrothermal condition and characterized by single-crystal X-ray diffraction, elemental analysis and IR spectra. Compound 1 exhibits a 1D ladder chain with the benzoic anions hanging on the two sides of the chain. For compound 2, it shows a fascinating 1D zigzag chain. Compound 3 displays (3,5)-connected (42·6)(42·67·8) topology, where the identical 2D networks entangle in highly rare parallel fashions to give a fascinating 2D → 3D framework with polycatenation and polyrotaxane characters. Moreover, the photoluminescent properties for the compounds 2 and 3 were also investigated.

  6. Along the Ta Diffusion Path Through a Boron and Oxygen Containing Tri-layer Structure

    NASA Astrophysics Data System (ADS)

    Ying, Ji-Feng; Ji, Rong; Wang, Chen Chen; Ter Lim, Sze; Xie, Huiqing; Gerard, Ernult F.


    Diffusion and migration of elements are commonly observed in the fabrication of multilayer thin-film devices, including those of STT-RAM. The CoFeB/MgO/CoFeB tri-layer thin-film stack has been widely used in the design of STT-RAM devices as the functional magnetic-tunnel-junction (MTJ) structure. Such issues faced in the fabrication of these devices have been extensively researched from the stand point of engineering the materials property and structure to achieve the best MTJ performance. In this work, we conducted a detailed examination of the chemical-state change of the Ta and B in a CoFeB/MgO/CoFeB/Ta film stack by using x-ray photoelectron spectroscopy (XPS) and time-of-flight secondary ion mass spectrometry. We showed that the chemical-state change of Ta and B is a result of the Ta diffusion phenomena through the CoFeB/MgO/CoFeB tri-layer structure. In particular, we report the evidences of the formation of TaB x O y compound at some considerable depth away from the Ta layer. Also of value to XPS spectroscopy, the Ta binding energy for such TaB x O y compound is reported for the first time.

  7. Two new polytypes of 2,4,6-tri­bromo­benzo­nitrile

    PubMed Central

    Britton, Doyle; Noland, Wayland E.; Tritch, Kenneth J.


    Three polymorphs of 2,4,6-tri­bromo­benzo­nitrile (RCN), C7H2Br3N, two of which are novel and one of which is a redetermination of the original structure first determined by Carter & Britton [(1972). Acta Cryst. B28, 945–950] are found to be polytypic. Each has a layer structure which differs only in the stacking of the layers. Each layer is composed of mol­ecules associated through C N⋯Br contacts which form R 2 2(10) rings. Two such rings are associated with each N atom; one with each ortho-Br atom. No new polytypes of 1,3,5-tri­bromo-2-iso­cyano­benzene (RNC) were found but a re-determination of the original structure by Carter et al. [(1977). Cryst. Struct. Commun. 6, 543–548] is presented. RNC was found to be isostructural with one of the novel polytypes of RCN. Unit cells were determined for 23 RCN samples and 11 RNC samples. Polytypes could not be distinguished based on crystal habits. In all four structures, each mol­ecule of the asymmetric unit lies across a mirror plane. PMID:26958382

  8. Fuzzy-Based Hybrid Control Algorithm for the Stabilization of a Tri-Rotor UAV.


    Ali, Zain Anwar; Wang, Daobo; Aamir, Muhammad


    In this paper, a new and novel mathematical fuzzy hybrid scheme is proposed for the stabilization of a tri-rotor unmanned aerial vehicle (UAV). The fuzzy hybrid scheme consists of a fuzzy logic controller, regulation pole-placement tracking (RST) controller with model reference adaptive control (MRAC), in which adaptive gains of the RST controller are being fine-tuned by a fuzzy logic controller. Brushless direct current (BLDC) motors are installed in the triangular frame of the tri-rotor UAV, which helps maintain control on its motion and different altitude and attitude changes, similar to rotorcrafts. MRAC-based MIT rule is proposed for system stability. Moreover, the proposed hybrid controller with nonlinear flight dynamics is shown in the presence of translational and rotational velocity components. The performance of the proposed algorithm is demonstrated via MATLAB simulations, in which the proposed fuzzy hybrid controller is compared with the existing adaptive RST controller. It shows that our proposed algorithm has better transient performance with zero steady-state error, and fast convergence towards stability. PMID:27171084

  9. Fuzzy-Based Hybrid Control Algorithm for the Stabilization of a Tri-Rotor UAV

    PubMed Central

    Ali, Zain Anwar; Wang, Daobo; Aamir, Muhammad


    In this paper, a new and novel mathematical fuzzy hybrid scheme is proposed for the stabilization of a tri-rotor unmanned aerial vehicle (UAV). The fuzzy hybrid scheme consists of a fuzzy logic controller, regulation pole-placement tracking (RST) controller with model reference adaptive control (MRAC), in which adaptive gains of the RST controller are being fine-tuned by a fuzzy logic controller. Brushless direct current (BLDC) motors are installed in the triangular frame of the tri-rotor UAV, which helps maintain control on its motion and different altitude and attitude changes, similar to rotorcrafts. MRAC-based MIT rule is proposed for system stability. Moreover, the proposed hybrid controller with nonlinear flight dynamics is shown in the presence of translational and rotational velocity components. The performance of the proposed algorithm is demonstrated via MATLAB simulations, in which the proposed fuzzy hybrid controller is compared with the existing adaptive RST controller. It shows that our proposed algorithm has better transient performance with zero steady-state error, and fast convergence towards stability. PMID:27171084

  10. Adaptive omnivory and species coexistence in tri-trophic food webs.


    Krivan, Vlastimil; Diehl, Sebastian


    The commonness of omnivory in natural communities is puzzling, because simple dynamic models of tri-trophic systems with omnivory are prone to species extinction. In particular, the intermediate consumer is frequently excluded by the omnivore at high levels of enrichment. It has been suggested that adaptive foraging by the omnivore may facilitate coexistence, because the intermediate consumer should persist more easily if it is occasionally dropped from the omnivore's diet. We explore theoretically how species permanence in tri-trophic systems is affected if the omnivore forages adaptively according to the "diet rule", i.e., feeds on the less profitable of its two prey species only if the more profitable one is sufficiently rare. We show that, compared to systems where omnivory is fixed, adaptive omnivory may indeed facilitate 3-species persistence. Counter to intuition, however, facilitation of 3-species coexistence requires that the intermediate consumer is a more profitable prey than the basal resource. Consequently, adaptive omnivory does not facilitate persistence of the intermediate consumer but enlarges the persistence region of the omnivore towards parameter space where a fixed omnivore would be excluded by the intermediate consumer. Overall, the positive effect of adaptive omnivory on 3-species persistence is, however, small. Generally, whether omnivory is fixed or adaptive, 3-species permanence is most likely when profitability (=conversion efficiency into omnivores) is low for basal resources and high for intermediate consumers.

  11. Health risk assessment of exposure to TriCresyl Phosphates (TCPs) in aircraft: a commentary.


    de Ree, Hans; van den Berg, Martin; Brand, Teus; Mulder, Gerard J; Simons, Ries; Veldhuijzen van Zanten, Brinio; Westerink, Remco H S


    Possible exposure to TriCresyl Phosphates (TCPs) has led to concerns among airline crew members. One isomer, Tri-ortho-Cresyl Phosphate (ToCP) is known to be neurotoxic and exposure to ToCP via contaminated cabin air has been suggested to be associated with the alleged Aerotoxic syndrome. The symptoms associated with Aerotoxic syndrome are diverse, including headaches, loss of balance, numbness and neurobehavioral abnormalities such as emotional instability, depression and cognitive dysfunction. Other ortho-isomers are toxic as well, but the non-ortho isomers are regarded as less toxic. In a collaborative effort to increase insight into the possible association between exposure to TCPs via contaminated cabin air and Aerotoxic syndrome, we performed an exposure- and toxicological risk assessment. Measurements in KLM 737 aircraft have demonstrated the presence of non-ortho isomers in low concentrations, though ToCP and other ortho-isomers could not be detected. Based on this exposure assessment, we established a toxicological risk model that also takes into account human differences in bioactivation and detoxification to derive a hazard quotient. From this model it appears unlikely that the health effects and alleged Aerotoxic syndrome are due to exposure to ToCP. Alternative explanations for the reported symptoms are discussed, but evaluation of the current findings in light of the criteria for occupational disease leads to the conclusion that the Aerotoxic Syndrome cannot be regarded as such. Additional research is thus required to unravel the underlying causes for the reported health complaints.

  12. The transverse space-charge force in tri-gaussian distribution

    SciTech Connect

    Ng, K.Y.; /Fermilab


    In tracking, the transverse space-charge force can be represented by changes in the horizontal and vertical divergences, {Delta}x{prime} and {Delta}y{prime} at many locations around the accelerator ring. In this note, they are going to list some formulas for {Delta}x{prime} and {delta}y{prime} arising from space-charge kicks when the beam is tri-Gaussian distributed. They will discuss separately a flat beam and a round beam. they are not interested in the situation when the emittance growth arising from space charge becomes too large and the shape of the beam becomes weird. For this reason, they can assume the bunch still retains its tri-Gaussian distribution, with its rms sizes {sigma}{sub x}, {sigma}{sub y}, and {sigma}{sub z} increasing by certain factors. Thus after each turn, {sigma}{sub x}, {sigma}{sub y}, and {sigma}{sub z} can be re-calculated.

  13. Activity classification using a single chest mounted tri-axial accelerometer.


    Godfrey, A; Bourke, A K; Olaighin, G M; van de Ven, P; Nelson, J


    Accelerometer-based activity monitoring sensors have become the most suitable means for objective assessment of mobility trends within patient study groups. The use of minimal, low power, IC (integrated circuit) components within these sensors enable continuous (long-term) monitoring which provides more accurate mobility trends (over days or weeks), reduced cost, longer battery life, reduced size and weight of sensor. Using scripted activities of daily living (ADL) such as sitting, standing, walking, and numerous postural transitions performed under supervised conditions by young and elderly subjects, the ability to discriminate these ADL were investigated using a single tri-axial accelerometer, mounted on the trunk. Data analysis was performed using Matlab® to determine the accelerations performed during eight different ADL. Transitions and transition types were detected using the scalar (dot) product technique and vertical velocity estimates on a single tri-axial accelerometer was compared to a proven discrete wavelet transform method that incorporated accelerometers and gyroscopes. Activities and postural transitions were accurately detected by this simplified low-power kinematic sensor and activity detection algorithm with a sensitivity and specificity of 86-92% for young healthy subjects in a controlled setting and 83-89% for elderly healthy subjects in a home environment. PMID:21636308

  14. A balanced JA/ABA status may correlate with adaptation to osmotic stress in Vitis cells.


    Ismail, Ahmed; Seo, Mitsunori; Takebayashi, Yumiko; Kamiya, Yuji; Nick, Peter


    Water-related stress is considered a major type of plant stress. Osmotic stress, in particular, represents the common part of all water-related stresses. Therefore, plants have evolved different adaptive mechanisms to cope with osmotic-related disturbances. In the current work, two grapevine cell lines that differ in their osmotic adaptability, Vitis rupestris and Vitis riparia, were investigated under mannitol-induced osmotic stress. To dissect signals that lead to adaptability from those related to sensitivity, osmotic-triggered responses with respect to jasmonic acid (JA) and its active form JA-Ile, abscisic acid (ABA), and stilbene compounds, as well as the expression of their related genes were observed. In addition, the transcript levels of the cellular homeostasis gene NHX1 were examined. The data are discussed with a hypothesis suggesting that a balance of JA and ABA status might correlate with cellular responses, either guiding cells to sensitivity or to progress toward adaptation. PMID:26277753

  15. The insula modulates arousal-induced reluctance to try novel tastes through adrenergic transmission in the rat

    PubMed Central

    Rojas, Sebastián; Diaz-Galarce, Raúl; Jerez-Baraona, Juan Manuel; Quintana-Donoso, Daisy; Moraga-Amaro, Rodrigo; Stehberg, Jimmy


    Reluctance to try novel tastes (neophobia) can be exacerbated in arousing situations, such as when children are under social stress or in rodents, when the new taste is presented in a high arousal context (HA) compared to a low arousal context (LA). The present study aimed at determining whether adrenergic transmission at the Insula regulates the reluctance to try novel tastes induced by arousing contexts. To this end, a combination of systemic and intra-insular manipulations of adrenergic activity was performed before the novel taste (saccharin 0.1%) was presented either in LA or HA contexts in rats. Our results show that systemic adrenergic activity modulates reluctance to try novel tastes. Moreover, intra-insular microinjections of propranolol or norepinephrine (NE) were found to modulate the effects of arousing contexts on reluctance to try novel tastes. Finally, intra-insular propranolol blocked epinephrine-induced increased reluctance, while intra-insular NE blocked oral propranolol-induced decreases in reluctance and increased the reluctance to try novel tastes presented in low arousing contexts. In conclusion, our results suggest that the insula is a critical site for regulating the effects of arousal in the reluctance to try novel tastes via the adrenergic system. PMID:26175672

  16. Tri-band optical coherence tomography for lipid and vessel spectroscopic imaging

    NASA Astrophysics Data System (ADS)

    Yu, Luoqin; Kang, Jiqiang; Wang, Xie; Wei, Xiaoming; Chan, Kin-Tak; Lee, Nikki P.; Wong, Kenneth K. Y.


    Optical coherence tomography (OCT) has been utilized for various functional imaging applications. One of its highlights comes from spectroscopic imaging, which can simultaneously obtain both morphologic and spectroscopic information. Assisting diagnosis and therapeutic intervention of coronary artery disease is one of the major directions in spectroscopic OCT applications. Previously Tanaka et al. have developed a spectral domain OCT (SDOCT) to image lipid distribution within blood vessel [1]. In the meantime, Fleming et al. have demonstrated optical frequency domain imaging (OFDI) by a 1.3-μm swept source and quadratic discriminant analysis model [2]. However, these systems suffered from burdensome computation as the optical properties' variation was calculated from a single-band illumination that provided limited contrast. On the other hand, multi-band OCT facilitates contrast enhancement with separated wavelength bands, which further offers an easier way to distinguish different materials. Federici and Dubois [3] and Tsai and Chan [4] have demonstrated tri-band OCT systems to further enhance the image contrast. However, these previous work provided under-explored functional properties. Our group has reported a dual-band OCT system based on parametrically amplified Fourier domain mode-locked (FDML) laser with time multiplexing scheme [5] and a dual-band FDML laser OCT system with wavelength-division multiplexing [6]. Fiber optical parametric amplifier (OPA) can be ideally incorporated in multi-band spectroscopic OCT system as it has a broad amplification window and offers an additional output range at idler band, which is phase matched with the signal band. The sweeping ranges can thus overcome traditional wavelength bands that are limited by intra-cavity amplifiers in FDML lasers. Here, we combines the dual-band FDML laser together with fiber OPA, which consequently renders a simultaneous tri-band output at 1.3, 1.5, and 1.6 μm, for intravascular applications

  17. Dermal sensitization potential of ja-2 solid propellant in guinea pigs. Report for 4 April-9 May 1986

    SciTech Connect

    Lewis, C.M.; Brown, L.D.; Korte, D.W.


    JA-2 Solid Propellant was evaluated for its potential to produce dermal sensitization in male guinea pigs. The Buehler test, which utilizes repeated closed patch inductions with the test compound, was used for this evaluation. No evidence that JA-2 Solid Propellant induced sensitization was obtained in the study.

  18. ASC Tri-lab Co-design Level 2 Milestone Report 2015

    SciTech Connect

    Hornung, Rich; Jones, Holger; Keasler, Jeff; Neely, Rob; Pearce, Olga; Hammond, Si; Trott, Christian; Lin, Paul; Vaughan, Courtenay; Cook, Jeanine; Hoekstra, Rob; Bergen, Ben; Payne, Josh; Womeldorff, Geoff


    In 2015, the three Department of Energy (DOE) National Laboratories that make up the Advanced Sci- enti c Computing (ASC) Program (Sandia, Lawrence Livermore, and Los Alamos) collaboratively explored performance portability programming environments in the context of several ASC co-design proxy applica- tions as part of a tri-lab L2 milestone executed by the co-design teams at each laboratory. The programming environments that were studied included Kokkos (developed at Sandia), RAJA (LLNL), and Legion (Stan- ford University). The proxy apps studied included: miniAero, LULESH, CoMD, Kripke, and SNAP. These programming models and proxy-apps are described herein. Each lab focused on a particular combination of abstractions and proxy apps, with the goal of assessing performance portability using those. Performance portability was determined by: a) the ability to run a single application source code on multiple advanced architectures, b) comparing runtime performance between \

  19. Clinical review: Thyroid hormone replacement in children after cardiac surgery – is it worth a try?

    PubMed Central

    Haas, Nikolaus A; Camphausen, Christoph K; Kececioglu, Deniz


    Cardiac surgery using cardiopulmonary bypass produces a generalized systemic inflammatory response, resulting in increased postoperative morbidity and mortality. Under these circumstances, a typical pattern of thyroid abnormalities is seen in the absence of primary disease, defined as sick euthyroid syndrome (SES). The presence of postoperative SES mainly in small children and neonates exposed to long bypass times and the pharmacological profile of thyroid hormones and their effects on the cardiovascular physiology make supplementation therapy an attractive treatment option to improve postoperative morbidity and mortality. Many studies have been performed with conflicting results. In this article, we review the important literature on the development of SES in paediatric postoperative cardiac patients, analyse the existing information on thyroid hormone replacement therapy in this patient group and try to summarize the findings for a recommendation. PMID:16719939

  20. Growth of bi- and tri-layered graphene on silicon carbide substrate via molecular dynamics simulation

    NASA Astrophysics Data System (ADS)

    Min, Tjun Kit; Lim, Thong Leng; Yoon, Tiem Leong


    Molecular dynamics (MD) simulation with simulated annealing method is used to study the growth process of bi- and tri-layered graphene on a 6H-SiC (0001) substrate via molecular dynamics simulation. Tersoff-Albe-Erhart (TEA) potential is used to describe the inter-atomic interactions among the atoms in the system. The formation temperature, averaged carbon-carbon bond length, pair correlation function, binding energy and the distance between the graphene formed and the SiC substrate are quantified. The growth mechanism, graphitization of graphene on the SiC substrate and characteristics of the surface morphology of the graphene sheet obtained in our MD simulation compare well to that observed in epitaxially grown graphene experiments and other simulation works.

  1. 1-nm-thick graphene tri-layer as the ultimate copper diffusion barrier

    SciTech Connect

    Nguyen, Ba-Son; Lin, Jen-Fin


    We demonstrate the thinnest ever reported Cu diffusion barrier, a 1-nm-thick graphene tri-layer. X-ray diffraction patterns and Raman spectra show that the graphene is thermally stable at up to 750 °C against Cu diffusion. Transmission electron microscopy images show that there was no inter-diffusion in the Cu/graphene/Si structure. Raman analyses indicate that the graphene may have degraded into a nanocrystalline structure at 750 °C. At 800 °C, the perfect carbon structure was damaged, and thus the barrier failed. The results of this study suggest that graphene could be the ultimate Cu interconnect diffusion barrier.

  2. Composite germanium monochromators - Results for the TriCS single-crystal diffractometer at SINQ

    NASA Astrophysics Data System (ADS)

    Schefer, J.; Fischer, S.; Böhm, M.; Keller, L.; Horisberger, M.; Medarde, M.; Fischer, P.

    Composite germanium monochromators are foremost in application in neutron diffraction due to their good scattering properties, low absorption values and the diamond structure which avoids second-order contamination when using hhk reflections (all odd). Our slices for the monochromator are built from 24 wafers, each 0.4 mm thick. The alignment of the wafers within the final composite wafer package has been improved by adding tin for the soldering process with a sputtering method instead of foils. Nine slices, each 12.5 mm high, are mounted on separate miniature goniometer heads to the focusing monochromator. The focusing angle is controlled by only one motor/digitizer by using a sophisticated mechanism. Turning the monochromator by 9° around overlineω allow access of the 311 (primary) and 511 (secondary) reflection. We also show the importance of permanent quality control with neutrons. The monochromator will be used on the single-crystal diffractometer TriCS at SINQ.

  3. Emergence of collective modes and tri-dimensional structures from epithelial confinement

    NASA Astrophysics Data System (ADS)

    Deforet, M.; Hakim, V.; Yevick, H. G.; Duclos, G.; Silberzan, P.


    Many in vivo processes, including morphogenesis or tumour maturation, involve small populations of cells within a spatially restricted region. However, the basic mechanisms underlying the dynamics of confined cell assemblies remain largely to be deciphered and would greatly benefit from well-controlled in vitro experiments. Here we show that confluent epithelial cells cultured on finite population-sized domains, exhibit collective low-frequency radial displacement modes as well as stochastic global rotation reversals. A simple mathematical model, in which cells are described as persistent random walkers that adapt their motion to that of their neighbours, captures the essential characteristics of these breathing oscillations. As these epithelia mature, a tri-dimensional peripheral cell cord develops at the domain edge by differential extrusion, as a result of the additional degrees of freedom of the border cells. These results demonstrate that epithelial confinement alone can induce morphogenesis-like processes including spontaneous collective pulsations and transition from 2D to 3D.

  4. The effects of compressive sensing on extracted features from tri-axial swallowing accelerometry signals

    NASA Astrophysics Data System (ADS)

    Sejdić, Ervin; Movahedi, Faezeh; Zhang, Zhenwei; Kurosu, Atsuko; Coyle, James L.


    Acquiring swallowing accelerometry signals using a comprehensive sensing scheme may be a desirable approach for monitoring swallowing safety for longer periods of time. However, it needs to be insured that signal characteristics can be recovered accurately from compressed samples. In this paper, we considered this issue by examining the effects of the number of acquired compressed samples on the calculated swallowing accelerometry signal features. We used tri-axial swallowing accelerometry signals acquired from seventeen stroke patients (106 swallows in total). From acquired signals, we extracted typically considered signal features from time, frequency and time-frequency domains. Next, we compared these features from the original signals (sampled using traditional sampling schemes) and compressively sampled signals. Our results have shown we can obtain accurate estimates of signal features even by using only a third of original samples.

  5. STS-96 M.S. Tokarev tries gas mask as part of a TCDT

    NASA Technical Reports Server (NTRS)


    STS-96 Mission Specialist Valery Ivanovich Tokarev, with the Russian Space Agency, tries on an oxygen gas mask during Terminal Countdown Demonstration Test (TCDT) activities at Launch Pad 39B. The TCDT provides the crew with simulated countdown exercises, emergency egress training and opportunities to inspect the mission payloads in the orbiter's payload bay. Other crew members taking part in the TCDT are Commander Kent V. Rominger, Pilot Rick Douglas Husband, and Mission Specialists Tamara E. Jernigan (Ph.D.), Daniel Barry (M.D., Ph.D.), Ellen Ochoa (Ph.D.) and Julie Payette, with the Canadian Space Agency. Scheduled for liftoff on May 20 at 9:32 a.m., STS-96 is a logistics and resupply mission for the International Space Station, carrying such payloads as a Russian crane, the Strela; a U.S.-built crane; the Spacehab Oceaneering Space System Box (SHOSS), a logistics items carrier; and STARSHINE, a student-led experiment.

  6. Behaviorally plastic host-plant use by larval Lepidoptera in tri-trophic food webs.


    Singer, Michael S


    Plant-insect interactions research emphasizes adaptive plasticity of plants and carnivores, such as parasitoids, implying a relatively passive role of herbivores. Current work is addressing this deficit, with exciting studies of behavioral plasticity of larval Lepidoptera (caterpillars). Here I use select examples to illustrate the diversity of behaviorally plastic host-plant use by caterpillars, including anti-predator tactics, self-medication, and evasion of dynamic plant defenses, as proof of the agency of caterpillar behavior in plant-insect interactions. I emphasize the significance of adaptive behavioral plasticity of caterpillars in the context of tri-trophic interactions. Recent research on trait-mediated indirect interactions places adaptive behavioral plasticity of herbivores at the center of community and food web dynamics, with far-reaching consequences of issues such as community stability. PMID:27436647

  7. Semiclassical description of TRI asymmetry in ternary fission induced by cold polarized neutrons

    SciTech Connect

    Bunakov, V. E.; Kadmensky, S. G.


    The possibility of semiclassically describing T-even TRI-type asymmetry in ternary fission induced by polarized neutrons is considered on the basis of employing Coriolis interaction that takes into account the coupling of a light charged particle to the collective rotation of a polarized fissile nucleus. It is shown that allowance for this interaction makes it possible to explain qualitatively the magnitudes of two asymmetry effects observed in light-charge-particle emission both within the semiclassical and within the quantum-mechanical approach. The difference in the relative magnitudes and signs of the effects between different target nuclei is associated with the interference contributions to the cross section from neighboring neutron resonances and therefore cannot be explained within the semiclassical approach.

  8. When it hurts (and helps) to try: the role of effort in language learning.


    Finn, Amy S; Lee, Taraz; Kraus, Allison; Hudson Kam, Carla L


    Compared to children, adults are bad at learning language. This is counterintuitive; adults outperform children on most measures of cognition, especially those that involve effort (which continue to mature into early adulthood). The present study asks whether these mature effortful abilities interfere with language learning in adults and further, whether interference occurs equally for aspects of language that adults are good (word-segmentation) versus bad (grammar) at learning. Learners were exposed to an artificial language comprised of statistically defined words that belong to phonologically defined categories (grammar). Exposure occurred under passive or effortful conditions. Passive learners were told to listen while effortful learners were instructed to try to 1) learn the words, 2) learn the categories, or 3) learn the category-order. Effortful learners showed an advantage for learning words while passive learners showed an advantage for learning the categories. Effort can therefore hurt the learning of categories.

  9. Behaviorally plastic host-plant use by larval Lepidoptera in tri-trophic food webs.


    Singer, Michael S


    Plant-insect interactions research emphasizes adaptive plasticity of plants and carnivores, such as parasitoids, implying a relatively passive role of herbivores. Current work is addressing this deficit, with exciting studies of behavioral plasticity of larval Lepidoptera (caterpillars). Here I use select examples to illustrate the diversity of behaviorally plastic host-plant use by caterpillars, including anti-predator tactics, self-medication, and evasion of dynamic plant defenses, as proof of the agency of caterpillar behavior in plant-insect interactions. I emphasize the significance of adaptive behavioral plasticity of caterpillars in the context of tri-trophic interactions. Recent research on trait-mediated indirect interactions places adaptive behavioral plasticity of herbivores at the center of community and food web dynamics, with far-reaching consequences of issues such as community stability.

  10. Growth of bi- and tri-layered graphene on silicon carbide substrate via molecular dynamics simulation

    SciTech Connect

    Min, Tjun Kit; Yoon, Tiem Leong; Lim, Thong Leng


    Molecular dynamics (MD) simulation with simulated annealing method is used to study the growth process of bi- and tri-layered graphene on a 6H-SiC (0001) substrate via molecular dynamics simulation. Tersoff-Albe-Erhart (TEA) potential is used to describe the inter-atomic interactions among the atoms in the system. The formation temperature, averaged carbon-carbon bond length, pair correlation function, binding energy and the distance between the graphene formed and the SiC substrate are quantified. The growth mechanism, graphitization of graphene on the SiC substrate and characteristics of the surface morphology of the graphene sheet obtained in our MD simulation compare well to that observed in epitaxially grown graphene experiments and other simulation works.

  11. Rapid fabrication and characterization of superhydrophobic tri-dimensional Ni/Al coatings

    NASA Astrophysics Data System (ADS)

    Guo, Xiaogang; Li, Xueming; Wei, Zhibo; Li, Xiaolin; Niu, Lidan


    Superhydrophobic tri-dimensional Ni/Al coatings (3DNACs) with great application value have been successfully fabricated via a simple two-step method combined with hydrogen bubble dynamic template and electrophoretic deposition technique after 1H, 1H, 2H, 2H-perfluorodecyltriethoxysilane treatment. The surface morphologies and chemical compositions were analyzed by FE-SEM, EDS, XRD, AFM and FT-IR in detail. The water contact angle of superhydrophobic 3DNACs surface was as high as 156 ± 2° (>150) much larger than that of unmodified samples. Moreover, the obtained samples exhibited great thermal properties and combustion performance. Thus, the superhydrophobic 3DNACs with prominent exothermic capability turn out to be a promising novel energy in field of mirco/nano energy materials for longer-term storage or transportation, especially in high humid environment.

  12. A predictive A model, charged lepton hierarchy and tri-bimaximal sum rule

    NASA Astrophysics Data System (ADS)

    Lin, Yin


    We propose a novel A model in which the Tri-Bimaximal (TB) neutrino mixing and the charged lepton mass hierarchy are reproduced simultaneously. At leading order, the residual symmetry of the neutrino sector is Z×Z which guarantees the TB mixing without adjusting ad hoc free parameters. In the charged lepton sector, one of the previous Z is maximally broken and the resulting mass matrix is nearly diagonal and hierarchical. A natural mechanism for the required vacuum alignment is given with the help of the supersymmetry and an Abelian symmetry factor. In our model, subleading effects which could lead to appreciable deviations from TB mixing are very restrictive giving rise to possible next-to-leading predictions. From an explicit example, we show that our "constrained" A model is a natural framework, based on symmetry principle, to incorporate the TB sum rule: sinθ=1/3+2√{2}(cosδsinθ)/3.

  13. What the brain's intrinsic activity can tell us about consciousness? A tri-dimensional view.


    Northoff, Georg


    Current neuroscience applies a bi-dimensional model to consciousness. Content and level of consciousness have been distinguished from each other in their underlying neuronal mechanisms. This though leaves open the role of the brain's intrinsic activity and its particular temporal and spatial structure in consciousness. I here review and investigate the spatial and temporal features of the brain's intrinsic activity in detail and postulate what I describe as spatiotemporal structure that implies a virtual (e.g., statistically based) spatiotemporal continuity. Such spatiotemporal continuity is supposed to structure and organize the neural processing of the incoming extrinsic stimuli and their potential association with consciousness. I therefore conclude that the current bi-dimensional view of consciousness focusing only on content and level may need to be complemented by a third dimension, the form, e.g., spatiotemporal structure, as provided by the intrinsic activity. In short, I here opt for tri-rather than bi-dimensional view of consciousness.

  14. Effect of endotoxin fever on plasma clearance of thyroxine and tri-iodothyronine: concise communication

    SciTech Connect

    Elson, M.K.; Oken, M.M.; Shafer, R.B.


    Endotoxin-induced fever in rabbits causes a rapid decrease in serum T3, a reciprocal rise of 3,3',5'-tri-iodothyronine (rT3), and a less marked reduction in T4 with a rebound at 24 hr. To answer the question whether the alteration in hormone levels was the result of a decrease in T3 or T4 production and release or of an increase in T3 and T4 metabolism, we measured the disappearance of (125I)T4 and (125I)T3 during endotoxin-induced fever and externally applied heat. Results showed no significant difference in disappearance of (125I)T4 or (125I)T3. This suggests that the rapid change in T3 levels associated with endotoxin fever is due to an inhibition of thyroid production and peripheral conversion, and not to increased metabolism of hormones.

  15. Crystal structure of bromido-nitro-syl-bis(tri-phenyl-phosphane-κP)nickel(II).


    Hockley, Rose; Irshad, Hira; Sheriff, Tippu S; Motevalli, Majid; Marinakis, Sarantos


    The asymmetric unit of the title complex, [NiBr(NO){P(C6H5)3}2], comprises two independent mol-ecules each with a similar configuration. The Ni(II) cation is coordinated by one bromide anion, one nitrosyl anion and two tri-phenyl-phosphane mol-ecules in a distorted BrNP2 tetra-hedral coordination geometry. The coordination of the nitrosyl group is non-linear, the Ni-N-O angles being 150.2 (5) and 151.2 (5)° in the two independent mol-ecules. In the crystal, mol-ecules are linked by weak C-H⋯Br hydrogen bonds and weak C-H⋯π inter-actions into a three-dimensional supra-molecular architecture. PMID:26029415

  16. Experimental study of time-dependent dielectric breakdown in tri-gate nanowire transistor

    NASA Astrophysics Data System (ADS)

    Ota, Kensuke; Tanaka, Chika; Numata, Toshinori; Matsushita, Daisuke; Saitoh, Masumi


    We systematically investigate the size dependence of the time-dependent dielectric breakdown (TDDB) in a tri-gate nanowire transistor (NW Tr.). It is newly found that TDDB reliability is degraded in NW Tr. as compared with that in a planar transistor owing to the locally enhanced electric field at the NW corner. Moreover, in the region with a width (W) less than 40 nm, nanowire width reduction leads to a shorter time to gate dielectric breakdown indicating additional degradation of TDDB reliability in NW Tr. with smaller W. Although TDDB in three-dimensional (3D) MOS structures such as a trench MOS capacitor has already been reported, the size dependence of TDDB in scaled NW Tr. is firstly discussed in this paper since a trench capacitor is different from recent NW Tr. in structure, device size, gate dielectric thickness, and scaling effect on TDDB.

  17. Neuroprotective Tri- and Tetracyclic BChE Inhibitors Releasing Reversible Inhibitors upon Carbamate Transfer

    PubMed Central


    Tri- and tetracyclic nitrogen-bridgehead compounds were designed and synthesized to yield micromolar cholinesterase (ChE) inhibitors. Structure–activity relationships identified potent compounds with butyrylcholinesterase selectivity. These compounds were selected as starting points for the design and synthesis of carbamate-based (pseudo)irreversible inhibitors. Compounds with superior inhibitory activity and selectivity were obtained and kinetically characterized also with regard to the velocity of enzyme carbamoylation. Structural elements were identified and introduced that additionally showed neuroprotective properties on a hippocampal neuronal cell line (HT-22) after glutamate-induced intracellular reactive oxygen species generation. We have identified potent and selective pseudoirreversible butyrylcholinesterase inhibitors that release reversible inhibitors with neuroprotective properties after carbamate transfer to the active site of cholinesterases. PMID:24900407

  18. Digital TV tri-state delta modulation system for Space Shuttle ku-band downlink

    NASA Technical Reports Server (NTRS)

    Udalov, S.; Huth, G. K.; Roberts, D.; Batson, B. H.


    A tri-state delta modulation/demodulation (TSDM) technique which provides for efficient run-length coding of constant-intensity segments of a TV picture is described. Aspects of the hardware implementation of a high-speed TSDM transmitter and receiver for black-and-white TV or field-sequential color or NTSC format color are reviewed. Run-length encoding of the TSDM output can consistently reduce the required channel data rate well below one bit per sample. As compared with a bistate delta modulation system, the present technique eliminates granularity in the reconstructed video without degrading rise or fall times. About 40 chips are used by TSDM when used to handle the luminance information in a color link. A possible overall space and ground functional configuration to accommodate Shuttle digital TV with scrambling for privacy is presented.

  19. Analysis of a stochastic tri-trophic food-chain model with harvesting.


    Liu, Meng; Bai, Chuanzhi


    We consider a tri-trophic stochastic food-chain model with harvesting. We first establish critical values between persistence in mean and extinction for each species. The results show that persistence and extinction of a species only depends on the demographic impacts of environmental stochasticity on the species and species at lower tropic levels; however, the mean abundance of a species depends on the impacts of environmental stochasticity at all trophic levels. Then we consider stability in distribution of the model. Finally, we provide a necessary and sufficient condition for existence of optimal harvesting strategy and give the optimal harvesting effort and maximum of sustainable yield. The results show that the optimal harvesting strategy is closely related to the stochastic noises in the model.

  20. Speed estimation from a tri-axial accelerometer using neural networks.


    Song, Yoonseon; Shin, Seungchul; Kim, Seunghwan; Lee, Doheon; Lee, Kwang H


    We propose a speed estimation method with human body accelerations measured on the chest by a tri-axial accelerometer. To estimate the speed we segmented the acceleration signal into strides measuring stride time, and applied two neural networks into the patterns parameterized from each stride calculating stride length. The first neural network determines whether the subject walks or runs, and the second neural network with different node interactions according to the subject's status estimates stride length. Walking or running speed is calculated with the estimated stride length divided by the measured stride time. The neural networks were trained by patterns obtained from 15 subjects and then validated by 2 untrained subjects' patterns. The result shows good agreement between actual and estimated speeds presenting the linear correlation coefficient r=0.9874. We also applied the method to the real field and track data.

  1. When It Hurts (and Helps) to Try: The Role of Effort in Language Learning

    PubMed Central

    Finn, Amy S.; Lee, Taraz; Kraus, Allison; Hudson Kam, Carla L.


    Compared to children, adults are bad at learning language. This is counterintuitive; adults outperform children on most measures of cognition, especially those that involve effort (which continue to mature into early adulthood). The present study asks whether these mature effortful abilities interfere with language learning in adults and further, whether interference occurs equally for aspects of language that adults are good (word-segmentation) versus bad (grammar) at learning. Learners were exposed to an artificial language comprised of statistically defined words that belong to phonologically defined categories (grammar). Exposure occurred under passive or effortful conditions. Passive learners were told to listen while effortful learners were instructed to try to 1) learn the words, 2) learn the categories, or 3) learn the category-order. Effortful learners showed an advantage for learning words while passive learners showed an advantage for learning the categories. Effort can therefore hurt the learning of categories. PMID:25047901

  2. Crystal structure of phenyl 2,4,5-tri­chloro­benzene­sulfonate

    PubMed Central

    Riley, Sean; Staples, Richard J.; Biros, Shannon M.; Ngassa, Felix N.


    The title compound, C12H7Cl3O3S, was synthesized via a nucleophilic substitution reaction between phenol and 2,4,5-tri­chloro­benzene­sulfonyl chloride. The two aryl rings are oriented gauche to one another around the sulfonate S—O bond, with a C—S—O—C torsion angle of −70.68 (16)°, and the two rings are inclined to one another by 72.40 (7)°. In the crystal, mol­ecules are linked via various C—Cl⋯π inter­actions, forming ribbons propagating along [100]. Neighboring ribbons are linked by a weak C—Cl⋯π inter­action, forming layers parallel to (010). PMID:27308043

  3. Asymptotic stability of tri-trophic food chains sharing a common resource.


    Vrkoč, Ivo; Křivan, Vlastimil


    One of the key results of the food web theory states that the interior equilibrium of a tri-trophic food chain described by the Lotka-Volterra type dynamics is globally asymptotically stable whenever it exists. This article extends this result to food webs consisting of several food chains sharing a common resource. A Lyapunov function for such food webs is constructed and asymptotic stability of the interior equilibrium is proved. Numerical simulations show that as the number of food chains increases, the real part of the leading eigenvalue, while still negative, approaches zero. Thus the resilience of such food webs decreases with the number of food chains in the web. PMID:26498384

  4. Tri-City Herald OpEd: Electric Vehicles are a smart choice

    SciTech Connect

    Christensen, Peter C.; Haas, Anne M.


    Why are so many of us at the Pacific Northwest National Laboratory, a national thought leader in power industry issues located right here in the Tri-Cities, so bullish on the future of EVs? And why do we think it's so important that this country, especially THIS part of the country, be leaders in the adoption of EVs? Is it that we all just happen to like driving polluting golf carts? The answer is that, like most everyone else, most of us here at PNNL drive to work every day, and like most people, we care about the cost of gasoline and the impact that burning imported oil has on the environment and on our foreign policy. The reality is that electric vehicles are simply more efficient, pollute much less, use locally-generated energy, and cost MUCH less to drive.

  5. Extraction of phenols from water with tri-octyl phosphine oxide

    SciTech Connect

    MacGlashan, J.D.


    Tri-octyl phosphine oxide (TOPO) was examined as an extractant for removing phenol; the dihydric phenols catechol, resorcinol, and hydroquinone; and the trihydric phenols pyrogallol, phloroglucinol, and 1,2,4-benzenetriol from water. Distribution coefficients were measured and results modelled for extractions with different diluents, solvent compositions, temperatures, and extractant-to-solute stoichiometric ratios. Modelling of the results indicates that the extraction mechanism is complicated, with the diluent probably playing an important role. The most effective diluents are those that have some electron-donating ability and are thus able to solvate the solute-TOPO complex, without competing with the solute for the phosphoryl oxygen on TOPO. The distribution coefficients decrease with increasing temperature, and show a linear dependence when plotted as ln(K/sub D/) vs. l/T.

  6. Current driven tri-stable resistance states in magnetic point contacts.


    Yanson, I K; Fisun, V V; Naidyuk, Yu G; Balkashin, O P; Triputen, L Yu; Konovalenko, A; Korenivski, V


    Point contacts between normal and ferromagnetic metals are investigated using magnetoresistance and transport spectroscopy measurements combined with micromagnetic simulations. Pronounced hysteresis in the point contact resistance versus both bias current and external magnetic field are observed. It is found that such hysteretic resistance can exhibit, in addition to bi-stable resistance states found in ordinary spin valves, tri-stable resistance states with a middle resistance level. We interpret these observations in terms of surface spin valve and spin vortex states, originating from a substantially modified spin structure at the ferromagnetic interface in the contact core. We argue that these surface spin states, subject to a weakened exchange interaction, dominate the effects of spin transfer torques on the nanometer scale. PMID:21828625

  7. Study on antibacterial dental resin using tri-n-butyl(4-vinylbenzyl)phosphonium chloride.


    Kurata, Shigeaki; Hamada, Nobushiro; Kanazawa, Akihiko; Endo, Takeshi


    The antibacterial properties of a polymeric phosphonium salt were studied to determine its suitability as an additive to develop an antibacterial dental resin. The phosphonium salt monomer studied was tri-n-butyl(4-vinylbenzyl)phosphonium chloride (VP), and acrylic acid (AC) and methacryloyloxyethyl trimethyl ammonium chloride (MA) were used as controls. The antibacterial activity of these monomers and their corresponding polymers (PVP, PAC, and PMA) against Streptococcus mutans (S. mutans) was examined. When incubating S. mutans in a medium containing 10 μmol/mL for 24 hours, the antibacterial activity of PVP against S. mutans was high, while the antibacterial activity of PMA and VP was lower. AC, PAC and PMA exhibited the lowest antibacterial activity. The mechanical properties of the copolymers of methyl methacrylate, 2-hydroxyethyl methacrylate, and VP decreased as VP content increased, and were lower than those of poly(methyl methacrylate).

  8. Problems Of The Use Of Lenticular Screens In Tri-Dimensional Television

    NASA Astrophysics Data System (ADS)

    Chauvierre, Marc


    The easiest solution to obtain tri-dimensional pictures to be viewed directly - that is without glasses - consists in using lenticular screens directly associated to matricial scanning. But if we put only with two pictures (as in stereophotography) the right viewing angle is limited. To improve it, the number of pictures must be increased to four at least. The transmission of four pictures is possible on one way only, thanks to the simultaneous use of matricial analysis and numerical modulation. Anyway, we meet the problem of the passing band if we do not want to loose definition. In this point of view, the numerical modulation permits to reduce greatly the passing band, taking into consideration that in several pictures, there are a great number of identical pixels : it is then useless to transmit them on several ways.

  9. Defining the framework for environmentally compliant cleanup: The Hanford site tri-party agreement

    SciTech Connect

    Austin, B.A.; Wisness, S.H.


    The Hanford Federal Facility Agreement and Consent Order, commonly called the Tri-Party Agreement, was signed by the U.S. Environmental Protection Agency (EPA), the State of Washington Department of Ecology (Ecology), and the U.S. Department of Energy (DOE) in May of 1989. It was the first three-party agreement of its magnitude in the country and was touted as a landmark agreement. It was one of the most significant actions that has been taken to define the framework for environmentally compliant cleanup actions at the Hanford Site. Accomplishments thus far represent a lot of planning, permitting, and development activities either required by regulation or necessary to ensure an adequate infrastructure to support cleanup activities. Actual cleanup work and construction of new facilities are beginning to accelerate as the Hanford Site moves out of study and development phases into actual cleanup activities. Significant changes to the Hanford Tri-Party Agreement were negotiated between May 1993 and January 1994. These negotiations were precipitated by the completion of a 15-month rebaselining study of the Hanford Site`s Tank Waste Remediation System. The revised agreement is based on comments and values the three agencies heard from people of the region during the negotiation process. The recent renegotiation reflected an ability of the agencies and the agreement to change commensurate with technical, economic, and political realities of today. Hanford has moved into a new era of public participation which will continue to watch and guide cleanup efforts in manners satisfactory to regional concerns and values.

  10. [Tri-Level Infrared Spectroscopic Identification of Hot Melting Reflective Road Marking Paint].


    Li, Hao; Ma, Fang; Sun, Su-qin


    In order to detect the road marking paint from the trace evidence in traffic accident scene, and to differentiate their brands, we use Tri-level infrared spectroscopic identification, which employs the Fourier transform infrared spectroscopy (FTIR), the second derivative infrared spectroscopy(SD-IR), two-dimensional correlation infrared spectroscopy(2D-IR) to identify three different domestic brands of hot melting reflective road marking paints and their raw materials in formula we Selected. The experimental results show that three labels coatings in ATR and FTIR spectrograms are very similar in shape, only have different absorption peak wave numbers, they have wide and strong absorption peaks near 1435 cm⁻¹, and strong absorption peak near 879, 2955, 2919, 2870 cm⁻¹. After enlarging the partial areas of spectrograms and comparing them with each kind of raw material of formula spectrograms, we can distinguish them. In the region 700-970 and 1370-1 660 cm⁻¹ the spectrograms mainly reflect the different relative content of heavy calcium carbonate of three brands of the paints, and that of polyethylene wax (PE wax), ethylene vinyl acetate resin (EVA), dioctyl phthalate (DOP) in the region 2800-2960 cm⁻¹. The SD-IR not only verify the result of the FTIR analysis, but also further expand the microcosmic differences and reflect the different relative content of quartz sand in the 512-799 cm-1 region. Within the scope of the 1351 to 1525 cm⁻¹, 2D-IR have more significant differences in positions and numbers of automatically peaks. Therefore, the Tri-level infrared spectroscopic identification is a fast and effective method to distinguish the hot melting road marking paints with a gradually improvement in apparent resolution.

  11. [Tri-Level Infrared Spectroscopic Identification of Hot Melting Reflective Road Marking Paint].


    Li, Hao; Ma, Fang; Sun, Su-qin


    In order to detect the road marking paint from the trace evidence in traffic accident scene, and to differentiate their brands, we use Tri-level infrared spectroscopic identification, which employs the Fourier transform infrared spectroscopy (FTIR), the second derivative infrared spectroscopy(SD-IR), two-dimensional correlation infrared spectroscopy(2D-IR) to identify three different domestic brands of hot melting reflective road marking paints and their raw materials in formula we Selected. The experimental results show that three labels coatings in ATR and FTIR spectrograms are very similar in shape, only have different absorption peak wave numbers, they have wide and strong absorption peaks near 1435 cm⁻¹, and strong absorption peak near 879, 2955, 2919, 2870 cm⁻¹. After enlarging the partial areas of spectrograms and comparing them with each kind of raw material of formula spectrograms, we can distinguish them. In the region 700-970 and 1370-1 660 cm⁻¹ the spectrograms mainly reflect the different relative content of heavy calcium carbonate of three brands of the paints, and that of polyethylene wax (PE wax), ethylene vinyl acetate resin (EVA), dioctyl phthalate (DOP) in the region 2800-2960 cm⁻¹. The SD-IR not only verify the result of the FTIR analysis, but also further expand the microcosmic differences and reflect the different relative content of quartz sand in the 512-799 cm-1 region. Within the scope of the 1351 to 1525 cm⁻¹, 2D-IR have more significant differences in positions and numbers of automatically peaks. Therefore, the Tri-level infrared spectroscopic identification is a fast and effective method to distinguish the hot melting road marking paints with a gradually improvement in apparent resolution. PMID:26964206

  12. Vasorelaxation Study and Tri-Step Infrared Spectroscopy Analysis of Malaysian Local Herbs

    PubMed Central

    Tan, Chu Shan; Loh, Yean Chun; Ahmad, Mariam; Zaini Asmawi, Mohd.; Yam, Mun Fei


    Objectives: The aim of this paper is to investigate the activities of Malaysian local herbs (Clinacanthus nutans Lindau, Strobilanthes crispus, Murdannia bracteata, Elephantopus scaber Linn., Pereskia bleo, Pereskia grandifolia Haw., Vernonia amygdalina, and Swietenia macrophylla King) for anti-hypertensive and vasorelaxant activity. An infrared (IR) macro-fingerprinting technique consisting of conventional fourier transform IR (FTIR), second-derivative IR (SD-IR), and two-dimensional correlation IR (2D-correlation IR) analyses were used to determine the main constituents and the fingerprints of the Malaysian local herbs. Methods: The herbs were collected, ground into powder form, and then macerated by using three different solvents: distilled water, 50% ethanol, and 95% ethanol, respectively. The potentials of the extracts produced from these herbs for use as vasorelaxants were determined. Additionally, the fingerprints of these herbs were analyzed by using FTIR spectra, SD-IR spectra, and 2D-correlation IR spectra in order to identify their main constituents and to provide useful information for future pharmacodynamics studies. Results: Swietenia macrophylla King has the highest potential in terms of vasorelaxant activity, followed by Vernonia amygdalina, Pereskia bleo, Strobilanthes crispus, Elephantopus scaber Linn., Pereskia grandifolia Haw., Clinacanthus nutans Lindau, and Murdannia bracteata. The tri-step IR macro-fingerprint of the herbs revealed that most of them contained proteins. Pereskia bleo and Pereskia grandifolia Haw. were found to contain calcium oxalate while Swietenia macrophylla King was found to contain large amounts of flavonoids. Conclusion: The flavonoid content of the herbs affects their vasorelaxant activity, and the tri-step IR macro- fingerprint method can be used as an analytical tool to determine the activity of a herbal medicine in terms of its vasorelaxant effect. PMID:27386148

  13. Health risk assessment of exposure to TriCresyl Phosphates (TCPs) in aircraft: a commentary.


    de Ree, Hans; van den Berg, Martin; Brand, Teus; Mulder, Gerard J; Simons, Ries; Veldhuijzen van Zanten, Brinio; Westerink, Remco H S


    Possible exposure to TriCresyl Phosphates (TCPs) has led to concerns among airline crew members. One isomer, Tri-ortho-Cresyl Phosphate (ToCP) is known to be neurotoxic and exposure to ToCP via contaminated cabin air has been suggested to be associated with the alleged Aerotoxic syndrome. The symptoms associated with Aerotoxic syndrome are diverse, including headaches, loss of balance, numbness and neurobehavioral abnormalities such as emotional instability, depression and cognitive dysfunction. Other ortho-isomers are toxic as well, but the non-ortho isomers are regarded as less toxic. In a collaborative effort to increase insight into the possible association between exposure to TCPs via contaminated cabin air and Aerotoxic syndrome, we performed an exposure- and toxicological risk assessment. Measurements in KLM 737 aircraft have demonstrated the presence of non-ortho isomers in low concentrations, though ToCP and other ortho-isomers could not be detected. Based on this exposure assessment, we established a toxicological risk model that also takes into account human differences in bioactivation and detoxification to derive a hazard quotient. From this model it appears unlikely that the health effects and alleged Aerotoxic syndrome are due to exposure to ToCP. Alternative explanations for the reported symptoms are discussed, but evaluation of the current findings in light of the criteria for occupational disease leads to the conclusion that the Aerotoxic Syndrome cannot be regarded as such. Additional research is thus required to unravel the underlying causes for the reported health complaints. PMID:25193069

  14. Taste education reduces food neophobia and increases willingness to try novel foods in school children

    PubMed Central

    Park, Bo-Kyung


    BACKGROUND/OBJECTIVES This study measured the effects of a taste education program developed in Korea on food neophobia and willingness to try novel foods in school children. SUBJECTS/METHODS One-hundred and twenty school children (aged 7-9 years) residing in Seoul participated in 12 sessions of a taste education program for 3 months. The Korean taste education program was adapted from "Les classes du goût" by J. Puisais and modified to suit a Korean education environment. The study subjected school children to pre- and post-programs on food neophobia and willingness to try novel foods (WTNF), in addition to children's food neophobia in their parents. A total of 101 survey data were analyzed using SPSS 18.0. RESULTS Regarding the effects of taste education, scores of food neophobia significantly decreased (P < 0.01) in the posttest, mean (m) score (4.10 ± 1.19) decreased compared to the pretest (4.39 ± 1.00), and WTNF significantly increased (P < 0.001) in the pretest (m) score (0.48 ± 0.33) compared to the pretest (0.32 ± 0.34). This result indicates verification of the study hypothesis. CONCLUSIONS Food neophobia scale (FNS), an index that measures personal food preference [12], showed a very weak correlation with behavioral willingness to taste novel foods (WTNF). Therefore, it is expected that the two scales measure different things. However, considering that the traits of food neophobia are not easily changed, the taste education program was administered in a remarkably effective manner. PMID:27087907

  15. 77 FR 43591 - Tri-State Financial Co., LLC, (d/b/a North Country Ethanol), Red River Energy, LLC; Notice of Filing

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Energy Regulatory Commission Tri-State Financial Co., LLC, (d/b/a North Country Ethanol), Red River... North Country Ethanol (Tri-State), and Red River Energy, LLC (Red River) filed an application, pursuant....P. in Richland County, North Dakota, to the Tri- State's ethanol facility near Rosholt, in...

  16. Integrated metabolomic and proteomic analysis reveals systemic responses of Rubrivivax benzoatilyticus JA2 to aniline stress.


    Mujahid, Md; Prasuna, M Lakshmi; Sasikala, Ch; Ramana, Ch Venkata


    Aromatic amines are widely distributed in the environment and are major environmental pollutants. Although degradation of aromatic amines is well studied in bacteria, physiological adaptations and stress response to these toxic compounds is not yet fully understood. In the present study, systemic responses of Rubrivivax benzoatilyticus JA2 to aniline stress were deciphered using metabolite and iTRAQ-labeled protein profiling. Strain JA2 tolerated high concentrations of aniline (30 mM) with trace amounts of aniline being transformed to acetanilide. GC-MS metabolite profiling revealed aniline stress phenotype wherein amino acid, carbohydrate, fatty acid, nitrogen metabolisms, and TCA (tricarboxylic acid cycle) were modulated. Strain JA2 responded to aniline by remodeling the proteome, and cellular functions, such as signaling, transcription, translation, stress tolerance, transport and carbohydrate metabolism, were highly modulated. Key adaptive responses, such as transcription/translational changes, molecular chaperones to control protein folding, and efflux pumps implicated in solvent extrusion, were induced in response to aniline stress. Proteo-metabolomics indicated extensive rewiring of metabolism to aniline. TCA cycle and amino acid catabolism were down-regulated while gluconeogenesis and pentose phosphate pathways were up-regulated, leading to the synthesis of extracellular polymeric substances. Furthermore, increased saturated fatty acid ratios in membranes due to aniline stress suggest membrane adaptation. The present study thus indicates that strain JA2 employs multilayered responses: stress response, toxic compound tolerance, energy conservation, and metabolic rearrangements to aniline.

  17. Transcriptome Analysis in Haematococcus pluvialis: Astaxanthin Induction by Salicylic Acid (SA) and Jasmonic Acid (JA)

    PubMed Central

    Wu, Guanxun; Li, Guoqiang; Sun, Haifeng; Deng, Suzhen; Shen, Yicheng; Chen, Guoqiang; Zhang, Ruihao; Meng, Chunxiao; Zhang, Xiaowen


    Haematococcus pluvialis is an astaxanthin-rich microalga that can increase its astaxanthin production by salicylic acid (SA) or jasmonic acid (JA) induction. The genetic transcriptome details of astaxanthin biosynthesis were analyzed by exposing the algal cells to 25 mg/L of SA and JA for 1, 6 and 24 hours, plus to the control (no stress). Based on the RNA-seq analysis, 56,077 unigenes (51.7%) were identified with functions in response to the hormone stress. The top five identified subcategories were cell, cellular process, intracellular, catalytic activity and cytoplasm, which possessed 5600 (~9.99%), 5302 (~9.45%), 5242 (~9.35%), 4407 (~7.86%) and 4195 (~7.48%) unigenes, respectively. Furthermore, 59 unigenes were identified and assigned to 26 putative transcription factors (TFs), including 12 plant-specific TFs. They were likely associated with astaxanthin biosynthesis in Haematococcus upon SA and JA stress. In comparison, the up-regulation of differential expressed genes occurred much earlier, with higher transcript levels in the JA treatment (about 6 h later) than in the SA treatment (beyond 24 h). These results provide valuable information for directing metabolic engineering efforts to improve astaxanthin biosynthesis in H. pluvialis. PMID:26484871

  18. Integrated metabolomic and proteomic analysis reveals systemic responses of Rubrivivax benzoatilyticus JA2 to aniline stress.


    Mujahid, Md; Prasuna, M Lakshmi; Sasikala, Ch; Ramana, Ch Venkata


    Aromatic amines are widely distributed in the environment and are major environmental pollutants. Although degradation of aromatic amines is well studied in bacteria, physiological adaptations and stress response to these toxic compounds is not yet fully understood. In the present study, systemic responses of Rubrivivax benzoatilyticus JA2 to aniline stress were deciphered using metabolite and iTRAQ-labeled protein profiling. Strain JA2 tolerated high concentrations of aniline (30 mM) with trace amounts of aniline being transformed to acetanilide. GC-MS metabolite profiling revealed aniline stress phenotype wherein amino acid, carbohydrate, fatty acid, nitrogen metabolisms, and TCA (tricarboxylic acid cycle) were modulated. Strain JA2 responded to aniline by remodeling the proteome, and cellular functions, such as signaling, transcription, translation, stress tolerance, transport and carbohydrate metabolism, were highly modulated. Key adaptive responses, such as transcription/translational changes, molecular chaperones to control protein folding, and efflux pumps implicated in solvent extrusion, were induced in response to aniline stress. Proteo-metabolomics indicated extensive rewiring of metabolism to aniline. TCA cycle and amino acid catabolism were down-regulated while gluconeogenesis and pentose phosphate pathways were up-regulated, leading to the synthesis of extracellular polymeric substances. Furthermore, increased saturated fatty acid ratios in membranes due to aniline stress suggest membrane adaptation. The present study thus indicates that strain JA2 employs multilayered responses: stress response, toxic compound tolerance, energy conservation, and metabolic rearrangements to aniline. PMID:25388363

  19. Identification of the third/extra allele for forensic application in cases with TPOX tri-allelic pattern.


    Picanço, Juliane Bentes; Raimann, Paulo Eduardo; da Motta, Carlos Henrique Ares Silveira; Rodenbusch, Rodrigo; Gusmão, Leonor; Alho, Clarice Sampaio


    Genotyping of polymorphic short tandem repeats (STRs) loci is widely used in forensic DNA analysis. STR loci eventually present tri-allelic pattern as a genotyping irregularity and, in that situation, the doubt about the tri-allele locus frequency calculation can reduce the analysis strength. In the TPOX human STR locus, tri-allelic genotypes have been reported with a widely varied frequency among human populations. We investigate whether there is a single extra allele (the third allele) in the TPOX tri-allelic pattern, what it is, and where it is, aiming to understand its genomic anatomy and to propose the knowledge of this TPOX extra allele from genetic profile, thus preserving the two standard TPOX alleles in forensic analyses. We looked for TPOX tri-allelic subjects in 75,113 Brazilian families. Considering only the parental generation (mother+father) we had 150,226 unrelated subjects evaluated. From this total, we found 88 unrelated subjects with tri-allelic pattern in the TPOX locus (0.06%; 88/150,226). Seventy three of these 88 subjects (73/88; 83%) had the Clayton's original Type 2 tri-allelic pattern (three peaks of even intensity). The remaining 17% (15/88) show a new Type 2 derived category with heterozygote peak imbalance (one double dose peak plus one regular sized peak). In this paper we present detailed data from 66 trios (mother+father+child) with true biological relationships. In 39 of these families (39/66; 59%) the extra TPOX allele was transmitted either from the mother or from the father to the child. Evidences indicated the allele 10 as the extra TPOX allele, and it is on the X chromosome. The present data, which support the previous Lane hypothesis, improve the knowledge about tri-allelic pattern of TPOX CODIS' locus allowing the use of TPOX profile in forensic analyses even when with tri-allelic pattern. This evaluation is now available for different forensic applications. PMID:25549886

  20. Partial Activation of SA- and JA-Defensive Pathways in Strawberry upon Colletotrichum acutatum Interaction.


    Amil-Ruiz, Francisco; Garrido-Gala, José; Gadea, José; Blanco-Portales, Rosario; Muñoz-Mérida, Antonio; Trelles, Oswaldo; de Los Santos, Berta; Arroyo, Francisco T; Aguado-Puig, Ana; Romero, Fernando; Mercado, José-Ángel; Pliego-Alfaro, Fernando; Muñoz-Blanco, Juan; Caballero, José L


    Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa) cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5, and FaPR10) were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen. PMID:27471515

  1. Partial Activation of SA- and JA-Defensive Pathways in Strawberry upon Colletotrichum acutatum Interaction.


    Amil-Ruiz, Francisco; Garrido-Gala, José; Gadea, José; Blanco-Portales, Rosario; Muñoz-Mérida, Antonio; Trelles, Oswaldo; de Los Santos, Berta; Arroyo, Francisco T; Aguado-Puig, Ana; Romero, Fernando; Mercado, José-Ángel; Pliego-Alfaro, Fernando; Muñoz-Blanco, Juan; Caballero, José L


    Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa) cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5, and FaPR10) were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen.

  2. Partial Activation of SA- and JA-Defensive Pathways in Strawberry upon Colletotrichum acutatum Interaction

    PubMed Central

    Amil-Ruiz, Francisco; Garrido-Gala, José; Gadea, José; Blanco-Portales, Rosario; Muñoz-Mérida, Antonio; Trelles, Oswaldo; de los Santos, Berta; Arroyo, Francisco T.; Aguado-Puig, Ana; Romero, Fernando; Mercado, José-Ángel; Pliego-Alfaro, Fernando; Muñoz-Blanco, Juan; Caballero, José L.


    Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa) cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5, and FaPR10) were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen. PMID:27471515

  3. Half-life extension of the HIV-fusion inhibitor peptide TRI-1144 using a novel linker technology.


    Schneider, Eric L; Ashley, Gary W; Dillen, Lieve; Stoops, Bart; Austin, Nigel E; Malcolm, Bruce A; Santi, Daniel V


    We have previously developed a linker technology for half-life extension of peptides, proteins and small molecule drugs (1). The linkers undergo β-elimination reactions with predictable cleavage rates to release the native drug. Here we utilize this technology for half-life extension of the 38 amino acid HIV-1 fusion inhibitor TRI-1144. Conjugation of TRI-1144 to 40 kDa PEG by an appropriate β-eliminative linker and i.v. administration of the conjugate increased the in vivo half-life of the released peptide from 4 to 34 h in the rat, and the pharmacokinetic parameters were in excellent accord with a one-compartment model. From these data we simulated the pharmacokinetics of the PEG-TRI-1144 conjugate in humans, predicting a t1/2,β of 70 h for the released peptide, and that a serum concentration of 25 nM could be maintained by weekly doses of 8 μmol of the conjugate. Using a non-circulating carrier (2) similar simulations indicated a t1/2,β of 150 h for the peptide released from the conjugate and that dosing of only 1.8 μmol/week could maintain serum concentrations of TRI-1144 above 25 nM. Hence, releasable β-eliminative linkers provide significant half-life extension to TRI-1144 and would be expected to do likewise for related peptides.

  4. A direct regulatory interaction between chaperonin TRiC and stress-responsive transcription factor HSF1.


    Neef, Daniel W; Jaeger, Alex M; Gomez-Pastor, Rocio; Willmund, Felix; Frydman, Judith; Thiele, Dennis J


    Heat shock transcription factor 1 (HSF1) is an evolutionarily conserved transcription factor that protects cells from protein-misfolding-induced stress and apoptosis. The mechanisms by which cytosolic protein misfolding leads to HSF1 activation have not been elucidated. Here, we demonstrate that HSF1 is directly regulated by TRiC/CCT, a central ATP-dependent chaperonin complex that folds cytosolic proteins. A small-molecule activator of HSF1, HSF1A, protects cells from stress-induced apoptosis, binds TRiC subunits in vivo and in vitro, and inhibits TRiC activity without perturbation of ATP hydrolysis. Genetic inactivation or depletion of the TRiC complex results in human HSF1 activation, and HSF1A inhibits the direct interaction between purified TRiC and HSF1 in vitro. These results demonstrate a direct regulatory interaction between the cytosolic chaperone machine and a critical transcription factor that protects cells from proteotoxicity, providing a mechanistic basis for signaling perturbations in protein folding to a stress-protective transcription factor. PMID:25437552

  5. Saving our shared birds: Partners in Flight tri-national vision for landbird conservation

    USGS Publications Warehouse

    Berlanga, Humberto; Kennedy, Judith A.; Rich, Terrell D.; Arizmendi, Maria del Coro; Beardmore, Carol J.; Blancher, Peter J.; Butcher, Gregory S.; Couturier, Andrew R.; Dayer, Ashley A.; Demarest, Dean W.; Easton, Wendy E.; Gustafson, Mary; Iñigo-Elias, Eduardo E.; Krebs, Elizabeth A.; Panjabi, Arvind O.; Rodriguez Contreras, Vicente; Rosenberg, Kenneth V.; Ruth, Janet M.; Santana Castellon, Eduardo; Vidal, Rosa Ma.; Will, Tom


    Landbirds are the most abundant and diverse group of birds in North America, with nearly 900 species distributed across every major terrestrial habitat. Birds are indicators of environmental health; their populations track changes in habitat, water, disease, and climate. They are providers of invaluable ecosystem services, such as pest control, seed dispersal, and pollination. As the focus of bird watching, they help generate billions of dollars for national economies. Yet, we are in danger of losing this spectacular and irreplaceable bird diversity: landbirds are experiencing significant declines, ominous threats, and shrinking habitats across a continent with growing human populations, increasing resource consumption, and changing climate. Saving Our Shared Birds presents for the first time a comprehensive conservation assessment of landbirds in Canada, Mexico, and the continental United States. This new tri-national vision encompasses the complete range of many migratory species and highlights the vital links among migrants and highly threatened resident species in Mexico. It points to a set of continent-scale actions necessary to maintain the landbird diversity and abundance that are our shared responsibility. This collaborative effort of Partners in Flight (PIF) is the next step in linking the countries of the Western Hemisphere to help species at risk and keep common birds common through voluntary partnerships—our mission since 1990. Saving Our Shared Birds builds upon PIF’s 2004 North American Landbird Conservation Plan, which presented science-based priorities for the conservation of 448 landbird species in Canada and the United States. Our three nations have expressed their commitment to cooperative conservation through numerous international treaties, agreements, and programs, including formation of the North American Bird Conservation Initiative (NABCI) a decade ago. The NABCI partnership recognizes that effective conservation requires a concerted

  6. Enhanced Lacto-Tri-Peptide Bio-Availability by Co-Ingestion of Macronutrients.


    Ten Have, Gabriella A M; van der Pijl, Pieter C; Kies, Arie K; Deutz, Nicolaas E P


    Some food-derived peptides possess bioactive properties, and may affect health positively. For example, the C-terminal lacto-tri-peptides Ile-Pro-Pro (IPP), Leu-Pro-Pro (LPP) and Val-Pro-Pro (VPP) (together named here XPP) are described to lower blood pressure. The bioactivity depends on their availability at the site of action. Quantitative trans-organ availability/kinetic measurements will provide more insight in C-terminal tri-peptides behavior in the body. We hypothesize that the composition of the meal will modify their systemic availability. We studied trans-organ XPP fluxes in catheterized pigs (25 kg; n=10) to determine systemic and portal availability, as well as renal and hepatic uptake of a water-based single dose of synthetic XPP and a XPP containing protein matrix (casein hydrolyte, CasH). In a second experiment (n=10), we compared the CasH-containing protein matrix with a CasH-containing meal matrix and the modifying effects of macronutrients in a meal on the availability (high carbohydrates, low quality protein, high fat, and fiber). Portal availability of synthetic XPP was 0.08 ± 0.01% of intake and increased when a protein matrix was present (respectively 3.1, 1.8 and 83 times for IPP, LPP and VPP). Difference between individual XPP was probably due to release from longer peptides. CasH prolonged portal bioavailability with 18 min (absorption half-life, synthetic XPP: 15 ± 2 min, CasH: 33 ± 3 min, p<0.0001) and increased systemic elimination with 20 min (synthetic XPP: 12 ± 2 min; CasH: 32 ± 3 min, p<0.0001). Subsequent renal and hepatic uptake is about 75% of the portal release. A meal containing CasH, increased portal 1.8 and systemic bioavailability 1.2 times. Low protein quality and fiber increased XPP systemic bioavailability further (respectively 1.5 and 1.4 times). We conclude that the amount and quality of the protein, and the presence of fiber in a meal, are the main factors that increase the systemic bioavailability of food

  7. First Measurements of Polar Mesospheric Summer Echoes by a Tri-static Radar System

    NASA Astrophysics Data System (ADS)

    La Hoz, C.


    Polar Mesospheric Summer Echoes (PMSE) have been observed for the first time by a tri-static radar system comprising the EISCAT VHF (224 MHz, 0.67 m Bragg wavelength) active radar in Tromso (Norway) and passive receiving stations in Kiruna, (Sweden) and Sodankyla (Finland). The antennas at the receiving stations, originally part of the EISCAT tri-static UHF radar system at 930 MHz, have been refitted with new feeder systems at the VHF frequency of the transmitter in Tromso. The refitted radar system opens new opportunities to study PMSE for its own sake and as a tracer of the dynamics of the polar mesosphere, a region that is difficult to investigate by other means. The measurements show that very frequently both remote receiving antennas detect coherent signals that are much greater than the regular incoherent scattering due to thermal electrons and coinciding in time and space with PMSE measured by the transmitter station in Tromso. This represents further evidence that PMSE is not aspect sensitive, as was already indicated by a less sensitive radar system in a bi-static configuration, and implying that the underlying atmospheric turbulence, at least at sub-meter scales, is isotropic in agreement with Kolmogorov's hypothesis. Measurements also show that the vertical rate of fall of persistent features of PMSE is the same as the vertical line of sight velocity inferred from the doppler shift of the PMSE signals. This equivalence forms the basis for using PMSE as a tracer of the dynamics of the background mesosphere. Thus, it is possible to measure the 3-dimensional velocity field in the PMSE layer over the intersection volume of the three antennas. Since the signals have large signal-to-noise ratios (up to 30 dB), the inferred velocities have high accuracies and good time resolutions. This affords the possibility to make estimates of momentum flux in the mesosphere deposited by overturning gravity waves. Gravity wave momentum flux is believed to be the engine of a

  8. Preliminary Survey on TRY Forest Traits and Growth Index Relations - New Challenges

    NASA Astrophysics Data System (ADS)

    Lyubenova, Mariyana; Kattge, Jens; van Bodegom, Peter; Chikalanov, Alexandre; Popova, Silvia; Zlateva, Plamena; Peteva, Simona


    Forest ecosystems provide critical ecosystem goods and services, including food, fodder, water, shelter, nutrient cycling, and cultural and recreational value. Forests also store carbon, provide habitat for a wide range of species and help alleviate land degradation and desertification. Thus they have a potentially significant role to play in climate change adaptation planning through maintaining ecosystem services and providing livelihood options. Therefore the study of forest traits is such an important issue not just for individual countries but for the planet as a whole. We need to know what functional relations between forest traits exactly can express TRY data base and haw it will be significant for the global modeling and IPBES. The study of the biodiversity characteristics at all levels and functional links between them is extremely important for the selection of key indicators for assessing biodiversity and ecosystem services for sustainable natural capital control. By comparing the available information in tree data bases: TRY, ITR (International Tree Ring) and SP-PAM the 42 tree species are selected for the traits analyses. The dependence between location characteristics (latitude, longitude, altitude, annual precipitation, annual temperature and soil type) and forest traits (specific leaf area, leaf weight ratio, wood density and growth index) is studied by by multiply regression analyses (RDA) using the statistical software package Canoco 4.5. The Pearson correlation coefficient (measure of linear correlation), Kendal rank correlation coefficient (non parametric measure of statistical dependence) and Spearman correlation coefficient (monotonic function relationship between two variables) are calculated for each pair of variables (indexes) and species. After analysis of above mentioned correlation coefficients the dimensional linear regression models, multidimensional linear and nonlinear regression models and multidimensional neural networks models are

  9. Multiple attractors and boundary crises in a tri-trophic food chain.


    Boer, M P; Kooi, B W; Kooijman, S A


    The asymptotic behaviour of a model of a tri-trophic food chain in the chemostat is analysed in detail. The Monod growth model is used for all trophic levels, yielding a non-linear dynamical system of four ordinary differential equations. Mass conservation makes it possible to reduce the dimension by 1 for the study of the asymptotic dynamic behaviour. The intersections of the orbits with a Poincaré plane, after the transient has died out, yield a two-dimensional Poincaré next-return map. When chaotic behaviour occurs, all image points of this next-return map appear to lie close to a single curve in the intersection plane. This motivated the study of a one-dimensional bi-modal, non-invertible map of which the graph resembles this curve. We will show that the bifurcation structure of the food chain model can be understood in terms of the local and global bifurcations of this one-dimensional map. Homoclinic and heteroclinic connecting orbits and their global bifurcations are discussed also by relating them to their counterparts for a two-dimensional map which is invertible like the next-return map. In the global bifurcations two homoclinic or two heteroclinic orbits collide and disappear. In the food chain model two attractors coexist; a stable limit cycle where the top-predator is absent and an interior attractor. In addition there is a saddle cycle. The stable manifold of this limit cycle forms the basin boundary of the interior attractor. We will show that this boundary has a complicated structure when there are heteroclinic orbits from a saddle equilibrium to this saddle limit cycle. A homoclinic bifurcation to a saddle limit cycle will be associated with a boundary crisis where the chaotic attractor disappears suddenly when a bifurcation parameter is varied. Thus, similar to a tangent local bifurcation for equilibria or limit cycles, this homoclinic global bifurcation marks a region in the parameter space where the top-predator goes extinct. The 'Paradox of

  10. Non-equivalent roles of two periplasmic subunits in the function and assembly of triclosan pump TriABC from Pseudomonas aeruginosa.


    Weeks, Jon W; Nickels, Logan M; Ntreh, Abigail T; Zgurskaya, Helen I


    In Gram-negative bacteria, multidrug efflux transporters function in complexes with periplasmic membrane fusion proteins (MFPs) that enable antibiotic efflux across the outer membrane. In this study, we analyzed the function, composition and assembly of the triclosan efflux transporter TriABC-OpmH from Pseudomonas aeruginosa. We report that this transporter possesses a surprising substrate specificity that encompasses not only triclosan but the detergent SDS, which are often used together in antibacterial soaps. These two compounds interact antagonistically in a TriABC-dependent manner and negate antibacterial properties of each other. Unlike other efflux pumps that rely on a single MFP for their activities, two different MFPs, TriA and TriB, are required for triclosan/SDS resistance mediated by TriABC-OpmH. We found that analogous mutations in the α-helical hairpin and membrane proximal domains of TriA and TriB differentially affect triclosan efflux and assembly of the complex. Furthermore, our results show that TriA and TriB function as a dimer, in which TriA is primarily responsible for stabilizing interactions with the outer membrane channel, whereas TriB is important for the stimulation of the transporter. We conclude that MFPs are engaged into complexes as asymmetric dimers, in which each protomer plays a specific role. PMID:26193906

  11. Non-equivalent roles of two periplasmic subunits in the function and assembly of triclosan pump TriABC from Pseudomonas aeruginosa.


    Weeks, Jon W; Nickels, Logan M; Ntreh, Abigail T; Zgurskaya, Helen I


    In Gram-negative bacteria, multidrug efflux transporters function in complexes with periplasmic membrane fusion proteins (MFPs) that enable antibiotic efflux across the outer membrane. In this study, we analyzed the function, composition and assembly of the triclosan efflux transporter TriABC-OpmH from Pseudomonas aeruginosa. We report that this transporter possesses a surprising substrate specificity that encompasses not only triclosan but the detergent SDS, which are often used together in antibacterial soaps. These two compounds interact antagonistically in a TriABC-dependent manner and negate antibacterial properties of each other. Unlike other efflux pumps that rely on a single MFP for their activities, two different MFPs, TriA and TriB, are required for triclosan/SDS resistance mediated by TriABC-OpmH. We found that analogous mutations in the α-helical hairpin and membrane proximal domains of TriA and TriB differentially affect triclosan efflux and assembly of the complex. Furthermore, our results show that TriA and TriB function as a dimer, in which TriA is primarily responsible for stabilizing interactions with the outer membrane channel, whereas TriB is important for the stimulation of the transporter. We conclude that MFPs are engaged into complexes as asymmetric dimers, in which each protomer plays a specific role.

  12. Development and use of a reverse transcription-PCR assay to study expression of Tri5 by Fusarium species in vitro and in planta.


    Doohan, F M; Weston, G; Rezanoor, H N; Parry, D W; Nicholson, P


    The Tri5 gene encodes trichodiene synthase, which catalyzes the first reaction in the trichothecene biosynthetic pathway. In vitro, a direct relationship was observed between Tri5 expression and the increase in deoxynivalenol production over time. We developed a reverse transcription (RT)-PCR assay to quantify Tri5 gene expression in trichothecene-producing strains of Fusarium species. We observed an increase in Tri5 expression following treatment of Fusarium culmorum with fungicides, and we also observed an inverse relationship between Tri5 expression and biomass, as measured by beta-D-glucuronidase activity, during colonization of wheat (cv. Avalon) seedlings by F. culmorum. RT-PCR analysis also showed that for ears of wheat cv. Avalon inoculated with F. culmorum, there were different levels of Tri5 expression in grain and chaff at later growth stages. We used the Tri5-specific primers to develop a PCR assay to detect trichothecene-producing Fusarium species in infected plant material. PMID:10473385

  13. Laparoscopic Resection of Cholecystocolic Fistula and Subtotal Cholecystectomy by Tri-Staple in a Type V Mirizzi Syndrome

    PubMed Central

    Yetişir, Fahri; Şarer, Akgün Ebru; Acar, Hasan Zafer; Parlak, Omer; Basaran, Basar; Yazıcıoğlu, Omer


    The Mirizzi syndrome (MS) is an impacted stone in the cystic duct or Hartmann's pouch that mechanically obstructs the common bile duct (CBD). We would like to report laparoscopic subtotal cholecystectomy (SC) and resection of cholecystocolic fistula by the help of Tri-Staple™ in a case with type V MS and cholecystocolic fistula, for first time in the literature. A 24-year-old man was admitted to emergency department with the complaint of abdominal pain, intermittent fever, jaundice, and diarrhea. Two months ago with the same complaint, ERCP was performed. Laparoscopic resection of cholecystocolic fistula and subtotal cholecystectomy were performed by the help of Tri-Staple. At the eight-month follow-up, he was symptom-free with normal liver function tests. In a patient with type V MS and cholecystocolic fistula, laparoscopic resection of cholecystocolic fistula and SC can be performed by using Tri-Staple safely. PMID:26904324

  14. High quality ZnS/Au/ZnS transparent conductive tri-layer films deposited by pulsed laser deposition

    NASA Astrophysics Data System (ADS)

    Wang, Caifeng; Li, Qingshan; Wang, Jisuo; Zhang, Lichun; Zhao, Fengzhou; Dong, Fangying


    ZnS/Au/ZnS tri-layer films were deposited on quartz glass substrates by pulsed laser deposition. The influence of Au layer thickness on optical and electrical properties of the tri-layer ZnS/Au/ZnS was studied. X-ray diffractometer (XRD) and scanning electron microscope were employed to characterize the crystalline structure and surface morphology of the tri-layer films. Hall measurements, ultraviolet and visible spectrophotometer, four-point probe were used to explore the optoelectronic properties of the ZnS/Au/ZnS. The increase of Au layer thickness resulted in the decreased resistivity, the increased carrier concentration, and the declined transmittance in the visible light region.

  15. Tri-band spectroscopic optical coherence tomography based on optical parametric amplification for lipid and vessel visualization

    NASA Astrophysics Data System (ADS)

    Yu, Luoqin; Kang, Jiqiang; Jinata, Chandra; Wang, Xie; Wei, Xiaoming; Chan, Kin Tak; Lee, Nikki P.; Wong, Kenneth K. Y.


    A tri-band spectroscopic optical coherence tomography (SOCT) system has been implemented for visualization of lipid and blood vessel distribution. The tri-band swept source, which covers output spectrum in 1.3, 1.5, and 1.6 μm wavelength windows, is based on a dual-band Fourier domain mode-locked laser and a fiber optical parametric amplifier. This tri-band SOCT can further differentiate materials, e.g., lipid and artery, qualitatively by contrasting attenuation coefficients difference within any two of these bands. Furthermore, ex vivo imaging of both porcine artery with artificial lipid plaque phantom and mice with coronary artery disease were demonstrated to showcase the capability of our SOCT.

  16. Static Electric Dipole Polarizabilities of Tri- and Tetravalent U, Np, and Pu Ions

    SciTech Connect

    Parmar, Payal; Peterson, Kirk A.; Clark, Aurora E.


    High-quality static electric dipole polarizabilities have been determined for the ground states of the hard-sphere cations of U, Np, and Pu in the III and IV oxidation states. The polarizabilities have been calculated using the numerical finite field technique in a four-component relativistic framework. Methods including Fock-space coupled cluster (FSCC) and Kramers-restricted configuration interaction (KRCI) have been performed in order to account for electron correlation effects. Comparisons between polarizabilities calculated using Dirac-Hartree-Fock (DHF), FSCC, and KRCI methods have been made using both triple- and quadruple-ζ basis sets for U⁴⁺. In addition to the ground state, this study also reports the polarizability data for the first two excited states of U3+/4+, Np3+/4+, and Pu3+/4+ ions at different levels of theory. The values reported in this work are the most accurate to date calculations for the dipole polarizabilities of the hard-sphere tri- and tetravalent actinide ions and may serve as reference values, aiding in the calculation of various electronic and response properties (for example, intermolecular forces, optical properties, etc.) relevant to the nuclear fuel cycle and material science applications.

  17. Effects of endodontic tri-antibiotic paste on bond strengths of dentin adhesives to coronal dentin

    PubMed Central

    Mirzakoucheki, Parvin; Walter, Ricardo; Jahromi, Maryam Zare; Mirsattari, Sanaz; Akbarzadeh, Navid


    Objectives The aim of this study was to evaluate the effects of tri-antibiotic paste (TAP) on microtensile bond strengths (MTBS) of dental adhesives to dentin. Materials and Methods Sixty extracted molars had their occlusal surfaces flattened to expose dentin. They were divided into two groups, i.e., control group with no dentin treatment and experimental group with dentin treatment with TAP. After 10 days, specimens were bonded using self-etch (Filtek P90 adhesive) or etch-and-rinse (Adper Single Bond Plus) adhesives and restored with composite resin. Teeth were sectioned into beams, and the specimens were subjected to MTBS test. Data were analyzed using two-way ANOVA and post hoc Tukey tests. Results There was a statistically significant interaction between dentin treatment and adhesive on MTBS to coronal dentin (p = 0.003). Despite a trend towards worse MTBS being noticed in the experimental groups, TAP application showed no significant effect on MTBS (p = 0.064). Conclusions The etch-and-rinse adhesive Adper Single Bond Plus presented higher mean bond strengths than the self-etch adhesive Filtek P90, irrespective of the group. The superior bond performance for Adper Single Bond when compared to Filtek P90 adhesive was confirmed by a fewer number of adhesive failures. The influence of TAP in bond strength is insignificant. PMID:25984475

  18. Design Methodology for Magnetic Field-Based Soft Tri-Axis Tactile Sensors.


    Wang, Hongbo; de Boer, Greg; Kow, Junwai; Alazmani, Ali; Ghajari, Mazdak; Hewson, Robert; Culmer, Peter


    Tactile sensors are essential if robots are to safely interact with the external world and to dexterously manipulate objects. Current tactile sensors have limitations restricting their use, notably being too fragile or having limited performance. Magnetic field-based soft tactile sensors offer a potential improvement, being durable, low cost, accurate and high bandwidth, but they are relatively undeveloped because of the complexities involved in design and calibration. This paper presents a general design methodology for magnetic field-based three-axis soft tactile sensors, enabling researchers to easily develop specific tactile sensors for a variety of applications. All aspects (design, fabrication, calibration and evaluation) of the development of tri-axis soft tactile sensors are presented and discussed. A moving least square approach is used to decouple and convert the magnetic field signal to force output to eliminate non-linearity and cross-talk effects. A case study of a tactile sensor prototype, MagOne, was developed. This achieved a resolution of 1.42 mN in normal force measurement (0.71 mN in shear force), good output repeatability and has a maximum hysteresis error of 3.4%. These results outperform comparable sensors reported previously, highlighting the efficacy of our methodology for sensor design.

  19. Road Infrastructure Development and Deforestation in Southwest Amazonia: a Tri-National Frontier Study

    NASA Astrophysics Data System (ADS)

    Almeyda Zambrano, A. M.; Broadbent, E. N.; Asner, G. P.; Knapp, D. E.; Durham, W. H.; Duchelle, A. E.; Wunder, S.


    Infrastructure development is a priority in many tropical countries. Road infrastructure, in particular, has been linked to deforestation. However, there is an insufficient understanding of how road infrastructure interacts with population and market dynamics to influence forest clearing. To address this we conducted a large-scale interdisciplinary research project in the tri-national Amazonian frontier of Peru, Brazil, and Bolivia encompassing 101,463 km2. This setting, a gradient of young to old Amazon frontier areas, provided a unique opportunity for the study of human environment interactions under varying stages of road infrastructure development while controlling for biophysical variation. We coupled multivariate statistical approaches on roads, population, markets, and deforestation with multitemporal spatial analysis of deforestation and infrastructure development using remote sensing and geographic information systems. Our results highlight the dynamic conditions occurring in Amazonian frontier regions, including rapid road infrastructure development, expansion of markets, and decrease in forest cover. We found that travel time to the nearest market dominated deforestation dynamics, with infrastructure development resulting in increased market access. Findings from this study support a deforestation framework focusing on urban population and market dynamics, and highlight the importance of modeling landscape deforestation using travel time versus spatial proximity approaches. Results are directly applicable to both furthering the theoretical understanding of human-environment interactions in frontier landscapes, as well as for applied environmental conservation and sustainable development efforts in the tropics.;

  20. STS-103 Pilot Scott Kelly and MS John Grunsfeld try on oxygen masks

    NASA Technical Reports Server (NTRS)


    In the bunker at Launch Pad 39B, STS-103 Pilot Scott J. Kelly (left) and Mission Specialist John M. Grunsfeld (Ph.D.) (right) try on oxygen masks during Terminal Countdown Demonstration Test (TCDT) activities. The TCDT provides the crew with emergency egress training, opportunities to inspect their mission payloads in the orbiter's payload bay, and simulated countdown exercises. Other crew members taking part are Commander Curtis L. Brown Jr. and Mission Specialists Steven L. Smith, C. Michael Foale (Ph.D.), and Jean-Frangois Clervoy of France and Claude Nicollier of Switzerland, who are with the European Space Agency. STS-103 is a 'call-up' mission due to the need to replace and repair portions of the Hubble Space Telescope, including the gyroscopes that allow the telescope to point at stars, galaxies and planets. The STS-103 crew will be replacing a Fine Guidance Sensor, an older computer with a new enhanced model, an older data tape recorder with a solid-state digital recorder, a failed spare transmitter with a new one, and degraded insulation on the telescope with new thermal insulation. The crew will also install a Battery Voltage/Temperature Improvement Kit to protect the spacecraft batteries from overcharging and overheating when the telescope goes into a safe mode. Four EVA's are planned to make the necessary repairs and replacements on the telescope. The mission is targeted for launch Dec. 6 at 2:37 a.m. EST.

  1. In-situ comprehensive calibration of a tri-port nano-electro-mechanical device

    NASA Astrophysics Data System (ADS)

    Collin, E.; Defoort, M.; Lulla, K.; Moutonet, T.; Heron, J.-S.; Bourgeois, O.; Bunkov, Yu. M.; Godfrin, H.


    We report on experiments performed in vacuum and at cryogenic temperatures on a tri-port nano-electro-mechanical (NEMS) device. One port is a very nonlinear capacitive actuation, while the two others implement the magnetomotive scheme with a linear input force port and a (quasi-linear) output velocity port. We present an experimental method enabling a full characterization of the nanomechanical device harmonic response: the nonlinear capacitance function C(x) is derived, and the normal parameters k and m (spring constant and mass) of the mode under study are measured through a careful definition of the motion (in meters) and of the applied forces (in Newtons). These results are obtained with a series of purely electric measurements performed without disconnecting/reconnecting the device, and rely only on known dc properties of the circuit, making use of a thermometric property of the oscillator itself: we use the Young modulus of the coating metal as a thermometer, and the resistivity for Joule heating. The setup requires only three connecting lines without any particular matching, enabling the preservation of a high impedance NEMS environment even at MHz frequencies. The experimental data are fit to a detailed electrical and thermal model of the NEMS device, demonstrating a complete understanding of its dynamics. These methods are quite general and can be adapted (as a whole, or in parts) to a large variety of electromechanical devices.

  2. In-situ comprehensive calibration of a tri-port nano-electro-mechanical device.


    Collin, E; Defoort, M; Lulla, K; Moutonet, T; Heron, J-S; Bourgeois, O; Bunkov, Yu M; Godfrin, H


    We report on experiments performed in vacuum and at cryogenic temperatures on a tri-port nano-electro-mechanical (NEMS) device. One port is a very nonlinear capacitive actuation, while the two others implement the magnetomotive scheme with a linear input force port and a (quasi-linear) output velocity port. We present an experimental method enabling a full characterization of the nanomechanical device harmonic response: the nonlinear capacitance function C(x) is derived, and the normal parameters k and m (spring constant and mass) of the mode under study are measured through a careful definition of the motion (in meters) and of the applied forces (in Newtons). These results are obtained with a series of purely electric measurements performed without disconnecting/reconnecting the device, and rely only on known dc properties of the circuit, making use of a thermometric property of the oscillator itself: we use the Young modulus of the coating metal as a thermometer, and the resistivity for Joule heating. The setup requires only three connecting lines without any particular matching, enabling the preservation of a high impedance NEMS environment even at MHz frequencies. The experimental data are fit to a detailed electrical and thermal model of the NEMS device, demonstrating a complete understanding of its dynamics. These methods are quite general and can be adapted (as a whole, or in parts) to a large variety of electromechanical devices. PMID:22559569

  3. Perfectionism and Effort-Related Cardiac Activity: Do Perfectionists Try Harder?

    PubMed Central

    Harper, Kelly L.; Eddington, Kari M.; Silvia, Paul J.


    Do perfectionists try harder? Previous research on perfectionism and effort has used self-report items and task performance as indicators of effort. The current study investigated whether individual differences in perfectionism predicted effort-related cardiac activity during a mental effort task. Based on past research that suggests adaptive perfectionism is associated with higher effort, it was hypothesized that self-oriented perfectionism (SOP) would predict increased effort on the task. One hundred and eleven college students completed the Multidimensional Perfectionism Scale (MPS) and a self-paced parity task in which they received a small cash reward (3 cents) for each correct response. Impedance cardiography was used to assess autonomic reactivity, and regression models tested whether SOP and socially prescribed perfectionism (SPP) explained autonomic reactivity. Overall, participants showed both sympathetic (faster pre-ejection period; PEP) and parasympathetic activation (elevated high-frequency heart rate variability; HRV) during the task, reflecting higher effort and engagement. Contrary to predictions, individual differences in perfectionism did not moderate cardiac reactivity. These findings draw attention to the importance of assessing physiological components of effort and motivation directly rather than inferring them from task performance or self-reported effort. PMID:27483467

  4. Weather data for simplified energy calculation methods. Volume I. Eastern United States: TRY data

    SciTech Connect

    Olsen, A.R.; Moreno, S.; Deringer, J.; Watson, C.R.


    The objective of this report is to provide a source of weather data for direct use with a number of simplified energy calculation methods available today. Complete weather data for a number of cities in the United States are provided for use in the following methods: degree hour, modified degree hour, bin, modified bin, and variable degree day. This report contains sets of weather data for 23 cities in the continental United States using Test Reference Year (TRY) source weather data. The weather data at each city has been summarized in a number of ways to provide differing levels of detail necessary for alternative simplified energy calculation methods. Weather variables summarized include dry bulb and wet bulb temperature, percent relative humidity, humidity ratio, wind speed, percent possible sunshine, percent diffuse solar radiation, total solar radiation on horizontal and vertical surfaces, and solar heat gain through standard DSA glass. Monthly and annual summaries, in some cases by time of day, are available. These summaries are produced in a series of nine computer generated tables.

  5. Modelling and characteristic analysis of tri-axle trucks with hydraulically interconnected suspensions

    NASA Astrophysics Data System (ADS)

    Ding, Fei; Han, Xu; Luo, Zhen; Zhang, Nong


    In this paper, a new hydraulically interconnected suspension (HIS) system is proposed for the implementation of a resistance control for the pitch and bounce modes of tri-axle heavy trucks. A lumped-mass half-truck model is established using the free-body diagram method. The equations of motion of a mechanical and hydraulic coupled system are developed by incorporating the hydraulic strut forces into the mechanical subsystem as externally applied forces. The transfer matrix method (TMM) is used to evaluate the impedance matrix of the hydraulic subsystem consisting of models of fluid pipes, damper valves, accumulators, and three-way junctions. The TMM is further applied to find the quantitative relationships between the hydraulic strut forces and boundary flow of the mechanical-fluid interactive subsystem. The modal analysis method is employed to perform the vibration analysis between the trucks with the conventional suspension and the proposed HIS. Comparison analysis focuses on free vibration with identified eigenvalues and eigenvectors, isolation vibration capacity, and force vibration in terms of the power spectrum density responses. The obtained results show the effectiveness of the proposed HIS system in reducing the pitch motion of sprung mass and simultaneously maintaining the ride comfort. The pitch stiffness is increased while the bounce stiffness is slightly softened. The peak values of sprung mass and wheel hop motions are greatly reduced, and the vibration decay rate of sprung mass is also significantly increased.

  6. Microwave-assisted facile synthesis of a new tri-block chitosan conjugate with improved mucoadhesion.


    Badhe, Ravindra V; Nanda, Rabindra K; Chejara, Dharmesh R; Choonara, Yahya E; Kumar, Pradeep; du Toit, Lisa C; Pillay, Viness


    A new chitosan-based tri-block conjugate, O-PEG-chitosan-N-cysteine was synthesized using microwave irradiation. For synthesis of this derivative, chitosan was modified to a PEG-chitosan conjugate followed by PEG-chitosan-cysteine using 6-O PEGylation and 2-N-thiolation, respectively. The synthesized derivative was characterized using various analytical techniques such as FT-IR and (1)H NMR spectroscopy. The conjugate was also analyzed for its biochemical, biodegradation and mucoadhesive properties. The modified chitosan conjugate exhibited improved mucoadhesion behavior (14.0 h) with greater biodegradation compared to the parent polymer (6.3h). The in silico modeling corroborated with the in vitro study demonstrating a stable complex between mucin and O-PEG-chitosan-N-cysteine conjugate (ΔE=-60.100 kcal/mol) compared to mucin and chitosan conjugate. The synthesis proposed herein, involves the use of microwave irradiation which causes a substantial reduction in the reaction time (approximately 2.30 h) compared to conventional method (35 h).

  7. Weather data for simplified energy calculation methods. Volume II. Middle United States: TRY data

    SciTech Connect

    Olsen, A.R.; Moreno, S.; Deringer, J.; Watson, C.R.


    The objective of this report is to provide a source of weather data for direct use with a number of simplified energy calculation methods available today. Complete weather data for a number of cities in the United States are provided for use in the following methods: degree hour, modified degree hour, bin, modified bin, and variable degree day. This report contains sets of weather data for 22 cities in the continental United States using Test Reference Year (TRY) source weather data. The weather data at each city has been summarized in a number of ways to provide differing levels of detail necessary for alternative simplified energy calculation methods. Weather variables summarized include dry bulb and wet bulb temperature, percent relative humidity, humidity ratio, wind speed, percent possible sunshine, percent diffuse solar radiation, total solar radiation on horizontal and vertical surfaces, and solar heat gain through standard DSA glass. Monthly and annual summaries, in some cases by time of day, are available. These summaries are produced in a series of nine computer generated tables.

  8. Design Methodology for Magnetic Field-Based Soft Tri-Axis Tactile Sensors.


    Wang, Hongbo; de Boer, Greg; Kow, Junwai; Alazmani, Ali; Ghajari, Mazdak; Hewson, Robert; Culmer, Peter


    Tactile sensors are essential if robots are to safely interact with the external world and to dexterously manipulate objects. Current tactile sensors have limitations restricting their use, notably being too fragile or having limited performance. Magnetic field-based soft tactile sensors offer a potential improvement, being durable, low cost, accurate and high bandwidth, but they are relatively undeveloped because of the complexities involved in design and calibration. This paper presents a general design methodology for magnetic field-based three-axis soft tactile sensors, enabling researchers to easily develop specific tactile sensors for a variety of applications. All aspects (design, fabrication, calibration and evaluation) of the development of tri-axis soft tactile sensors are presented and discussed. A moving least square approach is used to decouple and convert the magnetic field signal to force output to eliminate non-linearity and cross-talk effects. A case study of a tactile sensor prototype, MagOne, was developed. This achieved a resolution of 1.42 mN in normal force measurement (0.71 mN in shear force), good output repeatability and has a maximum hysteresis error of 3.4%. These results outperform comparable sensors reported previously, highlighting the efficacy of our methodology for sensor design. PMID:27563908

  9. The photoluminescence properties of tri-colour silicoaluminate phosphors prepared from oil shale ash

    NASA Astrophysics Data System (ADS)

    Zhang, Hui; Song, Yanhua; Sheng, Ye; Zheng, Keyan; Ding, Shizhou; Yuan, Bo; Xu, Xuechun; Zou, Haifeng


    In this paper, high value-added tri-colour phosphors Ba0.96Mg1.88Si2O7:0.02Eu2+, 0.02Dy3+, 0.12Mn2+; CaSr0.995SiO4:0.005Eu2+ and Ba0.91MgAl10O17:0.09Eu2+ were prepared using the white carbon black (hereinafter referred to as WCB) and alumina extracted from oil shale ash as raw materials. The structure and luminescence properties of the samples were characterized by X-ray diffraction (XRD) and photoluminescent spectra. The results show that the red and green phosphors synthesized by WCB exhibited much weaker emission than the phosphors synthesized by pure chemical reagent silica, which is mainly due to the high content of iron in the WCB. After purifying the WCB under laboratory conditions, the luminescence properties were improved and close to that of pure chemical reagent. By comparing with the emission of the samples synthesized with chemical reagents, the results show that the products extracted from oil shale ash can be applied to synthesize luminescent materials which have potential applications in white-light ultraviolet (UV)-LED field.

  10. Development of a Tri-Axial Cutting Force Sensor for the Milling Process.


    Li, Yingxue; Zhao, Yulong; Fei, Jiyou; Zhao, You; Li, Xiuyuan; Gao, Yunxiang


    This paper presents a three-component fixed dynamometer based on a strain gauge, which reduces output errors produced by the cutting force imposed on different milling positions of the workpiece. A reformative structure of tri-layer cross beams is proposed, sensitive areas were selected, and corresponding measuring circuits were arranged to decrease the inaccuracy brought about by positional variation. To simulate the situation with a milling cutter moving on the workpiece and validate the function of reducing the output errors when the milling position changes, both static calibration and dynamic milling tests were implemented on different parts of the workpiece. Static experiment results indicate that with standard loads imposed, the maximal deviation between the measured forces and the standard inputs is 4.87%. The results of the dynamic milling test illustrate that with identical machining parameters, the differences in output variation between the developed sensor and standard dynamometer are no larger than 6.61%. Both static and dynamic experimental results demonstrate that the developed dynamometer is suitable for measuring milling force imposed on different positions of the workpiece, which shows potential applicability in machining a monitoring system. PMID:27007374

  11. Fouling effects of tri-n-butylphosphate on reverse osmosis performance and techniques for performance recovery

    SciTech Connect

    Poy, F.L.


    The F/H Effluent Treatment Facility (F/H ETF) must be on-line by November 1988 to treat the low level activity wastes presently being discharged to the F- and H- areas' seepage basins. The three main processes of the F/H ETF are filtration, reverse osmosis, and ion exchange. Any dissolved organics present in the F/H ETF's feed have the potential to affect operation of the reverse osmosis system. Earlier studies with F/H ETF feed simulant and 70 volume percent kerosene and 30 volume percent tri-n-butylphosphate (TBP) additions showed that the kerosene/TBP mixture results in partial fouling of reverse osmosis membranes. A more detailed analysis of the seepage basin feed has shown that TBP is the major dissolved organic compound. Since it is dissolved (soluble to about 400 ppM at 25{degree}C), TBP will be present in the reverse osmosis feed unless removed by a means other than filtration. Thus the fouling effect of TBP (without kerosene) on reverse osmosis performance was investigated. 4 refs., 8 figs., 2 tabs.

  12. Tri-axial telecoil hearing aid for improved connection to public induction loops.


    Riehle, Timothy H; Knuesel, Robert J; Lichter, Patrick A; Panescu, Dorin


    Telecoils in hearing aids serve a dual purpose: to enhance telephone conversation and enable hearing aids to serve as a wireless interface for public audio broadcasts. When broadcasting audio signals, the signal is transmitted to the telecoil sensor (a magnetic field sensor located in the hearing aid) via magnetic energy from an induction wire loop located near the listener. This induction loop can be a small assembly located in the handset of the telephone or a large wire loop within a public venue like a theatre. Current hearing aids detect the magnetic signal using a single telecoil. If the telecoil is not aligned with the magnetic field, the strength of the detected signal is diminished. Unfortunately, public induction loops and telephone handsets seldom share a common alignment to the hearing aid, leading to sub-optimal performance by one or both in hearing aids available today. In this research, a prototype behind-the-ear (BTE) hearing aid with tri-axial telecoils was developed and DSP algorithms to process and combine the three signals were developed. The resulting hearing aid was evaluated in a human trial and provided better performance than a similar quality conventional telecoil hearing aid.

  13. Responding to inequities: gorillas try to maintain their competitive advantage during play fights.


    Van Leeuwen, Edwin J C; Zimmermann, Elke; Ross, Marina Davila


    Humans respond to unfair situations in various ways. Experimental research has revealed that non-human species also respond to unequal situations in the form of inequity aversions when they have the disadvantage. The current study focused on play fights in gorillas to explore for the first time, to our knowledge, if/how non-human species respond to inequities in natural social settings. Hitting causes a naturally occurring inequity among individuals and here it was specifically assessed how the hitters and their partners engaged in play chases that followed the hitting. The results of this work showed that the hitters significantly more often moved first to run away immediately after the encounter than their partners. These findings provide evidence that non-human species respond to inequities by trying to maintain their competitive advantages. We conclude that non-human primates, like humans, may show different responses to inequities and that they may modify them depending on if they have the advantage or the disadvantage.

  14. Assembly of a photosynthetic reaction center with ABA tri-block polymersomes: highlights on protein localization.


    Tangorra, R R; Operamolla, A; Milano, F; Hassan Omar, O; Henrard, J; Comparelli, R; Italiano, F; Agostiano, A; De Leo, V; Marotta, R; Falqui, A; Farinola, G M; Trotta, M


    The reconstitution of the integral membrane protein photosynthetic reaction center (RC) in polymersomes, i.e. artificial closed vesicles, was achieved by the micelle-to-vesicle transition technique, a very mild protocol based on size exclusion chromatography often used to drive the incorporation of proteins contemporarily to liposome formation. An optimized protocol was used to successfully reconstitute the protein in a fully active state in polymersomes formed by the tri-block copolymers PMOXA22-PDMS61-PMOXA22. The RC is very sensitive to its solubilizing environment and was used to probe the positioning of the protein in the vesicles. According to charge-recombination experiments and to the enzymatic activity assay, the RC is found to accommodate in the PMOXA22 region of the polymersome, facing the water bulk solution, rather than in the PDMS61 transmembrane-like region. Furthermore, polymersomes were found to preserve protein integrity efficiently as the biomimetic lipid bilayers but show a much longer temporal stability than lipid based vesicles.

  15. Medical data sheet in safe havens - A tri-layer cryptic solution.


    Praveenkumar, Padmapriya; Amirtharajan, Rengarajan; Thenmozhi, K; Balaguru Rayappan, John Bosco


    Secured sharing of the diagnostic reports and scan images of patients among doctors with complementary expertise for collaborative treatment will help to provide maximum care through faster and decisive decisions. In this context, a tri-layer cryptic solution has been proposed and implemented on Digital Imaging and Communications in Medicine (DICOM) images to establish a secured communication for effective referrals among peers without compromising the privacy of patients. In this approach, a blend of three cryptic schemes, namely Latin square image cipher (LSIC), discrete Gould transform (DGT) and Rubik׳s encryption, has been adopted. Among them, LSIC provides better substitution, confusion and shuffling of the image blocks; DGT incorporates tamper proofing with authentication; and Rubik renders a permutation of DICOM image pixels. The developed algorithm has been successfully implemented and tested in both the software (MATLAB 7) and hardware Universal Software Radio Peripheral (USRP) environments. Specifically, the encrypted data were tested by transmitting them through an additive white Gaussian noise (AWGN) channel model. Furthermore, the sternness of the implemented algorithm was validated by employing standard metrics such as the unified average changing intensity (UACI), number of pixels change rate (NPCR), correlation values and histograms. The estimated metrics have also been compared with the existing methods and dominate in terms of large key space to defy brute force attack, cropping attack, strong key sensitivity and uniform pixel value distribution on encryption.

  16. Study of CO2 recovery in a carbonate fuel cell tri-generation plant

    NASA Astrophysics Data System (ADS)

    Rinaldi, Giorgio; McLarty, Dustin; Brouwer, Jack; Lanzini, Andrea; Santarelli, Massimo


    The possibility of separating and recovering CO2 in a biogas plant that co-produces electricity, hydrogen, and heat is investigated. Exploiting the ability of a molten carbonate fuel cell (MCFC) to concentrate CO2 in the anode exhaust stream reduces the energy consumption and complexity of CO2 separation techniques that would otherwise be required to remove dilute CO2 from combustion exhaust streams. Three potential CO2 concentrating configurations are numerically simulated to evaluate potential CO2 recovery rates: 1) anode oxidation and partial CO2 recirculation, 2) integration with exhaust from an internal combustion engine, and 3) series connection of molten carbonate cathodes initially fed with internal combustion engine (ICE) exhaust. Physical models have been calibrated with data acquired from an operating MCFC tri-generating plant. Results illustrate a high compatibility between hydrogen co-production and CO2 recovery with series connection of molten carbonate systems offering the best results for efficient CO2 recovery. In this case the carbon capture ratio (CCR) exceeds 73% for two systems in series and 90% for 3 MCFC in series. This remarkably high carbon recovery is possible with 1.4 MWe delivered by the ICE system and 0.9 MWe and about 350 kg day-1 of H2 delivered by the three MCFC.

  17. Molecular dynamics simulation of tri-n-butyl-phosphate liquid: a force field comparative study.


    Cui, Shengting; de Almeida, Valmor F; Hay, Benjamin P; Ye, Xianggui; Khomami, Bamin


    Molecular dynamics (MD) simulations were conducted to compare the performance of four force fields in predicting thermophysical properties of tri-n-butyl-phosphate (TBP) in the liquid phase. The intramolecular force parameters used were from the Assisted Model Building with Energy Refinement (AMBER) force field model. The van der Waals parameters were based on either the AMBER or the Optimized Potential for Liquid Simulation (OPLS) force fields. The atomic partial charges were either assigned by performing quantum chemistry calculations or utilized previously published data, and were scaled to approximate the average experimental value of the electric dipole moment. Canonical ensemble computations based on the aforementioned parameters were performed near atmospheric pressure and temperature to obtain the electric dipole moment, mass density, and self-diffusion coefficient. In addition, the microscopic structure of the liquid was characterized via pair correlation functions between selected atoms. It has been demonstrated that the electric dipole moment can be approximated within 1% of the average experimental value by virtue of scaled atomic partial charges. The liquid mass density can be predicted within 0.5-1% of its experimentally determined value when using the corresponding charge scaling. However, in all cases, the predicted self-diffusion coefficient is significantly smaller than a commonly quoted experimental measurement; this result is qualified by the fact that the uncertainty of the experimental value was not available. PMID:22126596

  18. Tunable ferroelectricity in artificial tri-layer superlattices comprised of non-ferroic components.


    Rogdakis, K; Seo, J W; Viskadourakis, Z; Wang, Y; Qune, L F N Ah; Choi, E; Burton, J D; Tsymbal, E Y; Lee, J; Panagopoulos, C


    Heterostructured material systems devoid of ferroic components are presumed not to display ordering associated with ferroelectricity. In heterostructures composed of transition metal oxides, however, the disruption introduced by an interface can affect the balance of the competing interactions among electronic spins, charges and orbitals. This has led to the emergence of properties absent in the original building blocks of a heterostructure, including metallicity, magnetism and superconductivity. Here we report the discovery of ferroelectricity in artificial tri-layer superlattices consisting solely of non-ferroelectric NdMnO(3)/SrMnO(3)/LaMnO(3) layers. Ferroelectricity was observed below 40 K exhibiting strong tunability by superlattice periodicity. Furthermore, magnetoelectric coupling resulted in 150% magnetic modulation of the polarization. Density functional calculations indicate that broken space inversion symmetry and mixed valency, because of cationic asymmetry and interfacial polar discontinuity, respectively, give rise to the observed behaviour. Our results demonstrate the engineering of asymmetric layered structures with emergent ferroelectric and magnetic field tunable functions distinct from that of normal devices, for which the components are typically ferroelectrics. PMID:22990860

  19. Experimental and Computational Study of Trapped Vortex Combustor Sector Rig with Tri-pass Diffuser

    NASA Technical Reports Server (NTRS)

    Hendricks, Robert C.; Shouse, D. T.; Roquemore, W. M.; Burrus, D. L.; Duncan, B. S.; Ryder, R. C.; Brankovic, A.; Liu, N.-S.; Gallagher, J. R.; Hendricks, J. A.


    The Trapped Vortex Combustor (TVC) potentially offers numerous operational advantages over current production gas turbine engine combustors. These include lower weight, lower pollutant emissions, effective flame stabilization, high combustion efficiency, excellent high altitude relight capability, and operation in the lean burn or RQL (Rich burn/Quick mix/Lean burn) modes of combustion. The present work describes the operational principles of the TVC, and provides detailed performance data on a configuration featuring a tri-pass diffusion system. Performance data include EINOx (NO(sub x) emission index) results for various fuel-air ratios and combustor residence times, combustion efficiency as a function of combustor residence time, and combustor lean blow-out (LBO) performance. Computational fluid dynamics (CFD) simulations using liquid spray droplet evaporation and combustion modeling are performed and related to flow structures observed in photographs of the combustor. The CFD results are used to understand the aerodynamics and combustion features under different fueling conditions. Performance data acquired to date are favorable in comparison to conventional gas turbine combustors. Further testing over a wider range of fuel-air ratios, fuel flow splits, and pressure ratios is in progress to explore the TVC performance. In addition, alternate configurations for the upstream pressure feed, including bi-pass diffusion schemes, as well as variations on the fuel injection patterns, are currently in test and evaluation phases.

  20. Weather data for simplified energy calculation methods. Volume III. Western United States: TRY data

    SciTech Connect

    Olsen, A.R.; Moreno, S.; Deringer, J.; Watson, C.R.


    The objective is to provide a source of weather data for direct use with a number of simplified energy calculation methods available today. Complete weather data for a number of cities in the United States are provided for use in the following methods: degree hour, modified degree hour, bin, modified bin, and variable degree day. This report contains sets of weather data for 24 cities in the continental United States using Test Reference Year (TRY) source weather data. The weather data at each city has been summarized in a number of ways to provide differing levels of detail necessary for alternative simplified energy calculation methods. Weather variables summarized include dry bulb and wet bulb temperature, percent relative humidity, humidity ratio, wind speed, percent possible sunshine, percent diffuse solar radiation, total solar radiation on horizontal and vertical surfaces, and solar heat gain through standard DSA glass. Monthly and annual summaries, in some cases by time of day, are available. These summaries are produced in a series of nine computer generated tables.

  1. Metal-metal interactions in linear tri-, penta-, hepta-, and nona-nuclear ruthenium string complexes.


    Niskanen, Mika; Hirva, Pipsa; Haukka, Matti


    Density functional theory (DFT) methodology was used to examine the structural properties of linear metal string complexes: [Ru(3)(dpa)(4)X(2)] (X = Cl(-), CN(-), NCS(-), dpa = dipyridylamine(-)), [Ru(5)(tpda)(4)Cl(2)], and hypothetical, not yet synthesized complexes [Ru(7)(tpta)(4)Cl(2)] and [Ru(9)(ppta)(4)Cl(2)] (tpda = tri-α-pyridyldiamine(2-), tpta = tetra-α-pyridyltriamine(3-), ppta = penta-α-pyridyltetraamine(4-)). Our specific focus was on the two longest structures and on comparison of the string complexes and unsupported ruthenium backboned chain complexes, which have weaker ruthenium-ruthenium interactions. The electronic structures were studied with the aid of visualized frontier molecular orbitals, and Bader's quantum theory of atoms in molecules (QTAIM) was used to study the interactions between ruthenium atoms. The electron density was found to be highest and distributed most evenly between the ruthenium atoms in the hypothetical [Ru(7)(tpta)(4)Cl(2)] and [Ru(9)(ppta)(4)Cl(2)] string complexes.

  2. Emergent ferroelectricity in disordered tri-color multilayer structure comprised of ferromagnetic manganites

    NASA Astrophysics Data System (ADS)

    Niu, Li-Wei; Chen, Chang-Le; Dong, Xiang-Lei; Xing, Hui; Luo, Bing-Cheng; Jin, Ke-Xin


    Multiferroic materials, showing the coexistence and coupling of ferroelectric and magnetic orders, are of great technological and fundamental importance. However, the limitation of single phase multiferroics with robust magnetization and polarization hinders the magnetoelectric effect from being applied practically. Magnetic frustration, which can induce ferroelectricity, gives rise to multiferroic behavior. In this paper, we attempt to construct an artificial magnetically frustrated structure comprised of manganites to induce ferroelectricity. A disordered stacking of manganites is expected to result in frustration at interfaces. We report here that a tri-color multilayer structure comprised of non-ferroelectric La0.9Ca0.1MnO3(A)/Pr0.85Ca0.15MnO3(B)/Pr0.85Sr0.15MnO3(C) layers with the disordered arrangement of ABC-ACB-CAB-CBA-BAC-BCA is prepared to form magnetoelectric multiferroics. The multilayer film exhibits evidence of ferroelectricity at room temperature, thus presenting a candidate for multiferroics. Project supported by the National Natural Science Foundation of China (Grant Nos. 61471301, 61078057, 51172183, 51402240, and 51471134), the Specialized Research Fund for the Doctoral Program of Higher Education, China (Grant No. 20126102110045), the Natural Science Foundation of Shaanxi Province, China (Grant No. 2015JQ5125), and the Fundamental Research Funds for the Central Universities, China (Grant No. 3102015ZY078).

  3. Resonant Enhancement of Charge Density Wave Diffraction in the Rare-Earth Tri-Tellurides

    SciTech Connect

    Lee, W.S.; Sorini, A.P.; Yi, M.; Chuang, Y.D.; Moritz, B.; Yang, W.L.; Chu, J.-H.; Kuo, H.H.; Gonzalez, A.G.Cruz; Fisher, I.R.; Hussain, Z.; Devereau, T.P.; Shen, Z.X.


    We performed resonant soft X-ray diffraction on known charge density wave (CDW) compounds, rare earth tri-tellurides. Near the M{sub 5} (3d - 4f) absorption edge of rare earth ions, an intense diffraction peak is detected at a wavevector identical to that of CDW state hosted on Te{sub 2} planes, indicating a CDW-induced modulation on the rare earth ions. Surprisingly, the temperature dependence of the diffraction peak intensity demonstrates an exponential increase at low temperatures, vastly different than that of the CDW order parameter. Assuming 4f multiplet splitting due to the CDW states, we present a model to calculate X-ray absorption spectrum and resonant profile of the diffraction peak, agreeing well with experimental observations. Our results demonstrate a situation where the temperature dependence of resonant X-ray diffraction peak intensity is not directly related to the intrinsic behavior of the order parameter associated with the electronic order, but is dominated by the thermal occupancy of the valence states.

  4. Design Methodology for Magnetic Field-Based Soft Tri-Axis Tactile Sensors

    PubMed Central

    Wang, Hongbo; de Boer, Greg; Kow, Junwai; Alazmani, Ali; Ghajari, Mazdak; Hewson, Robert; Culmer, Peter


    Tactile sensors are essential if robots are to safely interact with the external world and to dexterously manipulate objects. Current tactile sensors have limitations restricting their use, notably being too fragile or having limited performance. Magnetic field-based soft tactile sensors offer a potential improvement, being durable, low cost, accurate and high bandwidth, but they are relatively undeveloped because of the complexities involved in design and calibration. This paper presents a general design methodology for magnetic field-based three-axis soft tactile sensors, enabling researchers to easily develop specific tactile sensors for a variety of applications. All aspects (design, fabrication, calibration and evaluation) of the development of tri-axis soft tactile sensors are presented and discussed. A moving least square approach is used to decouple and convert the magnetic field signal to force output to eliminate non-linearity and cross-talk effects. A case study of a tactile sensor prototype, MagOne, was developed. This achieved a resolution of 1.42 mN in normal force measurement (0.71 mN in shear force), good output repeatability and has a maximum hysteresis error of 3.4%. These results outperform comparable sensors reported previously, highlighting the efficacy of our methodology for sensor design. PMID:27563908

  5. Exciton Binding energies and effective masses in Organo-lead Tri-Halide Perovskites

    NASA Astrophysics Data System (ADS)

    Portugall, Oliver; Miyata, Atsuhiko; Mitioglu, Anatol; Plochocka, Paulina; Wang, Jacob Tse-Wei; Stranks, Samuel; Snaith, Henry; Nicholas, Robin; Lncmi Toulouse Team; Oxford University Team


    Solid-state perovskite-based solar cells have made a dramatic impact on emerging PV research with efficiencies of over 17% already achieved. However, to date the basic electronic properties of the perovskites such as the electron and hole effective masses and the exciton binding energy are not well known. We have measured both for methyl ammonium lead tri-iodide using magneto absorption in very high magnetic fields up to 150T showing that the exciton binding energy at low temperatures is only 16 meV, a value three times smaller than previously thought and sufficiently small to completely transform the way in which the devices must operate. Landau level spectroscopy shows that the reduced effective mass of 0.104 me is also smaller than previously thought. In addition by using a fast pulse 150T magnet we measure the band structure change due to the structural phase transition that occurs in this system at around 160K. We also observe Landau levels in the high temperature phase as used for device production, which has a very similar effective mass and the analysis suggests an exciton binding energy which is even smaller than in the low temperature phase.

  6. Tri-linear color multi-linescan sensor with 200 kHz line rate

    NASA Astrophysics Data System (ADS)

    Schrey, Olaf; Brockherde, Werner; Nitta, Christian; Bechen, Benjamin; Bodenstorfer, Ernst; Brodersen, Jörg; Mayer, Konrad J.


    In this paper we present a newly developed linear CMOS high-speed line-scanning sensor realized in a 0.35 μm CMOS OPTO process for line-scan with 200 kHz true RGB and 600 kHz monochrome line rate, respectively. In total, 60 lines are integrated in the sensor allowing for electronic position adjustment. The lines are read out in rolling shutter manner. The high readout speed is achieved by a column-wise organization of the readout chain. At full speed, the sensor provides RGB color images with a spatial resolution down to 50 μm. This feature enables a variety of applications like quality assurance in print inspection, real-time surveillance of railroad tracks, in-line monitoring in flat panel fabrication lines and many more. The sensor has a fill-factor close to 100%, preventing aliasing and color artefacts. Hence the tri-linear technology is robust against aliasing ensuring better inspection quality and thus less waste in production lines.

  7. Tri-county pre-commercial analysis of converting wastes to marketable products

    SciTech Connect

    Frolich, M.; Munk, G.; McArthur, K.


    Open field burning of harvest residues is an effective, low cost method of controlling diseases, insects and weeds in many agricultural operations. Restrictions have been imposed against this practice in several areas and these restrictions are expected to increase in the near future. The agricultural community in the Tri-County area of Nevada recognized that eventually burning would be an unacceptable practice of disposal. A biomass inventory was jointly funded by the area seed producers and Western Regional Biomass Energy Program that revealed a sufficient biomass resource to justify further work to answer the question: Can economic alternative methods of disposal be developed either through export of biomass or through conversion technologies in the local area? Technically the answer is yes. Several methods are available, either singly or in combination, capable of converting the difficult residues into energy or commodity products. Economically, the answer is not clear. There are many assumptions made in the financial analyses reported by the process developers that combine with a lack of concrete markets resulting in the conclusion that economic viability cannot be attained at the present time.

  8. Development of a Tri-Axial Cutting Force Sensor for the Milling Process

    PubMed Central

    Li, Yingxue; Zhao, Yulong; Fei, Jiyou; Zhao, You; Li, Xiuyuan; Gao, Yunxiang


    This paper presents a three-component fixed dynamometer based on a strain gauge, which reduces output errors produced by the cutting force imposed on different milling positions of the workpiece. A reformative structure of tri-layer cross beams is proposed, sensitive areas were selected, and corresponding measuring circuits were arranged to decrease the inaccuracy brought about by positional variation. To simulate the situation with a milling cutter moving on the workpiece and validate the function of reducing the output errors when the milling position changes, both static calibration and dynamic milling tests were implemented on different parts of the workpiece. Static experiment results indicate that with standard loads imposed, the maximal deviation between the measured forces and the standard inputs is 4.87%. The results of the dynamic milling test illustrate that with identical machining parameters, the differences in output variation between the developed sensor and standard dynamometer are no larger than 6.61%. Both static and dynamic experimental results demonstrate that the developed dynamometer is suitable for measuring milling force imposed on different positions of the workpiece, which shows potential applicability in machining a monitoring system. PMID:27007374

  9. Immunocytochemical localization of a tartrate-resistant and vanadate-sensitive acid nucleotide tri- and diphosphatase.


    Andersson, G N; Ek-Rylander, B; Hammarström, L E; Lindskog, S; Toverud, S U


    Purified rabbit antiserum to a tartrate-resistant and vanadate-sensitive acid phosphatase (nucleotide tri- and diphosphatase) prepared from rat bone was used in immunocytochemical studies. The antigen was localized in sections of fixed, decalcified tissue (head from rat) using the peroxidase-antiperoxidase bridge (PAP) or the avidin-biotin-peroxidase complex (ABC) technique. Both techniques resulted in similar and specific immunostaining in the following cells and tissues: osteoclasts situated in resorption lacunae, epithelium overlying enamel-free areas of tips of cusps of unerupted molars, cilia of respiratory epithelium, and tissue macrophages. This distribution corresponds to the cellular sites of tartrate-resistant acid phosphatase activity, as revealed by enzyme histochemistry. With the ABC method, staining in osteoclasts was obtained with antiserum dilutions of up to 1:10,000. Biochemical studies revealed that vanadate-sensitive acid ATPase activity in liver subcellular fractions was almost exclusively confined to lysosomes. Thus, the immunostaining has revealed the presence of the tartrate-resistant and vanadate-sensitive nucleotide phosphatase in many cells associated with tissue resorption and phagocytosis.

  10. Tri-state delta modulation system for Space Shuttle digital TV downlink

    NASA Technical Reports Server (NTRS)

    Udalov, S.; Huth, G. K.; Roberts, D.; Batson, B. H.


    Future requirements for Shuttle Orbiter downlink communication may include transmission of digital video which, in addition to black and white, may also be either field-sequential or NTSC color format. The use of digitized video could provide for picture privacy at the expense of additional onboard hardware, together with an increased bandwidth due to the digitization process. A general objective for the Space Shuttle application is to develop a digitization technique that is compatible with data rates in the 20-30 Mbps range but still provides good quality pictures. This paper describes a tri-state delta modulation/demodulation (TSDM) technique which is a good compromise between implementation complexity and performance. The unique feature of TSDM is that it provides for efficient run-length encoding of constant-intensity segments of a TV picture. Axiomatix has developed a hardware implementation of a high-speed TSDM transmitter and receiver for black-and-white TV and field-sequential color. The hardware complexity of this TSDM implementation is summarized in the paper.

  11. Treatment of halogenated phenolic compounds by sequential tri-metal reduction and laccase-catalytic oxidation.


    Dai, Yunrong; Song, Yonghui; Wang, Siyu; Yuan, Yu


    Halogenated phenolic compounds (HPCs) are exerting negative effects on human beings and ecological health. Zero-valence metal reduction can dehalogenate HPCs rapidly but cannot mineralize them. Enzymatic catalysis can oxidize phenolic compounds but fails to dehalogenate efficiently, and sometimes even produces more toxic products. In this study, [Fe|Ni|Cu] tri-metallic reduction (TMR) and laccase-catalytic oxidation (LCO) processes were combined to sequentially remove HPCs, including triclosan, tetrabromobisphenol A, and 2-bromo-4-fluorophenol in water. The kinetics, pH and temperature dependences of TMR and LCO were obtained. The detailed TMR, LCO, and TMR-LCO transformation pathways of three HPCs were well described based on the identification of intermediate products and frontier molecular orbitals (FMOs) theory. The results showed that the two-stage process worked synergically: TMR that reductively dehalogenated HPCs followed by LCO that completely removed dehalogenated products. TMR was proven to not only improve biodegradability of HPCs but also reduce the yield of potential carcinogenic by-products. Furthermore, a TMR-LCO flow reactor was assembled and launched for 256 h, during which >95% HPCs and >75% TOC were removed. Meanwhile, monitored by microorganism indicators, 83.2%-92.7% acute toxicity of HPCs was eliminated, and the genotoxicity, produced by LCO, was also avoided by using TMR as pretreatment process. PMID:25596562

  12. In-situ comprehensive calibration of a tri-port nano-electro-mechanical device.


    Collin, E; Defoort, M; Lulla, K; Moutonet, T; Heron, J-S; Bourgeois, O; Bunkov, Yu M; Godfrin, H


    We report on experiments performed in vacuum and at cryogenic temperatures on a tri-port nano-electro-mechanical (NEMS) device. One port is a very nonlinear capacitive actuation, while the two others implement the magnetomotive scheme with a linear input force port and a (quasi-linear) output velocity port. We present an experimental method enabling a full characterization of the nanomechanical device harmonic response: the nonlinear capacitance function C(x) is derived, and the normal parameters k and m (spring constant and mass) of the mode under study are measured through a careful definition of the motion (in meters) and of the applied forces (in Newtons). These results are obtained with a series of purely electric measurements performed without disconnecting/reconnecting the device, and rely only on known dc properties of the circuit, making use of a thermometric property of the oscillator itself: we use the Young modulus of the coating metal as a thermometer, and the resistivity for Joule heating. The setup requires only three connecting lines without any particular matching, enabling the preservation of a high impedance NEMS environment even at MHz frequencies. The experimental data are fit to a detailed electrical and thermal model of the NEMS device, demonstrating a complete understanding of its dynamics. These methods are quite general and can be adapted (as a whole, or in parts) to a large variety of electromechanical devices.

  13. Study of a tri-trophic prey-dependent food chain model of interacting populations.


    Haque, Mainul; Ali, Nijamuddin; Chakravarty, Santabrata


    The current paper accounts for the influence of intra-specific competition among predators in a prey dependent tri-trophic food chain model of interacting populations. We offer a detailed mathematical analysis of the proposed food chain model to illustrate some of the significant results that has arisen from the interplay of deterministic ecological phenomena and processes. Biologically feasible equilibria of the system are observed and the behaviours of the system around each of them are described. In particular, persistence, stability (local and global) and bifurcation (saddle-node, transcritical, Hopf-Andronov) analysis of this model are obtained. Relevant results from previous well known food chain models are compared with the current findings. Global stability analysis is also carried out by constructing appropriate Lyapunov functions. Numerical simulations show that the present system is capable enough to produce chaotic dynamics when the rate of self-interaction is very low. On the other hand such chaotic behaviour disappears for a certain value of the rate of self interaction. In addition, numerical simulations with experimented parameters values confirm the analytical results and shows that intra-specific competitions bears a potential role in controlling the chaotic dynamics of the system; and thus the role of self interactions in food chain model is illustrated first time. Finally, a discussion of the ecological applications of the analytical and numerical findings concludes the paper.

  14. Microwave-assisted facile synthesis of a new tri-block chitosan conjugate with improved mucoadhesion.


    Badhe, Ravindra V; Nanda, Rabindra K; Chejara, Dharmesh R; Choonara, Yahya E; Kumar, Pradeep; du Toit, Lisa C; Pillay, Viness


    A new chitosan-based tri-block conjugate, O-PEG-chitosan-N-cysteine was synthesized using microwave irradiation. For synthesis of this derivative, chitosan was modified to a PEG-chitosan conjugate followed by PEG-chitosan-cysteine using 6-O PEGylation and 2-N-thiolation, respectively. The synthesized derivative was characterized using various analytical techniques such as FT-IR and (1)H NMR spectroscopy. The conjugate was also analyzed for its biochemical, biodegradation and mucoadhesive properties. The modified chitosan conjugate exhibited improved mucoadhesion behavior (14.0 h) with greater biodegradation compared to the parent polymer (6.3h). The in silico modeling corroborated with the in vitro study demonstrating a stable complex between mucin and O-PEG-chitosan-N-cysteine conjugate (ΔE=-60.100 kcal/mol) compared to mucin and chitosan conjugate. The synthesis proposed herein, involves the use of microwave irradiation which causes a substantial reduction in the reaction time (approximately 2.30 h) compared to conventional method (35 h). PMID:26076619

  15. State of remediation and metal toxicity in the Tri-State Mining District, USA.


    Johnson, Aaron W; Gutiérrez, Mélida; Gouzie, Douglas; McAliley, L Rex


    Mining operations in the Tri-State Mining District of Kansas, Missouri and Oklahoma (TSMD), once one of the major lead and zinc mining areas in the world, had completely ceased by 1970. As mining companies moved out, the land was left with underground tunnels and mine shafts and the surface with abandoned tailings piles, which progressively contaminated groundwater and soil. Despite remedial actions undertaken in the 1980's, areas within the TSMD still contain Cd, Pb, and Zn concentrations exceeding safe levels. Because of the large area and highly dispersed occurrence of wastes, environmental studies generally have been confined either to a stream basin or to a single state. Studies also have differed in their approach and analytical methodologies. An overview of the totality of the TSMD and its present state of contamination is presented here. Data show that metal content in sediments have the following common features: (1) a wide range of Pb and Zn concentrations, up to three orders of magnitude, (2) median values for Cd, Pb and Zn content in sediments and soils were similar among studies, (3) median values for most studies were at or above the guidelines recommended for aquatic habitats, and (4) highest content of Pb and Zn were closely associated with the geographical location of former mining and smelting centers. The above observations imply that mine wastes remain a problem and further remediation is needed. Cost-effective remedial alternatives for this area's geology, climate, and land use, are discussed.

  16. Starting young? Children's experiences of trying smoking during pre-adolescence.


    Milton, Beth; Woods, S E; Dugdill, L; Porcellato, L; Springett, R J


    Although the risks smoking poses to health are now well known, many young people continue to take up the habit. While numerous cross-sectional studies of adolescents have identified correlates of smoking initiation, much less prospective, longitudinal research has been conducted with young children to gather their accounts of early experiences of smoking, and this study fills that significant gap. Quantitative and qualitative data, collected using questionnaires, interviews and focus groups, are presented from the pre-adolescent phase of the Liverpool Longitudinal Study of Smoking. By age 11, 27% of the cohort had tried smoking, 13% had smoked repeatedly and 3% were smoking regularly. Rates of experimentation increased over time. Qualitative data revealed that curiosity and the role of peers were central to children's accounts of early smoking. By pre-adolescence, children are at different stages in their smoking careers, therefore interventions must be targeted to their varied experiences. Current prevention strategies often focus on restricting access to cigarettes, but a broad range of intervention measures is required which take account of the multifactorial nature of smoking onset. To be effective, policies that aim to prevent smoking must be grounded in children's lived experiences.

  17. Crystal structure of benzene-1,3,5-tri-carb-oxy-lic acid-4-pyridone (1/3).


    Staun, Selena L; Oliver, Allen G


    Slow co-crystallization of a solution of benzene-1,3,5-tri-carb-oxy-lic acid with a large excess of 4-hy-droxy-pyridine produces an inter-penetrating, three-dimensional, hydrogen-bonded framework consisting of three 4-pyridone and one benzene-1,3,5-tri-carb-oxy-lic acid mol-ecules, C9H6O6·3C5H5NO. This structure represents an ortho-rhom-bic polymorph of the previously reported C-centered, monoclinic structure [Campos-Gaxiola et al. (2014 ▸). Acta Cryst. E70, o453-o454]. PMID:26594492

  18. Tri-Lateral Noor al Salaam High Concentration Solar Central Receiver Program

    SciTech Connect

    Blackmon, James B


    marketing research, identify opportunities for use of this technology, and to the extent possible, secure an agreement leading to a pre-commercialization demonstration or prototype plant. This was accomplished with the agreement to conduct the Noor al Salaam program as a tri-lateral project between Egypt, Israel, and the U.S. The tri-lateral project was led by the University of Alabama in Huntsville (UAH); this included the Egyptian New and Renewable Energy Authority and the Israeli USISTC participants. This project, known was Noor al Salaam, was funded by the U.S. Agency for International Development (USAID) through the Department of Energy (DOE). The Egyptian activity was under the auspices of the Egyptian Ministry of Energy and Electricity, New and Renewable Energy Authority (NREA) as part of Egypt's plans for renewable energy development. The objective of the Noor al Salaam project was to develop the conditions necessary to obtain funding and construct and operate an approximately 10 to 20 Megawatt hybrid solar/natural gas demonstration power plant in Zaafarana, Egypt that could serve both as a test bed for advanced solar technology evaluations, and as a forerunner to commercial plant designs. This plant, termed Noor Al Salaam, or “Light of Peace”, reached the initial phase of system definition before being curtailed, in part by changes in USAID objectives, coupled with various delays that were beyond the scope of the program to resolve. The background of the USISTF technology development and pre-commercialization effort is provided in this report, together with documentation of the technology developments conducted under the Noor al Salaam program. It should be noted that only a relatively small part of the Noor al Salaam funding was expended over the approximately five years for which UAH was prime contractor before the program was ordered closed (Reference 1) so that the remaining funds could be returned to USAID.

  19. Assessing head and trunk symmetry during sleep using tri-axial accelerometers.


    Sato, Haruhiko; Ikura, Daiki; Tsunoda, Masahiro


    Using two types of small, lightweight tri-axial accelerometers, we obtained evidence for the effectiveness of an approach for assessing head-trunk symmetrical or asymmetrical positions during sleep. First, we assessed the accuracy of our monitoring system in five healthy young adults (age range, 22-24 years). The participants wore acceleration monitors on the sternum and forehead; then spent 5 min in six different positions. Once accuracy was confirmed, we assessed head-trunk symmetry during night-time sleep in 10 healthy children (age range, 3-13 years) and 10 young adults (age range, 21-26 years) in their home environments. All participants wore the monitors during one night's sleep in their homes. After computing head-trunk positions using the orientation data obtained by the accelerometers, head and trunk symmetry were evaluated. The head and trunk positions were correctly detected: the positional data from the trunk had 99% agreement, and the data from the head had 96% agreement. Both the young adults and children were observed to spend time with the head-trunk in asymmetric positions; however, the subjects changed position frequently so the asymmetrical postures were mobile. We concluded that the proposed monitoring system is a reliable and valid approach for assessing head-trunk symmetry during sleep at home. Implications for Rehabilitation We propose a head and trunk symmetry monitoring system using accelerometers. The proposed system could accurately identify head and trunk position. Asymmetrical positioning was seen in healthy participants but it was not immobile. PMID:24274623

  20. Tri-trophic insecticidal effects of African plants against cabbage pests.


    Amoabeng, Blankson W; Gurr, Geoff M; Gitau, Catherine W; Nicol, Helen I; Munyakazi, Louis; Stevenson, Phil C


    -available Ghanaian plants give beneficial, tri-trophic benefits and merit further research as an inexpensive plant protection strategy for smallholder farmers in West Africa. PMID:24205287

  1. Growth and characterization of an organometallic tri-allylthiourea complex nonlinear optical crystals

    NASA Astrophysics Data System (ADS)

    Perumal, R.; Moorthy Babu, S.


    A novel family of allylthiourea metal complexes was identified for photonic applications with allylthiourea serving as a double ligand, and II (B) group metals were chosen as a co-ordination metal. This family belongs to an island-type organometallic category. A series of optically negative nonlinear optical (NLO) crystals (ATCC, ATCB, ATMC and ATMB) have been prepared. Their SHG efficiency was an order of magnitude higher than that of the well-known organic crystal, urea. The properties of allylthiourea complex with central atom Cd were compared with the crystals with another central atom Hg. The latter has longer transparency cut-off wavelength, higher thermal stability and SHG efficiencies. These organometallic tri-allylthiourea complex crystals were grown from the aqueous solution by temperature-lowering technique. Comprehensive studies of synthesis, solubility, crystal growth and the general properties including structural, spectral, optical and thermal properties were analyzed by conducting various characterization techniques. They were synthesized in the de-ionized water and the solubilities of each material were determined by employing thermogravimetric analysis. The growth conditions were analyzed in terms of the pH value of the mother solution because it plays a vital role during the growth. Their structural properties were examined by recording the powder X-ray diffraction pattern. The crystal formation and the metal co-ordination were confirmed by the spectral analysis. The transmission spectrum of these crystals shows a wide transparent UV-vis-NIR band. The thermal behavior of these complexes was studied from the thermal studies. Their NLO efficiencies were analyzed through the Kurt'z technique.

  2. Toxic Release Inventory (TRI), 1987-1994 (on cd-rom). Data file

    SciTech Connect


    Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act of 1986 (Public Law 99-499) requires EPA to establish a national inventory of toxic chemical emissions from certain facilities. The final Toxic Chemical Release Form R and regulations for the 1987 reporting year were published in the Federal Register on February 16, 1988 (53 FR 4500-4554). The list of toxic chemicals subject to reporting consisted initially of chemicals listed for similar reporting purposes by the states of New Jersey and Maryland. There are over 300 chemicals and categories on these lists. The reporting requirement applies to owners and operators of facilities that have 10 or more full-time employees, that are in Standard Industrial Classification (SIC) codes 20 through 39 (i.e., manufacturing facilities) and that manufacture (including importing), process or otherwise use a listed toxic chemical in excess of specified threshold quantities. The following information is required on Form R: the name, location and type of business; off-site locations to which the facility transfers toxic chemicals in waste; whether the chemical is manufactured (including importation), processed, or otherwise used and the general categories of use of the chemical; an estimate (in ranges) of the maximum amounts of the toxic chemical present at the facility at any time during the preceding year; quantity of the chemical entering each medium - air, land, and water - annually; waste treatment/disposal methods and efficiency of methods for each waste stream; optional information on waste minimization; and a certification by a senior facility official that the report is complete and accurate. The law mandates that the data be made publicly available through a computer database. The online TRI file should appeal to a broad based user audience.

  3. Tri-trophic insecticidal effects of African plants against cabbage pests.


    Amoabeng, Blankson W; Gurr, Geoff M; Gitau, Catherine W; Nicol, Helen I; Munyakazi, Louis; Stevenson, Phil C


    -available Ghanaian plants give beneficial, tri-trophic benefits and merit further research as an inexpensive plant protection strategy for smallholder farmers in West Africa.

  4. Effects of urbanization on direct and indirect interactions in a tri-trophic system.


    Tabea, Turrini; Dirk, Sanders; Eva, Knop


    While effects of urbanization on species assemblages are receiving increasing attention, effects on ecological interactions remain largely unexplored. We investigated how urbanization influences the strength of direct and indirect trophic interactions in a tri- trophic system. In a field experiment including five cities and nearby farmed areas, we used potted Vicia faba plants and manipulated the presence of Megoura viciae aphids and that of naturally occurring aphid predators. When predators could access aphids, they reduced their abundance less in the urban than in the agricultural ecosystem. Compared to aphid abundance on plants without predator access, abundance on plants with predator access was 2.58 times lower in urban and 5.27 times lower in agricultural areas. This indicates that urbanization limited top-down control of aphids by predators. In both ecosystems, plant biomass was negatively affected by herbivores and positively affected by predators, but the positive indirect predator effect was weaker in cities. Compared to aphid-infested plants without predator access, plants with predator access were 1.89 times heavier in urban and 2.12 times heavier in agricultural areas. Surprisingly, differences between ecosystems regarding the indirect predator effect on plants were not explained by the differentially strong herbivore suppression. Instead, the urban environment limited plant biomass per se, thereby mitigating the scope of a positive predator effect. Our results show that urbanization can influence direct and indirect trophic interactions through effects on biotic top-down forces and on plant growth. In order to understand how urbanization affects biodiversity and ecosystem functioning, it is fundamental to not only consider species assemblages, but also species interactions.

  5. Tris(bis(trimethylsilyl)amido)uranium: Compounds with tri-, tetra-, and penta-valent uranium

    SciTech Connect

    Stewart, J.L.


    This trivalent uranium compound, serves as a precursor to new tri-, tetra-, and penta-valent uranium species. The geometry about the U atom is pyramidal. Lewis-base coordination compounds of U(N(SiMe/sub 3/)/sub 2/)/sub 3/ with a one-to-one- ratio of Lewis base to uranium were isolated with pyridine, 4-dimethylamino-pyridine, 2,6-Me/sub 2/-C/sub 6/H/sub 3/NC, and TPO. Two-to-one coordination compounds were obtained with t-butylnitrile and t-butylisocyanide. Compounds with more sterically demanding bases could not be isolated. The expected decrease in U-N(SiMe/sub 3/)/sub 2/ bond length with increase in oxidation state is not observed. Reaction of ClU(N(SiMe/sub 3/)/sub 2/)/sub 3/and Li(NH(p-tolyl)) yields the uranium (IV) dimer, U/sub 2/(N(SiMe/sub 3/)/sub 2/)/sub 4/( 2/. Reaction with 2,4,6-triemethylaniline produces a dimer. Analogous substitution products could not be obtained with aniline or p-toluidine. t-Bu/sub 3/CO/sup /minus//, t-Bu/sub 2/CHO/sup /minus//, and t-Bu/sub 3/SiO/sup /minus// are used to synthesize new tetravalent, mononuclear uranium compounds. Reaction of ClU(tritox)/sub 3/ with alkyllithium reagents leads to isolation of RU(tritox)/sub 3/. The reaction of U(ditox)/sub 4/ with MeLi affords the addition product U(ditox)/sub 4/(Me)Li, whose crystal structure is described. Preparation of uranium silox compounds is reported. 97 refs., 26 figs., 39 tabs.

  6. An Experimental Investigation of Reactivity to Ecological Momentary Assessment Frequency among Adults Trying to Quit Smoking

    PubMed Central

    Minami, Haruka; Yeh, Vivian M.; Bold, Krysten W.


    Aims Ecological Momentary Assessment (EMA) captures real-time reports in subjects’ natural environments. This experiment manipulated EMA frequency to estimate effects on abstinence and peri-cessation subjective experiences. Design In this randomized trial, subjects had an equal chance of being assigned to low-frequency (once) or high-frequency (6 times) daily EMA for 4 weeks (1 week pre- and 3 weeks post-cessation). Participants completed 6 office visits over 5 weeks and 6- and 12-week follow-up telephone interviews. Setting Community participants were recruited from central New Jersey, USA. Participants 110 adult daily smokers seeking to quit smoking were included in intent-to-treat analyses of tobacco abstinence; 94 were available for secondary analyses of peri-cessation subjective ratings. Measurements Primary outcomes were cessation (abstaining at least 24 hours within 2 weeks of attempting to quit) and prolonged abstinence (no relapse between weeks 2 and 12 post-quit). Secondary outcomes were mean levels and growth in ratings of cigarette craving, affect, and quitting motivation and self-efficacy. Findings EMA frequency was unrelated to cessation (Odds Ratio=1.37, 95% CI=0.60–3.10) or prolonged abstinence (Odds Ratio=1.04, 95% CI=0.45–2.39) in intent-to-treat analyses. High-frequency EMA was associated with lower craving (B=−.54, SE=.18, p=.004, anxiety (B=−.42, SE=.17, p=.015), anger (B=−.47, SE=.14, p=.001), hunger (B=−.39, SE=.17, p=0.25), and positive affect (B=−.43, SE=.20, p=.03). Conclusions In smokers trying to quit, more frequent ecological momentary assessment (EMA) self-monitoring results in lower craving, anxiety, anger, hunger, and positive affect. It is not clear whether this translates into higher rates of smoking abstinence. PMID:26011583

  7. Reliability and Validity of Measures of Impulsive Choice and Impulsive Action in Smokers Trying to Quit

    PubMed Central

    McCarthy, Danielle E.; Bold, Krysten W.; Minami, Haruka; Yeh, Vivian M.; Rutten, Emily; Nadkarni, Shruti G.; Chapman, Gretchen B.


    Cross-sectional research suggests that smokers are more impulsive than are non-smokers, but few studies have examined relations between impulsiveness and later success in quitting smoking. The purpose of this study was to investigate the reliability and predictive validity of facets of impulsiveness in adult smokers trying to quit. Baseline behavioral measures of impulsive choice (assessed with a delay discounting task) and impulsive action (assessed with a measure of behavioral disinhibition) were used as predictors of smoking cessation success over 12 weeks. The sample included 116 adult (18 years old or older) daily smokers from central New Jersey. Impulsive choice, impulsive action, and self-reported impulsiveness were not significantly related to one another at baseline. Impulsive choice had high test-retest reliability from pre- to post-quit, whereas impulsive action was less stable. Test-retest reliability from pre-quit to three weeks post-quit was moderated by achievement of seven-day abstinence. Baseline impulsive action was significantly negatively related to quitting for at least one day in the first two weeks of a quit attempt and of prolonged abstinence (no relapse over the next 10 weeks). Baseline impulsive choice was robustly associated with biochemically verified seven-day point-prevalence abstinence 12 weeks post-quit, such that those with lower delay discounting were more likely to achieve abstinence. Facets of impulsiveness appear to function largely independently in adult smokers, as indicated by their lack of inter-correlation, differential stability, and differential relations with abstinence. Impulsive action may impede initial quitting, whereas impulsive choice may be an obstacle to maintaining lasting abstinence. PMID:26751623

  8. Vapor phase tri-methyl-indium seeding system suitable for high temperature spectroscopy and thermometry

    NASA Astrophysics Data System (ADS)

    Whiddon, R.; Zhou, B.; Borggren, J.; Aldén, M.; Li, Z. S.


    Tri-methyl-indium (TMI) is used as an indium transport molecule to introduce indium atoms to reactive hot gas flows/combustion environments for spectroscopic diagnostics. A seeding system was constructed to allow the addition of an inert TMI laden carrier gas into an air/fuel mixture burning consequently on a burner. The amount of the seeded TMI in the carrier gas can be readily varied by controlling the vapor pressure through the temperature of the container. The seeding process was calibrated using the fluorescent emission intensity from the indium 62S1/2 → 52P1/2 and 62S1/2 → 52P3/2 transitions as a function of the calculated TMI seeding concentration over a range of 2-45 ppm. The response was found to be linear over the range 3-22.5 ppm; at concentrations above 25 ppm there is a loss of linearity attributable to self-absorption or loss of saturation of TMI vapor pressure in the carrier gas flow. When TMI was introduced into a post-combustion environment via an inert carrier gas, molecular transition from InH and InOH radicals were observed in the flame emission spectrum. Combined laser-induced fluorescence and absorption spectroscopy were applied to detect indium atoms in the TMI seeded flame and the measured atomic indium concentration was found to be at the ppm level. This method of seeding organometallic vapor like TMI to a reactive gas flow demonstrates the feasibility for quantitative spectroscopic investigations that may be applicable in various fields, e.g., chemical vapor deposition applications or temperature measurement in flames with two-line atomic fluorescence.

  9. Vapor phase tri-methyl-indium seeding system suitable for high temperature spectroscopy and thermometry.


    Whiddon, R; Zhou, B; Borggren, J; Aldén, M; Li, Z S


    Tri-methyl-indium (TMI) is used as an indium transport molecule to introduce indium atoms to reactive hot gas flows/combustion environments for spectroscopic diagnostics. A seeding system was constructed to allow the addition of an inert TMI laden carrier gas into an air/fuel mixture burning consequently on a burner. The amount of the seeded TMI in the carrier gas can be readily varied by controlling the vapor pressure through the temperature of the container. The seeding process was calibrated using the fluorescent emission intensity from the indium 6(2)S1/2 → 5(2)P1/2 and 6(2)S1/2 → 5(2)P3/2 transitions as a function of the calculated TMI seeding concentration over a range of 2-45 ppm. The response was found to be linear over the range 3-22.5 ppm; at concentrations above 25 ppm there is a loss of linearity attributable to self-absorption or loss of saturation of TMI vapor pressure in the carrier gas flow. When TMI was introduced into a post-combustion environment via an inert carrier gas, molecular transition from InH and InOH radicals were observed in the flame emission spectrum. Combined laser-induced fluorescence and absorption spectroscopy were applied to detect indium atoms in the TMI seeded flame and the measured atomic indium concentration was found to be at the ppm level. This method of seeding organometallic vapor like TMI to a reactive gas flow demonstrates the feasibility for quantitative spectroscopic investigations that may be applicable in various fields, e.g., chemical vapor deposition applications or temperature measurement in flames with two-line atomic fluorescence. PMID:26429429

  10. Bioaerosols on Tri-city (Gdańsk-Sopot-Gdynia) beaches.


    Michalska, Małgorzata; Bartoszewicz, Maria; Cieszyńska, Monika; Nowacki, Jacek


    Bioaerosol formation is an important process of mass and energy exchange between the sea and the atmosphere by means of droplets of marine dust. Studies of marine aerosol activity developed in the last decades of the 20th century. Those studies revealed that concentrations of bacteria in aerosol droplets were hundreds of times higher than were those measured in superficial marine waters. Moreover, it was determined that aerosol activity at sea can influence the sanitary condition of the air, especially in seaside areas. Examinations of air composition in coastal regions were performed on the beaches of the Tri-city, Sobieszewo, and Komary. Airborne microorganisms were also investigated in the marine zone at the Vistula river mouth. The air samples were collected by a filtration method using Sartorius apparatus. The exposed filters were then placed onto agar media in Petri dishes and incubated. All measurements are expressed in CFU/m3, i.e. colony forming units per cubic metre of examined air. Meteorological parameters such as temperature, humidity, and wind speed and direction were also measured. The obtained results revealed statistically significant trends between the total number of bacteria and fungal spores, and the sampling season. The greatest number of microorganisms was noted in spring and autumn. Correlation analysis showed that a statistically significant relationship exists between the microbial abundance and the wind direction, wind speed, and the sampling site location. The maximum number of fungal spores was detected in the areas of Gdynia and Gdansk Brzeźno when south-west winds were blowing from the land. The highest number of bacteria was observed at the sampling stations located closest to the Vistula river mouth (Sobieszewo and Komary). PMID:20496328

  11. Effects of metal surface grinding at the porcelain try-in stage of fixed dental prostheses

    PubMed Central

    Kesim, Bülent; Gümüş, Hasan Önder; Dinçel, Mehmet; Erkaya, Selçuk


    PURPOSE This study was to evaluate the effect of grinding of the inner metal surface during the porcelain try-in stage on metal-porcelain bonding considering the maximum temperature and the vibration of samples. MATERIALS AND METHODS Ninety-one square prism-shaped (1 × 1 × 1.5 mm) nickel-chrome cast frameworks 0.3 mm thick were prepared. Porcelain was applied on two opposite outer axial surfaces of the frameworks. The grinding was performed from the opposite axial sides of the inner metal surfaces with a low-speed handpiece with two types of burs (diamond, tungsten-carbide) under three grinding forces (3.5 N, 7 N, 14 N) and at two durations (5 seconds, 10 seconds). The shear bond strength (SBS) test was performed with universal testing machine. Statistical analyzes were performed at 5% significance level. RESULTS The samples subjected to grinding under 3.5 N showed higher SBS values than those exposed to grinding under 7 N and 14 N (P<.05). SBS values of none of the groups differed from those of the control group (P>.05). The types of bur (P=.965) and the duration (P=.679) did not affect the SBS values. On the other hand, type of bur, force applied, and duration of the grinding affected the maximum temperatures of the samples, whereas the maximum vibration was affected only by the type of bur (P<.05). CONCLUSION Grinding the inner metal surface did not affect the metal-porcelain bond strength. Although the grinding affected the maximum temperature and the vibration values of the samples, these did not influence the bonding strength. PMID:25177476

  12. Assessing head and trunk symmetry during sleep using tri-axial accelerometers.


    Sato, Haruhiko; Ikura, Daiki; Tsunoda, Masahiro


    Using two types of small, lightweight tri-axial accelerometers, we obtained evidence for the effectiveness of an approach for assessing head-trunk symmetrical or asymmetrical positions during sleep. First, we assessed the accuracy of our monitoring system in five healthy young adults (age range, 22-24 years). The participants wore acceleration monitors on the sternum and forehead; then spent 5 min in six different positions. Once accuracy was confirmed, we assessed head-trunk symmetry during night-time sleep in 10 healthy children (age range, 3-13 years) and 10 young adults (age range, 21-26 years) in their home environments. All participants wore the monitors during one night's sleep in their homes. After computing head-trunk positions using the orientation data obtained by the accelerometers, head and trunk symmetry were evaluated. The head and trunk positions were correctly detected: the positional data from the trunk had 99% agreement, and the data from the head had 96% agreement. Both the young adults and children were observed to spend time with the head-trunk in asymmetric positions; however, the subjects changed position frequently so the asymmetrical postures were mobile. We concluded that the proposed monitoring system is a reliable and valid approach for assessing head-trunk symmetry during sleep at home. Implications for Rehabilitation We propose a head and trunk symmetry monitoring system using accelerometers. The proposed system could accurately identify head and trunk position. Asymmetrical positioning was seen in healthy participants but it was not immobile.

  13. Tri-Trophic Insecticidal Effects of African Plants against Cabbage Pests

    PubMed Central

    Amoabeng, Blankson W.; Gurr, Geoff M.; Gitau, Catherine W.; Nicol, Helen I.; Stevenson, Phil C.


    -available Ghanaian plants give beneficial, tri-trophic benefits and merit further research as an inexpensive plant protection strategy for smallholder farmers in West Africa. PMID:24205287

  14. Effects of urbanization on direct and indirect interactions in a tri-trophic system.


    Tabea, Turrini; Dirk, Sanders; Eva, Knop


    While effects of urbanization on species assemblages are receiving increasing attention, effects on ecological interactions remain largely unexplored. We investigated how urbanization influences the strength of direct and indirect trophic interactions in a tri- trophic system. In a field experiment including five cities and nearby farmed areas, we used potted Vicia faba plants and manipulated the presence of Megoura viciae aphids and that of naturally occurring aphid predators. When predators could access aphids, they reduced their abundance less in the urban than in the agricultural ecosystem. Compared to aphid abundance on plants without predator access, abundance on plants with predator access was 2.58 times lower in urban and 5.27 times lower in agricultural areas. This indicates that urbanization limited top-down control of aphids by predators. In both ecosystems, plant biomass was negatively affected by herbivores and positively affected by predators, but the positive indirect predator effect was weaker in cities. Compared to aphid-infested plants without predator access, plants with predator access were 1.89 times heavier in urban and 2.12 times heavier in agricultural areas. Surprisingly, differences between ecosystems regarding the indirect predator effect on plants were not explained by the differentially strong herbivore suppression. Instead, the urban environment limited plant biomass per se, thereby mitigating the scope of a positive predator effect. Our results show that urbanization can influence direct and indirect trophic interactions through effects on biotic top-down forces and on plant growth. In order to understand how urbanization affects biodiversity and ecosystem functioning, it is fundamental to not only consider species assemblages, but also species interactions. PMID:27411241

  15. Vapor phase tri-methyl-indium seeding system suitable for high temperature spectroscopy and thermometry

    SciTech Connect

    Whiddon, R.; Zhou, B.; Borggren, J.; Aldén, M.; Li, Z. S.


    Tri-methyl-indium (TMI) is used as an indium transport molecule to introduce indium atoms to reactive hot gas flows/combustion environments for spectroscopic diagnostics. A seeding system was constructed to allow the addition of an inert TMI laden carrier gas into an air/fuel mixture burning consequently on a burner. The amount of the seeded TMI in the carrier gas can be readily varied by controlling the vapor pressure through the temperature of the container. The seeding process was calibrated using the fluorescent emission intensity from the indium 6{sup 2}S{sub 1/2} → 5{sup 2}P{sub 1/2} and 6{sup 2}S{sub 1/2} → 5{sup 2}P{sub 3/2} transitions as a function of the calculated TMI seeding concentration over a range of 2–45 ppm. The response was found to be linear over the range 3–22.5 ppm; at concentrations above 25 ppm there is a loss of linearity attributable to self-absorption or loss of saturation of TMI vapor pressure in the carrier gas flow. When TMI was introduced into a post-combustion environment via an inert carrier gas, molecular transition from InH and InOH radicals were observed in the flame emission spectrum. Combined laser-induced fluorescence and absorption spectroscopy were applied to detect indium atoms in the TMI seeded flame and the measured atomic indium concentration was found to be at the ppm level. This method of seeding organometallic vapor like TMI to a reactive gas flow demonstrates the feasibility for quantitative spectroscopic investigations that may be applicable in various fields, e.g., chemical vapor deposition applications or temperature measurement in flames with two-line atomic fluorescence.

  16. Subcutaneous tri-block copolymer produces recovery from spinal cord injury.


    Borgens, Richard B; Bohnert, Debbie; Duerstock, Brad; Spomar, Daniel; Lee, Raphael C


    We have studied the ability of nonionic detergents and hydrophilic polymers to seal permeabilized membranes of damaged cells, rescuing them from progressive dissolution, degeneration, and death. We report that a single subcutaneous injection of the tri-block copolymer, Poloxamer 188 (P188) 6 hr after a severe compression of the adult guinea pig spinal cord is able to: (1). preserve the anatomic integrity of the cord; (2). produce a rapid recovery of nerve impulse conduction through the lesion; and (3). produce a behavioral recovery of a spinal cord dependent long tract spinal cord reflex. These observations stood out against a control group in blinded evaluation. Conduction through the lesion was monitored by stimulating the tibial nerve of the hind limb, and measuring the arrival of evoked potentials at the contralateral sensory cortex of the brain (somatosensory evoked potentials; SSEP). Behavioral recovery was determined by a return of sensitivity of formerly areflexic receptive fields of the cutaneous trunchi muscle (CTM) reflex. This contraction of back skin in response to tactile stimulation is totally dependent on the integrity of an identified bilateral column of ascending long tract axons. A statistically significant recovery of both SSEP conduction through the lesion and the CTM reflex occurred in P188-treated animals compared to vehicle-treated controls. Quantitative 3D computer reconstruction of the lesioned vertebral segment of spinal cord revealed a statistically significant sparing of spinal cord parenchyma and a significant reduction in cavitation of the spinal cord compared to control animals We determined that the proportion of P188-treated animals that recovered evoked potentials were nearly identical to that produced by a subcutaneous injection of polyethylene glycol (PEG). In contrast, P188 was not as effective as PEG in producing a recovery of CTM functioning. We discuss the likely differences in the mechanisms of action of these two polymers

  17. Transport of chromium(VI) through a supported liquid membrane containing tri-n-octylphosphine oxide

    SciTech Connect

    Huang, T.C.; Huang, C.C.; Chen, D.H.


    In this study the transport of chromium(VI) from aqueous solutions of pH 2--4 through a supported liquid membrane (SLM) with tri-n-octylphosphine oxide (TOPO) dissolved in kerosene as a mobile carrier was investigated. The transport flux of Cr(VI) increased with an increase in the concentrations of Cr(VI) in the feed phase and of TOPO in the membrane phase, but with a decrease in pH of the feed phase. Considering the equilibria of various Cr(VI) species in the aqueous phase and of the Cr(VI)-TOPO complexes formed in the membrane phase, a permeation model including the aqueous film diffusion of HCrO{sub 4}{sup {minus}} and Cr{sub 2}O{sub 7}{sup 2{minus}} toward the membrane, the interfacial chemical reaction between them and TOPO, and the membrane diffusion of the Cr(VI)-TOPO complexes ({ovr H{sub 2}CrO{sub 4}{center_dot}(TOPO)} and {ovr H{sub 2}Cr{sub 2}O{sub 7}{center_dot}(TOPO){sub 3}}) was proposed to describe the transport of Cr(VI) through the SLM. By best fitting the transport flux equations of Cr(VI) with the experimental data using the Rosenbrock method, the apparent mass-transfer coefficients of HCrO{sub 4}{sup {minus}} and Cr{sub 2}O{sub 7}{sup 2{minus}} across the aqueous film, and those of {ovr H{sub 2}CrO{sub 4}{center_dot}(TOPO)} and {ovr H{sub 2}Cr{sub 2}O{sub 7}{center_dot}(TOPO){sub 3}} across the membrane phase, were obtained. This work helps to clarify the transport mechanism of Cr(VI) through an SLM.

  18. Photodissociation spectroscopy of the complexes of Mg+ with di- and tri-ethylamine

    NASA Astrophysics Data System (ADS)

    Guo, Wenyue; Liu, Haichuan; Yang, Shihe


    We present the photodissociation spectroscopy of the complexes of Mg+ with di- and tri-ethylamine in the spectral range of 230-440 nm. Mass spectrometry of the two parent complexes exhibits the persistent product Mg+ from nonreactive quenching throughout the whole wavelength range. As for the reactive channels, C3H7•-elimination products are dominant when the complexes are excited to 3Px,y. Furthermore, photoexcitation of Mg+-NH(C2H5)2 to 3Px,y yields a minor MgH-elimination fragment. On the other hand, photodissociation of Mg+-N(C2H5)3 produces charge-transfer fragments N+(C2H5)3 and (C2H5)2N+CH2. The action spectra of the two complexes consist of two pronounced peaks on the red and blue side of the Mg+ 3 2P←3 2S atomic transition. The calculated absorption spectra of the two complexes using the optimized structures of their ground states agree nicely with the observed action spectra. Photofragment branching fractions of the products are shown to be nearly independent of the photon energy for the 3Px,y excitation, indicating the importance of exit channel effects. A photoreaction mechanism is proposed for C3H7•-elimination, which entails Mg+ insertion into one C-N bond, followed by a nonadiabatic transition to the ground-state surface through a conical intersection. However, for the MgH-elimination channel in the photodissociation of Mg+-NH(C2H5)2, Mg+ rather inserts into the α-C-H bond. Finally, photoexcitation of Mg+-N(C2H5)3 leads to a prominent charge-transfer product [N+(C2H5)3]*, which dissociates further to (C2H5)2N+CH2 by a loss of CH3•.

  19. In-shoe plantar tri-axial stress profiles during maximum-effort cutting maneuvers.


    Cong, Yan; Lam, Wing Kai; Cheung, Jason Tak-Man; Zhang, Ming


    Soft tissue injuries, such as anterior cruciate ligament rupture, ankle sprain and foot skin problems, frequently occur during cutting maneuvers. These injuries are often regarded as associated with abnormal joint torque and interfacial friction caused by excessive external and in-shoe shear forces. This study simultaneously investigated the dynamic in-shoe localized plantar pressure and shear stress during lateral shuffling and 45° sidestep cutting maneuvers. Tri-axial force transducers were affixed at the first and second metatarsal heads, lateral forefoot, and heel regions in the midsole of a basketball shoe. Seventeen basketball players executed both cutting maneuvers with maximum efforts. Lateral shuffling cutting had a larger mediolateral braking force than 45° sidestep cutting. This large braking force was concentrated at the first metatarsal head, as indicated by its maximum medial shear stress (312.2 ± 157.0 kPa). During propulsion phase, peak shear stress occurred at the second metatarsal head (271.3 ± 124.3 kPa). Compared with lateral shuffling cutting, 45° sidestep cutting produced larger peak propulsion shear stress (463.0 ± 272.6 kPa) but smaller peak braking shear stress (184.8 ± 181.7 kPa), of which both were found at the first metatarsal head. During both cutting maneuvers, maximum medial and posterior shear stress occurred at the first metatarsal head, whereas maximum pressure occurred at the second metatarsal head. The first and second metatarsal heads sustained relatively high pressure and shear stress and were expected to be susceptible to plantar tissue discomfort or injury. Due to different stress distribution, distinct pressure and shear cushioning mechanisms in basketball footwear might be considered over different foot regions.

  20. Synthesis, Structure, and Reactivity ofbis(1,2,4-tri-t-butylcyclopentadienyl) Complexes of Cerium

    SciTech Connect

    Werkema, Evan L.


    The sterically demanding 1,2,4-tri-t-butylcyclopentadienylligand (1,2,4-(Me3C)3C5H2, hereafter Cp') has been used to preparemonomeric cerium metallocenes, Cp 2CeX (X = Cl, I, OSO2CF3), which areused to synthesize the benzyl, Cp'2CeCH2C6H5. The benzyl is a usefulstarting material for preparing other complexes in the Cp'2CeZ system (Z= BF4, F, NH2, C6H5, H). X-ray crystal structures of Cp'2CeOSO2CF3,Cp'2CeF, Cp'2CeCH2C6H5, and Cp'2CeH are presented. The benzyl slowlydecomposes in solution to toluene and a metallacycle,[Cp'][(Me3C)2C5H2(CMe2CH2)]Ce. The ring CMe3 groups of both themetallacycle and the hydride, Cp'2CeH, can be fully deuterated byprolonged exposure to C6D6, providing a useful labeling tool inmechanistic studies.The hydride activates C-F and/or C-H bonds influorobenzenes, C6HxF6-x , x = 0-5. The reactions are selective, with theselectivity depending on the presence of two fluorines ortho to thereaction site more than on the type of bond activated. Complexes of thetype Cp'2CeC6HxF5-x , x = 0-4, are formed as intermediates, which slowlydecompose in solution to Cp'2CeF and fluorobenzynes, C6HxF4-x, x = 0-4,which are trapped. The rate at which Cp'2CeC6HxF5-x complexes decomposeincreases as the number of fluorines decreases. Complexes with oneortho-fluorine decompose much faster than those with two ortho-fluorines.The metallacycle activates only C-H bonds in fluorobenzenes, permittingthe synthesis of specific Cp'2

  1. New enhanced artificial bee colony (JA-ABC5) algorithm with application for reactive power optimization.


    Sulaiman, Noorazliza; Mohamad-Saleh, Junita; Abro, Abdul Ghani


    The standard artificial bee colony (ABC) algorithm involves exploration and exploitation processes which need to be balanced for enhanced performance. This paper proposes a new modified ABC algorithm named JA-ABC5 to enhance convergence speed and improve the ability to reach the global optimum by balancing exploration and exploitation processes. New stages have been proposed at the earlier stages of the algorithm to increase the exploitation process. Besides that, modified mutation equations have also been introduced in the employed and onlooker-bees phases to balance the two processes. The performance of JA-ABC5 has been analyzed on 27 commonly used benchmark functions and tested to optimize the reactive power optimization problem. The performance results have clearly shown that the newly proposed algorithm has outperformed other compared algorithms in terms of convergence speed and global optimum achievement.

  2. Physiological impacts of ABA-JA interactions under water-limitation.


    de Ollas, Carlos; Dodd, Ian C


    Plant responses to drought stress depend on highly regulated signal transduction pathways with multiple interactions. This complex crosstalk can lead to a physiological outcome of drought avoidance or tolerance/resistance. ABA is the principal mediator of these responses due to the regulation of stomatal closure that determines plant growth and survival, but also other strategies of drought resistance such as osmotic adjustment. However, other hormones such as JA seem responsible for regulating a subset of plant responses to drought by regulating ABA biosynthesis and accumulation and ABA-dependent signalling, but also by ABA independent pathways. Here, we review recent reports of ABA-JA hormonal and molecular interactions within a physiological framework of drought tolerance. Understanding the physiological significance of this complex regulation offers opportunities to find strategies of drought tolerance that avoid unwanted side effects that limit growth and yield, and may allow biotechnological crop improvement. PMID:27299601

  3. A self-adaptive genetic algorithm to estimate JA model parameters considering minor loops

    NASA Astrophysics Data System (ADS)

    Lu, Hai-liang; Wen, Xi-shan; Lan, Lei; An, Yun-zhu; Li, Xiao-ping


    A self-adaptive genetic algorithm for estimating Jiles-Atherton (JA) magnetic hysteresis model parameters is presented. The fitness function is established based on the distances between equidistant key points of normalized hysteresis loops. Linearity function and logarithm function are both adopted to code the five parameters of JA model. Roulette wheel selection is used and the selection pressure is adjusted adaptively by deducting a proportional which depends on current generation common value. The Crossover operator is established by combining arithmetic crossover and multipoint crossover. Nonuniform mutation is improved by adjusting the mutation ratio adaptively. The algorithm is used to estimate the parameters of one kind of silicon-steel sheet's hysteresis loops, and the results are in good agreement with published data.

  4. Physiological impacts of ABA-JA interactions under water-limitation.


    de Ollas, Carlos; Dodd, Ian C


    Plant responses to drought stress depend on highly regulated signal transduction pathways with multiple interactions. This complex crosstalk can lead to a physiological outcome of drought avoidance or tolerance/resistance. ABA is the principal mediator of these responses due to the regulation of stomatal closure that determines plant growth and survival, but also other strategies of drought resistance such as osmotic adjustment. However, other hormones such as JA seem responsible for regulating a subset of plant responses to drought by regulating ABA biosynthesis and accumulation and ABA-dependent signalling, but also by ABA independent pathways. Here, we review recent reports of ABA-JA hormonal and molecular interactions within a physiological framework of drought tolerance. Understanding the physiological significance of this complex regulation offers opportunities to find strategies of drought tolerance that avoid unwanted side effects that limit growth and yield, and may allow biotechnological crop improvement.

  5. New Enhanced Artificial Bee Colony (JA-ABC5) Algorithm with Application for Reactive Power Optimization

    PubMed Central


    The standard artificial bee colony (ABC) algorithm involves exploration and exploitation processes which need to be balanced for enhanced performance. This paper proposes a new modified ABC algorithm named JA-ABC5 to enhance convergence speed and improve the ability to reach the global optimum by balancing exploration and exploitation processes. New stages have been proposed at the earlier stages of the algorithm to increase the exploitation process. Besides that, modified mutation equations have also been introduced in the employed and onlooker-bees phases to balance the two processes. The performance of JA-ABC5 has been analyzed on 27 commonly used benchmark functions and tested to optimize the reactive power optimization problem. The performance results have clearly shown that the newly proposed algorithm has outperformed other compared algorithms in terms of convergence speed and global optimum achievement. PMID:25879054

  6. Tri-Axial Accelerometry and Heart Rate Telemetry: Relation and Agreement with Behavioral Observation in Elementary Physical Education

    ERIC Educational Resources Information Center

    Scruggs, Philip W.; Beveridge, Sandy K.; Clocksin, Brian D.


    The relation and agreement of tri-axial accelerometry and heart rate telemetry in measuring moderate to vigorous physical activity were examined in association to behavioral observation during 1st- and 2nd-grade physical education. In Study 1, physical activity measures of heart rate and behavioral observation were collected on 346 participants…

  7. What Lies beyond the Bubble? Trying out One of the Stanford History Education Group's New History Assessments

    ERIC Educational Resources Information Center

    Gerwin, David


    Trying out a "Beyond the Bubble" assessment in a social studies methods classroom revealed that the assessment worked much better than any multiple choice item while retaining great ease in marking. However, as discussion of the item showed, the rubrics for the item apply the "sourcing" heuristic so literally that it loses some…

  8. A spliceosome intermediate with loosely associated tri-snRNP accumulates in the absence of Prp28 ATPase activity

    PubMed Central

    Boesler, Carsten; Rigo, Norbert; Anokhina, Maria M.; Tauchert, Marcel J.; Agafonov, Dmitry E.; Kastner, Berthold; Urlaub, Henning; Ficner, Ralf; Will, Cindy L.; Lührmann, Reinhard


    The precise role of the spliceosomal DEAD-box protein Prp28 in higher eukaryotes remains unclear. We show that stable tri-snRNP association during pre-catalytic spliceosomal B complex formation is blocked by a dominant-negative hPrp28 mutant lacking ATPase activity. Complexes formed in the presence of ATPase-deficient hPrp28 represent a novel assembly intermediate, the pre-B complex, that contains U1, U2 and loosely associated tri-snRNP and is stalled before disruption of the U1/5′ss base pairing interaction, consistent with a role for hPrp28 in the latter. Pre-B and B complexes differ structurally, indicating that stable tri-snRNP integration is accompanied by substantial rearrangements in the spliceosome. Disruption of the U1/5′ss interaction alone is not sufficient to bypass the block by ATPase-deficient hPrp28, suggesting hPrp28 has an additional function at this stage of splicing. Our data provide new insights into the function of Prp28 in higher eukaryotes, and the requirements for stable tri-snRNP binding during B complex formation. PMID:27377154

  9. 78 FR 76852 - Notice of Intent To Prepare a Supplement to the Tri-County Draft Resource Management Plan and...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...In compliance with the National Environmental Policy Act of 1969 (NEPA), as amended, and the Federal Land Policy and Management Act of 1976 (FLPMA), as amended, the Bureau of Land Management (BLM) Las Cruces District Office, Las Cruces, New Mexico, intends to prepare a Supplement to the Tri-County Draft Resource Management Plan (RMP) and Draft Environmental Impact Statement (EIS), and by this......

  10. Palisade Russet and Teton Russet: Two New Potato Cultivars from the Northwest (Tri-State) Potato Variety Development Program

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The Tri-State Potato Variety Development Program released two potato cultivars in 2011: Palisade Russet and Teton Russet. Palisade Russet (PR) is notable for having resistance to foliar and tuber late blight. PR is also resistant to Verticillium wilt, black dot, and pink rot, and has a moderate re...

  11. Synthesis and Ligand-Exchange Reactions of a Tri-Tungsten Cluster with Applications in Biomedical Imaging

    ERIC Educational Resources Information Center

    Noey, Elizabeth; Curtis, Jeff C.; Tam, Sylvia; Pham, David M.; Jones, Ella F.


    In this experiment students are exposed to concepts in inorganic synthesis and various spectroscopies as applied to a tri-tungsten cluster with applications in biomedical imaging. The tungsten-acetate cluster, Na[W[superscript 3](mu-O)[subscript 2](CH[superscript 3]COO)[superscript 9

  12. 40 CFR 49.22 - Federal implementation plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2013 CFR


    ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 49.22 Section 49.22 Protection of Environment... MANAGEMENT Tribal Authority § 49.22 Federal implementation plan for Tri-Cities landfill, Salt River Pima... located on the Reservation of the Salt River Pima Maricopa Indian Community (SRPMIC) in Arizona,...

  13. 40 CFR 49.22 - Federal implementation plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2014 CFR


    ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 49.22 Section 49.22 Protection of Environment... MANAGEMENT Tribal Authority § 49.22 Federal implementation plan for Tri-Cities landfill, Salt River Pima... located on the Reservation of the Salt River Pima Maricopa Indian Community (SRPMIC) in Arizona,...

  14. 40 CFR 49.22 - Federal implementation plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2012 CFR


    ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 49.22 Section 49.22 Protection of Environment... MANAGEMENT Tribal Authority § 49.22 Federal implementation plan for Tri-Cities landfill, Salt River Pima... operator of the project located on the Reservation of the Salt River Pima Maricopa Indian Community...

  15. triADD: The Risk for Alcohol Abuse, Depression, and Diabetes Multimorbidity in the American Indian and Alaska Native Population

    ERIC Educational Resources Information Center

    Tann, Sheila S.; Yabiku, Scott T.; Okamoto, Scott K.; Yanow, Jessica


    This study examined the risk for alcoholism, diabetes, and depression (triADD) in American Indian/Alaska Native (AI/AN) populations in the U.S. Using the Behavioral Risk Factor Surveillance System, a series of descriptive statistics and regression models were used to examine the interrelationships among these disorders in AI/AN populations.…

  16. Opportunities in the Classroom or Cafeteria for a "Tasting Challenge" to Influence First Grade Students' Willingness to Try New Foods

    ERIC Educational Resources Information Center

    Bellows, Laura L.; Conlon, Tara; Cunningham-Sabo, Leslie; Johnson, Susan L.


    Purpose/Objective: To develop and implement a "Tasting Challenge" activity that is feasible for schools to influence and measure the willingness of elementary students to try new foods. Methods: The Tasting Challenge was as part of a classroom activity. Children were individually offered jicama and edamame to taste and rate (yummy, ok,…

  17. Piloting a Cooperative Extension Service Nutrition Education Program on First-Grade Children's Willingness to Try Foods Containing Legumes

    ERIC Educational Resources Information Center

    Edwards, Cassandra S.; Hermann, Janice R.


    Many nutrition education campaigns targeting children in the United States focus on increasing fruit and vegetable consumption, but most don't specifically promote legumes. The project described here sought to pilot the effect of an Extension nutrition education program on first grade children's willingness to try foods containing legumes. A…

  18. Large-eddy simulation of turbulent flow past tri-frame configurations of hydrokinetic turbines in an open channel

    NASA Astrophysics Data System (ADS)

    Chawdhary, Saurabh; Yang, Xiaolei; Hill, Craig; Guala, Michele; Sotiropoulos, Fotis


    An effective way to develop arrays of hydrokinetic turbines in streams and tidal sites is to arrange them in tri-frame configurations, where three turbines are mounted together at the apexes of a triangular frame. Turbines mounted on a tri-frame can serve as the building block for rapidly deploying multi-turbine arrays. We employ large-eddy simulation (LES) to understand wake interactions of turbines mounted on tri-frame configurations and develop design guidelines for field deployment. We employ the computational framework of Yang et al. (2013) to simulate the flow past turbines with the turbines modeled as actuator lines. The computed results are compared with experiments conducted at the Saint Anthony Falls Lab (SAFL) in terms of mean flow and turbulence characteristics. The flow fields are analyzed to elucidate the mechanisms of turbine interactions and wake evolution in tri-frame configurations and to develop design guidelines for maximizing the combined power output while reducing structural loads due to turbulent fluctuations. This work was supported by NSF grant IIP-1318201. The simulations were carried out at the Minnesota Supercomputing Institute.

  19. Arabidopsis TTG2 Regulates TRY Expression through Enhancement of Activator Complex-Triggered Activation[C][W

    PubMed Central

    Pesch, Martina; Dartan, Burcu; Birkenbihl, Rainer; Somssich, Imre E.; Hülskamp, Martin


    Trichome patterning in Arabidopsis thaliana is regulated by a regulatory feedback loop of the trichome promoting factors TRANSPARENT TESTA GLABRA1 (TTG1), GLABRA3 (GL3)/ENHANCER OF GL3 (EGL3), and GL1 and a group of homologous R3MYB proteins that act as their inhibitors. Together, they regulate the temporal and spatial expression of GL2 and TTG2, which are considered to control trichome cell differentiation. In this work, we show that TTG2 is a specific activator of TRY (but not CPC or GL2). The WRKY protein TTG2 binds to W-boxes in a minimal promoter fragment of TRY, and these W-boxes are essential for rescue of the try mutant phenotype. We further show that TTG2 alone is not able to activate TRY expression, but rather drastically enhances the activation by TTG1 and GL3. As TTG2 physically interacts with TTG1 and because TTG2 can associate with GL3 through its interaction with TTG1, we propose that TTG2 enhances the activity of TTG1 and GL3 by forming a protein complex. PMID:25304203

  20. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2013 CFR


    ... is codified at 40 CFR 49.22. ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River...

  1. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2014 CFR


    ... is codified at 40 CFR 49.22. ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River...

  2. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2010 CFR


    ... is codified at 40 CFR 49.22. ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River...

  3. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2011 CFR


    ... is codified at 40 CFR 49.22. ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River...

  4. 40 CFR 52.142 - Federal Implementation Plan for Tri-Cities landfill, Salt River Pima-Maricopa Indian Community.

    Code of Federal Regulations, 2012 CFR


    ... is codified at 40 CFR 49.22. ...-Cities landfill, Salt River Pima-Maricopa Indian Community. 52.142 Section 52.142 Protection of... IMPLEMENTATION PLANS Arizona § 52.142 Federal Implementation Plan for Tri-Cities landfill, Salt River...

  5. Trying to lose weight among non-overweight university students from 22 low, middle and emerging economy countries.


    Peltzer, Karl; Pengpid, Supa


    The aim of this study was to assess the prevalence of trying to lose weight among non-overweight in university students and its sociodemographic and behavioural factors from 22 low and middle income and emerging economy countries. In a cross-sectional survey we took anthropometric measurements and used a self-administered questionnaire among 15997 undergraduate university students (mean age 20.8, Standard deviation=2.8, age range of 16-30 years) from 22 universities in 22 countries. Body mass index (BMI) was used for weight status. Results indicate that 27.1% non-overweight students were trying to lose weight, 34.6% among women and 16.5% among men. Among underweight or normal weight students, 19.0% perceived themselves to be overweight, 11.3% were dieting to lose weight, and 53.5% considered to lose weight of high importance. Multivariate logistic regression found that being female, coming from a low income country, the perception of being overweight, high importance of losing weight, dieting to lose weight, trying to eat fibre, and avoiding foods with fat and cholesterol were associated with trying to lose weight in non-overweight university students. The study found a high prevalence of weight control practices and several specific risk factors were identified that can be utilized in interventions to target unhealthy weight control measures. PMID:25740756

  6. Copper-mediated synthesis of N-alkenyl-α,β-unsaturated nitrones and their conversion to tri- and tetrasubstituted pyridines

    PubMed Central

    Kontokosta, Dimitra; Mueller, Daniel S; Mo, Dong-Liang; Pace, Wiktoria H; Simpson, Rachel A


    Summary A Chan–Lam reaction has been used to prepare N-alkenyl-α,β-unsaturated nitrones, which undergo a subsequent thermal rearrangement to the corresponding tri- and tetrasubstituted pyridines. The optimization and scope of these transformations is discussed. Initial mechanistic experiments suggest a reaction pathway involving oxygen transfer followed by cyclization. PMID:26664630

  7. 77 FR 10475 - Tri-State Generation and Transmission Association, Inc., Notice of Intent To Hold Public Scoping...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Rural Utilities Service Tri-State Generation and Transmission Association, Inc., Notice of Intent To Hold Public Scoping Meetings and Prepare an Environmental Assessment AGENCY: Rural Utilities Service.... SUMMARY: The Rural Utilities Service (RUS), an agency of the United States Department of...

  8. Impulsivity and polysubstance use: A systematic comparison of delay discounting in mono, dual, and tri-substance use

    PubMed Central

    Moody, Lara; Franck, Christopher; Hatz, Laura; Bickel, Warren K.


    Understanding the association between polysubstance use and impulsivity is pertinent to treatment planning and efficacy. Delay discounting, a measure of impulsivity, supplies the rate at which a reinforcer loses value as the temporal delay to its receipt increases. Excessive delay discounting has been widely observed among drug using individuals; though, the impact of using more than one substance has been only minimally studied. Here, after controlling for demographic variables, we systematically compare delay discounting in community controls, heavy smokers, alcohol-dependent, and cocaine-dependent individuals to assess the impact of non-, mono-, dual-, and tri-substance use. All substance-using groups discount significantly more than community controls (p < 0.05). Additionally, groups that smoke cigarettes in addition to another substance dependency discount significantly more than cigarette smoking alone (p < 0.05). Lastly, tri-substance users who were alcohol-dependent, cocaine-dependent and heavy cigarette smokers discount significantly more than heavy smokers (p < 0.01). However, tri-substance users do not discount significantly more than any dual-substance group. Tri-substance use is associated with greater impulsivity than mono-substance smoking, but no greater impulsivity than dual-substance users, suggesting a ceiling effect on discounting when more than two substances are in use. The present study suggests that smokers who engage in additional substance use may experience worse treatment outcomes given that excessive discounting is predictive of poor therapeutic outcomes in several studies. PMID:26691847

  9. An Examination of Tri-Level Collaboration around Student Achievement Using the Gap Analysis Approach: Teacher Factors

    ERIC Educational Resources Information Center

    Carruthers, Anthony Steven


    Using the Gap Analysis problem-solving framework (Clark & Estes, 2008), this project examined collaboration around student achievement in the Pasadena Unified School District (PUSD) from the teacher perspective. As part of a tri-level study, two other projects examined collaboration around student achievement in PUSD from the perspectives of…

  10. Aniline is an inducer, and not a precursor, for indole derivatives in Rubrivivax benzoatilyticus JA2.


    Mujahid, Mohammed; Sasikala, Ch; Ramana, Ch V


    Rubrivivax benzoatilyticus JA2 and other anoxygenic photosynthetic bacteria produce indole derivatives when exposed to aniline, a xenobiotic compound. Though this phenomenon has been reported previously, the role of aniline in the production of indoles is still a biochemical riddle. The present study aims at understanding the specific role of aniline (as precursor or stimulator) in the production of indoles and elucidating the biochemical pathway of indoles in aniline-exposed cells by using stable isotope approaches. Metabolic profiling revealed tryptophan accumulation only in aniline exposed cells along with indole 3-acetic acid (IAA) and indole 3-aldehyde (IAld), the two major catabolites of tryptophan. Deuterium labelled aniline feeding studies revealed that aniline is not a precursor of indoles in strain JA2. Further, production of indoles only in aniline-exposed cells suggests that aniline is an indoles stimulator. In addition, production of indoles depended on the presence of a carbon source, and production enhanced when carbon sources were added to the culture. Isotope labelled fumarate feeding identified, fumarate as the precursor of indole, indicating de novo synthesis of indoles. Glyphosate (shikimate pathway inhibitor) inhibited the indoles production, accumulation of tryptophan, IAA and IAld indicating that indoles synthesis in strain JA2 occurs via the de novo shikimate pathway. The up-regulation of anthranilate synthase gene and induction of anthranilate synthase activity correlated well with tryptophan production in strain JA2. Induction of tryptophan aminotransferase and tryptophan 2-monooxygenase activities corroborated well with IAA levels, suggesting that tryptophan catabolism occurs simultaneously in aniline exposed cells. Our study demonstrates that aniline (stress) stimulates tryptophan/indoles synthesis via the shikimate pathway by possibly modulating the metabolic pathway.

  11. Biosynthesis of silver and zinc oxide nanoparticles using Pichia fermentans JA2 and their antimicrobial property

    NASA Astrophysics Data System (ADS)

    Chauhan, Ritika; Reddy, Arpita; Abraham, Jayanthi


    The development of eco-friendly alternative to chemical synthesis of metal nanoparticles is of great challenge among researchers. The present study aimed to investigate the biological synthesis, characterization, antimicrobial study and synergistic effect of silver and zinc oxide nanoparticles against clinical pathogens using Pichia fermentans JA2. The extracellular biosynthesis of silver and zinc oxide nanoparticles was investigated using Pichia fermentans JA2 isolated from spoiled fruit pulp bought in Vellore local market. The crystalline and stable metallic nanoparticles were characterized evolving several analytical techniques including UV-visible spectrophotometer, X-ray diffraction pattern analysis and FE-scanning electron microscope with EDX-analysis. The biosynthesized metallic nanoparticles were tested for their antimicrobial property against medically important Gram positive, Gram negative and fungal pathogenic microorganisms. Furthermore, the biosynthesized nanoparticles were also evaluated for their increased antimicrobial activities with various commercially available antibiotics against clinical pathogens. The biosynthesized silver nanoparticles inhibited most of the Gram negative clinical pathogens, whereas zinc oxide nanoparticles were able to inhibit only Pseudomonas aeruginosa. The combined effect of standard antibiotic disc and biosynthesized metallic nanoparticles enhanced the inhibitory effect against clinical pathogens. The biological synthesis of silver and zinc oxide nanoparticles is a novel and cost-effective approach over harmful chemical synthesis techniques. The metallic nanoparticles synthesized using Pichia fermentans JA2 possess potent inhibitory effect that offers valuable contribution to pharmaceutical associations.

  12. Effect of vitamin E (Tri E®) on antioxidant enzymes and DNA damage in rats following eight weeks exercise

    PubMed Central


    Background Exercise is beneficial to health, but during exercise the body generates reactive oxygen species (ROS) which are known to result in oxidative stress. The present study analysed the effects of vitamin E (Tri E®) on antioxidant enzymes; superoxide dismutase (SOD), glutathione peroxidase (GPx), catalase (Cat) activity and DNA damage in rats undergoing eight weeks exercise. Methods Twenty four Sprague-Dawley rats (weighing 320-370 gm) were divided into four groups; a control group of sedentary rats which were given a normal diet, second group of sedentary rats with oral supplementation of 30 mg/kg/d of Tri E®, third group comprised of exercised rats on a normal diet, and the fourth group of exercised rats with oral supplementation of 30 mg/kg/d of Tri E®. The exercising rats were trained on a treadmill for 30 minutes per day for 8 weeks. Blood samples were taken before and after 8 weeks of the study to determine SOD, GPx, Cat activities and DNA damage. Results SOD activity decreased significantly in all the groups compared to baseline, however both exercised groups showed significant reduction in SOD activity as compared to the sedentary groups. Sedentary control groups showed significantly higher GPx and Cat activity compared to baseline and exercised groups. The supplemented groups, both exercised and non exercised groups, showed significant decrease in Cat activity as compared to their control groups with normal diet. DNA damage was significantly higher in exercising rats as compared to sedentary control. However in exercising groups, the DNA damage in supplemented group is significantly lower as compared to the non-supplemented group. Conclusions In conclusion, antioxidant enzymes activity were generally reduced in rats supplemented with Tri E® probably due to its synergistic anti-oxidative defence, as evidenced by the decrease in DNA damage in Tri E® supplemented exercise group. PMID:21513540

  13. Tri (2-chloroisopropyl) phosphate--an unexpected organochlorine contaminant in some charcoal air-sampling sorbent tubes

    SciTech Connect

    van Netten, C.; Brands, R.; Park, J.; Deverall, R. )


    Air sampling in a government building was necessary in response to reports of a cancer cluster. SKC (Eighty Four, Pa.) charcoal coconut shell-based sorbent tubes (226-01 lot 120) were recommended for this procedure. A recently purchased supply was present at the University of British Columbia and consequently was used for this particular study. Analysis of the front charcoal section showed the presence of a flame retardant, tri (2-chloroisopropyl) phosphate, which was confirmed by gas liquid chromatography (GLC) and mass spectrometry analysis. In an effort to identify the source of this fire retardant in the building, it became apparent from the analysis done on unknown field blanks that tri (2-chloroisopropyl) phosphate was a contaminant of the sorbent tubes used. Analysis of additional blank tubes identified the foam separators as the most likely source of contamination. Levels of tri (2-chloroisopropyl) phosphate in the front charcoal section ranged from 1.3 to 5.9 micrograms. The foam separator contained between 11.4 and 16.5 micrograms, and the backup charcoal section contained between 14.5 and 24.0 micrograms of tri (2-chloroisopropyl) phosphate. In addition, another flame retardant, tri (1,3 dichloro-2-propyl) phosphate was also found. Because these contaminants have long column retention times in GLC, it may not be apparent that these contaminants are present and consequently are likely to have modified the sorbent characteristics of the activated charcoal. Another batch of sorbent tubes bearing the same catalog number and lot number was purchased from the supplier; no flame retardants were found in this batch.

  14. Overexpression of the Trichoderma brevicompactum tri5 Gene: Effect on the Expression of the Trichodermin Biosynthetic Genes and on Tomato Seedlings

    PubMed Central

    Tijerino, Anamariela; Hermosa, Rosa; Cardoza, Rosa E.; Moraga, Javier; Malmierca, Monica G.; Aleu, Josefina; Collado, Isidro G.; Monte, Enrique; Gutierrez, Santiago


    Trichoderma brevicompactum IBT 40841 produces trichodermin, a trichothecene-type toxin that shares most of the steps of its biosynthesis with harzianum A, another trichothecene produced by several Trichoderma species. The first specific step in the trichothecene biosynthesis is carried out by a terpene cylcase, trichodiene synthase, that catalyzes the conversion of farnesyl pyrophosphate to trichodiene and that is encoded by the tri5 gene. Overexpression of tri5 resulted in increased levels of trichodermin production, but also in an increase in tyrosol and hydroxytyrosol production, two antioxidant compounds that may play a regulatory role in trichothecene biosynthesis, and also in a higher expression of three trichothecene genes, tri4, tri6 and tri10, and of the erg1 gene, which participates in the synthesis of triterpenes. The effect of tri5 overexpression on tomato seedling disease response was also studied. PMID:22069764

  15. Overexpression of the Trichoderma brevicompactum tri5 gene: effect on the expression of the trichodermin biosynthetic genes and on tomato seedlings.


    Tijerino, Anamariela; Hermosa, Rosa; Cardoza, Rosa E; Moraga, Javier; Malmierca, Monica G; Aleu, Josefina; Collado, Isidro G; Monte, Enrique; Gutierrez, Santiago


    Trichoderma brevicompactum IBT 40841 produces trichodermin, a trichothecene-type toxin that shares most of the steps of its biosynthesis with harzianum A, another trichothecene produced by several Trichoderma species. The first specific step in the trichothecene biosynthesis is carried out by a terpene cylcase, trichodiene synthase, that catalyzes the conversion of farnesyl pyrophosphate to trichodiene and that is encoded by the tri5 gene. Overexpression of tri5 resulted in increased levels of trichodermin production, but also in an increase in tyrosol and hydroxytyrosol production, two antioxidant compounds that may play a regulatory role in trichothecene biosynthesis, and also in a higher expression of three trichothecene genes, tri4, tri6 and tri10, and of the erg1 gene, which participates in the synthesis of triterpenes. The effect of tri5 overexpression on tomato seedling disease response was also studied. PMID:22069764

  16. Tri-stereo Pleiades images-derived digital surface models for tectonic geomorphology studies

    NASA Astrophysics Data System (ADS)

    Ferry, Matthieu; Le Roux-Mallouf, Romain; Ritz, Jean-François; Berthet, Théo; Peyret, Michel; Vernant, Philippe; Maréchal, Anaïs; Cattin, Rodolphe; Mazzotti, Stéphane; Poujol, Antoine


    Very high resolution digital elevation models are a key component of modern quantitative geomorphology. In parallel to high-precision but time-consuming kinematic GPS and/or total station surveys and dense coverage but expensive LiDAR campaigns, we explore the usability of affordable, flexible, wide coverage digital surface models (DSMs) derived from Pleiades tri-stereo optical images. We present two different approaches to extract DSM from a triplet of images. The first relies on the photogrammetric extraction of 3 DSMs from the 3 possible stereo couples and subsequent merge based on the best correlation score. The second takes advantage of simultaneous correlation over the 3 images to derive a point cloud. We further extract DSM from panchromatic 0.5 m resolution images and multispectral 2 m resolution images to test for correlation and noise and determine optimal correlation window size and achievable resolution. Georeferencing is also assessed by comparing raw coordinates derived from Pleiades Rational Polynomial Coefficients to ground control points. Primary images appear to be referenced within ~15 m over flat areas where parallax is minimal while derived DSMs and associated orthorectified images show a much improved referencing within ~5 m of GCPs. In order to assess the adequacy of Pleiades DSMs for tectonic geomorphology, we present examples from case studies along the Trougout normal fault (Morocco), the Hovd strike-slip fault (Mongolia), the Denali strike-slip fault (USA and Canada) and the Main Frontal Thrust (Bhutan). In addition to proposing a variety of tectonic contexts, these examples cover a wide range of climatic conditions (semi-arid, arctic and tropical), vegetation covers (bare earth, sparse Mediterranean, homogeneous arctic pine, varied tropical forest), lithological natures and related erosion rates. The capacity of derived DSMs is demonstrated to characterize geomorphic markers of active deformation such as marine and alluvial terraces

  17. Acylated flavonol tri- and tetraglycosides in the flavonoid metabolome of Cladrastis kentukea (Leguminosae).


    Kite, Geoffrey C; Rowe, Emily R; Lewis, Gwilym P; Veitch, Nigel C


    The foliar metabolome of Cladrastis kentukea (Leguminosae) contains a complex mixture of flavonoids including acylated derivatives of the 3-O-rhamnosyl(1→2)[rhamnosyl(1→6)]-galactosides of kaempferol and quercetin and their 7-O-rhamnosides, together with an array of non-acylated kaempferol and quercetin di-, tri- and tetraglycosides. Thirteen of the acylated flavonoids, 12 of which had not been reported previously, were characterised by spectroscopic and chemical methods. Eight of these were the four isomers of kaempferol 3-O-α-l-rhamnopyranosyl(1→2)[α-l-rhamnopyranosyl(1→6)]-(3/4-O-E/Z-p-coumaroyl-β-d-galactopyranoside) and their 7-O-α-l-rhamnopyranosides, and three were isomers of quercetin 3-O-α-l-rhamnopyranosyl(1→2)[α-l-rhamnopyranosyl(1→6)]-(3/4-O-E/Z-p-coumaroyl-β-d-galactopyranoside) - the remaining 4Z isomer was identified by LC-UV-MS analysis of a crude extract. The final two acylated flavonoids characterised by NMR were the 3E and 4E isomers of kaempferol 3-O-α-l-rhamnopyranosyl(1→2)[α-l-rhamnopyranosyl(1→6)]-(3/4-O-E-feruloyl-β-d-galactopyranoside)-7-O-α-l-rhamnopyranoside while the 3Z and 4Z isomers were again detected by LC-UV-MS. Using the observed fragmentation behaviour of the isolated compounds following a variety of MS experiments, a further 18 acylated flavonoids were given tentative structures by LC-MS analysis of a crude extract. Acylated flavonoids were absent from the flowers of C. kentukea, which contained an array of non-acylated kaempferol and quercetin glycosides. Immature fruits contained kaempferol 3-O-α-rhamnopyranosyl(1→2)[α-rhamnopyranosyl(1→6)]-β-galactopyranoside and its 7-O-α-rhamnopyranoside as the major flavonoids with acylated flavonoids, different from those in the leaves, only present as minor constituents. The presence of acylated flavonoids distinguishes the foliar flavonoid metabolome of C. kentukea from that of a closely related legume, Styphnolobium japonicum, which contains a similar

  18. Evidence of Latitudinal Migration in Tri-colored Bats, Perimyotis subflavus

    PubMed Central

    Fraser, Erin E.; McGuire, Liam P.; Eger, Judith L.; Longstaffe, Fred J.; Fenton, M. Brock


    Background Annual movements of tri-colored bats (Perimyotis subflavus) are poorly understood. While this species has been considered a regional migrant, some evidence suggests that it may undertake annual latitudinal migrations, similar to other long distance North American migratory bat species. Methodology/Principal Findings We investigated migration in P. subflavus by conducting stable hydrogen isotope analyses of 184 museum specimen fur samples and comparing these results (δDfur) to published interpolated δD values of collection site growing season precipitation (δDprecip). Results suggest that the male molt period occurred between June 23 and October 16 and 33% of males collected during the presumed non-molt period were south of their location of fur growth. For the same time period, 16% of females were south of their location of fur growth and in general, had not travelled as far as migratory males. There were strong correlations between δDfur from the presumed molt period and both growing season δDprecip (males – r2 = 0.86; p<0.01; females – r2 = 0.75; p<0.01), and latitude of collection (males – r2 = 0.85; p<0.01; females – r2 = 0.73; p<0.01). Most migrants were collected at the northern (>40°N; males and females) and southern (<35°N; males only) extents of the species' range. Conclusions/Significance These results indicate a different pattern of migration for this species than previously documented, suggesting that some P. subflavus engage in annual latitudinal migrations and that migratory tendency varies with latitude and between sexes. We suggest that this species' hibernation ecology makes it particularly susceptible to long winters, making migration from the northern extent of the species' range to more southern hibernacula preferable for some individuals. Fur δD values for some of the northern individuals may indicate an increase in the currently accepted northern range of this species. Sex-biased differences in

  19. Endoscopic third ventriculostomy for post-inflammatory hydrocephalus in pediatric patients: is it worth a try?


    Raouf, Alaa; Zidan, Ihab; Mohamed, Eshra


    Hydrocephalus is a very common disease in developing countries. Congenital aqueductal obstruction and post-inflammatory hydrocephalus come on the top of the list of causes of hydrocephalus. Till the recent introduction of cranial endoscopy and despite their frequent complications, shunts were considered as the mainstream treatment for this disease. Endoscopic third ventriculostomy (ETV), especially for obstructive hydrocephalus, introduced a new era of treatment that is free of lifetime shunt dependency. This study was done to assess the efficacy of ETV for treating post-inflammatory hydrocephalus in a unique group of patients thus preventing—if possible—the lifetime shunt dependency and suffering. ETV was tried as a first-line therapy in 35 children (23 males and 12 females) with hydrocephalus proved to be secondary to intracranial infection. Mean age was 9.2 months (4-15). Twenty-four patients (68.6%) were below the age of 6 months while 11 patients (31.4%) were above 6 months. Twenty-five patients (71.4%) had a head circumference of 3 cm and 10 patients (28.6%) had a 5 cm or more increase in the head circumference above the 95th percentile. All the patients included were followed postoperatively with regular clinical, computerized tomography (CT), and magnetic resonance imaging (MRI) examinations as well as cerebrospinal fluid (CSF) analysis and culture. The overall success of ETV was 55.9% (19/34). Nine (81.9%) out of the 11 patients that were endoscopically documented to have aqueductal obstruction showed improvement. While out of the 23 patients with patent aqueduct, only 10 patients (43.4%) had improved. Procedure-related complications were not encountered. CSF leakage from the surgical wound occurred in three patients and mild CSF infection occurred in one patient. ETV is a simple, safe, and effective method in treating not only obstructive hydrocephalus due to non-inflammatory etiology, but also post-inflammatory hydrocephalus especially when the

  20. Molecular Simulation of Water Extraction into a Tri-n-Butyl-Phosphate/n-Dodecane Solution

    SciTech Connect

    de Almeida, Valmor F; Ye, Xianggui; Cui, Shengting; Khomami, Bamin


    Abstract: Molecular dynamics simulations were performed to investigate water extraction into a solution of 30 vol% tri-n-butyl-phosphate (TBP) in n-dodecane. This solvent extraction mixture is commonly used in hydrometallurgical and nuclear fuel recycling operations for recovering metals from aqueous streams. It is known that water is coextracted in the organic phase and that it competes with metal ions for the available extractant agent (TBP). Therefore investigating pure water extraction provides a realistic prototype to test molecular simulation methods for the first time in this area. Our computational results indicate that the TBP electric dipole moment has a significant effect on the predicted water solubility. A larger TBP dipole moment decreases the aqueous-organic interfacial tension, leading to increased roughness of the aqueous-organic interface. Interfacial roughness has a significant effect on disrupting the interfacial water hydrogen bonding structure, resulting in a greater number of dangling water molecules at the interface. This enhances the probability of water molecules to break away from the aqueous phase and to migrate into the bulk of the organic phase. Therefore, the magnitude of the TBP dipole moment is a crucial factor in controlling water hydrogen bond breaking at the aqueous-organic interface. By slightly lowering the atomic partial charges of the TBP atoms, to produce a dipole moment that better agrees with experimental data, we were able to predict water solubility in close agreement with experimental measurements. Hence we demonstrate that a molecular modeling and simulation approach may provide quantitative support to experimental programs in this area. In addition, our simulation results shed light into the molecular mechanism of water extraction, the critical role of TBP, and the structural forms of water molecules both at the interface and in the bulk of the organic phase. Specifically, it is found that water molecules are

  1. Two tri-spin complexes based on gadolinium and nitronyl nitroxide radicals: Structure and ferromagnetic interactions

    SciTech Connect

    Zhou Na; Ma Yue; Wang Chao; Xu Gongfeng; Tang Jinkui; Yan Shiping; Liao Daizheng


    Three Radical-Ln(III)-Radical complexes based on nitronyl nitroxide radicals have been synthesized, structurally and magnetically characterized: [Gd(hfac){sub 3}(NITPhOEt){sub 2}] (1) (hfac=hexafluoroacetylacetonate, and NITPhOEt=4'-ethoxy-phenyl-4,4,5,5-tetramethylimidazoline-1-oxyl-3-oxide), [Gd(hfac){sub 3}(NITPhOCH{sub 2}Ph){sub 2}] (2) (NITPhOCH{sub 2}Ph=4'-benzyloxy-phenyl-4,4,5, 5-tetramethylimidazoline-1-oxyl-3-oxide) and [Lu(hfac){sub 3}(NITPhOCH{sub 2}Ph){sub 2}] (3). The X-ray crystal structure analyses show that the structures of the three compounds are similar and all consist of the isolated molecules, in which central ions Gd{sup III} or Lu{sup III} are coordinated by six oxygen atoms from three hfac and two oxygen atoms from nitronyl radicals. The magnetic studies show that in both of the two Gd{sup III} complexes, there are ferromagnetic Gd{sup III}-Rad interactions and antiferro-magnetic Rad-Rad interactions in the molecules (with J{sub Rad-Gd}=0.27 cm{sup -1}, j{sub Rad-Rad}=-2.97 cm{sup -1} for 1: and J{sub Rad-Gd}=0.62 cm{sup -1}, j{sub Rad-Rad}=-7.01 cm{sup -1} for 2). An analogous complex of [Lu(hfac){sub 3} (NITPhOCH{sub 2}Ph){sub 2}] (3) containing diamagnetic Lu{sup III} ions has also been introduced for further demonstrating the nature of magnetic coupling between radicals. - Graphical abstract: Two tri-spin complexes based on gadolinium-radical have been synthesized and characterized, the magnetic studies show that in the two complexes the Gd-radical interaction is ferromagnetic and the radical-radical interaction is antiferromagnetic. An analogous complex containing the diamagnetic Lu{sup III} ions has also been synthesized to further demonstrate the nature of the magnetic coupling between radicals.

  2. Crystal structures of di­aquadi-μ-hydroxido-tris­[tri­methyl­tin(IV)] diformatotri­methyl­stannate(IV) and di-μ-hydroxido-tris­[tri­methyl­tin(IV)] chloride monohydrate

    PubMed Central

    Otte, Felix; Koller, Stephan G.; Golz, Christopher; Strohmann, Carsten


    The title compounds, [Sn3(CH3)9(OH)2(H2O)2][Sn(CH3)3(CHO2)2] (1) and [Sn3(CH3)9(OH)2]Cl·H2O (2), are partially condensed products of hydrolysed tri­methyl­tin chloride. In the structures of 1 and 2, short cationic tris­tannatoxanes (C9H29O2Sn3) are bridged by a diformatotri­methyl­tin anion or a chloride anion, respectively. Hydrogen bridges are present and supposedly stabilize these structures against further polymerization to the known polymeric tri­methyl­tin hydroxide. Especially noteworthy is that the formate present in this structure was formed from atmospheric CO2. PMID:27746950

  3. TriTel 3 dimensional space dosimetric telescope in the European Student Earth Orbiter project of ESA

    NASA Astrophysics Data System (ADS)

    Zábori, Balázs; Hirn, Attila


    The development of the European Student Earth Orbiter (ESEO) was announced in the year of 2008 by the European Space Agency for students interested in the space exploration. The Budapest University of Technology and Economics joined this international cooperation with three student groups among other participating European universities. One of them is the ESEO-TriTel team. The development of the TriTel 3D silicon detector telescope began in the KFKI Atomic Energy Research Institute several years ago in order to determine the average radiation quality factor of the space radiation field for dosimetric purposes. In the year 2011—before the start of the ESEO mission—it will be operated on board the European Columbus module of the International Space Station (ISS) and will be installed in the Russian segment of the ISS as well. The ESEO version of TriTel will fly higher than the ISS version, at an altitude of 520 km. At this altitude the Earth's geomagnetic field is much lower and the spectrum of the radiation field is also different. In the ESEO-TriTel experiment the anisotropies in the radiation field, the effects of the Earth shadow and the South Atlantic Anomaly (SAA) will be analysed and the results will be compared with the fluxes calculated with the standard AP-8 and AE-8 trapped proton and electron models. In the near future the frequency of manned space flights will probably increase, we can think of the continuous human presence in the near-Earth region (low Earth orbits) or the proposed human Mars expedition. That is why the cosmic radiation field is interesting not only in the near-Earth region but at higher altitudes or in the interplanetary field as well. The present paper addresses the optimal shielding of the dosimetric telescopes of TriTel in order to avoid the saturation of the electronics. The amount of optimal shielding is equivalent to the effective thickness of astronaut's space suit, which means that the same dose will be measured as what the

  4. Modulating the Nucleated Self-Assembly of Tri-β(3) -Peptides Using Cucurbit[n]urils.


    Satav, Tushar; Korevaar, Peter; de Greef, Tom F A; Huskens, Jurriaan; Jonkheijm, Pascal


    The modulation of the hierarchical nucleated self-assembly of tri-β(3) -peptides has been studied. β(3) -Tyrosine provided a handle to control the assembly process through host-guest interactions with CB[7] and CB[8]. By varying the cavity size from CB[7] to CB[8] distinct phases of assembling tri-β(3) -peptides were arrested. Given the limited size of the CB[7] cavity, only one aromatic β(3) -tyrosine can be simultaneously hosted and, hence, CB[7] was primarily acting as an inhibitor of self-assembly. In strong contrast, the larger CB[8] can form a ternary complex with two aromatic amino acids and hence CB[8] was acting primarily as cross-linker of multiple fibers and promoting the formation of larger aggregates. General insights on modulating supramolecular assembly can lead to new ways to introduce functionality in supramolecular polymers. PMID:27434777

  5. Modulating the Nucleated Self-Assembly of Tri-β(3) -Peptides Using Cucurbit[n]urils.


    Satav, Tushar; Korevaar, Peter; de Greef, Tom F A; Huskens, Jurriaan; Jonkheijm, Pascal


    The modulation of the hierarchical nucleated self-assembly of tri-β(3) -peptides has been studied. β(3) -Tyrosine provided a handle to control the assembly process through host-guest interactions with CB[7] and CB[8]. By varying the cavity size from CB[7] to CB[8] distinct phases of assembling tri-β(3) -peptides were arrested. Given the limited size of the CB[7] cavity, only one aromatic β(3) -tyrosine can be simultaneously hosted and, hence, CB[7] was primarily acting as an inhibitor of self-assembly. In strong contrast, the larger CB[8] can form a ternary complex with two aromatic amino acids and hence CB[8] was acting primarily as cross-linker of multiple fibers and promoting the formation of larger aggregates. General insights on modulating supramolecular assembly can lead to new ways to introduce functionality in supramolecular polymers.

  6. Amide-controlled, one-pot synthesis of tri-substituted purines generates structural diversity and analogues with trypanocidal activity.


    Pineda de las Infantas y Villatoro, Maria J; Unciti-Broceta, Juan D; Contreras-Montoya, Rafael; Garcia-Salcedo, Jose A; Gallo Mezo, Miguel A; Unciti-Broceta, Asier; Diaz-Mochon, Juan J


    A novel one-pot synthesis of tri-substituted purines and the discovery of purine analogues with trypanocidal activity are reported. The reaction is initiated by a metal-free oxidative coupling of primary alkoxides and diaminopyrimidines with Schiff base formation and subsequent annulation in the presence of large N,N-dimethylamides (e.g. N,N-dimethylpropanamide or larger). This synthetic route is in competition with a reaction previously-reported by our group, allowing the generation of a combinatorial library of tri-substituted purines by the simple modification of the amide and the alkoxide employed. Among the variety of structures generated, two purine analogues displayed trypanocidal activity against the protozoan parasite Trypanosoma brucei with IC50 < 5 μM, being each of those compounds obtained through each of the synthetic pathways.

  7. Quenching of triplet benzophenone by 2,4,6-tri-tert-butylphenol and formation of its phenoxy radical

    SciTech Connect

    Kajii, Y.; Fujita, M.; Hiratsuka, H.; Obi, K.; Mori, Y.; Tanaka, I.


    Quenching of triplet benzophenone in benzene by 2,4,6-tri-tert-butylphenol is studied by the nanosecond laser flash photolysis. The quenching rate constant of triplet benzophenone has been determined to be 6.2 x 10/sup 8/ M/sup -1/ s/sup -1/, which is slightly smaller than the diffusion-controlled limit. The quenching reaction produces benzophenone ketyl and 2,4,6-tri-tert-butylphenoxy radicals simultaneously. The transient spectrum of the latter radical shows characteristic structured bands around 400 nm and a broad absorption between 600 and 700 nm. The extinction coefficient at the peak lambda/sub max/ = 670 nm of red absorption has been estimated to be 1200 M/sup -1/ cm/sup -1/.

  8. Using Tri-Axial Accelerometers to Assess the Dynamic Control of Head Posture During Gait

    NASA Technical Reports Server (NTRS)

    Lawrence, John H., III


    Long duration spaceflight is known to cause a variety of biomedical stressors to the astronaut. One of the more functionally destabilizing effects of spaceflight involves microgravity-induced changes in vestibular or balance control. Balance control requires the integration of the vestibular, visual, and proprioceptive systems. In the microgravity environment, the normal gravity vector present on Earth no longer serves as a reference for the balance control system. Therefore, adaptive changes occur to the vestibular system to affect control of body orientation with altered, or non-present, gravity and/or proprioceptive inputs. Upon return to a gravity environment, the vestibular system must re-incorporate the gravity vector and gravity-induced proprioceptive inputs into the balance control regime. The result is often a period of postural instability, which may also be associated with space motion sickness (oscillopsia, nausea, and vertigo). Previous studies by the JSC Neuroscience group have found that returning astronauts often employ alterations in gait mechanics to maintain postural control during gait. It is believed that these gait alterations are meant to decrease the transfer of heel strike shock energy to the head, thus limiting the contradictory head and eye movements that lead to gait instability and motion sickness symptoms. We analyzed pre- and post-spaceflight tri-axial accelerometer data from the NASA/MIR long duration spaceflight missions to assess the heel to head transfer of heel strike shock energy during locomotion. Up to seven gait sessions (three preflight, four postflight) of head and shank (lower leg) accelerometer data was previously collected from six astronauts who engaged in space flights of four to six months duration. In our analysis, the heel to head transmission of shock energy was compared using peak vertical acceleration (a), peak jerk (j) ratio, and relative kinetic energy (a). A host of generalized movement variables was produced

  9. Effect of inositol and tri-iodothyronine on the hormonal responsiveness of hepatocytes obtained from partially hepatectomized rats.

    PubMed Central

    Huerta-Bahena, J; García-Sáinz, J A


    Hepatocytes obtained from animals partially hepatectomized (72 h before the experiment) have a diminished responsiveness to alpha 1-adrenergic amines, vasopressin, angiotensin and glucagon and an increased responsiveness to beta-adrenergic amines. Administration of inositol or tri-iodothyronine to the hepatectomized animals induced a recovery in the hepatocyte responsiveness to the Ca2+-dependent hormones and abolished that to beta-adrenergic amines; the response to glucagon was not improved. PMID:6508748

  10. Monitoring TriAcylGlycerols Accumulation by Atomic Force Microscopy Based Infrared Spectroscopy in Streptomyces Species for Biodiesel Applications.


    Deniset-Besseau, Ariane; Prater, Craig B; Virolle, Marie-Joëlle; Dazzi, Alexandre


    An atomic force microscope coupled with a tunable infrared laser source (AFM-IR) was used to measure the size and map the distribution of oil inclusions inside of microorganism without staining or other special sample preparation. The microorganism under study is Streptomyces, a soil bacterium that possesses the capability, under some specific nutritional conditions, to store its carbon source into TriAcylGlycerols, a potential direct source of biodiesel. PMID:26270832

  11. Efficient production of di- and tri-acylated mannosylerythritol lipids as glycolipid biosurfactants by Pseudozyma parantarctica JCM 11752(T).


    Morita, Tomotake; Konishi, Masaaki; Fukuoka, Tokuma; Imura, Tomohiro; Sakai, Hideki; Kitamoto, Dai


    Mannosylerythritol lipids (MELs) are one of the most promising biosurfactants known, because of their multifunctionality and biocompatibility. In order to attain an efficient production of MELs, Pseudozyma parantarctica JCM 11752(T), which is a newly identified strain of the genus, was examined for the productivity of MELs at different culture conditions. The yeast strain showed significant cell growth and production of di-acylated MELs even at 36 degrees C. In contrast, on conventional high-level MEL producers including P. rugulosa, the MEL yield considerably decreased with an increase of the cultivation temperature at over 30 degrees C. On P. parantarctica, soybean oil and sodium nitrate were the best carbon and nitrogen sources, respectively. Under the optimal conditions on a shake-flask culture at 34 degrees C, the amount of di-acylated MELs reached over 100 g/L by intermittent feeding of only soybean oil. Interestingly, the yeast strain produced tri-acylated MELs as well as di-acylated ones when grown on the medium containing higher soybean oil concentrations than 8% (vol/vol). The production of tri-acylated MELs was significantly accelerated at between 34 and 36 degrees C. With 20 % (vol/vol) of soybean oil at 34 degrees C, the yield of tri-acylated MELs reached 22.7 g/L. The extracellular lipase activity considerably depended on the culture temperature, and became the maximum at 34 degrees C; this would bring the accelerated production of tri-acylated MELs. Accordingly, the present strain of P. parantarctica provided high efficiency in MEL production at elevated temperatures compared to conventional MEL producers, and would thus be highly advantageous for the commercial production of the promising biosurfactants. PMID:18781056

  12. Tri-allelic pattern of short tandem repeats identifies the murderer among identical twins and suggests an embryonic mutational origin.


    Wang, Li-Feng; Yang, Ying; Zhang, Xiao-Nan; Quan, Xiao-Liang; Wu, Yuan-Ming


    Monozygotic twins can be co-identified by genotyping of short tandem repeats (STRs); however, for distinguishing them, STR genotyping is ineffective, especially in the case of murder. Here, a rarely occurring tri-allelic pattern in the vWA locus (16, 18, 19) was identified only in the DNA of one identical twin, which could help to exonerate the innocent twin in a murder charge. This mutation was defined as primary through genotyping of the family and could be detected in blood, buccal and semen samples from the individual; however, two alternative allele-balanced di-allelic patterns (16, 18 or 16, 19) were detected in hair root sheath cells. Such a kind of segregation indicates a one-step mutation occurs in cell mitosis, which is after embryonic zygote formation and during the early development of the individual after the division of the blastocyte. Sequencing revealed the insertion between the allele 18 and 19 is a repeat unit of TAGA/TCTA (plus/minus strand), which belongs to "AGAT/ATCT"-based core repeats identified from all tri-allelic pattern reports recorded in the STR base and a detailed model was proposed for STR repeat length variation caused by false priming during DNA synthesis. Our model illustrates the possible origination of allele-balanced and unbalanced tri-allelic pattern, clarifies that the genotypes of parent-child mismatches, aberrant di-allelic patterns, and type 1 or 2 tri-allelic patterns should be considered as independent, but interconnected forms of STR mutation. PMID:25732248

  13. Genetic and Environmental Interactions in Determining the Early Lexicon: Evidence from a Set of Tri-Zygotic Quadruplets

    ERIC Educational Resources Information Center

    McGregor, Karla K.; Capone, Nina C.


    A set of tri-zygotic quadruplets, three girls and one boy, participated in weekly observations from 1;2 to 1;10 (years;months), a period of transition from prelinguistic gesture to 50 words. In the study, one girl served as a genetic mate to her identical twin and a biological risk mate to her fraternal sister. The biological risk mates achieved…

  14. [Effects of bromide and ferric ions on formation of tri-halomethanes during disinfection of drinking water by chlorine].


    Zhu, Zhi-Liang; Wang, Jing; Ge, Yuan-Xin; Ma, Hong-Mei; Zhao, Jian-Fu


    Effects of bromide and ferric ions on the formation and distribution of tri-halomethanes (THMs) have been investigated. As disinfection by-product (DBP) model precursors of natural water, humic acid solutions were used and a series of experiments were conducted. The results showed that bromide in this reaction system not only contributed to the increase of brominated species, but also the total tri-halomethanes. When the concentration of Br(-) was 1.0 mg/L, the total amount of produced THMs reached to 270% of that without bromide ions. In the presence of bromide, ferric ions decreased the production of THMs at pH 6, but increased the production of THMs at pH 8, especially for the amount of tri-bromomethanes. When the concentration of Fe3+ was 5 mg/L, the amount of produced tri-bromomethanes had an increment of 54% (from 51.7 microg/L to 79.4 microg/L), and the total amount of THMs increased from 113.49 microg/L to 162.09 microg/L. Bromide ions had a significant effect on carcinogenicity risk in disinfection of drinking water by chlorine, and the co-existence of ferric ion and bromide in alkalescent environment can result in the biggest challenge on carcinogenicity risk. Under the condition of 0.2 mg/L Br(-), 5 mg/L Fe3+ and pH 6, the carcinogenicity risk increased 2.5 times than that without Br(-) and Fe3+, and much higher increment of 5.1 times appeared when pH was 8.

  15. Priming for JA-dependent defenses using hexanoic acid is an effective mechanism to protect Arabidopsis against B. cinerea.


    Kravchuk, Zhana; Vicedo, Begonya; Flors, Víctor; Camañes, Gemma; González-Bosch, Carmen; García-Agustín, Pilar


    Soil drench treatments with hexanoic acid can effectively protect Arabidopsis plants against Botrytis cinerea through a mechanism based on a stronger and faster accumulation of JA-dependent defenses. Plants impaired in ethylene, salicylic acid, abscisic acid or glutathion pathways showed intact protection by hexanoic acid upon B. cinerea infection. Accordingly, no significant changes in the SA marker gene PR-1 in either the SA or ABA hormone balance were observed in the infected and treated plants. In contrast, the JA signaling pathway showed dramatic changes after hexanoic acid treatment, mainly when the pathogen was present. The impaired JA mutants, jin1-2 and jar1, were unable to display hexanoic acid priming against the necrotroph. In addition, hexanoic acid-treated plants infected with B. cinerea showed priming in the expression of the PDF1.2, PR-4 and VSP1 genes implicated in the JA pathways. Moreover, JA and OPDA levels were primed at early stages by hexanoic acid. Treatments also stimulated increased callose accumulation in response to the pathogen. Although callose accumulation has proved an effective IR mechanism against B. cinerea, it is apparently not essential to express hexanoic acid-induced resistance (HxAc-IR) because the mutant pmr4.1 (callose synthesis defective mutant) is protected by treatment. We recently described how hexanoic acid treatments can protect tomato plants against B. cinerea by stimulating ABA-dependent callose deposition and by priming OPDA and JA-Ile production. We clearly demonstrate here that Hx-IR is a dependent plant species, since this acid protects Arabidopsis plants against the same necrotroph by priming JA-dependent defenses without enhancing callose accumulation.

  16. Elevated CO2 influences nematode-induced defense responses of tomato genotypes differing in the JA pathway.


    Sun, Yucheng; Yin, Jin; Cao, Haifeng; Li, Chuanyou; Kang, Le; Ge, Feng


    Rising atmospheric CO(2) concentrations can affect the induced defense of plants against chewing herbivores but little is known about whether elevated CO(2) can change the induced defense of plants against parasitic nematodes. This study examined the interactions between the root-knot nematode Meloidogyne incognita and three isogenic tomato (Lycopersicon esculentum) genotypes grown under ambient (390 ppm) and elevated (750 ppm) CO(2) in growth chambers. In a previous study with open-top chambers in the field, we reported that elevated CO(2) increased the number of nematode-induced root galls in a JA-defense-dominated genotype but not in a wild-type or JA-defense-recessive genotype. In the current study, we tested the hypothesis that elevated CO(2) will favor the salicylic acid (SA)-pathway defense but repress the jasmonic acid (JA)-pathway defense of plants against plant-parasitic nematodes. Our data showed that elevated CO(2) reduced the JA-pathway defense against M. incognita in the wild-type and in a genotype in which defense is dominated by the JA pathway (a JA-defense-dominated genotype) but up-regulated the SA-pathway defense in the wild type and in a JA-defense-recessive genotype (jasmonate-deficient mutant). Our results suggest that, in terms of defense genes, secondary metabolites, and volatile organic compounds, induced defense of nematode-infected plants could be affected by elevated CO(2), and that CO(2)-induced changes of plant resistance may lead to genotype-specific responses of plants to nematodes under elevated CO(2). The changes in resistance against nematodes, however, were small relative to those reported for chewing insects. PMID:21629688

  17. Elevated CO2 Influences Nematode-Induced Defense Responses of Tomato Genotypes Differing in the JA Pathway

    PubMed Central

    Sun, Yucheng; Yin, Jin; Cao, Haifeng; Li, Chuanyou; Kang, Le; Ge, Feng


    Rising atmospheric CO2 concentrations can affect the induced defense of plants against chewing herbivores but little is known about whether elevated CO2 can change the induced defense of plants against parasitic nematodes. This study examined the interactions between the root-knot nematode Meloidogyne incognita and three isogenic tomato (Lycopersicon esculentum) genotypes grown under ambient (390 ppm) and elevated (750 ppm) CO2 in growth chambers. In a previous study with open-top chambers in the field, we reported that elevated CO2 increased the number of nematode-induced root galls in a JA-defense-dominated genotype but not in a wild-type or JA-defense-recessive genotype. In the current study, we tested the hypothesis that elevated CO2 will favor the salicylic acid (SA)-pathway defense but repress the jasmonic acid (JA)-pathway defense of plants against plant-parasitic nematodes. Our data showed that elevated CO2 reduced the JA-pathway defense against M. incognita in the wild-type and in a genotype in which defense is dominated by the JA pathway (a JA-defense-dominated genotype) but up-regulated the SA-pathway defense in the wild type and in a JA-defense-recessive genotype (jasmonate-deficient mutant). Our results suggest that, in terms of defense genes, secondary metabolites, and volatile organic compounds, induced defense of nematode-infected plants could be affected by elevated CO2, and that CO2-induced changes of plant resistance may lead to genotype-specific responses of plants to nematodes under elevated CO2. The changes in resistance against nematodes, however, were small relative to those reported for chewing insects. PMID:21629688

  18. Production of Molecular Iodine and Tri-iodide in the Frozen Solution of Iodide: Implication for Polar Atmosphere.


    Kim, Kitae; Yabushita, Akihiro; Okumura, Masanori; Saiz-Lopez, Alfonso; Cuevas, Carlos A; Blaszczak-Boxe, Christopher S; Min, Dae Wi; Yoon, Ho-Il; Choi, Wonyong


    The chemistry of reactive halogens in the polar atmosphere plays important roles in ozone and mercury depletion events, oxidizing capacity, and dimethylsulfide oxidation to form cloud-condensation nuclei. Among halogen species, the sources and emission mechanisms of inorganic iodine compounds in the polar boundary layer remain unknown. Here, we demonstrate that the production of tri-iodide (I3(-)) via iodide oxidation, which is negligible in aqueous solution, is significantly accelerated in frozen solution, both in the presence and the absence of solar irradiation. Field experiments carried out in the Antarctic region (King George Island, 62°13'S, 58°47'W) also showed that the generation of tri-iodide via solar photo-oxidation was enhanced when iodide was added to various ice media. The emission of gaseous I2 from the irradiated frozen solution of iodide to the gas phase was detected by using cavity ring-down spectroscopy, which was observed both in the frozen state at 253 K and after thawing the ice at 298 K. The accelerated (photo-)oxidation of iodide and the subsequent formation of tri-iodide and I2 in ice appear to be related with the freeze concentration of iodide and dissolved O2 trapped in the ice crystal grain boundaries. We propose that an accelerated abiotic transformation of iodide to gaseous I2 in ice media provides a previously unrecognized formation pathway of active iodine species in the polar atmosphere. PMID:26745029

  19. Tri-State Synfuels Project Review: Volume 12. Fluor project status. [Proposed Henderson, Kentucky coal to gasoline plant; engineering

    SciTech Connect

    Not Available


    The purpose of this report is to document and summarize activities associated with Fluor's efforts on the Tri-State Synfuels Project. The proposed facility was to be coal-to-transport fuels facility located in Henderson, Kentucky. Tri-State Synfuels Company was participating in the project as a partner of the US Department of Energy per terms of a Cooperative Agreement resulting from DOE's synfuel's program solicitation. Fluor's initial work plan called for preliminary engineering and procurement services to the point of commitment for construction for a Sasol Fischer-Tropsch plant. Work proceeded as planned until October 1981 when results of alternative coal-to-methanol studies revealed the economic disadvantage of the Synthol design for US markets. A number of alternative process studies followed to determine the best process configuration. In January 1982 Tri-State officially announced a change from Synthol to a Methanol to Gasoline (MTG) design basis. Further evaluation and cost estimates for the MTG facility eventually led to the conclusion that, given the depressed economic outlook for alternative fuels development, the project should be terminated. Official announcement of cancellation was made on April 13, 1982. At the time of project cancellation, Fluor had completed significant portions of the preliminary engineering effort. Included in this report are descriptions and summaries of Fluor's work during this project. In addition location of key project data and materials is identified and status reports for each operation are presented.

  20. Production of Molecular Iodine and Tri-iodide in the Frozen Solution of Iodide: Implication for Polar Atmosphere.


    Kim, Kitae; Yabushita, Akihiro; Okumura, Masanori; Saiz-Lopez, Alfonso; Cuevas, Carlos A; Blaszczak-Boxe, Christopher S; Min, Dae Wi; Yoon, Ho-Il; Choi, Wonyong


    The chemistry of reactive halogens in the polar atmosphere plays important roles in ozone and mercury depletion events, oxidizing capacity, and dimethylsulfide oxidation to form cloud-condensation nuclei. Among halogen species, the sources and emission mechanisms of inorganic iodine compounds in the polar boundary layer remain unknown. Here, we demonstrate that the production of tri-iodide (I3(-)) via iodide oxidation, which is negligible in aqueous solution, is significantly accelerated in frozen solution, both in the presence and the absence of solar irradiation. Field experiments carried out in the Antarctic region (King George Island, 62°13'S, 58°47'W) also showed that the generation of tri-iodide via solar photo-oxidation was enhanced when iodide was added to various ice media. The emission of gaseous I2 from the irradiated frozen solution of iodide to the gas phase was detected by using cavity ring-down spectroscopy, which was observed both in the frozen state at 253 K and after thawing the ice at 298 K. The accelerated (photo-)oxidation of iodide and the subsequent formation of tri-iodide and I2 in ice appear to be related with the freeze concentration of iodide and dissolved O2 trapped in the ice crystal grain boundaries. We propose that an accelerated abiotic transformation of iodide to gaseous I2 in ice media provides a previously unrecognized formation pathway of active iodine species in the polar atmosphere.

  1. Silicon nanowire-based ring-shaped tri-axial force sensor for smart integration on guidewire

    NASA Astrophysics Data System (ADS)

    Han, Beibei; Yoon, Yong-Jin; Hamidullah, Muhammad; Tsu-Hui Lin, Angel; Park, Woo-Tae


    A ring-shaped tri-axial force sensor with a 200 µm × 200 µm sensor area using silicon nanowires (SiNWs) as piezoresistive sensing elements is developed and characterized. The sensor comprises a suspended ring structure located at the center of four suspended beams that can be integrated on the distal tip of a guidewire by passing through the hollow core of the sensor. SiNWs with a length of 6 µm and a cross section of 90 nm × 90 nm are embedded at the anchor of each silicon bridge along <1 1 0> direction as the piezoresistive sensing element. Finite element analysis has been used to determine the location of maximum stress and the simulation results are verified with the experimental measurements. Taking advantage of the high sensitivity of SiNWs, the fabricated ring-shaped sensor is capable of detecting small displacement in nanometer ranges with a sensitivity of 13.4 × 10-3 µm-1 in the z-direction. This tri-axial force sensor also shows high linearity (>99.9%) to the applied load and no obvious hysteresis is observed. The developed SiNW-based tri-axial force sensor provides new opportunities to implement sensing capability on medical instruments such as guidewires and robotic surgical grippers, where ultra-miniaturization and high sensitivity are essential.

  2. Chaperonin TRiC/CCT Modulates the Folding and Activity of Leukemogenic Fusion Oncoprotein AML1-ETO.


    Roh, Soung-Hun; Kasembeli, Moses; Galaz-Montoya, Jesús G; Trnka, Mike; Lau, Wilson Chun-Yu; Burlingame, Alma; Chiu, Wah; Tweardy, David J


    AML1-ETO is the most common fusion oncoprotein causing acute myeloid leukemia (AML), a disease with a 5-year survival rate of only 24%. AML1-ETO functions as a rogue transcription factor, altering the expression of genes critical for myeloid cell development and differentiation. Currently, there are no specific therapies for AML1-ETO-positive AML. While known for decades to be the translational product of a chimeric gene created by the stable chromosome translocation t(8;21)(q22;q22), it is not known how AML1-ETO achieves its native and functional conformation or whether this process can be targeted for therapeutic benefit. Here, we show that the biosynthesis and folding of the AML1-ETO protein is facilitated by interaction with the essential eukaryotic chaperonin TRiC (or CCT). We demonstrate that a folding intermediate of AML1-ETO binds to TRiC directly, mainly through its β-strand rich, DNA-binding domain (AML-(1-175)), with the assistance of HSP70. Our results suggest that TRiC contributes to AML1-ETO proteostasis through specific interactions between the oncoprotein's DNA-binding domain, which may be targeted for therapeutic benefit.

  3. Analysis of aberrant virulence of Gibberella zeae following transformation-mediated complementation of a trichothecene-deficient (Tri5) mutant.


    Desjardins, A E; Bai, G h; Plattner, R D; Proctor, R H


    Gibberella zeae causes wheat ear blight and produces trichothecene toxins in infected grain. In previous studies, trichothecene production in this fungus was disabled by specific disruption of the trichodiene synthase gene (Tri5) and was restored by two methods: gene reversion and transformation-mediated mutant complementation. In previous field tests of wheat ear blight, trichothecene-nonproducing mutants were less virulent than the wild-type progenitor strain from which they were derived. Trichothecene-producing revertants also were restored to wild-type levels of virulence. In contrast, in the field test of wheat ear blight reported here, trichothecene-producing strains obtained by Tri5 mutant complementation were not restored to wild-type levels of virulence. The complemented mutants showed a slightly reduced radial growth compared to the wild-type strain, but otherwise appeared normal in morphology, pigmentation and sexual fertility. Genetic analysis indicated that the aberrant virulence of a complemented mutant was likely due to non-target effects that occurred during the process of transforming the trichothecene-nonproducing mutant with Tri5. These results confirm previous findings that trichothecenes contribute to the virulence of G. zeae, but also demonstrate that manipulating this fungus in the laboratory may cause it to undergo subtle changes that reduce its virulence. PMID:10931910

  4. Two-dimensional imaging of Debye-Scherrer ring for tri-axial stress analysis of industrial materials

    NASA Astrophysics Data System (ADS)

    Sasaki, T.; Maruyama, Y.; Ohba, H.; Ejiri, S.


    In this study, an application of the two-dimensional imaging technology to the X ray tri-axial stress analysis was studied. An image plate (IP) was used to obtain a Debye-Scherre ring and the image data was analized for determining stress. A new principle for stress analysis which is suitable to two-dimensional imaging data was used. For the verification of this two-dimensional imaging type X-ray stress measurement method, an experiment was conducted using a ferritic steel sample which was processed with a surface grinder. Tri-axial stress analysis was conducted to evaluate the sample. The conventional method for X-ray tri-axial stress analysis proposed by Dölle and Hauk was used to evaluate residual stress in order to compare with the present method. As a result, it was confirmed that a sufficiently highly precise and high-speed stress measurement was enabled with the two-dimensional imaging technology compared with the conventional method.

  5. 75 FR 25310 - Port Harbor Railroad, Inc.-Lease and Operation Exemption-Line of Tri-City Regional Port District

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Surface Transportation Board Port Harbor Railroad, Inc.--Lease and Operation Exemption--Line of Tri-City... operate, a 2.97-mile line of railroad extending between milepost 0.00 and milepost 2.97 in Madison County..., the industries located on Tri-City's property receive service over the rail lines of the...

  6. Analysis of the small interfering RNA profiles of randomly inserted pTRM-TRI6 Fusarium graminearum mutants and their DON related phenotypes

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Deoxynivalenol (DON) production by Fusarium graminearum requires activation of the trichothecene pathway in which TRI5 catalyzes the first step of trichothecene synthesis and TRI6 is a transcription factor activates the pathway. RNA interference (RNAi) has emerged as a useful fungal genetics tool f...

  7. 40 CFR 721.642 - Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and...

    Code of Federal Regulations, 2014 CFR


    ... unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and tetrapropylenepenta-. 721.642 Section 721.642... Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and... substances amines, N-(C14-18 and C16-18 unsaturated alkyl)] dipropylenetri-, (PMN...

  8. 40 CFR 721.642 - Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and...

    Code of Federal Regulations, 2011 CFR


    ... unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and tetrapropylenepenta-. 721.642 Section 721.642... Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and... substances amines, N-(C14-18 and C16-18 unsaturated alkyl)] dipropylenetri-, (PMN...

  9. 40 CFR 721.642 - Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and...

    Code of Federal Regulations, 2010 CFR


    ... unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and tetrapropylenepenta-. 721.642 Section 721.642... Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and... substances amines, N-(C14-18 and C16-18 unsaturated alkyl)] dipropylenetri-, (PMN...

  10. 40 CFR 721.642 - Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and...

    Code of Federal Regulations, 2013 CFR


    ... unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and tetrapropylenepenta-. 721.642 Section 721.642... Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and... substances amines, N-(C14-18 and C16-18 unsaturated alkyl)] dipropylenetri-, (PMN...

  11. 40 CFR 721.642 - Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and...

    Code of Federal Regulations, 2012 CFR


    ... unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and tetrapropylenepenta-. 721.642 Section 721.642... Amines, N-(C14-18 and C16-16 unsaturated alkyl)] dipropylene-tri-, tripropylenetetra-, and... substances amines, N-(C14-18 and C16-18 unsaturated alkyl)] dipropylenetri-, (PMN...

  12. Rice Rab11 is required for JA-mediated defense signaling

    SciTech Connect

    Hong, Min Ji; Lee, Yun mi; Son, Young Sim; Im, Chak Han; Yi, Young Byung; Rim, Yeong Gil; Bahk, Jeong Dong; Heo, Jae Bok


    Highlights: •OsRab11 interacts with OsOPR8. •OsOPR8 is localized in the cytosol and peroxisome. •OsRab11 enhances the NADPH consumption by OsOPR8. •Transgenic Arabidopsis overexpressing OsRab11 represents a pathogen-resistant phenotype. -- Abstract: Rab proteins play an essential role in regulating vesicular transport in eukaryotic cells. Previously, we characterized OsRab11, which in concert with OsGAP1 and OsGDI3 regulates vesicular trafficking from the trans-Golgi network (TGN) to the plasma membrane or vacuole. To further elucidate the physiological function of OsRab11 in plants, we performed yeast two-hybrid screens using OsRab11 as bait. OsOPR8 was isolated and shown to interact with OsRab11. A co-immunoprecipitation assay confirmed this interaction. The green fluorescent protein-OsOPR8 fusion product was targeted to the cytoplasm and peroxisomes of protoplasts from Arabidopsis thaliana. OsOPR8 exhibited NADPH-dependent reduction activity when 2-cyclohexen-1-one (CyHE) and 12-oxo-phytodienoic acid (OPDA) were supplied as possible substrates. Interestingly, NADPH oxidation by OsOPR8 was increased when wild-type OsRab11 or the constitutively active form of OsRab11 (Q78L) were included in the reaction mix, but not when the dominant negative form of OsRab11 (S28N) was included. OsRab11 was expressed broadly in plants and both OsRab11 and OsOPR8 were induced by jasmonic acid (JA) and elicitor treatments. Overexpressed OsRab11 transgenic plants showed resistance to pathogens through induced expression of JA-responsive genes. In conclusion, OsRab11 may be required for JA-mediated defense signaling by activating the reducing activity of OsOPR8.

  13. Permeability Changes of Coal Cores and Briquettes under Tri-Axial Stress Conditions

    NASA Astrophysics Data System (ADS)

    Wierzbicki, Mirosław; Konečný, Pavel; Kožušníková, Alena


    The paper is dealing with the permeability of coal in triaxial state of stress. The permeability of coal, besides coal's methane capacity, is the main parameter determining the quantity of methane inflow into underground excavations. The stress in a coal seam is one of the most important factors influencing coal permeability therefore the permeability measurements were performed in tri-axial state of stress. The hydrostatic three-axial state of stress was gradually increased from 5 MPa with steps of 5 MPa up to a maximum of 30 MPa. Nitrogen was applied as a gas medium in all experiments. The results of the permeability measurements of coal cores from the "Zofiówka" mine, Poland, and three mines from the Czech Republic are presented in this paper. As a "reference", permeability measurements were also taken for coal briquettes prepared from coal dust with defined porosity. It was confirmed that the decreasing porosity of coal briquettes affects the decreasing permeability. The advantage of experimentation on coal briquettes is its good repeatability. From the experimental results, an empirical relation between gas permeability and confining pressure has also been identified. The empirical relation for coal briquettes is in good correspondence with published results. However, for coal cores, the character of change differs. The influence of confining pressure has a different character and the decrease in permeability is stronger due to the increasing confining pressure Przepuszczalność węgla, oprócz pojemności sorpcyjnej względem metanu jest głównym parametrem określającym dopływ metanu do podziemnych wyrobiskach górniczych. W warunkach naturalnych wartość przepuszczalności jest ściśle związana ze stanem naprężenia w pokładzie węgla. W pracy przedstawiono wyniki pomiarów przepuszczalności wykonanych w trójosiowym stanie naprężenia. Hydrostatyczny trójosiowy stan naprężenia stopniowo zwiększano od 5 MPa do maksymalnie 30 MPa z krokiem

  14. The tomato res mutant which accumulates JA in roots in non-stressed conditions restores cell structure alterations under salinity.


    Garcia-Abellan, José O; Fernandez-Garcia, Nieves; Lopez-Berenguer, Carmen; Egea, Isabel; Flores, Francisco B; Angosto, Trinidad; Capel, Juan; Lozano, Rafael; Pineda, Benito; Moreno, Vicente; Olmos, Enrique; Bolarin, Maria C


    Jasmonic acid (JA) regulates a wide spectrum of plant biological processes, from plant development to stress defense responses. The role of JA in plant response to salt stress is scarcely known, and even less known is the specific response in root, the main plant organ responsible for ionic uptake and transport to the shoot. Here we report the characterization of the first tomato (Solanum lycopersicum) mutant, named res (restored cell structure by salinity), that accumulates JA in roots prior to exposure to stress. The res tomato mutant presented remarkable growth inhibition and displayed important morphological alterations and cellular disorganization in roots and leaves under control conditions, while these alterations disappeared when the res mutant plants were grown under salt stress. Reciprocal grafting between res and wild type (WT) (tomato cv. Moneymaker) indicated that the main organ responsible for the development of alterations was the root. The JA-signaling pathway is activated in res roots prior to stress, with transcripts levels being even higher in control condition than in salinity. Future studies on this mutant will provide significant advances in the knowledge of JA role in root in salt-stress tolerance response, as well as in the energy trade-off between plant growth and response to stress.

  15. Novel JAZ co-operativity and unexpected JA dynamics underpin Arabidopsis defence responses to Pseudomonas syringae infection.


    de Torres Zabala, Marta; Zhai, Bing; Jayaraman, Siddharth; Eleftheriadou, Garoufalia; Winsbury, Rebecca; Yang, Ron; Truman, William; Tang, Saijung; Smirnoff, Nicholas; Grant, Murray


    Pathogens target phytohormone signalling pathways to promote disease. Plants deploy salicylic acid (SA)-mediated defences against biotrophs. Pathogens antagonize SA immunity by activating jasmonate signalling, for example Pseudomonas syringae pv. tomato DC3000 produces coronatine (COR), a jasmonic acid (JA) mimic. This study found unexpected dynamics between SA, JA and COR and co-operation between JAZ jasmonate repressor proteins during DC3000 infection. We used a systems-based approach involving targeted hormone profiling, high-temporal-resolution micro-array analysis, reverse genetics and mRNA-seq. Unexpectedly, foliar JA did not accumulate until late in the infection process and was higher in leaves challenged with COR-deficient P. syringae or in the more resistant JA receptor mutant coi1. JAZ regulation was complex and COR alone was insufficient to sustainably induce JAZs. JAZs contribute to early basal and subsequent secondary plant defence responses. We showed that JAZ5 and JAZ10 specifically co-operate to restrict COR cytotoxicity and pathogen growth through a complex transcriptional reprogramming that does not involve the basic helix-loop-helix transcription factors MYC2 and related MYC3 and MYC4 previously shown to restrict pathogen growth. mRNA-seq predicts compromised SA signalling in a jaz5/10 mutant and rapid suppression of JA-related components on bacterial infection. PMID:26428397

  16. Crystal structure of bis­(ethyl­enedi­thio)­tetra­thia­fulvalenium μ2-acetato-bis­[tri­bromido­rhenate(III)] 1,1,2-tri­chloro­ethane hemisolvate

    PubMed Central

    Golichenko, Alexander A.; Kravchenko, Andrey V.; Omelchenko, Irina V.; Chudak, Denis M.; Starodub, Vladimir A.; Barszcz, Boleslaw; Shtemenko, Alexander V.


    The asymmetric unit of the title salt, (C10H8S8)[Re2Br6(CH3COO)]·0.5C2H3Cl3, contains one bis­(ethyl­enedi­thio)­tetra­thia­fulvalene (ET) radical cation, one μ2-acetato-bis­[tri­bromido­rhenate(III)] anion and a 1,1,2-tri­chloro­ethane mol­ecule with half-occupancy disordered about a twofold rotation axis. The tetra­thia­fulvalene fragment adopts an almost planar configuration typical of the ET radical cation. The C atoms of both ethyl­enedi­thio fragments in the cation are disordered over two orientations with occupancy factors 0.65:0.35 and 0.77:0.23. In the anion, six Br atoms and a μ2-acetate ligand form a strongly distorted cubic O2Br6 coordination polyhedron around the Re2 dinuclear centre. In the crystal, centrosymmetrically related ET cations and Re2O2Br6 anions are linked into dimers by π–π stacking inter­actions [centroid-to-centroid distance = 3.826 (8) Å] and by pairs of additional Re⋯Br contacts [3.131 (3) Å], respectively. The dimers are further packed into a three-dimensional network by non-directional inter­ionic electrostatic forces and by C—H⋯Br and C—H⋯S hydrogen bonds. The disordered 1,1,2-tri­chloro­ethane mol­ecules occupy solvent-accessible channels along the b axis. PMID:27308025

  17. Crystal structure of bis-(ethyl-enedi-thio)-tetra-thia-fulvalenium μ2-acetato-bis-[tri-bromido-rhenate(III)] 1,1,2-tri-chloro-ethane hemisolvate.


    Golichenko, Alexander A; Kravchenko, Andrey V; Omelchenko, Irina V; Chudak, Denis M; Starodub, Vladimir A; Barszcz, Boleslaw; Shtemenko, Alexander V


    The asymmetric unit of the title salt, (C10H8S8)[Re2Br6(CH3COO)]·0.5C2H3Cl3, contains one bis-(ethyl-enedi-thio)-tetra-thia-fulvalene (ET) radical cation, one μ2-acetato-bis-[tri-bromido-rhenate(III)] anion and a 1,1,2-tri-chloro-ethane mol-ecule with half-occupancy disordered about a twofold rotation axis. The tetra-thia-fulvalene fragment adopts an almost planar configuration typical of the ET radical cation. The C atoms of both ethyl-enedi-thio fragments in the cation are disordered over two orientations with occupancy factors 0.65:0.35 and 0.77:0.23. In the anion, six Br atoms and a μ2-acetate ligand form a strongly distorted cubic O2Br6 coordination polyhedron around the Re2 dinuclear centre. In the crystal, centrosymmetrically related ET cations and Re2O2Br6 anions are linked into dimers by π-π stacking inter-actions [centroid-to-centroid distance = 3.826 (8) Å] and by pairs of additional Re⋯Br contacts [3.131 (3) Å], respectively. The dimers are further packed into a three-dimensional network by non-directional inter-ionic electrostatic forces and by C-H⋯Br and C-H⋯S hydrogen bonds. The disordered 1,1,2-tri-chloro-ethane mol-ecules occupy solvent-accessible channels along the b axis. PMID:27308025

  18. L-Tryptophan catabolism by Rubrivivax benzoatilyticus JA2 occurs through indole 3-pyruvic acid pathway.


    Kumavath, Ranjith N; Ramana, Ch V; Sasikala, Ch


    Rubrivivax benzoatilyticus JA2 utilizes L: -tryptophan as the sole source of nitrogen for growth, and it has a doubling time of approximately 11 h (compared to 8 h with ammonium chloride). With cell free extracts in the presence of 2-oxoglutarate, indole-3-pyruvic acid, indole-3-acetaldehyde, indole-3-acetic acid, isatin, benzaldehyde, gallic acid and pyrogallol were identified using high performance liquid chromatography (HPLC) and liquid chromatography-mass spectroscopy (LC-MS) analysis. The conversion of L: -tryptophan into indole 3-pyruvic acid and glutamate by an enzyme aminotransferase was confirmed and the catabolism of indole-3-pyruvic acid via side chain oxidation followed by ring oxidation, gallic acid and pyrogallol were confirmed as metabolites. In addition, the proposed pathway sequential conversion of indole-3-pyruvic acid to the end product of pyrogallol was identified, including an enzymatic step that would convert isatin to benzaldehyde by an enzyme yet to be identified. At this stage of the study, the enzyme tryptophan aminotransferase in R. benzoatilyticus JA2 was demonstrated.

  19. Early dust formation and a massive progenitor for SN 2011ja?

    NASA Astrophysics Data System (ADS)

    Andrews, J. E.; Krafton, Kelsie M.; Clayton, Geoffrey C.; Montiel, E.; Wesson, R.; Sugerman, Ben E. K.; Barlow, M. J.; Matsuura, M.; Drass, H.


    SN 2011ja was a bright (I = -18.3) Type II supernova occurring in the nearby edge on spiral galaxy NGC 4945. Flat-topped and multipeaked H α and H β spectral emission lines appear between 64 and 84 d post-explosion, indicating interaction with a disc-like circumstellar medium inclined ˜45° from edge-on. After day 84, an increase in the H- and K-band flux along with heavy attenuation of the red wing of the emission lines are strong indications of early dust formation, likely located in the cool dense shell created between the forward shock of the SN ejecta and the reverse shock created as the ejecta plows into the existing circumstellar material. Radiative transfer modelling reveals both ≈1 × 10-5 M⊙ of pre-existing dust located ˜1016.7 cm away and up to ≈6 × 10-4 M⊙ of newly formed dust. Spectral observations after 1.5 yr reveal the possibility that the fading SN is located within a young (3-6 Myr) massive stellar cluster, which when combined with tentative 56Ni mass estimates of 0.2 M⊙ may indicate a massive (≥25 M⊙) progenitor for SN 2011ja.

  20. Draft genome sequence of Rhodomicrobium udaipurense JA643T with special reference to hopanoid biosynthesis.


    Tushar, L; Sasikala, Ch; Ramana, Ch V


    Hopanoids are present in vast amounts as integral components of bacteria and plants with their primary function to strengthen rigidity of the plasma membrane. To establish their roles more precisely, we conducted sequencing of the whole genome of Rhodomicrobium udaipurense JA643(T) isolated from a fresh water stream of Udaipur in Himachal Pradesh, India, by using the Illumina HiSeq pair end chemistry of 2 × 100 bp platform. Determined genome showed a high degree of similarity to the genome of R. vannielii ATCC17100(T) and the 13.7 million reads generated a sequence of 3,649,277 bp possessing 3,611 putative genes. The genomic data were subsequently investigated with respect to genes involved in various features. The machinery required for the degradation of aromatic compounds and resistance to solvents as well as all that required for photosynthesis are present in this organism. Also, through extensive functional annotation, 18 genes involved in the biosynthesis of hopanoids are predicted, namely those responsible for the synthesis of diploptene, diplopterol, adenosylhopane, ribosylhopane, aminobacteriohopanetriol, glycosyl group containing hopanoids and unsaturated hopanoids. The hopanoid biosynthetic pathway was then inferred based on the genes identified and through experimental validation of individual hopanoid molecules. The genome data of R. udaipurense JA643(T) will be useful in understanding the functional features of hopanoids in this bacterium.

  1. Transcriptome sequencing and de novo analysis of cytoplasmic male sterility and maintenance in JA-CMS cotton.


    Yang, Peng; Han, Jinfeng; Huang, Jinling


    Cytoplasmic male sterility (CMS) is the failure to produce functional pollen, which is inherited maternally. And it is known that anther development is modulated through complicated interactions between nuclear and mitochondrial genes in sporophytic and gametophytic tissues. However, an unbiased transcriptome sequencing analysis of CMS in cotton is currently lacking in the literature. This study compared differentially expressed (DE) genes of floral buds at the sporogenous cells stage (SS) and microsporocyte stage (MS) (the two most important stages for pollen abortion in JA-CMS) between JA-CMS and its fertile maintainer line JB cotton plants, using the Illumina HiSeq 2000 sequencing platform. A total of 709 (1.8%) DE genes including 293 up-regulated and 416 down-regulated genes were identified in JA-CMS line comparing with its maintainer line at the SS stage, and 644 (1.6%) DE genes with 263 up-regulated and 381 down-regulated genes were detected at the MS stage. By comparing the two stages in the same material, there were 8 up-regulated and 9 down-regulated DE genes in JA-CMS line and 29 up-regulated and 9 down-regulated DE genes in JB maintainer line at the MS stage. Quantitative RT-PCR was used to validate 7 randomly selected DE genes. Bioinformatics analysis revealed that genes involved in reduction-oxidation reactions and alpha-linolenic acid metabolism were down-regulated, while genes pertaining to photosynthesis and flavonoid biosynthesis were up-regulated in JA-CMS floral buds compared with their JB counterparts at the SS and/or MS stages. All these four biological processes play important roles in reactive oxygen species (ROS) homeostasis, which may be an important factor contributing to the sterile trait of JA-CMS. Further experiments are warranted to elucidate molecular mechanisms of these genes that lead to CMS.

  2. Three-Dimensional Microfluidic Tri-Culture Model of the Bone Marrow Microenvironment for Study of Acute Lymphoblastic Leukemia.


    Bruce, Allison; Evans, Rebecca; Mezan, Ryan; Shi, Lin; Moses, Blake S; Martin, Karen H; Gibson, Laura F; Yang, Yong


    Acute lymphoblastic leukemia (ALL) initiates and progresses in the bone marrow, and as such, the marrow microenvironment is a critical regulatory component in development of this cancer. However, ALL studies were conducted mainly on flat plastic substrates, which do not recapitulate the characteristics of marrow microenvironments. To study ALL in a model of in vivo relevance, we have engineered a 3-D microfluidic cell culture platform. Biologically relevant populations of primary human bone marrow stromal cells, osteoblasts and human leukemic cells representative of an aggressive phenotype were encapsulated in 3-D collagen matrix as the minimal constituents and cultured in a microfluidic platform. The matrix stiffness and fluidic shear stress were controlled in a physiological range. The 3-D microfluidic as well as 3-D static models demonstrated coordinated cell-cell interactions between these cell types compared to the compaction of the 2-D static model. Tumor cell viability in response to an antimetabolite chemotherapeutic agent, cytarabine in tumor cells alone and tri-culture models for 2-D static, 3-D static and 3-D microfluidic models were compared. The present study showed decreased chemotherapeutic drug sensitivity of leukemic cells in 3-D tri-culture models from the 2-D models. The results indicate that the bone marrow microenvironment plays a protective role in tumor cell survival during drug treatment. The engineered 3-D microfluidic tri-culture model enables systematic investigation of effects of cell-cell and cell-matrix interactions on cancer progression and therapeutic intervention in a controllable manner, thus improving our limited comprehension of the role of microenvironmental signals in cancer biology. PMID:26488876

  3. Wireless Tri-Axial Trunk Accelerometry Detects Deviations in Dynamic Center of Mass Motion Due to Running-Induced Fatigue

    PubMed Central


    Small wireless trunk accelerometers have become a popular approach to unobtrusively quantify human locomotion and provide insights into both gait rehabilitation and sports performance. However, limited evidence exists as to which trunk accelerometry measures are suitable for the purpose of detecting movement compensations while running, and specifically in response to fatigue. The aim of this study was therefore to detect deviations in the dynamic center of mass (CoM) motion due to running-induced fatigue using tri-axial trunk accelerometry. Twenty runners aged 18–25 years completed an indoor treadmill running protocol to volitional exhaustion at speeds equivalent to their 3.2 km time trial performance. The following dependent measures were extracted from tri-axial trunk accelerations of 20 running steps before and after the treadmill fatigue protocol: the tri-axial ratio of acceleration root mean square (RMS) to the resultant vector RMS, step and stride regularity (autocorrelation procedure), and sample entropy. Running-induced fatigue increased mediolateral and anteroposterior ratios of acceleration RMS (p < .05), decreased the anteroposterior step regularity (p < .05), and increased the anteroposterior sample entropy (p < .05) of trunk accelerometry patterns. Our findings indicate that treadmill running-induced fatigue might reveal itself in a greater contribution of variability in horizontal plane trunk accelerations, with anteroposterior trunk accelerations that are less regular from step-to-step and are less predictable. It appears that trunk accelerometry parameters can be used to detect deviations in dynamic CoM motion induced by treadmill running fatigue, yet it is unknown how robust or generalizable these parameters are to outdoor running environments. PMID:26517261

  4. Three-Dimensional Microfluidic Tri-Culture Model of the Bone Marrow Microenvironment for Study of Acute Lymphoblastic Leukemia

    PubMed Central

    Bruce, Allison; Evans, Rebecca; Mezan, Ryan; Shi, Lin; Moses, Blake S.; Martin, Karen H.; Gibson, Laura F.; Yang, Yong


    Acute lymphoblastic leukemia (ALL) initiates and progresses in the bone marrow, and as such, the marrow microenvironment is a critical regulatory component in development of this cancer. However, ALL studies were conducted mainly on flat plastic substrates, which do not recapitulate the characteristics of marrow microenvironments. To study ALL in a model of in vivo relevance, we have engineered a 3-D microfluidic cell culture platform. Biologically relevant populations of primary human bone marrow stromal cells, osteoblasts and human leukemic cells representative of an aggressive phenotype were encapsulated in 3-D collagen matrix as the minimal constituents and cultured in a microfluidic platform. The matrix stiffness and fluidic shear stress were controlled in a physiological range. The 3-D microfluidic as well as 3-D static models demonstrated coordinated cell-cell interactions between these cell types compared to the compaction of the 2-D static model. Tumor cell viability in response to an antimetabolite chemotherapeutic agent, cytarabine in tumor cells alone and tri-culture models for 2-D static, 3-D static and 3-D microfluidic models were compared. The present study showed decreased chemotherapeutic drug sensitivity of leukemic cells in 3-D tri-culture models from the 2-D models. The results indicate that the bone marrow microenvironment plays a protective role in tumor cell survival during drug treatment. The engineered 3-D microfluidic tri-culture model enables systematic investigation of effects of cell-cell and cell-matrix interactions on cancer progression and therapeutic intervention in a controllable manner, thus improving our limited comprehension of the role of microenvironmental signals in cancer biology. PMID:26488876

  5. Genomic DNA extraction from medicinal plants available in Malaysia using a TriOmic(TM) improved extraction kit.


    Mohd-Hairul, A R; Sade, A B; Yiap, B C; Raha, A R


    DNA extraction was carried out on 32 medicinal plant samples available in Malaysia using the TriOmic(TM) extraction kit. Amounts of 0.1 g flowers or young leaves were ground with liquid nitrogen, lysed at 65°C in RY1(plus) buffer and followed by RNAse treatment. Then, RY2 buffer was added to the samples and mixed completely by vortexing before removal of cell debris by centrifugation. Supernatants were transferred to fresh microcentrifuge tubes and 0.1 volume RY3 buffer was added to each of the transferred supernatant. The mixtures were applied to spin columns followed by a centrifugation step to remove buffers and other residues. Washing step was carried out twice by applying 70% ethanol to the spin columns. Genomic DNA of the samples was recovered by applying 50 μL TE buffer to the membrane of each spin column, followed by a centrifugation step at room temperature. A modification of the TriOmic(TM) extraction procedure was carried out by adding chloroform:isoamyl alcohol (24:1) steps in the extraction procedure. The genomic DNA extracted from most of the 32 samples showed an increase of total yield when chloroform:isoamyl alcohol (24:1) steps were applied in the TriOmicTM extraction procedure. This preliminary study is very important for molecular studies of medicinal plants available in Malaysia since the DNA extraction can be completed in a shorter period of time (within 1 h) compared to manual extraction, which entails applying phenol, chloroform and ethanol precipitation, and requires 1-2 days to complete.

  6. Wireless Tri-Axial Trunk Accelerometry Detects Deviations in Dynamic Center of Mass Motion Due to Running-Induced Fatigue.


    Schütte, Kurt H; Maas, Ellen A; Exadaktylos, Vasileios; Berckmans, Daniel; Venter, Rachel E; Vanwanseele, Benedicte


    Small wireless trunk accelerometers have become a popular approach to unobtrusively quantify human locomotion and provide insights into both gait rehabilitation and sports performance. However, limited evidence exists as to which trunk accelerometry measures are suitable for the purpose of detecting movement compensations while running, and specifically in response to fatigue. The aim of this study was therefore to detect deviations in the dynamic center of mass (CoM) motion due to running-induced fatigue using tri-axial trunk accelerometry. Twenty runners aged 18-25 years completed an indoor treadmill running protocol to volitional exhaustion at speeds equivalent to their 3.2 km time trial performance. The following dependent measures were extracted from tri-axial trunk accelerations of 20 running steps before and after the treadmill fatigue protocol: the tri-axial ratio of acceleration root mean square (RMS) to the resultant vector RMS, step and stride regularity (autocorrelation procedure), and sample entropy. Running-induced fatigue increased mediolateral and anteroposterior ratios of acceleration RMS (p < .05), decreased the anteroposterior step regularity (p < .05), and increased the anteroposterior sample entropy (p < .05) of trunk accelerometry patterns. Our findings indicate that treadmill running-induced fatigue might reveal itself in a greater contribution of variability in horizontal plane trunk accelerations, with anteroposterior trunk accelerations that are less regular from step-to-step and are less predictable. It appears that trunk accelerometry parameters can be used to detect deviations in dynamic CoM motion induced by treadmill running fatigue, yet it is unknown how robust or generalizable these parameters are to outdoor running environments.

  7. Effects of advertisements on smokers’ interest in trying e-cigarettes: the roles of product comparison and visual cues

    PubMed Central

    Pepper, Jessica K; Emery, Sherry L; Ribisl, Kurt M; Southwell, Brian G; Brewer, Noel T


    Introduction Electronic cigarettes (e-cigarettes) are battery-powered nicotine delivery devices that have become popular among smokers. We conducted an experiment to understand adult smokers’ responses to e-cigarette advertisements and investigate the impact of ads’ arguments and imagery. Methods A US national sample of smokers who had never tried e-cigarettes (n=3253) participated in a between-subjects experiment. Smokers viewed an online advertisement promoting e-cigarettes using one of three comparison types (emphasising similarity to regular cigarettes, differences or neither) with one of three images, for nine conditions total. Smokers then indicated their interest in trying e-cigarettes. Results Ads that emphasised differences between e-cigarettes and regular cigarettes elicited more interest than ads without comparisons (p<0.01), primarily due to claims about e-cigarettes’ lower cost, greater healthfulness and utility for smoking cessation. However, ads that emphasised the similarities of the products did not differ from ads without comparisons. Ads showing a person using an e-cigarette created more interest than ads showing a person without an e-cigarette (p<0.01). Conclusions Interest in trying e-cigarettes was highest after viewing ads with messages about differences between regular and electronic cigarettes and ads showing product use. If e-cigarettes prove to be harmful or ineffective cessation devices, regulators might restrict images of e-cigarette use in advertising, and public health messages should not emphasise differences between regular and electronic cigarettes. To inform additional regulations, future research should seek to identify what advertising messages and features appeal to youth. PMID:24935896

  8. Tri-peptide reference structures for the calculation of relative solvent accessible surface area in protein amino acid residues.


    Topham, Christopher M; Smith, Jeremy C


    Relative amino acid residue solvent accessibility values allow the quantitative comparison of atomic solvent-accessible surface areas in different residue types and physical environments in proteins and in protein structural alignments. Geometry-optimised tri-peptide structures in extended solvent-exposed reference conformations have been obtained for 43 amino acid residue types at a high level of quantum chemical theory. Significant increases in side-chain solvent accessibility, offset by reductions in main-chain atom solvent exposure, were observed for standard residue types in partially geometry-optimised structures when compared to non-minimised models built from identical sets of proper dihedral angles abstracted from the literature. Optimisation of proper dihedral angles led most notably to marked increases of up to 54% in proline main-chain atom solvent accessibility compared to literature values. Similar effects were observed for fully-optimised tri-peptides in implicit solvent. The relief of internal strain energy was associated with systematic variation in N, C(α) and C(β) atom solvent accessibility across all standard residue types. The results underline the importance of optimisation of 'hard' degrees of freedom (bond lengths and valence bond angles) and improper dihedral angle values from force field or other context-independent reference values, and impact on the use of standardised fixed internal co-ordinate geometry in sampling approaches to the determination of absolute values of protein amino acid residue solvent accessibility. Quantum chemical methods provide a useful and accurate alternative to molecular mechanics methods to perform energy minimisation of peptides containing non-standard (chemically modified) amino acid residues frequently present in experimental protein structure data sets, for which force field parameters may not be available. Reference tri-peptide atomic co-ordinate sets including hydrogen atoms are made freely available

  9. Transitions from mono- to co- to tri-culture uniquely affect gene expression in breast cancer, stromal, and immune compartments

    PubMed Central

    Weinberger, Emma M.; Regehr, Keil J.; Berry, Scott M.; Beebe, David J.; Alarid, Elaine T.


    Heterotypic interactions in cancer microenvironments play important roles in disease initiation, progression, and spread. Co-culture is the predominant approach used in dissecting paracrine interactions between tumor and stromal cells, but functional results from simple co-cultures frequently fail to correlate to in vivo conditions. Though complex heterotypic in vitro models have improved functional relevance, there is little systematic knowledge of how multi-culture parameters influence this recapitulation. We therefore have employed a more iterative approach to investigate the influence of increasing model complexity; increased heterotypic complexity specifically. Here we describe how the compartmentalized and microscale elements of our multi-culture device allowed us to obtain gene expression data from one cell type at a time in a heterotypic culture where cells communicated through paracrine interactions. With our device we generated a large dataset comprised of cell type specific gene-expression patterns for cultures of increasing complexity (three cell types in mono-, co-, or tri-culture) not readily accessible in other systems. Principal component analysis indicated that gene expression was changed in co-culture but was often more strongly altered in tri-culture as compared to mono-culture. Our analysis revealed that cell type identity and the complexity around it (mono-, co-, or tri-culture) influence gene regulation. We also observed evidence of complementary regulation between cell types in the same heterotypic culture. Here we demonstrate the utility of our platform in providing insight into how tumor and stromal cells respond to microenvironments of varying complexities highlighting the expanding importance of heterotypic cultures that go beyond conventional co-culture. PMID:27432323

  10. Vaccinia-Related Kinase 2 Controls the Stability of the Eukaryotic Chaperonin TRiC/CCT by Inhibiting the Deubiquitinating Enzyme USP25

    PubMed Central

    Kim, Sangjune; Lee, Dohyun; Lee, Juhyun; Song, Haengjin; Kim, Hyo-Jin


    Molecular chaperones monitor the proper folding of misfolded proteins and function as the first line of defense against mutant protein aggregation in neurodegenerative diseases. The eukaryotic chaperonin TRiC is a potent suppressor of mutant protein aggregation and toxicity in early stages of disease progression. Elucidation of TRiC functional regulation will enable us to better understand the pathological mechanisms of neurodegeneration. We have previously shown that vaccinia-related kinase 2 (VRK2) downregulates TRiC protein levels through the ubiquitin-proteasome system by recruiting the E3 ligase COP1. However, although VRK2 activity was necessary in TRiC downregulation, the phosphorylated substrate was not determined. Here, we report that USP25 is a novel TRiC interacting protein that is also phosphorylated by VRK2. USP25 catalyzed deubiquitination of the TRiC protein and stabilized the chaperonin, thereby reducing accumulation of misfolded polyglutamine protein aggregates. Notably, USP25 deubiquitinating activity was suppressed when VRK2 phosphorylated the Thr680, Thr727, and Ser745 residues. Impaired USP25 deubiquitinating activity after VRK2-mediated phosphorylation may be a critical pathway in TRiC protein destabilization. PMID:25755282

  11. Combined metabonomic and quantitative real-time PCR analyses reveal systems metabolic changes of Fusarium graminearum induced by Tri5 gene deletion.


    Chen, Fangfang; Zhang, Jingtao; Song, Xiushi; Yang, Jian; Li, Heping; Tang, Huiru; Liao, Yu-Cai


    Fusarium graminearum (FG) is a serious plant pathogen causing huge losses in global production of wheat and other cereals. Tri5-gene encoded trichodiene synthase is the first key enzyme for biosynthesis of trichothecene mycotoxins in FG. To further our understandings of FG metabolism which is essential for developing novel strategies for controlling FG, we conducted a comprehensive investigation on the metabolic changes caused by Tri5-deletion by comparing metabolic differences between the wild-type FG5035 and an FG strain, Tri5(-), with Tri5 deleted. NMR methods identified more than 50 assigned fungal metabolites. Combined metabonomic and quantitative RT-PCR (qRT-PCR) analyses revealed that Tri5 deletion caused significant and comprehensive metabolic changes for FG apart from mycotoxin biosynthesis. These changes involved both carbon and nitrogen metabolisms including alterations in GABA shunt, TCA cycle, shikimate pathway, and metabolisms of lipids, amino acids, inositol, choline, pyrimidine, and purine. The hexose transporter has also been affected. These findings have shown that Tri5 gene deletion induces widespread changes in FG primary metabolism and demonstrated the combination of NMR-based metabonomics and qRT-PCR analyses as a useful way to understand the systems metabolic changes resulting from a single specific gene knockout in an eukaryotic genome and thus Tri5 gene functions. PMID:21413710

  12. Tri-material multilayer coatings with high reflectivity and wide bandwidth for 25 to 50 nm extreme ultraviolet light.


    Aquila, A; Salmassi, F; Liu, Yanwei; Gullikson, E M


    Magnesium/silicon carbide (Mg/SiC) multilayers have been fabricated with normal incidence reflectivity in the vicinity of 40% to 50% for wavelengths in the 25 to 50 nm wavelength range. However many applications, for example solar telescopes and ultrafast studies using high harmonic generation sources, desire larger bandwidths than provided by high reflectivity Mg/SiC multilayers. We investigate introducing a third material, Scandium, to create a tri-material Mg/Sc/SiC multilayer allowing an increase the bandwidth while maintaining high reflectivity. PMID:19997456

  13. White Paper on Ion Beam Transport for ICF: Issues, R&D Need,and Tri-Lab Plans

    SciTech Connect

    Olson, C.; Lee, E.; Langdon, B.


    To date, most resources for ion beam fusion have been devoted to development of accelerators and target physics; relatively few resources have gone into ion beam transport development. Because of theoretical studies and substantial experience with electron beam transport, the ion beam transport community is now poised to develop and optimize ion beam transport for ICF. Because of this Tri-Lab effort, a path for coordinated development of ion beam transport has been established. The rate of progress along this path will now be determined largely by the availability of resources.

  14. Tri-material multilayer coatings with high reflectivity and wide bandwidth for 25 to 50 nm extreme ultraviolet light

    SciTech Connect

    Aquila, Andrew; Salmassi, Farhad; Liu, Yanwei; Gullikson, Eric M.


    Magnesium/silicon carbide (Mg/SiC) multilayers have been fabricated with normal incidence reflectivity in the vicinity of 40% to 50% for wavelengths in the 25 to 50 nm wavelength range. However many applications, for example solar telescopes and ultrafast studies using high harmonic generation sources, desire larger bandwidths than provided by high reflectivity Mg/SiC multilayers. We investigate introducing a third material, Scandium, to create a tri-material Mg/Sc/SiC multilayer allowing an increase the bandwidth while maintaining high reflectivity.

  15. BEaTriX, expanded x-ray beam facility for testing modular elements of telescope optics: an update

    NASA Astrophysics Data System (ADS)

    Pelliciari, C.; Spiga, D.; Bonnini, E.; Buffagni, E.; Ferrari, C.; Pareschi, G.; Tagliaferri, G.


    We present in this paper an update on the design of BEaTriX (Beam Expander Testing X-ray facility), an X-ray apparatus to be realized at INAF/OAB and that will generate an expanded, uniform and parallel beam of soft X-rays. BEaTriX will be used to perform the functional tests of X-ray focusing modules of large X-ray optics such as those for the ATHENA X-ray observatory, using the Silicon Pore Optics (SPO) as a baseline technology, and Slumped Glass Optics (SGO) as a possible alternative. Performing the tests in X-rays provides the advantage of an in-situ, at-wavelength quality control of the optical modules produced in series by the industry, performing a selection of the modules with the best angular resolution, and, in the case of SPOs, there is also the interesting possibility to align the parabolic and the hyperbolic stacks directly under X-rays, to minimize the aberrations. However, a parallel beam with divergence below 2 arcsec is necessary in order to measure mirror elements that are expected to reach an angular resolution of about 4 arcsec, since the ATHENA requirement for the entire telescope is 5 arcsec. Such a low divergence over the typical aperture of modular optics would require an X-ray source to be located in a several kilometers long vacuum tube. In contrast, BEaTriX will be compact enough (5 m x 14 m) to be housed in a small laboratory, will produce an expanded X-ray beam 60 mm x 200 mm broad, characterized by a very low divergence (1.5 arcsec HEW), strong polarization, high uniformity, and X-ray energy selectable between 1.5 keV and 4.5 keV. In this work we describe the BEaTriX layout and show a performance simulation for the X-ray energy of 4.5 keV.

  16. The TriGuard embolic deflection device for prevention of stroke and cerebral embolization during transcatheter aortic valve replacement.


    Baumbach, Andreas; Pietras, Cody; Lansky, Alexandra


    The incidence of embolic ischemic cerebral events during transcatheter aortic valve implantation remains high. The effects range from clinically silent embolic lesions in the brain to severe disabling stroke. Memory loss and other functional neurocognitive impairment are a direct result of embolic strokes. The TriGuard embolic deflection device is a nitinol frame filter that is placed across all three aortic cerebral vessel ostia to prevent particles from entering the brain circulation during the procedure. The results of clinical studies suggest that this procedure can lead to a reduction of embolic events, and an improvement of neurocognitive function when compared with unprotected transcatheter aortic valve implantation. PMID:26364995

  17. [Tri-phalā (Three Myrobalans) as Described in the Second Part of the Bower Manuscript, the Nāvanītaka].


    Natsume, Yohko


    In India, since ancient times Tri-phalā (meaning "three fruits" in Sanskrit) has been considered to be a combination of the following fruits: -Harītakī (Terminalia chebula, Retz.), Āmalaka (Embelica officinalis Gaertn), and Vibhītaka (Terminalia belerica Roxb.). These plants are also listed in the Ayurvedic Pharmacopoeia of India. Harītakī and Āmalaka have also been used for medicinal purposes since ancient times in Japan under the Japanese names of (see text) (Kariroku) and (see text) (Annmaroku), respectively. Both have been carefully preserved as treasured drugs in the nationally important Shosoin treasure storehouse. This study attempts to clarify the description of Tri-phalā in the Nāvanītaka, which is the second part of the Bower Manuscript (Bower Ms.), and examines the reasons why these plants were combined. This paper begins with a summary description of Tri-phalā in the context of traditional Asian medicine, followed by the delineation of drug selection principles in Ayurveda. Tri-phalā formulas in the Nāvanītaka are then examined. The Carakasamhitā (CS) treats Tri-phalā as a purifier and tonic (rasāyana), describing it as a formula for rejuvenation and longevity. On the other hand, the Susrutasamhitd (SS) regards Tri-phalā as having the efficacy of balancing kapha (phlegm) and pitta (bile), and also as being a medicine to promote excretion and enhance digestive functions for better nutritional intake. It is described to have an effect of curing diseases by keeping the tridhāu (theree element) valance. Tri-phalā is thus used as an ingredient of laxatives for diseases that result from kapha imbalance and tonic. The Aşţāngahŗdayasamhitā (AHS) considers Tri-phalā to have a particular superiority among cure-all medicines with the power to dispel illness. It controls kapha and overcomes blood diseases. Tri-phalā formulas found in the Nāvanītaka were prescribed for the treatment of abdominal tumors induced by vāyu (wind) disorder

  18. [Tri-phalā (Three Myrobalans) as Described in the Second Part of the Bower Manuscript, the Nāvanītaka].


    Natsume, Yohko


    In India, since ancient times Tri-phalā (meaning "three fruits" in Sanskrit) has been considered to be a combination of the following fruits: -Harītakī (Terminalia chebula, Retz.), Āmalaka (Embelica officinalis Gaertn), and Vibhītaka (Terminalia belerica Roxb.). These plants are also listed in the Ayurvedic Pharmacopoeia of India. Harītakī and Āmalaka have also been used for medicinal purposes since ancient times in Japan under the Japanese names of (see text) (Kariroku) and (see text) (Annmaroku), respectively. Both have been carefully preserved as treasured drugs in the nationally important Shosoin treasure storehouse. This study attempts to clarify the description of Tri-phalā in the Nāvanītaka, which is the second part of the Bower Manuscript (Bower Ms.), and examines the reasons why these plants were combined. This paper begins with a summary description of Tri-phalā in the context of traditional Asian medicine, followed by the delineation of drug selection principles in Ayurveda. Tri-phalā formulas in the Nāvanītaka are then examined. The Carakasamhitā (CS) treats Tri-phalā as a purifier and tonic (rasāyana), describing it as a formula for rejuvenation and longevity. On the other hand, the Susrutasamhitd (SS) regards Tri-phalā as having the efficacy of balancing kapha (phlegm) and pitta (bile), and also as being a medicine to promote excretion and enhance digestive functions for better nutritional intake. It is described to have an effect of curing diseases by keeping the tridhāu (theree element) valance. Tri-phalā is thus used as an ingredient of laxatives for diseases that result from kapha imbalance and tonic. The Aşţāngahŗdayasamhitā (AHS) considers Tri-phalā to have a particular superiority among cure-all medicines with the power to dispel illness. It controls kapha and overcomes blood diseases. Tri-phalā formulas found in the Nāvanītaka were prescribed for the treatment of abdominal tumors induced by vāyu (wind) disorder

  19. Banana fruit VQ motif-containing protein5 represses cold-responsive transcription factor MaWRKY26 involved in the regulation of JA biosynthetic genes

    PubMed Central

    Ye, Yu-Jie; Xiao, Yun-Yi; Han, Yan-Chao; Shan, Wei; Fan, Zhong-Qi; Xu, Qun-Gang; Kuang, Jian-Fei; Lu, Wang-Jin; Lakshmanan, Prakash; Chen, Jian-Ye


    Most harvested fruits and vegetables are stored at low temperature but many of them are highly sensitive to chilling injury. Jasmonic acid (JA), a plant hormone associated with various stress responses, is known to reduce chilling injury in fruits. However, little is known about the transcriptional regulation of JA biosynthesis in relation to cold response of fruits. Here, we show the involvement of a Group I WRKY transcription factor (TF) from banana fruit, MaWRKY26, in regulating JA biosynthesis. MaWRKY26 was found to be nuclear-localized with transcriptional activation property. MaWRKY26 was induced by cold stress or by methyl jasmonate (MeJA), which enhances cold tolerance in banana fruit. More importantly, MaWRKY26 transactivated JA biosynthetic genes MaLOX2, MaAOS3 and MaOPR3 via binding to their promoters. Further, MaWRKY26 physically interacted with a VQ motif-containing protein MaVQ5, and the interaction attenuated MaWRKY26-induced transactivation of JA biosynthetic genes. These results strongly suggest that MaVQ5 might act as a repressor of MaWRKY26 in activating JA biosynthesis. Taken together, our findings provide new insights into the transcriptional regulation of JA biosynthesis in response to cold stress and a better understanding of the molecular aspects of chilling injury in banana fruit. PMID:27004441

  20. Design and Analysis of a Novel Fully Decoupled Tri-axis Linear Vibratory Gyroscope with Matched Modes.


    Xia, Dunzhu; Kong, Lun; Gao, Haiyu


    We present in this paper a novel fully decoupled silicon micromachined tri-axis linear vibratory gyroscope. The proposed gyroscope structure is highly symmetrical and can be limited to an area of about 8.5 mm × 8.5 mm. It can differentially detect three axes' angular velocities at the same time. By elaborately arranging different beams, anchors and sensing frames, the drive and sense modes are fully decoupled from each other. Moreover, the quadrature error correction and frequency tuning functions are taken into consideration in the structure design for all the sense modes. Since there exists an unwanted in-plane rotational mode, theoretical analysis is implemented to eliminate it. To accelerate the mode matching process, the particle swam optimization (PSO) algorithm is adopted and a frequency split of 149 Hz is first achieved by this method. Then, after two steps of manual adjustment of the springs' dimensions, the frequency gap is further decreased to 3 Hz. With the help of the finite element method (FEM) software ANSYS, the natural frequencies of drive, yaw, and pitch/roll modes are found to be 14,017 Hz, 14,018 Hz and 14,020 Hz, respectively. The cross-axis effect and scale factor of each mode are also simulated. All the simulation results are in good accordance with the theoretical analysis, which means the design is effective and worthy of further investigation on the integration of tri-axis accelerometers on the same single chip to form an inertial measurement unit.

  1. Modeling Quantum and Coulomb Effects in Nanoscale Enhancement-Mode Tri-Gate III-V MOSFETs

    NASA Astrophysics Data System (ADS)

    Al-Sibiani, Sameer; Khair, Khadija; Ahmed, Shaikh


    Because of limited benefits of strain engineering in extremely scaled silicon devices and lack of demonstration of a performance gain at the product level with nanowires, nanotubes, graphene, and other exotic channel materials, there is a strong motivation to continue device scaling using high-transport III-V (such as InGaAs and InAsSb) channel materials beyond the year 2020. However, there are several challenges with III-V MOSFETs prohibiting their use in high-performance and low-power logic applications. In this work, we investigate the performance of the tri-gate III-V FETs as compared to the planar counterpart, and show how quantum size quantization and random dopant fluctuations (RDF) affect the tri-gate FET characteristics and how to curb these issues. A 3-D fully atomistic quantum-corrected Monte Carlo device simulator has been used in this work. Space-quantization effects have been accounted for via a parameter-free effective potential scheme (and benchmarked against the NEGF approach in the ballistic limit). To treat full Coulomb (electron-ion and electron-electron) interactions, the simulator implements a real-space corrected Coulomb electron dynamics (ED) scheme. Also, the essential bandstructure parameters (bandgap, effective masses, and the density-of-states) have been computed using a 20-band nearest-neighbour sp3d5s* tight-binding scheme.

  2. Dynamics of cyanobacteria and cyanobacterial toxins and their correlation with environmental parameters in Tri An Reservoir, Vietnam.


    Dao, Thanh-Son; Nimptsch, Jorge; Wiegand, Claudia


    This study evaluates the water quality from Tri An Reservoir, a drinking water supply for several million people in southern Vietnam, in terms of cyanobacterial biomass and their potent toxins, microcystins (MCs). Cyanobacteria, their toxins and environmental parameters were monitored monthly for 1 year (April 2008-March 2009) at six stations covering a transect through the reservoir. Dynamics of cyanobacterial abundance in relation to cyanobacterial biomass, toxins and environmental factors were investigated. Environmental variables from Tri An Reservoir favored algal and cyanobacterial development. However, cyanobacterial biomass and proportion varied widely, influenced by physical conditions, available nutrients and nutrient competition among the phytoplankton groups. Cyanobacterial biomass correlated slightly positively to temperature, pH and biochemical oxygen demand (BOD5), but negatively to total inorganic nitrogen concentrations. During most of the sampling times, MC concentrations in the reservoir were quite low (≤0.07 μg L(-1) MC-LR equivalent), and presented a slight positive correlation to BOD5, total nitrogen:total phosphorus ratio and cyanobacterial biomass. However, in cyanobacterial scum samples, which now and then occurred in the reservoir, MC concentrations reached up to 640 μg g(-1) DW(-1). The occurrence of MC in the reservoir poses a risk to local residents who use the water daily for domestic purposes. PMID:27441865

  3. The Management of Diabetic Foot Ulcers with Porcine Small Intestine Submucosa Tri-Layer Matrix: A Randomized Controlled Trial

    PubMed Central

    Cazzell, Shawn M.; Lange, Darrell L.; Dickerson, Jaime E.; Slade, Herbert B.


    Objective: This study demonstrates that superior outcomes are possible when diabetic foot ulcers (DFU) are managed with tri-layer porcine small intestine submucosa (SIS). Approach: Patients with DFU from 11 centers participated in this prospective randomized controlled trial. Qualified subjects were randomized (1:1) to either SIS or standard care (SC) selected at the discretion of the Investigator and followed for 12 weeks or complete ulcer closure. Results: Eighty-two subjects (41 in each group) were evaluable in the intent-to-treat analysis. Ulcers managed with SIS had a significantly greater proportion closed by 12 weeks than for the Control group (54% vs. 32%, p=0.021) and this proportion was numerically higher at all visits. Time to closure for ulcers achieving closure was 2 weeks earlier for the SIS group than for SC. Median reduction in ulcer area was significantly greater for SIS at each weekly visit (all p values<0.05). Review of reported adverse events found no safety concerns. Innovation: These data support the use of tri-layer SIS for the effective management of DFU. Conclusion: In this randomized controlled trial, SIS was found to be associated with more rapid improvement, and a higher likelihood of achieving complete ulcer closure than those ulcers treated with SC. PMID:26634183

  4. Identification of the traditional Tibetan medicine "Shaji" and their different extracts through tri-step infrared spectroscopy

    NASA Astrophysics Data System (ADS)

    Liu, Yue; Li, Jingyi; Fan, Gang; Sun, Suqin; Zhang, Yuxin; Zhang, Yi; Tu, Ya


    Hippophae rhamnoides subsp. sinensis Rousi, Hippophae gyantsensis (Rousi) Y. S. Lian, Hippophae neurocarpa S. W. Liu & T. N. He and Hippophae tibetana Schlechtendal are typically used under one name "Shaji", to treat cardiovascular diseases and lung disorders in Tibetan medicine (TM). A complete set of infrared (IR) macro-fingerprints of these four Hippophae species should be characterized and compared simply, accurately, and in detail for identification. In the present study, tri-step IR spectroscopy, which included Fourier transform IR (FT-IR) spectroscopy, second derivative IR (SD-IR) spectroscopy and two-dimensional correlation IR (2D-IR) spectroscopy, was employed to discriminate the four Hippophae species and their corresponding extracts using different solvents. The relevant spectra exhibited the holistic chemical compositions and variations. Flavonoids, fatty acids and sugars were found to be the main chemical components. Characteristic peak positions, intensities and shapes derived from FT-IR, SD-IR and 2D-IR spectra provided valuable information for sample discrimination. Principal component analysis (PCA) of spectral differences was performed to illustrate the objective identification. Results showed that the species and their extracts can be clearly distinguished. Thus, a quick, precise and effective tri-step IR spectroscopy combined with PCA can be applied to identify and discriminate medicinal materials and their extracts in TM research.

  5. Ferulic acid, an efficient inhibitor of type B trichothecene biosynthesis and Tri gene expression in Fusarium liquid cultures.


    Boutigny, Anne-Laure; Barreau, Christian; Atanasova-Penichon, Vessela; Verdal-Bonnin, Marie-Noëlle; Pinson-Gadais, Laëtitia; Richard-Forget, Florence


    The effect of ferulic acid, the most abundant phenolic acid in wheat bran, was studied in vitro on type B trichothecene biosynthesis by Fusarium. It was demonstrated that ferulic acid is an efficient inhibitor of mycotoxin production by all strains of Fusarium tested, including different chemotypes and species. To analyse the mechanism of toxin biosynthesis inhibition by ferulic acid, expression of representative Tri genes, involved in the trichothecene biosynthesis pathway, was monitored by real-time RT-PCR. A decrease in the level of Tri gene expression was measured, suggesting that inhibition of toxin synthesis by ferulic acid could be regulated at the transcriptional level. Moreover, toxin production was shown to be reduced proportionally to the initial amount of ferulic acid added in the culture medium. Addition of ferulic acid either at the spore germination step or to a mycelial culture resulted in the same final inhibitory effect on mycotoxin accumulation. A cumulative inhibitory effect on trichothecene biosynthesis was even observed with successive supplementation of ferulic acid. Ferulic acid, which content varies among wheat varieties, could then play an important role in modulating trichothecene biosynthesis by Fusarium in some wheat varieties.

  6. Effects of polymorphisms in pepsinogen (PEP), amylase (AMY) and trypsin (TRY) genes on food habit domestication traits in mandarin fish.


    Yi, Tilin; Sun, Jian; Liang, Xufang; He, Shan; Li, Ling; Wen, Zhengyong; Shen, Dan


    Mandarin fish (Siniperca chuatsi) have a peculiar feeding habit of only accepting live fish prey and refusing dead prey and artificial diets. However, previous research has shown that some individuals accept dead prey after gradual domestication. Digestive enzymes are correlated with feeding habits in fish. In the current study, SNPs in the mandarin fish genes for pepsinogen (PEP), amylase (AMY), and trypsin (TRY) were evaluated for associations with feeding habits in domesticated mandarin fish by scanning their complete genomic sequence. In total, two SNPs were found in PEP, one was found in TRY, and none were found in AMY. The D1(CTCC) and D5(TTTT) diplotypes in the PEP gene tended to show strong effects on the feeding habits of domesticated fish (p < 0.01). The results indicate that PEP may be associated with the genetic mechanism for feeding habits in mandarin fish, and the D1(CTCC) and D5(TTTT) diplotypes in the PEP gene may be useful markers for selecting mandarin fish with appropriate feeding habits for domestication.

  7. Preparation and Characterization of Di-, Tri-, and Tetranuclear Schiff Base Complexes Derived from Diamines and 3,4-Dihydroxybenzaldehyde

    PubMed Central

    Abdulghani, Ahlam Jameel; Khaleel, Asmaa Mohammed Noori


    A series of new di-, tri-, and tetranuclear Co(II) and Cu(II) complexes of three new diSchiff base ligands were synthesized by two different methods. The first method involved the synthesis of the three ligands from condensation reaction of 3,4-dihydroxybenzaldehyde (L′H2) with ethylenediamine (en), o-phenylenediamine (o-PD), or 4,5-dimethyl-1,2-phenylendiamine (DMPD) in a mole ratio of 2 : 1 followed by the reaction of the resulting Schiff bases ligands with Cu(II) or Co(II) ions in the presence of 2,2′-bipyridyl (L) to form the di- and trinuclear metal complexes. The second method involved the condensation of the copper complex LCu(II)L′ (L = 2,2′-bipyridyl, L′ = 4-formylbenzene-1,2-bis(olate)) with en, o-PD, or DMPD in a mole ratio of 2 : 1, respectively, followed by reaction with CuCl2 or Cu(ClO4)2 to form di-, tri-, and tetranuclear copper (II) complexes, respectively. The structures of the ligands and metal complexes were characterized by elemental analyses, NMR, and FTIR spectra. The geometries of metal complexes were suggested according to elemental analysis, electronic spectra, thermal analyses, atomic absorption, and magnetic moments and conductivity measurements. PMID:24453995

  8. Unified Tri-service Cognitive Performance Assessment Battery (UTC-PAB). Part 1: Design and specification of the battery

    NASA Astrophysics Data System (ADS)

    Englund, C. E.; Reeves, D. L.; Shingledecker, C. A.; Thorne, D. R.; Wilson, K. P.


    The Unified Tri-Service Cognitive Performance Assessment Battery (UTC-PAB) represents the primary metric for a Level 2 evaluation of cognitive performance in the JWGD3 MILPERF chemical defense biomedical drug screening program. Emphasis for UTC-PAB development has been on the standardization of test batteries across participating laboratories with respect to content, computer-based administration, test scoring, and data formatting. This effort has produced a 25-test UTC-PAB that represents the consolidation and unification of independent developments by the Tri-service membership. Test selection was based on established test validity and relevance of military performance. Sensitivity to effects of hostile environments and sustained operations were also considerations involved in test selection. Information processing, decision making, perception, and mental workload capacity are among the processes and abilities addressed in the battery. The UTC-PAB represents a dynamic approach to battery development. The nature of the biomedical drugs screened and information from performance centered task analyses will direct the form of future versions of the battery.

  9. Free and protein-bound tri-iodothyronine in the serum of vitamin A-deficient rats.


    Garcin, H; Higueret, P


    Tri-iodothyronine (T3) transport in the serum of rats on a vitamin A-deficient diet was studied by electrophoresis after the incubation of serum samples with radioactive T3. The level of serum free tri-iodothyronine (fT3) was measured by radioimmunoassay after serum chromatography on Sephadex LH-20 gel. In the serum of control rats a major part of the radioactivity was bound to the albumin zone (61%) and a minor part to the prealbumin zone (32%). In the serum of vitamin A-deficient rats a larger amount of radioactivity was bound to the postalbumin zone; the lower the level of vitamin A in serum, the greater was the radioactivity in this zone of the electrophoretogram. In these animals there was also a negative correlation between the serum vitamin A and the fT3. There was also a positive correlation between the radioactivity bound to the postalbumin zone and the fT3. The possible causes and effects of these modifications in vitamin A-deficient rats are discussed.

  10. Crystal Structures of Lys-63-linked tri- and di-ubiquitin Reveal a Highly Extended Chain Architecture

    SciTech Connect

    Weeks, S.; Grasty, K; Hernandez-Cuebas, L; Loll, P


    The covalent attachment of different types of poly-ubiquitin chains signal different outcomes for the proteins so targeted. For example, a protein modified with Lys-48-linked poly-ubiquitin chains is targeted for proteasomal degradation, whereas Lys-63-linked chains encode nondegradative signals. The structural features that enable these different types of chains to encode different signals have not yet been fully elucidated. We report here the X-ray crystal structures of Lys-63-linked tri- and di-ubiquitin at resolutions of 2.3 and 1.9 {angstrom}, respectively. The tri- and di-ubiquitin species adopt essentially identical structures. In both instances, the ubiquitin chain assumes a highly extended conformation with a left-handed helical twist; the helical chain contains four ubiquitin monomers per turn and has a repeat length of {approx}110 {angstrom}. Interestingly, Lys-48 ubiquitin chains also adopt a left-handed helical structure with a similar repeat length. However, the Lys-63 architecture is much more open than that of Lys-48 chains and exposes much more of the ubiquitin surface for potential recognition events. These new crystal structures are consistent with the results of solution studies of Lys-63 chain conformation, and reveal the structural basis for differential recognition of Lys-63 versus Lys-48 chains.

  11. The legacy of war: an epidemiological study of cluster weapon and land mine accidents in Quang Tri Province, Vietnam.


    Phung, Tran Kim; Le, Viet; Husum, Hans


    The study examines the epidemiology of cluster weapon and land mine accidents in Quang Tri Province since the end of the Vietnam War. The province is located just south of the demarcation line and was the province most affected during the war. In 2009, a cross sectional household study was conducted in all nine districts of the province. During the study period of 1975-2009, 7,030 persons in the study area were exposed to unexploded ordnances (UXO) or land mine accidents, or 1.1% of the provincial population. There were 2,620 fatalities and 4,410 accident survivors. The study documents that the main problem is cluster weapons and other unexploded ordnances; only 4.3% of casualties were caused by land mines. The legacy of the war affects poor people the most; the accident rate was highest among villagers living in mountainous areas, ethnic minorities, and low-income families. The most common activities leading to the accidents were farming (38.6%), collecting scrap metal (11.2%), and herding of cattle (8.3%). The study documents that the people of the Quang Tri Province until this day have suffered heavily due to the legacy of war. Mine risk education programs should account for the epidemiological findings when future accident prevention programs are designed to target high-risk areas and activities. PMID:23077828

  12. Performance evaluation of a compact PET/SPECT/CT tri-modality system for small animal imaging applications

    NASA Astrophysics Data System (ADS)

    Wei, Qingyang; Wang, Shi; Ma, Tianyu; Wu, Jing; Liu, Hui; Xu, Tianpeng; Xia, Yan; Fan, Peng; Lyu, Zhenlei; Liu, Yaqiang


    PET, SPECT and CT imaging techniques are widely used in preclinical small animal imaging applications. In this paper, we present a compact small animal PET/SPECT/CT tri-modality system. A dual-functional, shared detector design is implemented which enables PET and SPECT imaging with a same LYSO ring detector. A multi-pinhole collimator is mounted on the system and inserted into the detector ring in SPECT imaging mode. A cone-beam CT consisting of a micro focus X-ray tube and a CMOS detector is implemented. The detailed design and the performance evaluations are reported in this paper. In PET imaging mode, the measured NEMA based spatial resolution is 2.12 mm (FWHM), and the sensitivity at the central field of view (CFOV) is 3.2%. The FOV size is 50 mm (∅)×100 mm (L). The SPECT has a spatial resolution of 1.32 mm (FWHM) and an average sensitivity of 0.031% at the center axial, and a 30 mm (∅)×90 mm (L) FOV. The CT spatial resolution is 8.32 lp/mm @10%MTF, and the contrast discrimination function value is 2.06% with 1.5 mm size cubic box object. In conclusion, a compact, tri-modality PET/SPECT/CT system was successfully built with low cost and high performance.

  13. Effect of tri-sodium citrate concentration on structural, optical and electrical properties of chemically deposited tin sulfide films

    NASA Astrophysics Data System (ADS)

    Gode, F.; Guneri, E.; Baglayan, O.


    Tin sulfide thin films were deposited onto glass substrates by chemical bath deposition. The effects of molar concentration of the complexing agent, tri-sodium citrate, on the structural, morphological, optical and electrical properties of the films were investigated. The films are characterized by X-ray diffraction, scanning electron microscopy, atomic force microscopy, optical absorption spectroscopy and Hall effect measurements. Polycrystalline film structure in orthorhombic phase was determined. Flower-like spherical grains are observed on the surface. While their average size increased from 345 nm to 750 nm when the tri-sodium citrate concentration was increased from 6.4 × 10-3 M to 8.0 × 10-3 M, the surface roughness varied in an opposite manner from approximately 120.18 nm to 29.36 nm. For these concentrations, optical band gap of the films decreased from 1.40 eV to 1.17 eV, whereas the Hall conductivity, mobility and carrier concentration of the films increased slightly from 5.91 × 10-5 to 8.78 × 10-5 (Ω cm)-1, from 148 to 228 cm2 V-1 s-1 and from 1.73 × 1012 to 3.59 × 1012 cm-1, respectively.

  14. The legacy of war: an epidemiological study of cluster weapon and land mine accidents in Quang Tri Province, Vietnam.


    Phung, Tran Kim; Le, Viet; Husum, Hans


    The study examines the epidemiology of cluster weapon and land mine accidents in Quang Tri Province since the end of the Vietnam War. The province is located just south of the demarcation line and was the province most affected during the war. In 2009, a cross sectional household study was conducted in all nine districts of the province. During the study period of 1975-2009, 7,030 persons in the study area were exposed to unexploded ordnances (UXO) or land mine accidents, or 1.1% of the provincial population. There were 2,620 fatalities and 4,410 accident survivors. The study documents that the main problem is cluster weapons and other unexploded ordnances; only 4.3% of casualties were caused by land mines. The legacy of the war affects poor people the most; the accident rate was highest among villagers living in mountainous areas, ethnic minorities, and low-income families. The most common activities leading to the accidents were farming (38.6%), collecting scrap metal (11.2%), and herding of cattle (8.3%). The study documents that the people of the Quang Tri Province until this day have suffered heavily due to the legacy of war. Mine risk education programs should account for the epidemiological findings when future accident prevention programs are designed to target high-risk areas and activities.

  15. A prototype hand-held tri-modal instrument for in vivo ultrasound, photoacoustic, and fluorescence imaging

    NASA Astrophysics Data System (ADS)

    Kang, Jeeun; Chang, Jin Ho; Wilson, Brian C.; Veilleux, Israel; Bai, Yanhui; DaCosta, Ralph; Kim, Kang; Ha, Seunghan; Lee, Jong Gun; Kim, Jeong Seok; Lee, Sang-Goo; Kim, Sun Mi; Lee, Hak Jong; Ahn, Young Bok; Han, Seunghee; Yoo, Yangmo; Song, Tai-Kyong


    Multi-modality imaging is beneficial for both preclinical and clinical applications as it enables complementary information from each modality to be obtained in a single procedure. In this paper, we report the design, fabrication, and testing of a novel tri-modal in vivo imaging system to exploit molecular/functional information from fluorescence (FL) and photoacoustic (PA) imaging as well as anatomical information from ultrasound (US) imaging. The same ultrasound transducer was used for both US and PA imaging, bringing the pulsed laser light into a compact probe by fiberoptic bundles. The FL subsystem is independent of the acoustic components but the front end that delivers and collects the light is physically integrated into the same probe. The tri-modal imaging system was implemented to provide each modality image in real time as well as co-registration of the images. The performance of the system was evaluated through phantom and in vivo animal experiments. The results demonstrate that combining the modalities does not significantly compromise the performance of each of the separate US, PA, and FL imaging techniques, while enabling multi-modality registration. The potential applications of this novel approach to multi-modality imaging range from preclinical research to clinical diagnosis, especially in detection/localization and surgical guidance of accessible solid tumors.

  16. Dynamics of cyanobacteria and cyanobacterial toxins and their correlation with environmental parameters in Tri An Reservoir, Vietnam.


    Dao, Thanh-Son; Nimptsch, Jorge; Wiegand, Claudia


    This study evaluates the water quality from Tri An Reservoir, a drinking water supply for several million people in southern Vietnam, in terms of cyanobacterial biomass and their potent toxins, microcystins (MCs). Cyanobacteria, their toxins and environmental parameters were monitored monthly for 1 year (April 2008-March 2009) at six stations covering a transect through the reservoir. Dynamics of cyanobacterial abundance in relation to cyanobacterial biomass, toxins and environmental factors were investigated. Environmental variables from Tri An Reservoir favored algal and cyanobacterial development. However, cyanobacterial biomass and proportion varied widely, influenced by physical conditions, available nutrients and nutrient competition among the phytoplankton groups. Cyanobacterial biomass correlated slightly positively to temperature, pH and biochemical oxygen demand (BOD5), but negatively to total inorganic nitrogen concentrations. During most of the sampling times, MC concentrations in the reservoir were quite low (≤0.07 μg L(-1) MC-LR equivalent), and presented a slight positive correlation to BOD5, total nitrogen:total phosphorus ratio and cyanobacterial biomass. However, in cyanobacterial scum samples, which now and then occurred in the reservoir, MC concentrations reached up to 640 μg g(-1) DW(-1). The occurrence of MC in the reservoir poses a risk to local residents who use the water daily for domestic purposes.

  17. The effects of ethylene oxide containing lipopolymers and tri-block copolymers on lipid bilayers of dipalmitoylphosphatidylcholine.

    PubMed Central

    Baekmark, T R; Pedersen, S; Jørgensen, K; Mouritsen, O G


    A comparative study is conducted on the influence of two types of polymeric compounds on the phase behavior of 1,2-dihexadecanoyl-s,n-glycero-3-phosphotidylcholine (DC16PC) lipid bilayers. The first polymeric compound is a lipopolymer, with two different lengths of a hydrophilic polyethylene oxide moity, anchored to the bilayer by a 1,2-dioctadecanoyl-s,n-glycero-3-phosphoethanolamine (DC18PE) lipid. The second type, which is a novel type of membrane-spanning object, is an amphiphilic tri-block copolymer composed of two hydrophilic stretches of polyethylene oxide separated by a hydrophobic stretch of polystyrene. Hence the tri-block copolymer may act as a membrane-spanning macromolecule mimicking an amphiphilic protein or polypeptide. Differential scanning calorimetry is used to determine a partial phase diagram for the lipopolymer systems and to assess the amount of lipopolymer that can be loaded into DC16PC lipid bilayers before micellization takes place. Unilamellar and micellar phase structures are investigated by fluorescence quenching using bilayer permeating dithionite. The chain length-dependent critical lipopolymer concentration, denoting the lamellar-to-micellar phase transition, compares favorably with a theoretical prediction based on free-energy considerations involving bilayer cohesion and lateral pressure exerted by the polymer chains. Images FIGURE 10 PMID:9284315

  18. Tri-color composite volume H-PDLC grating and its application to 3D color autostereoscopic display.


    Wang, Kangni; Zheng, Jihong; Gao, Hui; Lu, Feiyue; Sun, Lijia; Yin, Stuart; Zhuang, Songlin


    A tri-color composite volume holographic polymer dispersed liquid crystal (H-PDLC) grating and its application to 3-dimensional (3D) color autostereoscopic display are reported in this paper. The composite volume H-PDLC grating consists of three different period volume H-PDLC sub-gratings. The longer period diffracts red light, the medium period diffracts the green light, and the shorter period diffracts the blue light. To record three different period gratings simultaneously, two photoinitiators are employed. The first initiator consists of methylene blue and p-toluenesulfonic acid and the second initiator is composed of Rose Bengal and N-phenyglycine. In this case, the holographic recording medium is sensitive to entire visible wavelengths, including red, green, and blue so that the tri-color composite grating can be written simultaneously by harnessing three different color laser beams. In the experiment, the red beam comes from a He-Ne laser with an output wavelength of 632.8 nm, the green beam comes from a Verdi solid state laser with an output wavelength of 532 nm, and the blue beam comes from a He-Cd laser with an output wavelength of 441.6 nm. The experimental results show that diffraction efficiencies corresponding to red, green, and blue colors are 57%, 75% and 33%, respectively. Although this diffraction efficiency is not perfect, it is high enough to demonstrate the effect of 3D color autostereoscopic display. PMID:26698768

  19. The collinear cluster tri-partition (CCT) of 252Cf (sf): New aspects from neutron gated data

    NASA Astrophysics Data System (ADS)

    Pyatkov, Yu. V.; Kamanin, D. V.; von Oertzen, W.; Alexandrov, A. A.; Alexandrova, I. A.; Falomkina, O. V.; Jacobs, N.; Kondratjev, N. A.; Kuznetsova, E. A.; Lavrova, Yu. E.; Malaza, V.; Ryabov, Yu. V.; Strekalovsky, O. V.; Tyukavkin, A. N.; Zhuchko, V. E.


    Results of two different experiments for the study of fission of 252Cf (sf) events in coincidence with neutrons are reported. Two time-of-flight-energy (TOF- E detectors systems have been used. The fission fragment masses were obtained in a double arm coincidence set-up, where the missing mass in the binary decay is used to characterise ternary fission as a collinear cluster tri-partition (CCT). The 3He filled neutron counters have been arranged so as to detect principally neutrons emitted from an isotropic source in the laboratory frame. The fission events connected to the larger experimental neutron multiplicities show a wide range in the missing-mass spectrum, down to α -particles, carbon and oxygen isotopes. These are linked with magic nuclei in the binary mass-mass correlations of the fission fragments. These neutron gated data are virtually free from background events from scattered binary fission fragments. The ungated spectra are compared to those of the previous data from our previous article (Eur. Phys. J. A. 45, 29 (2010)), the observed structures agree well with the manifestations of the collinear cluster tri-partition of 252Cf (sf) observed earlier. Several new families of the CCT modes are observed.

  20. Simultaneous tri-wavelength laser operation at 916, 1086, and 1089 nm of diode-pumped Nd:LuVO4 crystal

    NASA Astrophysics Data System (ADS)

    Shen, Bingjun; Jin, Lihong; Zhang, Jiajia; Tian, Jian


    We report a diode-pumped continuous-wave tri-wavelength Nd:LuVO4 laser operating at 916, 1086, and 1089 nm. A theoretical analysis has been introduced to determine the threshold conditions for simultaneous tri-wavelength laser operation. Using a T-shaped cavity, we realized efficient tri-wavelength operation at 4F3/2  →  4I9/2 and 4F3/2  →  4I11/2 transitions for Nd:LuVO4 crystal, simultaneously. The maximum output power was 2.8 W, which included 916, 1086, and 1089 nm, and the optical conversion efficiency was 15.1%. To our knowledge, this is the first work that realizes simultaneous tri-wavelength Nd:LuVO4 laser operation.