Sample records for pinus sylvestris roots

  1. Ectomycorrhizal identity determines respiration and concentrations of nitrogen and non-structural carbohydrates in root tips: a test using Pinus sylvestris and Quercus robur saplings.


    Trocha, Lidia K; Mucha, Joanna; Eissenstat, David M; Reich, Peter B; Oleksyn, Jacek


    Fine roots play a significant role in plant and ecosystem respiration (RS); therefore, understanding factors controlling that process is important both to advancing understanding and potentially in modelling carbon (C) budgets. However, very little is known about the extent to which ectomycorrhizal (ECM) identity may influence RS or the underlying chemistry that may determine those rates. In order to test these relationships, we examined RS, measured as O(2) consumption, of first-order ECM root tips of Pinus sylvestris L. and Quercus robur L. saplings in relation to their ECM fungal symbionts and associated nitrogen (N), C and non-structural carbohydrate concentrations. Roots of P. sylvestris were colonized by Rhizopogon roseolus, Tuber sp. 1 and an unknown species of Pezizales. Fungal species colonizing Q. robur roots were Hebeloma sp., Tuber sp. 2 and one unidentified ECM fungus described as Tuber-like based on ECM morphology. ECM RS rates for different host species were significantly different and more than 97% of the variation in RS within a host species was explained by ECM root tip N concentrations. This may indicate that some of the variability in fine root RS-N relationships observed between and within different host species or their functional groups may be related to intraspecific host species differences in root tip N concentration among ECM fungal associates.

  2. Variation among matsutake ectomycorrhizae in four clones of Pinus sylvestris.


    Vaario, Lu-Min; Lu, Jinrong; Koistinen, Arto; Tervahauta, Arja; Aronen, Tuija


    Tricholoma matsutake is an ectomycorrhizal fungus that forms commercially important mushrooms in coniferous forests. In this study, we explored the ability of T. matsutake to form mycorrhizae with Pinus sylvestris by inoculating emblings produced through somatic embryogenesis (SE) in an aseptic culture system. Two months after inoculation, clones with less phenolic compounds in the tissue culture phase formed mycorrhizae with T. matsutake, while clones containing more phenols did not. Effects of inoculation on embling growth varied among clones; two of the four tested showed a significant increase in biomass and two had a significant increase in root density. In addition, results suggest that clones forming well-developed mycorrhizae absorbed more Al, Fe, Na, P, and Zn after 8 weeks of inoculation. This study illustrates the value of SE materials in experimental work concerning T. matsutake as well as the role played by phenolic compounds in host plant response to infection by mycorrhizal fungi.

  3. Spontaneous hybridization between Pinus mugo and Pinus sylvestris at the Lithuanian seaside: a morphological survey.


    Danusevičius, Darius; Marozas, Vitas; Brazaitis, Gediminas; Petrokas, Raimundas; Christensen, Knud Ib


    We address the problem of spontaneous hybridization between an exotic species Pinus mugo and the native/local P. sylvestris at the seaside spit of Kursiu Nerija in Lithuania. The objective was to identify spontaneous hybrids between P. mugo and P. sylvestris based on morphology traits among the individuals naturally regenerating at the seaside spit. The field inventory was carried out over the entire Lithuanian part of the spit, and 200 individuals morphologically intermediate between P. sylvestris and P. mugo were identified. Based on a weighted trait index, the intermediate individuals were grouped into two groups, one morphologically close to P. sylvestris and another close to P. mugo. The needle micromorphological traits of the putative hybrids were of intermediate values between P. mugo and P. sylvestris. The results provide a strong evidence of spontaneous hybridization between P. mugo and P. sylvestris in Lithuanian seaside spit of Kursiu Nerija.

  4. Spontaneous Hybridization between Pinus mugo and Pinus sylvestris at the Lithuanian Seaside: A Morphological Survey

    PubMed Central

    Danusevičius, Darius; Marozas, Vitas; Brazaitis, Gediminas; Petrokas, Raimundas; Christensen, Knud Ib


    We address the problem of spontaneous hybridization between an exotic species Pinus mugo and the native/local P. sylvestris at the seaside spit of Kursiu Nerija in Lithuania. The objective was to identify spontaneous hybrids between P. mugo and P. sylvestris based on morphology traits among the individuals naturally regenerating at the seaside spit. The field inventory was carried out over the entire Lithuanian part of the spit, and 200 individuals morphologically intermediate between P. sylvestris and P. mugo were identified. Based on a weighted trait index, the intermediate individuals were grouped into two groups, one morphologically close to P. sylvestris and another close to P. mugo. The needle micromorphological traits of the putative hybrids were of intermediate values between P. mugo and P. sylvestris. The results provide a strong evidence of spontaneous hybridization between P. mugo and P. sylvestris in Lithuanian seaside spit of Kursiu Nerija. PMID:22619615

  5. The ectomycorrhizal symbiosis between Lactarius deliciosus and Pinus sylvestris in forest soil samples: symbiotic efficiency and development on roots of a rDNA internal transcribed spacer-selected isolate of L. deliciosus.


    Guerin-Laguette, Alexis; Conventi, Serge; Ruiz, Guy; Plassard, Claude; Mousain, Daniel


    The effect on plant growth of pre-inoculation of Pinus sylvestris with the ectomycorrhizal (ECM) edible basidiomycete Lactarius deliciosus (isolate D45) under controlled conditions, and the development on roots of this basidiomycete, were investigated in gamma-irradiated and unsterilized containers containing different forest soil cores or a perlite-vermiculite mixture. Five months after planting, L. deliciosus mycorrhizal plants exhibited greater growth than the non-mycorrhizal ones in all soil types, i.e. up to a 325% increase in shoot height in the sterilized soils. The experiment demonstrated the dependency of P. sylvestris seedlings upon ECM symbiosis for their survival in gamma-irradiated, microbiologically disturbed soil samples. Furthermore, in two soils, the growth of L. deliciosus-inoculated seedlings was greater in the sterilized soil samples than in the non-sterilized ones, i.e. 46% and 132% increase in shoot height under sterilized soil conditions. In containers randomly sampled from each soil type, the degree of root colonization by the inoculated isolate, calculated as the number of mycorrhizal root tips divided by the total number of root tips x100, ranged from 80% to 35%. Within the short term, the inoculated isolate developed rapidly on roots, dominated, and hampered ectomycorrhiza formation by various unidentified (but not Lactarius) resident ECM fungi in unsterilized soil types. Results indicate that the ECM species L. deliciosus is worth investigating to ascertain if other isolates benefit pine growth like the isolate D45, and are therefore also attractive candidates for forestry applications in the Mediterranean area.

  6. Stem compression reversibly reduces phloem transport in Pinus sylvestris trees.


    Henriksson, Nils; Tarvainen, Lasse; Lim, Hyungwoo; Tor-Ngern, Pantana; Palmroth, Sari; Oren, Ram; Marshall, John; Näsholm, Torgny


    Manipulating tree belowground carbon (C) transport enables investigation of the ecological and physiological roles of tree roots and their associated mycorrhizal fungi, as well as a range of other soil organisms and processes. Girdling remains the most reliable method for manipulating this flux and it has been used in numerous studies. However, girdling is destructive and irreversible. Belowground C transport is mediated by phloem tissue, pressurized through the high osmotic potential resulting from its high content of soluble sugars. We speculated that phloem transport may be reversibly blocked through the application of an external pressure on tree stems. Thus, we here introduce a technique based on compression of the phloem, which interrupts belowground flow of assimilates, but allows trees to recover when the external pressure is removed. Metal clamps were wrapped around the stems and tightened to achieve a pressure theoretically sufficient to collapse the phloem tissue, thereby aiming to block transport. The compression's performance was tested in two field experiments: a (13)C canopy labelling study conducted on small Scots pine (Pinus sylvestris L.) trees [2-3 m tall, 3-7 cm diameter at breast height (DBH)] and a larger study involving mature pines (∼15 m tall, 15-25 cm DBH) where stem respiration, phloem and root carbohydrate contents, and soil CO2 efflux were measured. The compression's effectiveness was demonstrated by the successful blockage of (13)C transport. Stem compression doubled stem respiration above treatment, reduced soil CO2 efflux by 34% and reduced phloem sucrose content by 50% compared with control trees. Stem respiration and soil CO2 efflux returned to normal within 3 weeks after pressure release, and (13)C labelling revealed recovery of phloem function the following year. Thus, we show that belowground phloem C transport can be reduced by compression, and we also demonstrate that trees recover after treatment, resuming C

  7. Ericaceous dwarf shrubs affect ectomycorrhizal fungal community of the invasive Pinus strobus and native Pinus sylvestris in a pot experiment.


    Kohout, Petr; Sýkorová, Zuzana; Bahram, Mohammad; Hadincová, Věroslava; Albrechtová, Jana; Tedersoo, Leho; Vohník, Martin


    This study aimed to elucidate the relationship between ericaceous understorey shrubs and the diversity and abundance of ectomycorrhizal fungi (EcMF) associated with the invasive Pinus strobus and native Pinus sylvestris. Seedlings of both pines were grown in mesocosms and subjected to three treatments simulating different forest microhabitats: (a) grown in isolation and grown with (b) Vaccinium myrtillus or (c) Vaccinium vitis-idaea. Ericaceous plants did not act as a species pool of pine mycobionts and inhibited the ability of the potentially shared species Meliniomyces bicolor to form ectomycorrhizae. Similarly, Ericaceae significantly reduced the formation of Thelephora terrestris ectomycorrhizae in P. sylvestris. EcMF species composition in the mesocosms was strongly affected by both the host species and the presence of an ericaceous neighbour. When grown in isolation, P. strobus root tips were predominantly colonised by Wilcoxina mikolae, whereas those of P. sylvestris were more commonly colonised by Suillus and Rhizopogon spp. Interestingly, these differences were less evident (Suillus + Rhizopogon spp.) or absent (W. mikolae) when the pines were grown with Ericaceae. P. strobus exclusively associated with Rhizopogon salebrosus s.l., suggesting the presence of host specificity at the intrageneric level. Ericaceous plants had a positive effect on colonisation of P. strobus root tips by R. salebrosus s.l. This study demonstrates that the interaction of selective factors such as host species and presence of ericaceous plants may affect the realised niche of the ectomycorrhizal fungi.

  8. Abundance, diversity, and vitality of mycorrhizae of Scots pine (Pinus sylvestris L.) in lignite recultivation sites.


    Münzenberger, B; Golldack, J; Ullrich, A; Schmincke, B; Hüttl, R F


    Scots pine (Pinus sylvestris L.) stands cover large areas in the Lusatian and the Middle German lignite mining districts. Due to adverse chemical substrate conditions, the root systems of the trees are restricted to the ameliorated top-spoil and the organic forest floor layers. To investigate functioning of fine root systems under the prevailing site factors, we studied mycorrhizal colonization rate and frequency as well as mycorrhizal diversity, vitality and growth phases in Scots pine ecosystems along a chronosequence in both mining districts. Mycorrhizal rate was close to 100% in both districts. Mycorrhizal abundance was higher in the organic forest floor layer than the mineral soil layer. In total, 25 morphotypes were recorded. Diversity differed between the districts. The mycorrhizae of Amphinema byssoides, Tuber puberulum, Pinirhiza discolor, Pinirhiza cf. bicolorata and E-type were present in both mining areas. These morphotypes are typical of nutrient-rich soils with high pH values. Compared with the undisturbed sites, vitality of mycorrhizae was very high at the test sites on spoil substrate, correlating with the high growth dynamics of mycorrhizae at recultivation sites. A relatively high carbon flow to the mycorrhizal root systems at these sites seems likely. Thus, mycorrhizal root systems are able to cope with the ameliorated top-spoil and the organic layer. The main reason for the adaptation is the large number of ectomycorrhizal fungal species available in this area where Pinus sylvestris is indigenous.

  9. Patterns of structural and defense investments in fine roots of Scots pine (Pinus sylvestris L.) across a strong temperature and latitudinal gradient in Europe.


    Zadworny, Marcin; McCormack, M Luke; Żytkowiak, Roma; Karolewski, Piotr; Mucha, Joanna; Oleksyn, Jacek


    Plant functional traits may be altered as plants adapt to various environmental constraints. Cold, low fertility growing conditions are often associated with root adjustments to increase acquisition of limiting nutrient resources, but they may also result in construction of roots with reduced uptake potential but higher tissue persistence. It is ultimately unclear whether plants produce fine roots of different structure in response to decreasing temperatures and whether these changes represent a trade-off between root function or potential root persistence. We assessed patterns of root construction based on various root morphological, biochemical and defense traits including root diameter, specific root length (SRL), root tissue density (RTD), C:N ratio, phenolic compounds, and number of phellem layers across up to 10 root orders in diverse populations of Scots pine along a 2000-km climatic gradient in Europe. Our results showed that different root traits are related to mean annual temperature (MAT) and expressed a pattern of higher root diameter and lower SRL and RTD in northern sites with lower MAT. Among absorptive roots, we observed a gradual decline in chemical defenses (phenolic compounds) with decreasing MAT. In contrast, decreasing MAT resulted in an increase of structural protection (number of phellem layers) in transport fine roots. This indicated that absorptive roots with high capacity for nutrient uptake, and transport roots with low uptake capacity, were characterized by distinct and contrasting trade-offs. Our observations suggest that diminishing structural and chemical investments into the more distal, absorptive roots in colder climates is consistent with building roots of higher absorptive capacity. At the same time, roots that play a more prominent role in transport of nutrients and water within the root system saw an increase in structural investment, which can increase persistence and reduce long-term costs associated with their frequent

  10. Comparative pathobiology of Heterobasidion annosum during challenge on Pinus sylvestris and Arabidopsis roots: an analysis of defensin gene expression in two pathosystems.


    Jaber, Emad; Xiao, Chaowen; Asiegbu, Fred O


    Heterobasidion annosum is widely known as a major root and butt rot pathogen of conifer trees, but little information is available on its interaction with the roots of herbaceous angiosperm plants. We investigated the infection biology of H. annosum during challenge with the angiosperm model Arabidopsis and monitored the host response after exposure to different hormone elicitors, chemicals (chitin, glucan and chitosan) and fungal species that represent diverse basidiomycete life strategies [e.g., pathogen (H. annosum), saprotroph (Stereum sanguinolentum) and mutualist (Lactarius rufus)]. The results revealed that the tree pathogen (H. annosum) and the saprotroph (S. sanguinolentum) could infect the Col-8 (Columbia) ecotype of Arabidopsis in laboratory inoculation experiments. Germinated H. annosum spores had appressorium-like penetration structures attached to the surface of the Arabidopsis roots. Subsequent invasive fungal growth led to the disintegration of the vascular region of the root tissues. Progression of root rot symptoms in Arabidopsis was similar to the infection development that was previously documented in Scots pine seedlings. Scots pine PsDef1 and Arabidopsis DEFLs (AT5G44973.1) and PDF1.2 were induced at the initial stage of the infection. However, differences in the expression patterns of the defensin gene homologs from the two plant groups were observed under various conditions, suggesting functional differences in their regulation. The potential use of the H. annosum-Arabidopsis pathosystem as a model for studying forest tree diseases is discussed.

  11. Annual Cambial Rhythm in Pinus halepensis and Pinus sylvestris as Indicator for Climate Adaptation.


    Prislan, Peter; Gričar, Jožica; de Luis, Martin; Novak, Klemen; Martinez Del Castillo, Edurne; Schmitt, Uwe; Koch, Gerald; Štrus, Jasna; Mrak, Polona; Žnidarič, Magda T; Čufar, Katarina


    To understand better the adaptation strategies of intra-annual radial growth in Pinus halepensis and Pinus sylvestris to local environmental conditions, we examined the seasonal rhythm of cambial activity and cell differentiation at tissue and cellular levels. Two contrasting sites differing in temperature and amount of precipitation were selected for each species, one typical for their growth and the other represented border climatic conditions, where the two species coexisted. Mature P. halepensis trees from Mediterranean (Spain) and sub-Mediterranean (Slovenia) sites, and P. sylvestris from sub-Mediterranean (Slovenia) and temperate (Slovenia) sites were selected. Repeated sampling was performed throughout the year and samples were prepared for examination with light and transmission electron microscopes. We hypothesized that cambial rhythm in trees growing at the sub-Mediterranean site where the two species co-exist will be similar as at typical sites for their growth. Cambium in P. halepensis at the Mediterranean site was active throughout the year and was never truly dormant, whereas at the sub-Mediterranean site it appeared to be dormant during the winter months. In contrast, cambium in P. sylvestris was clearly dormant at both sub-Mediterranean and temperate sites, although the dormant period seemed to be significantly longer at the temperate site. Thus, the hypothesis was only partly confirmed. Different cambial and cell differentiation rhythms of the two species at the site where both species co-exist and typical sites for their growth indicate their high but different adaptation strategies in terms of adjustment of radial growth to environmental heterogeneity, crucial for long-term tree performance and survival.

  12. Annual Cambial Rhythm in Pinus halepensis and Pinus sylvestris as Indicator for Climate Adaptation

    PubMed Central

    Prislan, Peter; Gričar, Jožica; de Luis, Martin; Novak, Klemen; Martinez del Castillo, Edurne; Schmitt, Uwe; Koch, Gerald; Štrus, Jasna; Mrak, Polona; Žnidarič, Magda T.; Čufar, Katarina.


    To understand better the adaptation strategies of intra-annual radial growth in Pinus halepensis and Pinus sylvestris to local environmental conditions, we examined the seasonal rhythm of cambial activity and cell differentiation at tissue and cellular levels. Two contrasting sites differing in temperature and amount of precipitation were selected for each species, one typical for their growth and the other represented border climatic conditions, where the two species coexisted. Mature P. halepensis trees from Mediterranean (Spain) and sub-Mediterranean (Slovenia) sites, and P. sylvestris from sub-Mediterranean (Slovenia) and temperate (Slovenia) sites were selected. Repeated sampling was performed throughout the year and samples were prepared for examination with light and transmission electron microscopes. We hypothesized that cambial rhythm in trees growing at the sub-Mediterranean site where the two species co-exist will be similar as at typical sites for their growth. Cambium in P. halepensis at the Mediterranean site was active throughout the year and was never truly dormant, whereas at the sub-Mediterranean site it appeared to be dormant during the winter months. In contrast, cambium in P. sylvestris was clearly dormant at both sub-Mediterranean and temperate sites, although the dormant period seemed to be significantly longer at the temperate site. Thus, the hypothesis was only partly confirmed. Different cambial and cell differentiation rhythms of the two species at the site where both species co-exist and typical sites for their growth indicate their high but different adaptation strategies in terms of adjustment of radial growth to environmental heterogeneity, crucial for long-term tree performance and survival. PMID:28082994

  13. Pinus halepensis, Pinus pinaster, Pinus pinea and Pinus sylvestris Essential Oils Chemotypes and Monoterpene Hydrocarbon Enantiomers, before and after Inoculation with the Pinewood Nematode Bursaphelenchus xylophilus.


    Rodrigues, Ana M; Mendes, Marta D; Lima, Ana S; Barbosa, Pedro M; Ascensão, Lia; Barroso, José G; Pedro, Luis G; Mota, Manuel M; Figueiredo, A Cristina


    Pinewood nematode (PWN), Bursaphelenchus xylophilus, is the causal agent of pine wilt disease, a serious threat to global forest populations of conifers, especially Pinus spp. A time-course study of the essential oils (EOs) of 2-year-old Pinus halepensis, Pinus pinaster, Pinus pinea and Pinus sylvestris following inoculation with the PWN was performed. The constitutive and nematode inoculation induced EOs components were analyzed at both the wounding or inoculation areas and at the whole plant level. The enantiomeric ratio of optically active main EOs components was also evaluated. External symptoms of infection were observed only in P. pinaster and P. sylvestris 21 and 15 days after inoculation, respectively. The EO composition analysis of uninoculated and unwounded plants revealed the occurrence of chemotypes for P. pinaster, P. halepensis and P. sylvestris, whereas P. pinea showed a homogenous EO composition. When whole plants were evaluated for EO and monoterpene hydrocarbon enantiomeric chemical composition, no relevant qualitative and quantitative differences were found. Instead, EO analysis of inoculated and uninoculated wounded areas revealed an increase of sesquiterpenes and diterpenic compounds, especially in P. pinea and P. halepensis, comparatively to healthy whole plants EOs.

  14. Selectivity of Pinus sylvestris extract and essential oil to estrogen-insensitive breast cancer cells Pinus sylvestris against cancer cells

    PubMed Central

    Hoai, Nguyen Thi; Duc, Ho Viet; Thao, Do Thi; Orav, Anne; Raal, Ain


    Background: So far, the anticancer action of pine tree extracts has mainly been shown for the species distributed widely around the Asian countries. Objective: Therefore, this study was performed to examine the potential cytotoxicity of Scots pine (Pinus sylvestris L.) native also to the European region and growing widely in Estonia. Materials and Methods: The cytotoxic activity of methanol extract and essential oil of Scots pine needles was determined by sulforhodamine B assay in different human cancer cell lines. Results: This needle extract was found to suppress the viability of several human cancer cell lines showing some selectivity to estrogen receptor negative breast cancer cells, MDA-MB-231(half maximal inhibitory concentration [IC50] 35 μg/ml) in comparison with estrogen receptor-positive breast cancer cells, MCF-7 (IC50 86 μg/ml). It is the strongest cytotoxic effect at all measured, thus far for the needles and leaves extracts derived from various pine species, and is also the first study comparing the anticancer effects of pine tree extracts on molecularly different human breast cancer cells. The essential oil showed the stronger cytotoxic effect to both negative and positive breast cancer cell lines (both IC50 29 μg/ml) than pine extract (IC50 42 and 80 μg/ml, respectively). Conclusion: The data from this report indicate that Scots pine needles extract and essential oil exhibits some potential as chemopreventive or chemotherapeutic agent for mammary tumors unresponsive to endocrine treatment. PMID:26664017

  15. Draft Genome Sequence of Phytopathogenic Fungus Fusarium fujikuroi CF-295141, Isolated from Pinus sylvestris

    PubMed Central

    Bertoni-Mann, Michele; Sánchez-Hidalgo, Marina; González-Menéndez, Victor


    Here, we report the draft genome sequence of a new strain of Fusarium fujikuroi, isolated from Pinus sylvestris, which was also found to produce the mycotoxin beauvericin. The Illumina-based sequence analysis revealed an approximate genome size of 44.2 Mbp, containing 164 secondary metabolite biosynthetic clusters. PMID:27795279

  16. No evidence for depletion of carbohydrate pools in Scots pine (Pinus sylvestris L.) under drought stress

    PubMed Central

    Gruber, A.; Pirkebner, D.; Florian, C.; Oberhuber, W.


    The physiological mechanisms leading to Scots pine (Pinus sylvestris L.) decline in the dry inner Alpine valleys are still unknown. Testing the carbon starvation hypothesis, we analysed the seasonal course of mobile carbohydrate pools (NSC) of Scots pine growing at a xeric and a dry-mesic site within an inner Alpine dry valley (750 m a.s.l., Tyrol, Austria) during the year 2009, which was characterized by exceptional soil dryness. Although, soil moisture content dropped to c. 10% at both sites during the growing season, NSC concentrations were rising in all tissues (branch, stem, root) till end of July, except in needles where maxima were reached around bud break. NSC concentrations were not significantly different in the analysed tissues at the xeric and the dry-mesic site. At the dry-mesic site NSC concentrations in the above ground tree biomass were significantly higher during the period of radial growth. An accumulation of NSC in roots at the end of July indicates a change in carbon allocation after an early cessation in above ground growth, possibly due to elevated below ground carbon demand. In conclusion our results revealed that extensive soil dryness during the growing season did not lead to carbon depletion. However, even though C-reserves were not exhausted, a sequestration of carbohydrate pools during drought periods might lead to deficits in carbon supply that weaken tree vigour and drive tree mortality. PMID:21974742

  17. Genetic and environmental control of seasonal carbohydrate dynamics in trees of diverse Pinus sylvestris populations.


    Oleksyn, J.; Zytkowiak, R.; Karolewski, P.; Reich, P. B.; Tjoelker, M. G.


    We explored environmental and genetic factors affecting seasonal dynamics of starch and soluble nonstructural carbohydrates in needle and twig cohorts and roots of Scots pine (Pinus sylvestris L.) trees of six populations originating between 49 degrees and 60 degrees N, and grown under common garden conditions in western Poland. Trees of each population were sampled once or twice per month over a 3-year period from age 15 to 17 years. Based on similarity in starch concentration patterns in needles, two distinct groups of populations were identified; one comprised northern populations from Sweden and Russia (59-60 degrees N), and another comprised central European populations from Latvia, Poland, Germany and France (49-56 degrees N). Needle starch concentrations of northern populations started to decline in late spring and reached minimum values earlier than those of central populations. For all populations, starch accumulation in spring started when minimum air temperature permanently exceeded 0 degrees C. Starch accumulation peaked before bud break and was highest in 1-year-old needles, averaging 9-13% of dry mass. Soluble carbohydrate concentrations were lowest in spring and summer and highest in autumn and winter. There were no differences among populations in seasonal pattern of soluble carbohydrate concentrations. Averaged across all populations, needle soluble carbohydrate concentrations increased from about 4% of needle dry mass in developing current-year needles, to about 9% in 1- and 2-year-old needles. Root carbohydrate concentration exhibited a bimodal pattern with peaks in spring and autumn. Northern populations had higher concentrations of fine-root starch in spring and autumn than central populations. Late-summer carbohydrate accumulation in roots started only after depletion of starch in needles and woody shoots. We conclude that Scots pine carbohydrate dynamics depend partially on inherited properties that are probably related to phenology of root

  18. Larvicidal efficacies and chemical composition of essential oils of Pinus sylvestris and Syzygium aromaticum against mosquitoes

    PubMed Central

    Fayemiwo, Kehinde Adenike; Adeleke, Monsuru Adebayo; Okoro, Ovie Princewill; Awojide, Shola Hezekiah; Awoniyi, Ilias Olufemi


    Objective To assess the chemical composition and mosquito larvicidal potentials of essential oils of locally sourced Pinus sylvestris (P. sylvestris) and Syzygium aromaticum (S. aromaticum) against Aedes aegypti (A. aegypti) and Culex quinquefasciatus (C. quinquefasciatus). Method The chemical composition of the essential oils of both plants was determined using GC-MS while the larvicidal bioassay was carried out using different concentrations of the oils against the larvae of A. aegypti and C. quinquefasciatus in accordance with the standard protocol. Results The results as determined by GC-MS showed that oil of S. aromaticum has eugenol (80.5%) as its principal constituent while P. sylvestris has 3-Cyclohexene-1-methanol, .alpha., .alpha.4-trimethyl (27.1%) as its dominant constituent. Both oils achieved over 85% larval mortality within 24 h. The larvae of A. aegypti were more susceptible to the oils [LC50 (S. aromaticum)=92.56 mg/L, LC50(P. sylvestris)=100.39 mg/L] than C. quinquefasciatus [LC50(S. aromaticum)=124.42 mg/L; LC50(P. sylvestris)=128.00 mg/L]. S. aromaticum oil was more toxic to the mosquito larvae than oil of P. sylvestris but the difference in lethal concentrations was insignificant (P>0.05). Conclusion The results justify the larvicidal potentials of both essential oils and the need to incorporate them in vector management and control. PMID:24144127

  19. [Physiological characteristics of Pinus densiflora var. zhangwuensis and Pinus sylvestris var. mongolica seedlings on sandy lands under salt-alkali stresses].


    Meng, Peng; Li, Yu-Ling; Zhang, Bai-xi


    For the popularization of Pinus densiflora var. zhangwuensis, a new afforestation tree species on the desertified and salinized-alkalized lands in Northern China, and to evaluate the salinity-alkalinity tolerance of the tree species and to better understand the tolerance mechanisms, a pot experiment with 4-year old P. densiflora var. zhangwuensis and P. sylvestris var. mongolica was conducted to study their seedlings growth and physiological and biochemical indices under the effects of three types salt (NaCl, Na2CO3, and NaHCO3 ) stresses and of alkali (NaOH) stress. Under the salt-alkali stresses, the injury level of P. densiflora var. zhangwuensis was lower, and the root tolerance index was higher. The leaf catalase (CAT) activity increased significantly by 22. 6 times at the most, as compared with the control; the leaf malondialdehyde (MDA) content had no significant increase; the leaf chlorophyll (Chl) content had a smaller decrement; and the leaf water content (LWC) increased slightly. P. sylvestris var. mongolica responded differently to the salt-alkali stresses. Its leaf CAT activity had less change, MDA content increased significantly, Chl content had significant decrease, and LWC decreased slightly. It was suggested that P. densi-flora var. zhangwuensis had a greater salinity-alkalinity tolerance than P. sylvestris var. mongolica. The higher iron concentration in P. densiflora var. zhangwuensis needles enhanced the CAT activity and Chl content, whereas the higher concentrations of zinc and copper were associated with the stronger salinity-alkalinity tolerance.

  20. Effects of experimental conditions on mycorrhizal relationships between Pinus sylvestris and Lactarius deliciosus and unprecedented fruit-body formation of the Saffron milk cap under controlled soilless conditions.


    Guerin-Laguette, A; Plassard, C; Mousain, D


    The mycorrhizal relationships between pines and two edible species of Lactarius sect. Dapetes were investigated by optimizing the experimental conditions of mycelial growth and of mycorrhizal colonization of pine seedlings. In vitro mycelial growth of Lactarius deliciosus and L. sanguifluus was improved on a buffered medium containing glucose, amino acids, and vitamins. Two methods of mycorrhization of pines with Lactarius deliciosus were tested. The mycorrhizal colonization was rapid and intense under non-aseptic conditions with a low nutrient supply and without exogenous glucose. A positive influence of mycorrhizal colonization on Pinus sylvestris growth was subsequently observed. Under axenic conditions and with a high nutrient supply, mycorrhization was stimulated at 10 g/L of exogenous glucose, irrespective of the phosphorus concentration. At high phosphorus level (1 mM) and 0.1, 1.0, or 10.0 g/L glucose, growth of Pinus sylvestris was reduced by inoculation. Stability and development of Pinus spp./Lactarius deliciosus symbioses were assayed in a climatic chamber using containers filled with a synthetic substrate. Over a 2-year culture period, the root systems of the pine seedlings were heavily colonized by Lactarius deliciosus. One year following inoculation, Lactarius deliciosus fruit-body primordia appeared associated with Pinus sylvestris seedlings. Six months later, two mature basidiomata were obtained. This is the first report of soilless fruit-body formation of this edible mushroom.

  1. [Morphological abnormalities among the offspring of irradiated pines (pinus sylvestris L.) from chernobyl populations].


    Igonina, E V; Fedotov, I S; Korotkevich, A Iu; Rubanovich, A V


    The significant changes of the quantitative signs and the increase in the frequency of morphological abnormalities were found among the offspring of pines (Pinus sylvestris L.) exposed as a result of the Chernobyl accident. We have detected that the typical effects of radiation exposure (stimulation, inhibition, abnormalities of morphogenesis) are transmitted to the offspring of irradiated pine trees. The mechanisms of their occurrence are discussed.

  2. Nutrient conservation increases with latitude of origin in European Pinus sylvestris populations.


    Oleksyn, J; Reich, P B; Zytkowiak, R; Karolewski, P; Tjoelker, M G


    Nutrient availability varies across climatic gradients, yet intraspecific adaptation across such gradients in plant traits related to internal cycling and nutrient resorption remains poorly understood. We examined nutrient resorption among six Scots pine (Pinus sylvestris L.) populations of wide-ranging origin grown under common-garden conditions in Poland. These results were compared with mass-based needle N and P for 195 Scots pine stands throughout the species' European range. At the common site, green needle N (r(2)=0.81, P=0.01) and P (r(2)=0.58, P=0.08) concentration increased with increasing latitude of population origin. Resorption efficiency (the proportion of the leaf nutrient pool resorbed during senescence) of N and P of Scots pine populations increased with the latitude of seed origin (r(2) > or = 0.67, P < or = 0.05). The greater resorption efficiency of more northerly populations led to lower concentrations of N and P in senescent leaves (higher resorption proficiency) than populations originating from low latitudes. The direction of change in these traits indicates potential adaptation of populations from northern, colder habitats to more efficient internal nutrient cycling. For native Scots pine stands, results showed greater nutrient conservation in situ in cold-adapted northern populations, via extended needle longevity (from 2 to 3 years at 50 degrees N to 7 years at 70 degrees N), and greater resorption efficiency and proficiency, with their greater resorption efficiency and proficiency having genotypic roots demonstrated in the common-garden experiment. However, for native Scots pine stands, green needle N decreased with increasing latitude (r(2)=0.83, P=0.0002), and P was stable other than decreasing above 62 degrees N. Hence, the genotypic tendency towards maintenance of higher nutrient concentrations in green foliage and effective nutrient resorption, demonstrated by northern populations in the common garden, did not entirely compensate for

  3. Development and characterization of 25 EST-SSR markers in Pinus sylvestris var. mongolica (Pinaceae)1

    PubMed Central

    Fang, Pan; Niu, Shihui; Yuan, Huwei; Li, Zhexin; Zhang, Yuncheng; Yuan, Lu; Li, Wei


    • Premise of the study: A set of novel expressed sequence tag (EST) microsatellite markers was developed in Pinus sylvestris var. mongolica to promote further genetic studies in this species. • Methods and Results: One hundred seventy-five EST–simple sequence repeat (SSR) primers were designed and synthesized for 31,653 isotigs based on P. tabuliformis EST sequences. The primer pairs were used to identify 25 polymorphic loci in 48 individuals. The number of alleles ranged from two to eight with observed and expected heterozygosity values of 0.0435 to 0.8125 and 0.0430 to 0.7820, respectively. • Conclusions: These new polymorphic EST-SSR markers will be useful for assessing genetic diversity, molecular breeding and genetic improvement, and conservation of P. sylvestris var. mongolica. PMID:25202597

  4. Seasonal dynamics of mobile carbohydrates and stem growth in Scots pine (Pinus sylvestris) exposed to drought

    NASA Astrophysics Data System (ADS)

    Oberhuber, Walter; Kofler, Werner; Schuster, Roman; Swidrak, Irene; Gruber, Andreas


    Tree growth requires a continuous supply of carbon as structural material and as a source for metabolic energy. To detect whether intra-annual stem growth is related to changes in carbon allocation, we monitored seasonal dynamics of shoot and radial growth and concentrations of mobile carbohydrates (NSC) in above- and belowground organs of Scots pine (Pinus sylvestris L.). The study area is situated within an inner Alpine dry environment (750 m asl, Tyrol, Austria), which is characterized by recurring drought periods at the start of the growing season in spring and limited water holding capacity of nutrient deficient, shallow stony soils. Shoot elongation was monitored on lateral branches in the canopy and stem radius changes were continuously followed by electronic band dendrometers. Daily radial stem growth and tree water deficit (ΔW) were extracted from dendrometer records. ΔW is regarded a reliable measure of drought stress in trees and develops when transpirational water loss from leaves exceeds water uptake by the root system. Daily radial stem growth and ΔW were related to environmental variables and determination of NSC was performed using specific enzymatic assays. Results revealed quite early culmination of aboveground growth rates in late April (shoot growth) and late May (radial growth), and increasing accumulation of NSC in coarse roots in June. NSC content in roots peaked at the end of July and thereafter decreased again, indicating a shift in carbon allocation after an early cessation of aboveground stem growth. ΔW was found to peak in late summer, when high temperatures prevailed. That maximum growth rates of aboveground organs peaked quite before precipitation increased during summer is related to the finding that ΔW and radial stem growth were more strongly controlled by the atmospheric environment, than by soil water content. We conclude that as a response to the seasonal development of ΔW a shift in carbon allocation from aboveground

  5. [Pathways and rates of Pinus sylvestris L. and Picea species recolonization into Scandinavia in Holocene].


    Sannikov, S N; Sannikova, N S


    The results are presented of comparative analysis of pathways, rates, and timing of recolonization into Scandinavia, in Holocene, of Pinus sylvestris populations and those of Picea abies and P. obovata. The dispersion rate, starting from 12 thou years before present (BP), is calculated using palynological data from scientific literature on radiometric dating. It is found out that P sylvestris spread into Central Scandinavia from the Alps via the Danish Isthmus about 8.2 thou years BP with the speed of 500-1250 km per 1 thou years. A hypothesis is put forward suggesting that such a fast speed is due to pine seeds hydrochory, which is much faster than anemochory according to our researches. From the northern part of the East European Plain, P. sylvestris spread into Fennoscandia with lower speed (520 km per 1 thou years). Populations of Picea species dispersed from the same regions with speed (131-164 km per 1 thou years) 3-10 times lower than that of P. sylvestris. Therefore, invasion of Picea abies from the Alps into Scandinavia via the Danish Isthmus did not have time to happen before the formation of the Kattegat Strait. By circumferential pathway, through Karelia, both species of Picea reached the northern parts of Scandinavia only 3.5 thou years BP, its central parts - 2 thou years BP, and its southern parts - 1.5 thou years BP, i.e., later than P. sylvestris by 4, 6.2, and 8.5 thou years respectively. Probably, this may be explained by the fact that in pines the time to seeding is twofold shorter, while their sprouts were more tolerant to climatic extremums in periglacial habitats in middle Holocene.

  6. Effect of long-term drought on carbon allocation and nitrogen uptake of Pinus sylvestris seedlings

    NASA Astrophysics Data System (ADS)

    Pumpanen, Jukka; Aaltonen, Heidi; Lindén, Aki; Köster, Kajar; Biasi, Christina; Heinonsalo, Jussi


    Weather extremes such as drought events are expected to increase in the future as a result of climate change. The drought affects the allocation of carbon assimilated by plants e.g. by modifying the root to shoot ratio, amount of fine roots and the amount of mycorrhizal fungal hyphae. We studied the effect of long term drought on the allocation of carbon in a common garden experiment with 4-year-old Pinus sylvestris seedlings. Half of the seedlings were exposed to long-term drought by setting the soil water content close to wilting point for over two growing seasons whereas the other half was grown in soil close to field capacity. We conducted a pulse labelling with 13CO2 in the end of the study by injecting a known amount of 13C enriched CO2 to the seedlings and measuring the CO2 uptake and distribution of 13C to the biomass of the seedlings and to the root and rhizosphere respiration. In addition, we studied the effect of drought on the decomposition of needle litter and uptake of nitrogen by 15N labelled needles buried in the soil in litter bags. The litterbags were collected and harvested in the end of the experiment and the changes in microbial community in the litterbags were studied from the phospholipid fatty acid (PLFA) composition. We also determined the 15N isotope concentrations from the needles of the seedlings to study the effect of drought on the nitrogen uptake of the seedlings. Our results indicate that the drought had a significant effect both on the biomass allocation of the seedlings and on the microbial species composition. The amount of carbon allocated belowground was much higher in the seedlings exposed to drought compared to the control seedlings. The seedlings seemed to adapt their carbon allocation to long-term drought to sustain adequate needle biomass and water uptake. The seedlings also adapted their osmotic potential and photosynthesis capacity to sustain the long-term drought as was indicated by the measurements of osmotic potential

  7. Detection of Intracellular Bacteria in the Buds of Scotch Pine (Pinus sylvestris L.) by In Situ Hybridization

    PubMed Central

    Pirttilä, Anna Maria; Laukkanen, Hanna; Pospiech, Helmut; Myllylä, Raili; Hohtola, Anja


    Bacterial isolates were obtained from pine (Pinus sylvestris L.) tissue cultures and identified as Methylobacterium extorquens and Pseudomonas synxantha. The existence of bacteria in pine buds was investigated by 16S rRNA in situ hybridization. Bacteria inhabited the buds of every tree examined, primarily colonizing the cells of scale primordia and resin ducts. PMID:10877808

  8. Comparative analysis of transcript abundance in Pinus sylvestris after challenge with a saprotrophic, pathogenic or mutualistic fungus.


    Adomas, Aleksandra; Heller, Gregory; Olson, Ake; Osborne, Jason; Karlsson, Magnus; Nahalkova, Jarmila; Van Zyl, Len; Sederoff, Ron; Stenlid, Jan; Finlay, Roger; Asiegbu, Frederick O


    To investigate functional differences in the recognition and response mechanisms of conifer roots to fungi with different trophic strategies, Pinus sylvestris L. was challenged with a saprotrophic fungus Trichoderma aureoviride Rifai. The results were compared with separate studies investigating pine interactions with a pathogen, Heterobasidion annosum (Fr.) Bref. sensu stricto and an ectomycorrhizal symbiont, Laccaria bicolor Maire (Orton). Global changes in the expression of 2109 conifer genes were assayed 1, 5 and 15 days after inoculation. Gene expression data from a cDNA microarray were analyzed by the 2-interconnected mixed linear model statistical approach. The total number of genes differentially expressed compared with the uninfected control was similar after challenge with the pathogen and the ectomycorrhizal symbiont, but the number of differentially expressed genes increased over time for H. annosum, and decreased for L. bicolor. Inoculation of pine roots with T. aureoviride resulted overall in a much lower number of genes with changed transcript levels compared with inoculation with H. annosum or L. bicolor. Functional classification of the differentially expressed genes revealed that the ectomycorrhizal fungus triggered transient induction of defence-related genes. The response and induction of defence against the pathogen was delayed and the magnitude increased over time. Thus, there were specific transcriptional responses depending on whether the conifer roots were challenged with mutualistic, saprotrophic or pathogenic fungi. This suggests that pine trees are able to recognize diverse fungal species and specifically distinguish whether they are pathogenic, neutral or beneficial microbial agents.

  9. Interactive effects of juvenile defoliation, light conditions, and interspecific competition on growth and ectomycorrhizal colonization of Fagus sylvatica and Pinus sylvestris seedlings.


    Trocha, Lidia K; Weiser, Ewa; Robakowski, Piotr


    Seedlings of forest tree species are exposed to a number of abiotic (organ loss or damage, light shortage) and biotic (interspecific competition) stress factors, which may lead to an inhibition of growth and reproduction and, eventually, to plant death. Growth of the host and its mycorrhizal symbiont is often closely linked, and hence, host damage may negatively affect the symbiont. We designed a pot experiment to study the response of light-demanding Pinus sylvestris and shade-tolerant Fagus sylvatica seedlings to a set of abiotic and biotic stresses and subsequent effects on ectomycorrhizal (ECM) root tip colonization, seedling biomass, and leaf nitrogen content. The light regime had a more pronounced effect on ECM colonization than did juvenile damage. The interspecific competition resulted in higher ECM root tip abundance for Pinus, but this effect was insignificant in Fagus. Low light and interspecific competition resulted in lower seedling biomass compared to high light, and the effect of the latter was partially masked by high light. Leaf nitrogen responded differently in Fagus and Pinus when they grew in interspecific competition. Our results indicated that for both light-demanding (Pinus) and shade-tolerant (Fagus) species, the light environment was a major factor affecting seedling growth and ECM root tip abundance. The light conditions favorable for the growth of seedlings may to some extent compensate for the harmful effects of juvenile organ loss or damage and interspecific competition.

  10. Fertility variation and status number in clonal seed orchards of Pinus sylvestris.


    Bilir, Nebi; Temiraga, Halime


    The present study was carried out to evaluate fertility variation, status number and gene diversity based on strobili productions in two clonal seed orchards of Scots pine (Pinus sylvestris L.). There were large differences among clones for the female and male strobili productions in the orchards. Positive and significant (p< or =0.05) correlations were found between female and male strobili production (r = 0.76, 0.55). Female fertility variation (1.03, 1.07) was larger than male fertility variation (1.02, 1.03) in the orchards. The status numbers estimated based on the total fertility were very high (97 and 98% of census numbers). The large fertility variation could be balanced by different treatments such as mixing seed equally from clones or genetinc thinning.

  11. Temporal dynamics of non-structural carbohydrates and xylem growth in Pinus sylvestris exposed to drought

    PubMed Central

    Oberhuber, Walter; Swidrak, Irene; Pirkebner, Daniela; Gruber, Andreas


    Wood formation requires a continuous supply of carbohydrates for structural growth and metabolism. In the montane belt of the central Austrian Alps we monitored the temporal dynamics of xylem growth and non-structural carbohydrates (NSC) in stem sapwood of Pinus sylvestris L. during the growing season 2009, which was characterized by exceptional soil dryness within the study area. Soil water content dropped below 10 % at the time of maximum xylem growth end of May. Histological analyses have been used to describe cambial activity and xylem growth. Determination of NSC was performed using specific enzymatic assays revealing that total NSC ranged from 0.8 to 1.7 % dry matter throughout the year. Significant variations (P < 0.05) of the size of the NSC pool were observed during the growing season. Starch showed persistent abundance throughout the year reaching a maximum shortly before onset of late wood formation in mid-July. Seasonal dynamics of NSC and xylem growth suggest that (i) high sink activity occurred at start of the growing season in spring and during late wood formation in summer and (ii) there was no particular shortage in NSC, which caused P. sylvestris to draw upon stem reserves more heavily during drought in 2009. PMID:22003262

  12. [Variability of the cytological parameters of Pinus sylvestris L. seeds from the unique Hrenovskoy pine forest].


    Butorina, A K; Cherkashina, O N; Chernodubov, A I; Avdeeva, I A


    Hrenovskoy pine forest is a unique island stand at the boundary of the species range of Scots pine Pinus sylvestris L. This object is of exceptional economic value, because it serves as a forest-seed base for the Voronezh oblast and some other regions of Russia; therefore, the stand and seed qualities have to be monitored constantly. The results of the first cytogenetic study of the seed progeny of P. sylvestris from the Morozov Grove, a high-quality stand in a reserved site within the Hrenovskoy pine forest, are reported. The studies have been performed in order to obtain a more correct assessment of seed quality based not only on their germination and energy of germination (traditionally used by forest breeders), but also on their genomic stability. The latter may be estimated by the stability of chromosome number in the somatic cells of seedlings and the regularity of mitotic divisions, because they also characterize the state of the generative system of parental forms and may serve as an integrated estimate of the stand development homeostasis. Therefore, the chromosome number, mitotic and nucleolar activities, and the number and spectrum of pathological mitoses (PMs) have been determined. Seedlings have been obtained from 240 seeds (collected from 12 trees) that resulted from free pollination. The cytological analysis of the rootlets of these seedlings has not detected any deviations from the chromosome number typical of the species P. sylvestris L. (2n = 24). However, considerable variation has been found in each family with respect to the mitotic index (MI) (from 4.2 +/- 0.36 to 8.1 +/- 0.39%) and the number of PMs (from 0.5 to 2.1%); micronuclei have also been found in each family (from 0.01 to 0.05%). In general, the phenotypic characteristics and the variation pattern of cytological parameters of the progeny of the trees studied in the Hrenovskoy pine forest, together with the high germination rate of seeds (90-98%), indicate that the current state of

  13. Growth and Survival Variation among Scots Pine (Pinus sylvestris L.) Provenances

    PubMed Central

    Gülcü, Süleyman


    Tree height, basal diameter, and survival were examined in thirteen-year-old provenance test established by 30 seed sources of Scots pine (Pinus sylvestris L.) at two exotic sites of the species in Southern part of Turkey. Variations within provenance and among provenances and relations among the traits were estimated to compare Scots pine provenance and two other native species. Averages of tree height and basal diameter were 350 cm and 52.7 mm in Aydogmus site and 385 cm and 51.2 mm in Kemer site, respectively. There were large differences within and among provenances for the characters. Sites were similar (p > 0.05) for the characters, while there were significant differences (p ≤ 0.05) among provenances within site according to results of variance analysis (ANOVA). Scots pine provenances were higher and had more thickness than that of black pine (Pinus nigra Arnold) and Taurus cedar (Cedrus libani A. Rich.) which were natural species of the region. There were positive and significant (p < 0.05) correlations between height and basal diameter in the species. Average survivals were 56% and 35% of the provenances in the sites. They were 71% and 11% in black pine and 53% in Taurus cedar for the sites respectively. PMID:28133603

  14. Growth and Survival Variation among Scots Pine (Pinus sylvestris L.) Provenances.


    Gülcü, Süleyman; Bilir, Nebi


    Tree height, basal diameter, and survival were examined in thirteen-year-old provenance test established by 30 seed sources of Scots pine (Pinus sylvestris L.) at two exotic sites of the species in Southern part of Turkey. Variations within provenance and among provenances and relations among the traits were estimated to compare Scots pine provenance and two other native species. Averages of tree height and basal diameter were 350 cm and 52.7 mm in Aydogmus site and 385 cm and 51.2 mm in Kemer site, respectively. There were large differences within and among provenances for the characters. Sites were similar (p > 0.05) for the characters, while there were significant differences (p ≤ 0.05) among provenances within site according to results of variance analysis (ANOVA). Scots pine provenances were higher and had more thickness than that of black pine (Pinus nigra Arnold) and Taurus cedar (Cedrus libani A. Rich.) which were natural species of the region. There were positive and significant (p < 0.05) correlations between height and basal diameter in the species. Average survivals were 56% and 35% of the provenances in the sites. They were 71% and 11% in black pine and 53% in Taurus cedar for the sites respectively.

  15. Impact of experimentally elevated ozone on seed germination and growth of Russian pine (Pinus sylvestris) and spruce (Picea spp.) provenances.


    Prozherina, Nadezda; Nakvasina, Elena; Oksanen, Elina


    The impact of elevated ozone concentrations on early ontogenetic stages of pine (Pinus sylvestris) and spruce (Picea abies, Picea obovata, P. abies x P. obovata) seedlings originating from different provenances in Russia were studied in the open-field ozone fumigation system located in Kuopio, Finland, over a span of 2 y. The AOT40 value (accumulated ozone dose over the threshold 40 ppb during daylight hours) was 11 ppm hr per growing season, which was 1.4 times higher than the ambient air concentration. The plants were measured for germination rate; shoot increment; needle length; and dry mass of needles, shoots, and roots. Significant differences between pine and spruce provenance response to ozone were found in all parameters. Ozone stress immediately reduced the germination rate of Northern pine provenances, whereas biomass reductions became evident during the second year of the exposure in all pine provenances. Spruce species were more tolerant to elevated ozone concentrations. Our results indicate that seedling development is vulnerable to increasing ozone concentrations and that attention must be paid to the provenance selection.

  16. Trichoderma sp. PDR1-7 promotes Pinus sylvestris reforestation of lead-contaminated mine tailing sites.


    Babu, A Giridhar; Shea, Patrick J; Oh, Byung-Taek


    Vegetation is critical to stabilize and remediate mine tailing sites, but plant growth is often poor due to toxicity from heavy metal(loid)s (HMs). A non-symbiotic endophytic fungus, Trichoderma sp. PDR1-7, isolated from Pb-contaminated mine tailing soil, exhibited both high tolerance to HMs and desirable plant growth-promoting characteristics. PDR1-7 promoted HM solubilization in mine tailing soil and removed significant amounts of Pb and other HMs from liquid media containing single and multiple metals. Pb removal efficiency increased with initial pH from 4 to 6 and with Pb concentration from 100 to 125 mg L(-1). Inoculating soil with PDR1-7 significantly increased nutrient availability and seedling growth, chlorophyll and protein contents, as well as antioxidative enzyme (superoxide dismutase) activity. A decrease in malondialdehyde indicated less oxidative stress. HM concentrations were much higher in Pinus sylvestris roots when PDR1-7 was present. These observations suggest the utility of Trichoderma sp. PDR1-7 for pine reforestation and phytoremediation of Pb-contaminated mine soil.

  17. [Radiation risk assessment for plant reference species (Pinus sylvestris and Vicia cracca) from the area of radium production waste storage].


    Evseeva, T I; Geras'kin, S A; Belykh, E S; Maĭstrenko, T A; Vakhrusheva, O M


    The risk of an enhanced level of radionuclides of the uranium and thorium decay series in the environment for reference plant species (Pinus sylvestris and Vicia cracca) was assessed. 238U, 230Th, 226Ra, 210Po, 232Th and 228Th concentration factors for plants were found to be lower than one. The aboveground parts of Vicia cracca sampled from the area of the radium production waste storage mainly accumulated 22Ra, Pinus sylvestris branches--210Pb, 226Ra and 210Po. LOEDR calculated for the chromosome aberration frequency in both plant studies was 17-71 microGy/h. LOERD values for the reproductive capacity decrease in P. sylvestris and V. cracca were 17-71 microGy/h and 116-258 microGy/h, correspondingly. EDR10 for the chromosome aberration frequency in P. sylvestris and V. cracca were 148 and 347 microGy/h, that is, correspondingly, 255 and 708 times higher that background values. EDR10 for the plant reproductive capacity was 11-34 microGy/h, which 19-69 times increases the background values.

  18. 13C discriminations of Pinus sylvestris vs. Pinus ponderosa at a dry site in Brandenburg (eastern Germany): 100-year growth comparison.


    Wagner, Ralf; Insinna, Patrick A; Götz, Bernhard; Junge, Sebastian; Boettger, Tatjana


    The carbon isotope composition (delta(13)C, per thousand) and discrimination (Delta, per thousand) of old grown North American Pinus ponderosa Dougl. Ex P. et C. Laws. and European Pinus sylvestris L. were determined using trees grown under almost identical growing conditions in a mixed stand in Bralitz, Northeast Germany. Single-tree delta(13)C analyses of tree-ring cellulose of both species were carried out at a yearly resolution for the period 1901-2001 and the results compared with growth (basal area increment). Annual mean delta(13)C values for P. ponderosa ranged from-21.6 per thousand to-25.2 per thousand and for P. sylvestris from-21.4 per thousand to-24.4 per thousand. Accordingly, (13)C discrimination (Delta) showed higher values for P. ponderosa throughout the investigation period. Five characteristic periods of Delta were identified for both the tree species, reflecting positive and negative influences of environmental factors. Good growing conditions such as after-thinning events had a positive effect on Delta, reflecting higher values, while poor conditions like aridity and air pollution had a negative influence, reflecting lower values. The dynamics of Delta were likewise reflected in the growth (basal area increment, BAI). Higher (13)C discrimination values of P. ponderosa led to higher BAIs of P. ponderosa in comparison with P. sylvestris. Correlation function analyses confirmed that P. sylvestris was more dependent on precipitation than P. ponderosa, which showed a closer relationship with temperature. The results confirm that under predominantly dry growing conditions, P. ponderosa showed better growth performance than P. sylvestris, indicating better common intrinsic water-use efficiency and, therefore, higher rates of net photosynthesis at a given transpiration. In view of the prospect of climate change, the results are very significant for assessing both trees' physiological properties and, hence, their potential for coping with future growing

  19. Stress acclimation and particulate matter accumulation in Pinus sylvestris saplings affected by moderate combinations of urban stressors.


    Hanslin, Hans Martin; Przybysz, Arkadiusz; Slimestad, Rune; Sæbø, Arne


    To predict how the function of urban vegetation and the provision of ecosystem services respond to combinations of natural and anthropogenic drivers, a better understanding of multiple stress interactions is required. This study tested combined effects of moderate levels of drought, soil salinity and exposure to diesel exhaust on parameters of physiology, metabolism, morphology and growth of Pinus sylvestris L. saplings. We found that plant responses were primarily dominated by single stressors and a few two-way interactions. Stressor combinations did not have considerable additional negative effects on plant performance compared to single stressors. Hence, synergistic and antagonistic interactions were rare and additive effects frequent. Drought cycles caused most negative effects, from chlorophyll a fluorescence and epicuticular wax content to growth responses, while soil salinity caused fewer negative effects but contributed to reduction in fine root growth and fluorescence parameters at low air contamination. Interestingly, the air contamination alone had only marginal effects on plant morphology and growth, but contributed an antagonistic effect, dampening the negative effect of drought and salinity on the maximum quantum efficiency of PSII photochemistry (Fv/Fm) and fine root biomass. Although, these effects were moderate, it appears that exhaust exposure had a cross-acclimation effect on plant responses to drought and salinity. We also found that salinity had a negative effect on the accumulation of particulate matter on shoots, illustrating that the plant stress situation can affect the provisioning of certain ecosystem services like pollution attenuation. These findings have implications for the understanding of the complex natural and anthropogenic stress situation of urban, and how to maintain the ecological functions and delivery of ecosystem services.

  20. Wood properties of Scots pines (Pinus sylvestris) grown at elevated temperature and carbon dioxide concentration.


    Kilpeläinen, Antti; Peltola, Heli; Ryyppö, Aija; Sauvala, Kari; Laitinen, Kaisa; Kellomäki, Seppo


    Impacts of elevated temperature and carbon dioxide concentration ([CO2]) on wood properties of 15-year-old Scots pines (Pinus sylvestris L.) grown under conditions of low nitrogen supply were investigated in open-top chambers. The treatments consisted of (i) ambient temperature and ambient [CO2] (AT+AC), (ii) ambient temperature and elevated [CO2] (AT+EC), (iii) elevated temperature and ambient [CO2] (ET+AC) and (iv) elevated temperature and elevated [CO2] (ET+EC). Wood properties analyzed for the years 1992-1994 included ring width, early- and latewood width and their proportions, intra-ring wood density (minimum, maximum and mean, as well as early- and latewood densities), mean fiber length and chemical composition of the wood (cellulose, hemicellulose, lignin and acetone extractive concentration). Absolute radial growth over the 3-year period was 54% greater in AT+EC trees and 30 and 25% greater in ET+AC and ET+EC trees, respectively, than in AT+AC trees. Neither elevated temperature nor elevated [CO2] had a statistically significant effect on ring width, early- and latewood widths or their proportions. Both latewood density and maximum intra-ring density were increased by elevated [CO2], whereas fiber length was increased by elevated temperature. Hemicellulose concentration decreased and lignin concentration increased significantly in response to elevated temperature. There were no statistically significant interaction effects of elevated temperature and elevated [CO2] on the wood properties, except on earlywood density.

  1. Radioactive contamination of pine (Pinus sylvestris) in Krasnoyarsk (Russia) following fallout from the Fukushima accident.


    Bolsunovsky, A; Dementyev, D


    Following the Fukushima accident in March 2011, samples of pine trees (Pinus sylvestris) were collected from three sites near the city of Krasnoyarsk (Siberia, Russia) during 2011-2012 and analyzed for artificial radionuclides. Concentrations of Fukushima-derived radionuclides in the samples of pine needles in April 2011 reached 5.51 ± 0.52 Bq kg(-1)(131)I, 0.92 ± 0.04 Bq kg(-1)(134)Cs, and 1.51 ± 0.07 Bq kg(-1)(137)Cs. An important finding was the detection of (134)Cs from the Fukushima accident not only in the pine needles and branches but also in the new shoots in 2012, which suggested a transfer of Fukushima cesium isotopes from branches to shoots. In 2011 and 2012, the (137)Cs/(134)Cs ratio for pine needles and branches collected in sampling areas Krasnoyarsk-1 and Krasnoyarsk-2 was greater than 1 (varying within a range of 1.2-2.6), suggesting the presence of "older", pre-Fukushima accident (137)Cs. Calculations showed that for pine samples growing in areas of the Krasnoyarskii Krai unaffected by contamination from the nuclear facility, the activity of the Fukushima-derived cesium isotopes was two-three times higher than the activity of the pre-accident (137)Cs.

  2. Photosynthetic electron transport adjustments in overwintering Scots pine (Pinus sylvestris L.).


    Ivanov, A G; Sane, P V; Zeinalov, Y; Malmberg, G; Gardeström, P; Huner, N P; Oquist, G


    As shown before [C. Ottander et al. (1995) Planta 197:176-183], there is a severe inhibition of the photosystem (PS) II photochemical efficiency of Scots pine (Pinus sylvestris L.) during the winter. In contrast, the in vivo PSI photochemistry is less inhibited during winter as shown by in vivo measurements of deltaA820/A820 (P700+). There was also an enhanced cyclic electron transfer around PSI in winter-stressed needles as indicated by 4-fold faster reduction kinetics of P700+. The differential functional stability of PSII and PSI was accompanied by a 3.7-fold higher intersystem electron pool size, and a 5-fold increase in the stromal electron pool available for P700+ reduction. There was also a strong reduction of the QB band in the thermoluminescence glow curve and markedly slower Q-A re-oxidation in needles of winter pine, indicating an inhibition of electron transfer between QA and QB. The data presented indicate that the plastoquinone pool is largely reduced in winter pine, and that this reduced state is likely to be of metabolic rather than photochemical origin. The retention of PSI photochemistry, and the suggested metabolic reduction of the plastoquinone pool in winter stressed needles of Scots pine are discussed in terms of the need for enhanced photoprotection of the needles during the winter and the role of metabolically supplied energy for the recovery of photosynthesis from winter stress in evergreens.

  3. Pine (Pinus sylvestris L. ) tree-limit surveillance during recent decades, central Sweden

    SciTech Connect

    Kullman, L. )


    The altitudinal tree-limit of Scots pine (Pinus sylvestris L.) has been surveyed at the population level since the early- and mid-1970s in the Swedish Scandes. Elevational tree-limit advance was recorded for the majority of sites, despite statistically stable, although highly fluctuating climate with clusters of exceptionally cold winters and many relatively cool summers. The new tree-limit derived from pines established in the late 1950s. Tree-limit rise was concurrent with net population decline for the period 1972 to 1991, mainly as a result of failing regeneration. The main factor of individual vitality depression and mortality was deduced to be winter desiccation. The progressive tree-limit has a tendency for slow upslope advance during periods of climatic stability, even if punctuated by shorter events of unfavorable climate. Pine tree-limit dynamics is suggested to be a complex of climate/age/disturbance interactions. The tree-limit may decline altitudinally mainly in response to secular climate cooling, which makes it best suited for surveying sustained climatic trends and analogous paleoclimatic reconstruction. 51 refs., 12 figs., 1 tabs.

  4. Pinus sylvestris as a missing source of nitrous oxide and methane in boreal forest

    PubMed Central

    Machacova, Katerina; Bäck, Jaana; Vanhatalo, Anni; Halmeenmäki, Elisa; Kolari, Pasi; Mammarella, Ivan; Pumpanen, Jukka; Acosta, Manuel; Urban, Otmar; Pihlatie, Mari


    Boreal forests comprise 73% of the world’s coniferous forests. Based on forest floor measurements, they have been considered a significant natural sink of methane (CH4) and a natural source of nitrous oxide (N2O), both of which are important greenhouse gases. However, the role of trees, especially conifers, in ecosystem N2O and CH4 exchange is only poorly understood. We show for the first time that mature Scots pine (Pinus sylvestris L.) trees consistently emit N2O and CH4 from both stems and shoots. The shoot fluxes of N2O and CH4 exceeded the stem flux rates by 16 and 41 times, respectively. Moreover, higher stem N2O and CH4 fluxes were observed from wet than from dry areas of the forest. The N2O release from boreal pine forests may thus be underestimated and the uptake of CH4 may be overestimated when ecosystem flux calculations are based solely on forest floor measurements. The contribution of pine trees to the N2O and CH4 exchange of the boreal pine forest seems to increase considerably under high soil water content, thus highlighting the urgent need to include tree-emissions in greenhouse gas emission inventories. PMID:26997421

  5. Pinus sylvestris as a missing source of nitrous oxide and methane in boreal forest.


    Machacova, Katerina; Bäck, Jaana; Vanhatalo, Anni; Halmeenmäki, Elisa; Kolari, Pasi; Mammarella, Ivan; Pumpanen, Jukka; Acosta, Manuel; Urban, Otmar; Pihlatie, Mari


    Boreal forests comprise 73% of the world's coniferous forests. Based on forest floor measurements, they have been considered a significant natural sink of methane (CH4) and a natural source of nitrous oxide (N2O), both of which are important greenhouse gases. However, the role of trees, especially conifers, in ecosystem N2O and CH4 exchange is only poorly understood. We show for the first time that mature Scots pine (Pinus sylvestris L.) trees consistently emit N2O and CH4 from both stems and shoots. The shoot fluxes of N2O and CH4 exceeded the stem flux rates by 16 and 41 times, respectively. Moreover, higher stem N2O and CH4 fluxes were observed from wet than from dry areas of the forest. The N2O release from boreal pine forests may thus be underestimated and the uptake of CH4 may be overestimated when ecosystem flux calculations are based solely on forest floor measurements. The contribution of pine trees to the N2O and CH4 exchange of the boreal pine forest seems to increase considerably under high soil water content, thus highlighting the urgent need to include tree-emissions in greenhouse gas emission inventories.

  6. Persisting soil drought reduces leaf specific conductivity in Scots pine (Pinus sylvestris) and pubescent oak (Quercus pubescens).


    Sterck, Frank J; Zweifel, Roman; Sass-Klaassen, Ute; Chowdhury, Qumruzzaman


    Leaf specific conductivity (LSC; the ratio of stem conductivity (K(P)) to leaf area (A(L))), a measure of the hydraulic capacity of the stem to supply leaves with water, varies with soil water content. Empirical evidence for LSC responses to drought is ambiguous, because previously published results were subject to many confounding factors. We tested how LSC of similar-sized trees of the same population, under similar climatic conditions, responds to persistently wet or dry soil. Scots pine (Pinus sylvestris L.) and pubescent oak (Quercus pubescens Willd.) trees were compared between a dry site and a wet site in the Valais, an inner alpine valley in Switzerland. Soil water strongly influenced A(L) and K(P) and the plant components affecting K(P), such as conduit radius, conduit density and functional sapwood area. Trees at the dry site had lower LSC than trees with the same stem diameter at the wet site. Low LSC in trees at the dry site was associated with a smaller functional sapwood area and narrower conduits, resulting in a stronger reduction in K(P) than in A(L). These observations support the hypothesis that trees maintain a homeostatic water pressure gradient. An alternative hypothesis is that relatively high investments in leaves compared with sapwood contribute to carbon gain over an entire season by enabling rapid whole-plant photosynthesis during periods of high water availability (e.g., in spring, after rain events and during morning hours when leaf-to-air vapor pressure deficit is small). Dynamic data and a hydraulic plant growth model are needed to test how investments in leaves versus sapwood and roots contribute to transpiration and to maximizing carbon gain throughout entire growth seasons.

  7. Reciprocal controlled crosses between Pinus sylvestris and P. mugo verified by a species-specific cpDNA marker.


    Wachowiak, Witold; Lewandowski, Andrzej; Prus-Głowacki, Wiesław


    A species-specific marker of cpDNA (paternally inherited in pines) was used to verify the hybrid origin of seedlings from controlled reciprocal crosses between Pinus sylvestris and P. mugo. A very low degree of compatibility between those two species has been revealed. In the three consecutive years of experiments, no filled seeds were obtained in the combination with P. mugo as the seed parent. From P. sylvestris as the seed parent and P. mugo as the pollen donor, we succeeded to obtain four filled seeds (about 1 %), but only in one year. The seedling obtained from the seeds had cpDNA haplotypes specific to P. mugo, which proves their hybrid origin. This method enables verification of the result of controlled crosses. The importance of the results has been discussed in the aspect of postulated natural hybridisation in sympatric populations of the two species.

  8. Site fertility and the morphological and photosynthetic acclimation of Pinus sylvestris needles to light.


    Niinemets, U; Ellsworth, D S; Lukjanova, A; Tobias, M


    Morphological and photosynthetic acclimation of current-year needles to canopy gradients in light availability (seasonal mean integrated quantum flux density, Q(int)) was studied in the temperate conifer, Pinus sylvestris L., at two sites of contrasting nutrient availability. The nutrient-rich site supported a monospecific P. sylvestris stand on an old-field. The trees were approximately 30 years old and 19-21 m tall. Mean foliar N and P contents (+/- SD) were 1.53 +/- 0.11% and 0.196 +/- 0.017%, respectively. The nutrient-poor site was located on a raised bog supporting a sparse stand of 50- to 100-year-old trees, with a height of 1-2 m, and mean needle N and P contents of 0.86 +/- 0.12% and 0.074 +/- 0.010%, respectively. At both sites, needle thickness (T) and width (W) increased with increasing Qint, and leaf dry mass per unit leaf area (MA) was also greater at higher irradiance. The light effects on MA-the product of needle density (D) and volume to total area ratio (V/AT)-resulted primarily from large increases in V/AT with Qint rather than from modifications of D, which was relatively insensitive to light. Although needle morphology versus light relationships were qualitatively similar at both sites, needles were shorter, and the slopes of W, T, MA and V/AT versus light relationships were lower, at the nutrient-poor than at the nutrient-rich site, indicating that the plasticity of foliar morphological characteristics was affected by nutrient availability. As a result of lower plasticity, needles at the nutrient-poor site were narrower, thinner, and had lower MA at high irradiance than needles at the nutrient-rich site. The maximum carboxylase activity of ribulose-1,5-bisphosphate carboxylase/oxygenase (Vcmax) and the maximum photosynthetic electron transport rate (Jmax) scaled positively with foliar N and P contents. The correlations were generally stronger with P than with N, suggesting that needle photosynthetic capacity was more heavily limited by the

  9. Genetic variability and heritability of chlorophyll a fluorescence parameters in Scots pine (Pinus sylvestris L.).


    Čepl, Jaroslav; Holá, Dana; Stejskal, Jan; Korecký, Jiří; Kočová, Marie; Lhotáková, Zuzana; Tomášková, Ivana; Palovská, Markéta; Rothová, Olga; Whetten, Ross W; Kaňák, Jan; Albrechtová, Jana; Lstibůrek, Milan


    Current knowledge of the genetic mechanisms underlying the inheritance of photosynthetic activity in forest trees is generally limited, yet it is essential both for various practical forestry purposes and for better understanding of broader evolutionary mechanisms. In this study, we investigated genetic variation underlying selected chlorophyll a fluorescence (ChlF) parameters in structured populations of Scots pine (Pinus sylvestris L.) grown on two sites under non-stress conditions. These parameters were derived from the OJIP part of the ChlF kinetics curve and characterize individual parts of primary photosynthetic processes associated, for example, with the exciton trapping by light-harvesting antennae, energy utilization in photosystem II (PSII) reaction centers (RCs) and its transfer further down the photosynthetic electron-transport chain. An additive relationship matrix was estimated based on pedigree reconstruction, utilizing a set of highly polymorphic single sequence repeat markers. Variance decomposition was conducted using the animal genetic evaluation mixed-linear model. The majority of ChlF parameters in the analyzed pine populations showed significant additive genetic variation. Statistically significant heritability estimates were obtained for most ChlF indices, with the exception of DI0/RC, φD0 and φP0 (Fv/Fm) parameters. Estimated heritabilities varied around the value of 0.15 with the maximal value of 0.23 in the ET0/RC parameter, which indicates electron-transport flux from QA to QB per PSII RC. No significant correlation was found between these indices and selected growth traits. Moreover, no genotype × environment interaction (G × E) was detected, i.e., no differences in genotypes' performance between sites. The absence of significant G × E in our study is interesting, given the relatively low heritability found for the majority of parameters analyzed. Therefore, we infer that polygenic variability of these indices is

  10. Hydrogen apparent fractionation between source water and epicuticular waxes of Pinus sylvestris in North East Finland

    NASA Astrophysics Data System (ADS)

    Newberry, S. L.; Grace, J.; Pedentchouk, N.


    Hydrogen isotopic composition of plant biomass provides crucial information about plant ecophysiology and local hydrology. Little is known about the apparent fractionation between hydrogen in source water and epicuticular leaf waxes of coniferous tree species that dominate the boreal forest ecosystem exposed to prolonged periods of sunlight during the growing season. In this study, single rope canopy access techniques were used to harvest needle and twig material from the upper, middle and lower crown of north and south facing branches of Pinus sylvestris within the subarctic forest of North East Finland. Samples were collected towards the beginning of the growing season in July and repeated in late September 2010. Leaf and twig waters were extracted cryogenically and analysed for D-enrichment. Individual n-alkanes are currently being quantified and analyzed for 13C/12C and D/H compositions. The molecular and isotopic data are supplemented by long-term in-situ cuvette photosynthetic assimilation measurements as well as relative humidity (RH), air temperature, precipitation and wind speed data collected by Helsinki University (SMEAR I). In addition RH, air temperature, wind speed and incoming solar radiation measurements were made at each individual sample point at the time of harvesting to quantify meteorological and microclimatological variation within individual trees. The outcome of this investigation will provide important insights into plant biochemistry and physiology of a crucial climate sensitive higher plant species subjected to continuous low light throughout the season. Furthermore, this work will expand our understanding of modern and palaeo-hydrology not only in northern Finland but also in other boreal forests around the world.

  11. [Genetic structure, variability and differentiation of Pinus sylvestris L. populations in the Ukrainian Carpathian Mountains and Rastoch'e].


    Pirko, Ia V; Korshikov, I I


    On the basis of electrophoretic analysis of 9 enzymous systems encoded by 20 gene loci the level of intra- and inter-population variation of two relict populations of Pinus sylvestris L. in the Ukrainian Carpathians and two ones in Rastochiye was studied. The less allele representation and the lower level of heterozygosity are typical for the Carpathian populations. Fst and Gst, parameters of populations subdivision, were not high--0.020 and 0.022 correspondingly and the coefficient DN was 0.008 in average. The results of the cluster analysis showed that only the populations of Rastochiye were united in one group indicating their genetic affinity.

  12. Manipulation of VOC emissions with methyl jasmonate and carrageenan in the evergreen conifer Pinus sylvestris and evergreen broadleaf Quercus ilex.


    Semiz, G; Blande, J D; Heijari, J; Işik, K; Niinemets, U; Holopainen, J K


    Plant defence can be induced by exposing plants to the plant hormone jasmonic acid (JA) or its volatile ester, methyl jasmonate (MeJA). Carrageenans (Carr) - sulphated D-galactans extracted from red algae - can also induce plant defences. In this study, the effects of exogenous MeJA and Carr application (concentration 300 and 12.7 μmol, respectively) on volatile emissions from two widespread evergreen woody species, Pinus sylvestris (nine Turkish and one Finnish provenance) and Quercus ilex (Italian provenance) were investigated. We collected headspace samples from seedlings and analysed the quality and quantity of volatile compounds emitted by treated and control plants. In total, 19 monoterpenes, 10 sesquiterpenes, 10 green leaf volatiles (GLVs) and two aromatic compounds were emitted by P. sylvestris from all the provenances studied. Foliar MeJA application clearly affected the volatile profiles of trees from all the provenances. Effects of Carr were genotype specific. In Q. ilex, emissions of sesquiterpenes, GLVs and the homoterpene (E)-DMNT were all induced by MeJA application. However, emissions of most constitutively emitted monoterpenes were significantly reduced. Carr application also led to a significant reduction in monoterpene emissions, but without corresponding increases in other emissions. Our results indicate that exogenously applied MeJA and Carr can both significantly modify the volatile profiles of P. sylvestris and Q. ilex, but also that there are important provenance- and species-specific differences in the overall degree of elicitation and compositions of elicited compounds.

  13. A hybrid swarm population of Pinus densiflora x P. sylvestris hybrids inferred from sequence analysis of chloroplast DNA and morphological characters

    Technology Transfer Automated Retrieval System (TEKTRAN)

    To confirm a hybrid swarm population of Pinus densiflora × P. sylvestris in Jilin, China and to study whether shoot apex morphology of 4-year old seedlings can be correlated with the sequence of a chloroplast DNA simple sequence repeat marker (cpDNA SSR), needles and seeds from P. densiflora, P. syl...

  14. Reduced gravitropic sensitivity in roots of a starch-deficient mutant of Nicotiana sylvestris

    NASA Technical Reports Server (NTRS)

    Kiss, J. Z.; Sack, F. D.


    Gravitropism was studied in seedlings of Nicotiana sylvestris Speg. et Comes wild-type (WT) and mutant NS 458 which has a defective plastid phosphoglucomutase (EC Starch was greatly reduced in NS 458 compared to the WT, but small amounts of starch were detected in rootcap columella cells in NS 458 by light and electron microscopy. The roots of WT are more sensitive to gravity than mutant NS 458 roots since: (1) in mutant roots, curvature was reduced and delayed in the time course of curvature; (2) curvature of mutant roots was 24-56% that of WT roots over the range of induction periods tested; (3) in intermittent-stimulation experiments, curvature of mutant roots was 37% or less than that of WT roots in all treatments tested. The perception time, determined by intermittent-stimulation experiments, was < or = 5 s for WT roots and 30-60 s for mutant roots. The growth rates for WT and NS 458 roots were essentially equal. These results and our previous results with WT and starchless mutant Arabidopsis roots (Kiss et al. 1989, Planta 177, 198-206) support the conclusions that a full complement of starch is necessary for full gravitropic sensitivity and that amyloplasts function in gravity perception. Since a presumed relatively small increase in plastid buoyant mass (N. sylvestris mutant versus Arabidopsis mutant) significantly improves the orientation of the N. sylvestris mutant roots, we suggest that plastids are the likeliest candidates to be triggering gravity perception in roots of both mutants.

  15. Arboreal insects associated with herbicide-stressed Pinus resinosa and Pinus sylvestris used as Sirex noctilio trap trees in New York.


    Dodds, Kevin J; Zylstra, Kelley E; Dubois, Garret D; Hoebeke, E Richard


    In September of 2004, Sirex noctilio F. (Hymenoptera: Siricidae) was detected in New York State and later found to be established over a larger area, including parts of southeastern Canada and the northeastern United States. A key component of S. noctilio detection and management plans in other parts of the world where S. noctilio has become established are chemically girdled trap trees. Trap tree usage in North America is confounded by the presence of diverse communities of organisms that inhabit dead and dying trees. We trapped a portion of the arboreal insect community arriving at Pinus resinosa Ait. and Pinus sylvestris L., trap trees girdled 3 mo before (April), one month before (June), and at S. noctilio flight (July) in central New York. Multiple-funnel traps attached to trap trees captured 30,031 individuals from 109 species of Scolytinae, Cerambycidae, and Siricidae. Ips pini (Say) and Ips grandicollis (Eichhoff) accounted for almost 50% of the scolytines captured at trap trees and were present on all girdling dates. Significantly more scolytines and cerambycids were captured on P. sylvestris compared with P. resinosa, but species richness of captured insects did not differ between the two trees. More total and conifer-inhabiting scolytines and cerambycids were captured in traps on trees girdled in April and June and higher observed species richness was found on trees girdled in April and controls. Results from this study suggest a large community of arboreal insects and associated organisms are attracted to chemically girdled trap trees and likely interact with S. noctilio.

  16. Living on the Edge: Contrasted Wood-Formation Dynamics in Fagus sylvatica and Pinus sylvestris under Mediterranean Conditions

    PubMed Central

    Martinez del Castillo, Edurne; Longares, Luis A.; Gričar, Jožica; Prislan, Peter; Gil-Pelegrín, Eustaquio; Čufar, Katarina; de Luis, Martin


    Wood formation in European beech (Fagus sylvatica L.) and Scots pine (Pinus sylvestris L.) was intra-annually monitored to examine plastic responses of the xylem phenology according to altitude in one of the southernmost areas of their distribution range, i.e., in the Moncayo Natural Park, Spain. The monitoring was done from 2011 to 2013 at 1180 and 1580 m a.s.l., corresponding to the lower and upper limits of European beech forest in this region. Microcores containing phloem, cambium and xylem were collected biweekly from twenty-four trees from the beginning of March to the end of November to assess the different phases of wood formation. The samples were prepared for light microscopy to observe the following phenological phases: onset and end of cell production, onset and end of secondary wall formation in xylem cells and onset of cell maturation. The temporal dynamics of wood formation widely differed among years, altitudes and tree species. For Fagus sylvatica, the onset of cambial activity varied between the first week of May and the third week of June. Cambial activity then slowed down and stopped in summer, resulting in a length of growing season of 48–75 days. In contrast, the growing season for P. sylvestris started earlier and cambium remained active in autumn, leading to a period of activity varying from 139-170 days. The intra-annual wood-formation pattern is site and species-specific. Comparison with other studies shows a clear latitudinal trend in the duration of wood formation, positive for Fagus sylvatica and negative for P. sylvestris. PMID:27047534

  17. Influence of solar UV radiation on the nitrogen metabolism in needles of Scots pine (Pinus sylvestris L.).


    Krywult, Marek; Smykla, Jerzy; Kinnunen, Heli; Martz, Françoise; Sutinen, Marja-Liisa; Lakkala, Kaisa; Turunen, Minna


    Needles of 20-year-old Scots pine (Pinus sylvestris L.) saplings were studied in an ultraviolet (UV) exclusion field experiment (from 2000 to 2002) in northern Finland (67 degrees N). The chambers held filters that excluded both UV-B and UV-A, excluded UV-B only, transmitted all UV (control), or lacked filters (ambient). UV-B/UV-A exclusion decreased nitrate reductase (NR) activity of 1-year-old needles of Scots pines compared to the controls. The proportion of free amino acids varied in the range 1.08-1.94% of total proteins, and was significantly higher in needles of saplings grown under UV-B/UV-A exclusion compared to the controls or UV-B exclusion. NR activity correlated with air temperature, indicating a "chamber effect". The study showed that both UV irradiance and increasing temperature are significant modulators of nitrogen (N) metabolism in Scots pine needles.

  18. [Comparative study of allozyme polymorphism in groups of pine trees (Pinus sylvestris L.) with different seed productivity].


    Korshikov, I I; Kalafat, L A


    Genotypes of 196 Pinus sylvestris L. plants from 10 natural populations of five Ukrainian regions have been determined using 19 polymorphic isozyme loci. Variability of quantity of full-grained, empty-grained and underdeveloped seeds in the cones of these plants has been studied. The basic indexes of genetic polymorphism were determined for 6 samples presented by 18-19 trees with high and low productivity of the full-grained, empty-grained and underdeveloped seeds. The maximum amount of rare alleles and genotypes as well as the highest heterozygosity (Ho = 0.285) were typical for the sample of plants with the maximum quantity of empty-grained seeds in the cones.

  19. Damage to stomata and inhibition of photosynthesis by toxic pollutants in Pinus sylvestris needles as affected by the exposure time

    SciTech Connect

    Kaipiainen, L.K.; Sofronova, G.I.; Hari, P.


    The impact of persistent exposure of Pinus sylvestris L. trees of various ages to industrial emissions on stomata and photosynthesis of needles was studied in relation to the exposure time. The electron microscopic examination of the needles revealed an erosion of the epicuticular wax and damage to stomata, which increased with needle age until stomata were completely occluded by polymetallic dust. Pollutant particles wee found to contain S, Cl, Ca, K, Mg, Mn, Al, Ni, Fe, Cu, Co, Ti, and Zn. Photosynthetic rates were inhibited by 20-60%, depending on the needle age and tree condition. It is concluded that a nonuniformity in the toxicant distribution over the forest canopy and the age-dependent changes in the state of the cuticular wax layer are the most likely causes of variability in the extent to which individual trees were damaged by the toxicants.

  20. Ectomycorrhizal colonization of naturally regenerating Pinus sylvestris L. seedlings growing in different micro-habitats in boreal forest.


    Iwański, Michał; Rudawska, Maria


    We investigated the species richness and composition of ectomycorrhizal (EM) fungi colonizing Pinus sylvestris L. seedlings naturally regenerating in boreal forest, in three different microhabitats: on forest ground, on decaying stumps, and within moss layer on erratic boulders. We tested the hypothesis that habitat differences would affect the composition of the EM community of regenerating pine seedlings. In total, 16 EM species were detected, from which none occurred on seedlings growing in all three microhabitats. Piloderma croceum and Cenococcum geophilum were common for seedlings growing in forest ground and on boulders, while Tricholoma aestuans and Suillus luteus were shared between seedlings growing on forest ground and decaying stumps. EM species richness and composition were strikingly different between seedlings regenerating in different microhabitats. Results are discussed as a function of dispersal and niche differentiation of EM fungi.

  1. Height growth of different European Scots pine Pinus sylvestris L. Provenances in a heavily polluted and a control environment.


    Oleksyn, J


    Results are presented of height measurements and degree of needle injury on five-year-old plants of Scots pine (Pinus sylvestris L.) growing near a phosphate fertiliser plant that emits SO(2) and fluorides. The populations of Scots pine represented in this experiment originate from 11 countries and were substantially differentiated in height growth and extent of needle necroses. Those populations which grew most rapidly were found to be the most sensitive to pollutant injury. The least productive provenances from the north of the range (Sweden, USSR) are at the same time characterized by lowest decline in height growth, lowest mortality and least extensive necroses. It is proposed that gene banks be established for the best genotypes likely to be eliminated in the heavily polluted conditions of Poland today.

  2. 13C-isotopic fingerprint of Pinus pinaster Ait. and Pinus sylvestris L. wood related to the quality of standing tree mass in forests from NW Spain.


    Fernandez, Irene; González-Prieto, Serafin J; Cabaneiro, Ana


    Pine forest plantations of Pinus pinaster Ait. and P. sylvestris L. located in Galicia, NW Spain, were selected to study the 13C/12C-isotopic fingerprint in wood core samples in order to find possible relationships between the delta(13)C at natural abundance levels and the quality of the standing tree mass. For each pine species, 24 forests growing on acidic soils were studied: half developed over granite and half over schists. Two dominant trees from each plot, corresponding to all possible combinations of forest stands with high or low site index and with adults or young trees, were drilled at the basal part of trunks using a Pressler drill to obtain tree ring samples. The C-isotopic compositions of the litter and the soil organic matter from different soil depths were also determined and statistically significant correlations between these values and the 13C content of the wood were observed. Despite internal variations due to the influence of site index, tree age and parent material, the isotopic fingerprint of P. pinaster wood (mean value delta13C=-26.2+/-0.8 per thousand) significantly differed (P<0.001) from that of P. sylvestris (mean value delta13C=-24.6+/-0.7 per thousand). Relationships between the quality of the stand and the C-isotopic composition of the wood were observed, high quality stands having trees more 13C-depleted than low quality ones. A high correlation between wood delta13C and site index values for P. pinaster stands (r=-0.667, P<0.001) was found, this correlation being even clearer when only P. pinaster growing over schists (r=-0.833, P<0.001) are considered. Again, the correlation between the site index and the wood delta13C of young P. pinaster trees is higher when plots over granite or schists are separately considered. A similar fact occurs for adult P. sylvestris trees from schists stands, high quality specimens being 13C-depleted compared with low quality ones. On the other hand, 13C natural abundance of wood from P. sylvestris

  3. [Responses of Pinus sylvestris var. mongolica radial growth to climate warming in Great Xing' an Mountins: a case study in Mangui].


    Zhang, Xing-Liang; He, Xing-Yuan; Chen, Zhen-Ju; Cui, Ming-Xing; Li, Na


    Based on the theory and methodology of dendrochronology, the tree ring width chronology of Pinus sylvestris var. mongolica in Mangui of Great Xing' an Mountains was developed, and the relationships between the standardized tree ring width chronology and local climate factors (temperature and precipitation) as well as the effects of climate factors on the P. sylvestris var. mongolica radial growth were analyzed. In this region, the mean monthly temperature in April-August of current year was the main factor limiting the radial growth, and the increasing mean monthly temperature from April to August had negative effects to the radial growth. The simulation of the variations of the radial growth by the mean monthly temperature change in April-August showed that the radial growth of P. sylvestris var. mongolica would present a declining trend accompanied with the warmer and drier regional climate condition.

  4. Ozone fumigation under dark/light conditions of Norway Spruce (Picea Abies) and Scots Pine (Pinus Sylvestris)

    NASA Astrophysics Data System (ADS)

    Canaval, Eva; Jud, Werner; Hansel, Armin


    Norway Spruce (Picea abies) and Scots Pine (Pinus sylvestris) represent dominating tree species in the northern hemisphere. Thus, the understanding of their ozone sensitivity in the light of the expected increasing ozone levels in the future is of great importance. In our experiments we investigated the emissions of volatile organic compounds (VOCs) of 3-4 year old Norway Spruce and Scots Pine seedlings under ozone fumigation (50-150 ppbv) and dark/light conditions. For the experiments the plants were placed in a setup with inert materials including a glass cuvette equipped with a turbulent air inlet and sensors for monitoring a large range of meteorological parameters. Typical conditions were 20-25°C and a relative humidity of 70-90 % for both plant species. A fast gas exchange rate was used to minimize reactions of ozone in the gas phase. A Switchable-Reagent-Ion-Time-of-Flight-MS (SRI-ToF-MS) was used to analyze the VOCs at the cuvette outlet in real-time during changing ozone and light levels. The use of H3O+ and NO+ as reagent ions allows the separation of certain isomers (e.g. aldehydes and ketones) due to different reaction pathways depending on the functional groups of the molecules. Within the Picea abies experiments the ozone loss, defined as the difference of the ozone concentration between cuvette inlet and outlet, remained nearly constant at the transition from dark to light. This indicates that a major part of the supplied ozone is depleted non-stomatally. In contrast the ozone loss increased by 50 % at the transition from dark to light conditions within Pinus sylvestris experiments. In this case the stomata represent the dominant loss channel. Since maximally 0.1% of the ozone loss could be explained by gas phase reactions with monoterpenes and sesquiterpenes, we suggest that ozone reactions on the surface of Picea abies represent the major sink in this case and lead to an light-independent ozone loss. This is supported by the fact that we detected

  5. Tree rings of Scots pine ( Pinus sylvestris L.) as a source of information about past climate in northern Poland

    NASA Astrophysics Data System (ADS)

    Koprowski, Marcin; Przybylak, Rajmund; Zielski, Andrzej; Pospieszyńska, Aleksandra


    Scots pine ( Pinus sylvestris) is a very common tree in Polish forests, and therefore was widely used as timber. A relatively large amount of available wood allowed a long-term chronology to be built up and used as a source of information about past climate. The analysis of reconstructed indexed values of mean temperature in 51-year moving intervals allowed the recognition of the coldest periods in the years 1207-1346, 1383-1425, 1455-1482, 1533-1574, 1627-1646, and 1694-1785. The analysis of extreme wide and narrow rings forms a complementary method of examining climatic data within tree rings. The tree ring widths, early wood and late wood widths of 16 samples were assessed during the period 1581-1676. The most apparent effect is noted in the dry summer of 1616. According to previous research and our findings, temperature from February to March seems to be one of the most stable climatic factors which influenced pine growth in Poland. Correlation coefficients in the calibration and validation procedure gave promising results for temperature reconstruction from the pine chronology.

  6. Tree rings of Scots pine (Pinus sylvestris L.) as a source of information about past climate in northern Poland.


    Koprowski, Marcin; Przybylak, Rajmund; Zielski, Andrzej; Pospieszyńska, Aleksandra


    Scots pine (Pinus sylvestris) is a very common tree in Polish forests, and therefore was widely used as timber. A relatively large amount of available wood allowed a long-term chronology to be built up and used as a source of information about past climate. The analysis of reconstructed indexed values of mean temperature in 51-year moving intervals allowed the recognition of the coldest periods in the years 1207-1346, 1383-1425, 1455-1482, 1533-1574, 1627-1646, and 1694-1785. The analysis of extreme wide and narrow rings forms a complementary method of examining climatic data within tree rings. The tree ring widths, early wood and late wood widths of 16 samples were assessed during the period 1581-1676. The most apparent effect is noted in the dry summer of 1616. According to previous research and our findings, temperature from February to March seems to be one of the most stable climatic factors which influenced pine growth in Poland. Correlation coefficients in the calibration and validation procedure gave promising results for temperature reconstruction from the pine chronology.

  7. Actinobacteria possessing antimicrobial and antioxidant activities isolated from the pollen of scots pine (Pinus sylvestris) grown on the Baikal shore.


    Axenov-Gribanov, Denis V; Voytsekhovskaya, Irina V; Rebets, Yuriy V; Tokovenko, Bogdan T; Penzina, Tatyana A; Gornostay, Tatyana G; Adelshin, Renat V; Protasov, Eugenii S; Luzhetskyy, Andriy N; Timofeyev, Maxim A


    Isolated ecosystems existing under specific environmental conditions have been shown to be promising sources of new strains of actinobacteria. The taiga forest of Baikal Siberia has not been well studied, and its actinobacterial population remains uncharacterized. The proximity between the huge water mass of Lake Baikal and high mountain ranges influences the structure and diversity of the plant world in Siberia. Here, we report the isolation of eighteen actinobacterial strains from male cones of Scots pine trees (Pinus sylvestris) growing on the shore of the ancient Lake Baikal in Siberia. In addition to more common representative strains of Streptomyces, several species belonging to the genera Rhodococcus, Amycolatopsis, and Micromonospora were isolated. All isolated strains exhibited antibacterial and antifungal activities. We identified several strains that inhibited the growth of the pathogen Candida albicans but did not hinder the growth of Saccharomyces cerevisiae. Several isolates were active against Gram-positive and Gram-negative bacteria. The high proportion of biologically active strains producing antibacterial and specific antifungal compounds may reflect their role in protecting pollen against phytopathogens.

  8. Effects of Thinning and Water Supply Manipulation on the Productivity of Pinus sylvestris var. mongolica in Northeastern China

    PubMed Central

    Tang, Yi; Liu, Ming-yu; Wu, Jin-hua


    Management is an effective tool for increasing the productivity of Mongolian pine (Pinus sylvestris var. mongolica). This species has been widely planted in China, especially in sandy lands. However, optimization of management practices had not been fully explored. We established a system dynamic model to evaluate the effects of thinning and of manipulation of water supply on the productivity and population density of a Mongolian pine forest (17 scenarios in total). Different levels of thinning increased the mean biomass of Mongolian pine over no-management to a range from 202 to 256 t·ha-1. Increasing water supply decreased the mean biomass of Mongolian pine to a range from 176 to 199 t·ha-1. These results indicated that thinning at different levels may lead to an increase in biomass accumulation, while manipulating water supply may decrease biomass. Further, thinning appeared more effective than increasing water supply in efforts at maintaining high productivity of Mongolian pine forests. Moreover, the highest biomass occurred in a scenario with a thinning intensity of 30% in over-mature trees, indicating that this thinning intensity was the most effective choice for to the maintenance of the highest biomass in Mongolian pine forests. This study informs about the interactions between Mongolian pine and forest management, and provides guidelines for the practice of management of this forest type. PMID:27829012

  9. Variation and inheritance pattern in cone and seed characteristics of Scots pine (Pinus sylvestris L.) for evaluation of genetic diversity.


    Sevik, Hakan; Topaçoğlu, Osman


    Scots pine (Pinus sylvestris L.) is one of the most common and important forest tree species in Turkey due to usefulness of its wood to many commercial uses. This species is classified as one of the economically important tree species for Turkish Forestry in the "National Tree Breeding and Seed Production Program". The objective of the present study was to investigate variation and inheritance pattern in cone and seed characteristics of Scots pine and to evaluate variation in cone and seed characters within and among clones and grafts. The results showed that maximum CV among the clones was found for SWe (21.95), FS (16.99) and CWe (16.88). According to the results of SAS, variation between the clones is averaged at 19.2% and variation within the clones is averaged at 24.4 %. Variation between the clones ranged from 3.6% (SW) to 34.5% (TC) and variation within the clones ranged from 12.3% (SW) to 38.1% (WL). For CW, AL, AW, WW and TC, genetic variation among clones was higher than within clones. When the results of study like compared with results obtained from natural populations, it was seen that genetic variability in seed orchard which was subjected to study was quite low. This case may have dangerous results for the future of forests.

  10. Microfibril angle in wood of Scots pine trees (Pinus sylvestris) after irradiation from the Chernobyl nuclear reactor accident.


    Tulik, Mirela; Rusin, Aleksandra


    The secondary cell wall structure of tracheids of Scots pine (Pinus sylvestris L.), especially the angle of microfibrils in the S(2) layer, was examined in wood deposited prior to and after the Chernobyl accident in 1986. Microscopic analysis was carried out on wood samples collected in October 1997 from breast height of three pine trees 16, 30 and 42 years old. The polluted site was located in a distance of 5 km south from the Chernobyl nuclear power plant where radioactive contamination in 1997 was 3.7 x 10(5) kBq m(-2). Anatomical analysis showed that the structure of the secondary cell wall in tracheids formed after the Chernobyl accident was changed. Changes occurred both in S(2) and S(3) layers. The angle of microfibrils in S(2) layer in wood deposited after the Chernobyl accident was different in comparison to this measured in wood formed prior to the disaster. The intensity of the changes, i.e. alteration of the microfibrils angle in S(2) layer and unusual pattern of the S(3) layer, depended on the age of the tree and was most intensive in a young tree.

  11. Ozone uptake and effects on transpiration, net photosynthesis, and dark respiration in Scots pine. [Pinus sylvestris L

    SciTech Connect

    Skaerby, L.; Troeng, E.; Bostroem, C.


    Ozone uptake, transpiration, net photosynthesis, and dark respiration were studied in the field by using an open gas exchange system in a 20-year-old stand of Scots pine (Pinus sylvestris L.). A current shoot was treated with ozone concentrations ranging from 120 to 400 x m/sup -3/ during one month. During daytime there was a linear relationship between ozone concentration and ozone uptake, and the deposition rate varied between 0.05 and 0.13 cm x s/sup -1/. Ozone at the highest concentrations seemed to decrease transpiration somewhat during daytime. At night, ozone was taken up only at the highest concentration. Both transpiration and stomatal conductance increased at night when ozone concentration was x m/sup -3/ and higher. There was no significant influence on the net photosynthetic performance during exposure to ozone. Dark respiration, however, increased throughout the experimental period, and the accumulated respiration was about 60% higher for the ozone-exposed shoot at the end of the experiment.

  12. Root architecture and wind-firmness of mature Pinus pinaster.


    Danjon, Frédéric; Fourcaud, Thierry; Bert, Didier


    This study aims to link three-dimensional coarse root architecture to tree stability in mature timber trees with an average of 1-m rooting depth. Undamaged and uprooted trees were sampled in a stand damaged by a storm. Root architecture was measured by three-dimensional (3-D) digitizing. The distribution of root volume by root type and in wind-oriented sectors was analysed. Mature Pinus pinaster root systems were organized in a rigid 'cage' composed of a taproot, the zone of rapid taper of horizontal surface roots and numerous sinkers and deep roots, imprisoning a large mass of soil and guyed by long horizontal surface roots. Key compartments for stability exhibited strong selective leeward or windward reinforcement. Uprooted trees showed a lower cage volume, a larger proportion of oblique and intermediate depth horizontal roots and less wind-oriented root reinforcement. Pinus pinaster stability on moderately deep soils is optimized through a typical rooting pattern and a considerable structural adaptation to the prevailing wind and soil profile.

  13. Impact of Scots pine (Pinus sylvestris L.) plantings on long term (137)Cs and (90)Sr recycling from a waste burial site in the Chernobyl Red Forest.


    Thiry, Yves; Colle, Claude; Yoschenko, Vasyl; Levchuk, Svjatoslav; Van Hees, May; Hurtevent, Pierre; Kashparov, Valery


    Plantings of Scots pine (Pinus sylvestris L.) on a waste burial site in the Chernobyl Red Forest was shown to greatly influence the long term redistribution of radioactivity contained in sub-surfaces trenches. After 15 years of growth, aboveground biomass of the average tree growing on waste trench no.22 had accumulated 1.7 times more (137)Cs than that of trees growing off the trench, and 5.4 times more (90)Sr. At the scale of the trench and according to an average tree density of 3300 trees/ha for the study zone, tree contamination would correspond to 0.024% of the (137)Cs and 2.52% of the (90)Sr contained in the buried waste material. A quantitative description of the radionuclide cycling showed a potential for trees to annually extract up to 0.82% of the (90)Sr pool in the trench and 0.0038% of the (137)Cs. A preferential (90)Sr uptake from the deep soil is envisioned while pine roots would take up (137)Cs mostly from less contaminated shallow soil layers. The current upward flux of (90)Sr through vegetation appeared at least equal to downward loss in waste material leaching as reported by Dewiere et al. (2004, Journal of Environmental Radioactivity 74, 139-150). Using a prospective calculation model, we estimated that maximum (90)Sr cycling can be expected to occur at 40 years post-planting, resulting in 12% of the current (90)Sr content in the trench transferred to surface soils through biomass turnover and 7% stored in tree biomass. These results are preliminary, although based on accurate methodology. A more integrated ecosystem study leading to the coupling between biological and geochemical models of radionuclide cycling within the Red Forest seems opportune. Such a study would help in the adequate management of that new forest and the waste trenches upon which they reside.

  14. Comparison of the moss Pleurozium schreberi with needles and bark of Pinus sylvestris as biomonitors of pollution by industry in Stalowa Wola (southeast Poland).


    Samecka-Cymerman, A; Kosior, G; Kempers, A J


    Concentrations of heavy metals were determined in the terrestrial bryophyte Pleurozium schreberi and in samples of bark and current and previous year needles of Pinus sylvestris collected along transects around the Stalowa Wola industry center (southeast Poland) and compared with material of the same species from a control site. The suitability of bark and pine needles for use in monitoring of serious heavy metal pollution was investigated. In the examined area current and previous year pine needles can be considered suitable biomonitors for atmospheric pollution for Cu and Zn and bark for only Cu. Bioaccumulation abilities of Cd and Cu in P. schreberi and P. sylvestris current and previous year needles were similar. Current and previous year needles were better accumulators of Mn, Ni, and Zn compared to the moss P. schreberi. Bark was a better accumulator of Cd, Cu, and Ni and an inferior accumulator of Mn compared to P. schreberi in the examined area.

  15. Semi-automated stand delineation in Mediterranean Pinus sylvestris plantations through segmentation of LiDAR data: The influence of pulse density

    NASA Astrophysics Data System (ADS)

    Varo-Martínez, Mª Ángeles; Navarro-Cerrillo, Rafael M.; Hernández-Clemente, Rocío; Duque-Lazo, Joaquín


    Traditionally, forest-stand delineation has been assessed based on orthophotography. The application of LiDAR has improved forest management by providing high-spatial-resolution data on the vertical structure of the forest. The aim of this study was to develop and test a semi-automated algorithm for stands delineation in a plantation of Pinus sylvestris L. using LiDAR data. Three specific objectives were evaluated, i) to assess two complementary LiDAR metrics, Assmann dominant height and basal area, for the characterization of the structure of P. sylvestris Mediterranean forests based on object-oriented segmentation, ii) to evaluate the influence of the LiDAR pulse density on forest-stand delineation accuracy, and iii) to investigate the algorithmś effectiveness in the delineation of P. sylvestris stands for map prediction of Assmann dominant height and basal area. Our results show that it is possible to generate accurate P. sylvestris forest-stand segmentations using multiresolution or mean shift segmentation methods, even with low-pulse-density LiDAR - which is an important economic advantage for forest management. However, eCognition multiresolution methods provided better results than the OTB (Orfeo Tool Box) for stand delineation based on dominant height and basal area estimations. Furthermore, the influence of pulse density on the results was not statistically significant in the basal area calculations. However, there was a significant effect of pulse density on Assmann dominant height [F2,9595 = 5.69, p = 0.003].for low pulse density. We propose that the approach shown here should be considered for stand delineation in other large Pinus plantations in Mediterranean regions with similar characteristics.

  16. A Functional and Structural Mongolian Scots Pine (Pinus sylvestris var. mongolica) Model Integrating Architecture, Biomass and Effects of Precipitation

    PubMed Central

    Wang, Feng; Letort, Véronique; Lu, Qi; Bai, Xuefeng; Guo, Yan; de Reffye, Philippe; Li, Baoguo


    Mongolian Scots pine (Pinus sylvestris var. mongolica) is one of the principal tree species in the network of Three-North Shelterbelt for windbreak and sand stabilisation in China. The functions of shelterbelts are highly correlated with the architecture and eco-physiological processes of individual tree. Thus, model-assisted analysis of canopy architecture and function dynamic in Mongolian Scots pine is of value for better understanding its role and behaviour within shelterbelt ecosystems in these arid and semiarid regions. We present here a single-tree functional and structural model, derived from the GreenLab model, which is adapted for young Mongolian Scots pines by incorporation of plant biomass production, allocation, allometric rules and soil water dynamics. The model is calibrated and validated based on experimental measurements taken on Mongolian Scots pines in 2007 and 2006 under local meteorological conditions. Measurements include plant biomass, topology and geometry, as well as soil attributes and standard meteorological data. After calibration, the model allows reconstruction of three-dimensional (3D) canopy architecture and biomass dynamics for trees from one- to six-year-old at the same site using meteorological data for the six years from 2001 to 2006. Sensitivity analysis indicates that rainfall variation has more influence on biomass increment than on architecture, and the internode and needle compartments and the aboveground biomass respond linearly to increases in precipitation. Sensitivity analysis also shows that the balance between internode and needle growth varies only slightly within the range of precipitations considered here. The model is expected to be used to investigate the growth of Mongolian Scots pines in other regions with different soils and climates. PMID:22927982

  17. Two new triterpenoids from the roots of Pinus densiflora.


    Otaka, Junnosuke; Komatsu, Masabumi; Miyazaki, Yasumasa; Futamura, Yushi; Osada, Hiroyuki


    Chemical investigation of the roots of Pinus densiflora led to the isolation of two new triterpenoids, (24S)-3β-methoxy-24,25-epoxy-lanost-9(11)-ene (1) and 29-acetoxy-3α-methoxyserrat-14-en-21α-ol (2), together with three known serratene-type triterpenoids (3-5) and four known diterpenoids (6-9). Their structures were determined by spectroscopic analyses.

  18. Association of FLOWERING LOCUS T/TERMINAL FLOWER 1-like gene FTL2 expression with growth rhythm in Scots pine (Pinus sylvestris).


    Avia, Komlan; Kärkkäinen, Katri; Lagercrantz, Ulf; Savolainen, Outi


    Understanding the genetic basis of the timing of bud set, an important trait in conifers, is relevant for adaptation and forestry practice. In common garden experiments, both Scots pine (Pinus sylvestris) and Norway spruce (Picea abies) show a latitudinal cline in the trait. We compared the regulation of their bud set biology by examining the expression of PsFTL2, a Pinus sylvestris homolog to PaFTL2, a FLOWERING LOCUS T/TERMINAL FLOWER 1 (FT/TFL1)-like gene, the expression levels of which have been found previously to be associated with the timing of bud set in Norway spruce. In a common garden study, we analyzed the relationship of bud phenology under natural and artificial photoperiods and the expression of PsFTL2 in a set of Scots pine populations from different latitudes. The expression of PsFTL2 increased in the needles preceding bud set and decreased during bud burst. In the northernmost population, even short night periods were efficient to trigger this expression, which also increased earlier under all photoperiodic regimes compared with the southern populations. Despite the different biology, with few limitations, the two conifers that diverged 140 million yr ago probably share an association of FTL2 with bud set, pointing to a common mechanism for the timing of growth cessation in conifers.

  19. Speciation history of three closely related pines Pinus mugo (T.), P. uliginosa (N.) and P. sylvestris (L.).


    Wachowiak, Witold; Palmé, Anna E; Savolainen, Outi


    Nucleotide polymorphisms at genomic regions including 17 nuclear loci, two chloroplast and one mitochondrial DNA fragments were used to study the speciation history of three pine species: dwarf mountain pine (Pinus mugo), peat-bog pine (P. uliginosa) and Scots pine (P. sylvestris). We set out to investigate three specific speciation scenarios: (I) P. uliginosa is a homoploid hybrid between the other two, (II) the species have evolved without gene flow after divergence and (III) there has been substantial gene flow between the species since their divergence. Overall, the genetic data suggest that P. mugo and P. uliginosa share the same gene pool (average net divergence of 0.0001) and that the phenotypic differences (e.g. growth form) are most likely due to very limited areas of the genome. P. mugo and P. uliginosa are more diverged from P. sylvestris than from each other (average net divergence of 0.0027 and 0.0026, respectively). The nucleotide patterns can best be explained by the divergence with migration speciation scenario, although the hybrid speciation scenario with small genomic contribution from P. sylvestris cannot be completely ruled out. We suggest that the large amount of shared polymorphisms between the pine taxa and the lack of monophyly at all loci studied between P. sylvestris and P. mugo-P. uliginosa can largely be explained by relatively recent speciation history and large effective population sizes but also by interspecific gene flow. These closely related pine taxa form an excellent system for searching for loci involved in adaptive variation as they are differentiated in phenotype and ecology but have very similar genetic background.

  20. Raman Spectroscopic Online Investigation of Respiratory Quotients in Pinus Sylvestris and Picea Abies during Drought and Shading

    NASA Astrophysics Data System (ADS)

    Hanf, S.; Fischer, S.; Hartmann, H.; Trumbore, S.; Popp, J.; Frosch, T.


    Drought and heat waves have been linked to forest mortality event across the globe. The underlying physiological processes are still not elucidated but both tree carbon and water relations have been identified as the driving forces. While studies on tree hydraulics are straightforward, studies on the tree carbon balance are not. For example, the use of different carbon compounds for maintenance respiration during drought cannot be assessed with measurements of carbon pools but requires real-time analyses of respiration stoichiometry. However, so far there were no technical solutions for such applications. Here we introduce cavity-enhanced Raman spectrometry (CERS) for simultaneous real-time monitoring of O2 and CO2 and rapid and continuous quantification of dark respiration rates and the respiratory quotient (RQ), i.e. the ratio of CO2 produced over O2 consumed during respiration. This ratio indicates the proportions of different substrates (carbohydrates [COH], lipids, proteins) used during respiration and allows fundamental insights into tree physiology. CERS combines high temporal resolution with a high dynamic concentration range for all important gases, ranging from few ppm to 100 vol. % with a single measurement every few seconds. The respiration analysis of tree branches was performed in a closed chamber for two species of different drought tolerance, Pinus sylvestris and Picea abies. We applied not only drought but also a shading treatment because both cause reductions in carbon assimilation rates but have different effects on tree hydraulics. Declines in RQ during shading in both species indicate a switch from pure COH metabolism to a mixture of COH, lipids and proteins. During drought such declines occurred only in the drought-tolerant pine but not in spruce and the underlying more dynamic carbon use strategy in pine may provide a physiological basis for its drought tolerance, more detailed investigation still pending. Our study highlights the suitability

  1. Influence of tree provenance on biogenic VOC emissions of Scots pine (Pinus sylvestris) stumps

    NASA Astrophysics Data System (ADS)

    Kivimäenpää, Minna; Magsarjav, Narantsetseg; Ghimire, Rajendra; Markkanen, Juha-Matti; Heijari, Juha; Vuorinen, Martti; Holopainen, Jarmo K.


    Resin-storing plant species such as conifer trees can release substantial amounts of volatile organic compounds (VOCs) into the atmosphere under stress circumstances that cause resin flow. Wounding can be induced by animals, pathogens, wind or direct mechanical damage e.g. during harvesting. In atmospheric modelling of biogenic VOCs, actively growing vegetation has been mostly considered as the source of emissions. Root systems and stumps of resin-storing conifer trees could constitute a significant store of resin after tree cutting. Therefore, we assessed the VOC emission rates from the cut surface of Scots pine stumps and estimated the average emission rates for an area with a density of 2000 stumps per ha. The experiment was conducted with trees of one Estonian and three Finnish Scots pine provenances covering a 1200 km gradient at a common garden established in central Finland in 1991. VOC emissions were dominated by monoterpenes and less than 0.1% of the total emission was sesquiterpenes. α-Pinene (7-92% of the total emissions) and 3-carene (0-76% of the total emissions) were the dominant monoterpenes. Proportions of α-pinene and camphene were significantly lower and proportions of 3-carene, sabinene, γ-terpinene and terpinolene higher in the southernmost Saaremaa provenance compared to the other provenances. Total terpene emission rates (standardised to +20 °C) from stumps varied from 27 to 1582 mg h-1 m-2 when measured within 2-3 h after tree cutting. Emission rates decreased rapidly to between 2 and 79 mg h-1 m-2 at 50 days after cutting. The estimated daily terpene emission rates on a hectare basis from freshly cut stumps at a cut tree density of 2000 per ha varied depending on provenance. Estimated emission ranges were 100-710 g ha-1 d-1 and 137-970 g ha-1 d-1 in 40 and in 60 year-old forest stands, respectively. Our result suggests that emission directly from stump surfaces could be a significant source of monoterpene emissions for a few weeks after

  2. Relationship of Bursaphelenchus xylophilus Population Density to Mortality of Pinus sylvestris

    PubMed Central

    Melakeberhan, H.; Webster, J. M.


    Seven-month-old Scots pine seedlings were inoculated with water or culture filtrate (controls), with 10,000, or 20,000 (experiment 1), and with 2,500 (experiment 2) Bursaphelenchus xylophilus B.C. isolate nematodes and maintained under defined experimental conditions. Controls did not develop pine wilt disease over a 2-month period. In experiment 1, less than 50% of the inoculum was recovered from the nematode-inoculated seedlings in the first 48 hours, after which the nematode population of both treatments increased exponentially resulting in pine death and approximately equal populations at 216 hours after inoculation. In the second experiment, plant mortality, which was always preceded by 2-3 days of chlorosis and associated stem vascular necrosis, first occurred 14 days after inoculation. The nematode population increased until about day 40 after inoculation and declined thereafter. Nematodes extracted from the roots 2 weeks after inoculation accounted for ca.15% of the total number of nematodes per pine. The study indicates that the rate of nematode reproduction is a factor in pine wilt disease. However, the lack of a linear correlation between the number of nematodes and the timing of pine mortality suggests that the timing of pine death may also depend on the location of nematode damage to the host tissue. PMID:19287724

  3. Hyperspectral and multispectral satellite sensors for mapping chlorophyll content in a Mediterranean Pinus sylvestris L. plantation

    NASA Astrophysics Data System (ADS)

    Navarro-Cerrillo, Rafael Mª; Trujillo, Jesus; de la Orden, Manuel Sánchez; Hernández-Clemente, Rocío


    A new generation of narrow-band hyperspectral remote sensing data offers an alternative to broad-band multispectral data for the estimation of vegetation chlorophyll content. This paper examines the potential of some of these sensors comparing red-edge and simple ratio indices to develop a rapid and cost-effective system for monitoring Mediterranean pine plantations in Spain. Chlorophyll content retrieval was analyzed with the red-edge R750/R710 index and the simple ratio R800/R560 index using the PROSPECT-5 leaf model and the Discrete Anisotropic Radiative Transfer (DART) and experimental approach. Five sensors were used: AHS, CHRIS/Proba, Hyperion, Landsat and QuickBird. The model simulation results obtained with synthetic spectra demonstrated the feasibility of estimating Ca + b content in conifers using the simple ratio R800/R560 index formulated with different full widths at half maximum (FWHM) at the leaf level. This index yielded a r2 = 0.69 for a FWHM of 30 nm and r2 = 0.55 for a FWHM of 70 nm. Experimental results compared the regression coefficients obtained with various multispectral and hyperspectral images with different spatial resolutions at the stand level. The strongest relationships where obtained using high-resolution hyperspectral images acquired with the AHS sensor (r2 = 0.65) while coarser spatial and spectral resolution images yielded a lower root mean square error (QuickBird r2 = 0.42; Landsat r2 = 0.48; Hyperion r2 = 0.56; CHRIS/Proba r2 = 0.57). This study shows the need to estimate chlorophyll content in forest plantations at the stand level with high spatial and spectral resolution sensors. Nevertheless, these results also show the accuracy obtained with medium-resolution sensors when monitoring physiological processes. Generating biochemical maps at the stand level could play a critical rule in the early detection of forest decline processes enabling their use in precision forestry.

  4. Did the ambient ozone affect stem increment of Scots Pines (Pinus sylvestris L.) on territories under regional pollution load? Step III of Lithuanian studies.


    Augustaitis, Algirdas; Augustaitiene, Ingrida; Cinga, Gintautas; Mazeika, Juozapas; Deltuvas, Romualdas; Juknys, Romualdas; Vitas, Adomas


    This study aimed to explore if changes in stem increment of Scots pines (Pinus sylvestris L.) could be related to changes in ambient ozone concentration when the impact of tree dendrometric parameters (age, diameter) and crown defoliation are accounted for. More than 200 dominant and codominant trees from 12 pine stands, for which crown defoliation had been assessed since 1994, were chosen for increment boring and basal area increment computing. Stands are located in Lithuanian national parks, where since 1994-95 Integrated Monitoring Stations have been operating. Findings of the study provide statistical evidence that peak concentrations of ambient ozone (O3) can have a negative impact on pine tree stem growth under field conditions where O3 exposure is below phytotoxic levels.

  5. Descendant root volume varies as a function of root type: estimation of root biomass lost during uprooting in Pinus pinaster.


    Danjon, Frédéric; Caplan, Joshua S; Fortin, Mathieu; Meredieu, Céline


    Root systems of woody plants generally display a strong relationship between the cross-sectional area or cross-sectional diameter (CSD) of a root and the dry weight of biomass (DWd) or root volume (Vd) that has grown (i.e., is descendent) from a point. Specification of this relationship allows one to quantify root architectural patterns and estimate the amount of material lost when root systems are extracted from the soil. However, specifications of this relationship generally do not account for the fact that root systems are comprised of multiple types of roots. We assessed whether the relationship between CSD and Vd varies as a function of root type. Additionally, we sought to identify a more accurate and time-efficient method for estimating missing root volume than is currently available. We used a database that described the 3D root architecture of Pinus pinaster root systems (5, 12, or 19 years) from a stand in southwest France. We determined the relationship between CSD and Vd for 10,000 root segments from intact root branches. Models were specified that did and did not account for root type. The relationships were then applied to the diameters of 11,000 broken root ends to estimate the volume of missing roots. CSD was nearly linearly related to the square root of Vd, but the slope of the curve varied greatly as a function of root type. Sinkers and deep roots tapered rapidly, as they were limited by available soil depth. Distal shallow roots tapered gradually, as they were less limited spatially. We estimated that younger trees lost an average of 17% of root volume when excavated, while older trees lost 4%. Missing volumes were smallest in the central parts of root systems and largest in distal shallow roots. The slopes of the curves for each root type are synthetic parameters that account for differentiation due to genetics, soil properties, or mechanical stimuli. Accounting for this differentiation is critical to estimating root loss accurately.

  6. Direct and indirect effects of climate on demography and early growth of Pinus sylvestris at the rear edge: changing roles of biotic and abiotic factors.


    Benavides, Raquel; Rabasa, Sonia G; Granda, Elena; Escudero, Adrián; Hódar, José A; Martínez-Vilalta, Jordi; Rincón, Ana M; Zamora, Regino; Valladares, Fernando


    Global change triggers shifts in forest composition, with warming and aridification being particularly threatening for the populations located at the rear edge of the species distributions. This is the case of Scots pine (Pinus sylvestris) in the Mediterranean Basin where uncertainties in relation to its dynamics under these changing scenarios are still high. We analysed the relative effect of climate on the recruitment patterns of Scots pine and its interactions with local biotic and abiotic variables at different spatial scales. Number of seedlings and saplings was surveyed, and their annual shoot growth measured in 96 plots located across altitudinal gradients in three different regions in the Iberian Peninsula. We found a significant influence of climate on demography and performance of recruits, with a non-linear effect of temperature on the presence of juveniles, and a positive effect of precipitation on their survival. Abundance of juveniles of P. sylvestris that underwent their first summer drought was skewed towards higher altitudes than the altitudinal mean range of the conspecific adults and the optimum elevation for seedlings' emergence. At local level, light availability did not influence juveniles' density, but it enhanced their growth. Biotic interactions were found between juveniles and the herb cover (competition) and between the number of newly emerged seedlings and shrubs (facilitation). Results also highlighted the indirect effect that climate exerts over the local factors, modulating the interactions with the pre-existing vegetation that were more evident at more stressful sites. This multiscale approach improves our understanding of the dynamics of these marginal populations and some management criteria can be inferred to boost their conservation under the current global warming.

  7. Mongolian pines (Pinus sylvestris var. mongolica) in the Hulun Buir steppe, China, respond to climate in adjustment to the local water supply.


    Bao, Guang


    The growth response of Mongolian pine (Pinus sylvestris var. mongolica) to climate was studied at three sites in the Hulun Buir steppe on the eastern Mongolian Plateau, China. Correlation analysis revealed two patterns of response: (1) trees on two sites in the upstream section of the Yimin River are strongly limited by temperature and precipitation during the growing season from April to September, and (2) trees in the convergence area of the downstream section of the Yimin River and of the midstream section of the Hailar River are sensitive to precipitation during winter (December-January) and early spring (April) as well as to the early growing season temperature (April and June). These responses can be attributed to the positions where groundwater, recharged by the runoff from summer to autumn (July-September), could supply sufficient water needed for tree growth. Therefore, the patterns of growth-climate responses and of climate variation trends in this steppe region should be considered for the management and afforestation of Mongolian pines.

  8. Genotoxicity of dill (Anethum graveolens L.), peppermint (Menthaxpiperita L.) and pine (Pinus sylvestris L.) essential oils in human lymphocytes and Drosophila melanogaster.


    Lazutka, J R; Mierauskiene, J; Slapsyte, G; Dedonyte, V


    Genotoxic properties of the essential oils extracted from dill (Anethum graveolens L.) herb and seeds, peppermint (Menthaxpiperita L.) herb and pine (Pinus sylvestris L.) needles were studied using chromosome aberration (CA) and sister chromatid exchange (SCE) tests in human lymphocytes in vitro, and Drosophila melanogaster somatic mutation and recombination test (SMART) in vivo. In the CA test, the most active essential oil was from dill seeds, then followed essential oils from dill herb, peppermint herb and pine needles, respectively. In the SCE test, the most active essential oils were from dill herb and seeds followed by essential oils from pine needles and peppermint herb. Essential oils from dill herb and seeds and pine needles induced CA and SCE in a clear dose-dependent manner, while peppermint essential oil induced SCE in a dose-independent manner. All essential oils were cytotoxic for human lymphocytes. In the SMART test, a dose-dependent increase in mutation frequency was observed for essential oils from pine and dill herb. Peppermint essential oil induced mutations in a dose-independent manner. Essential oil from dill seeds was almost inactive in the SMART test.

  9. [Allozyme variation of seed embryos and mating system in relict populations of Scots pine (Pinus sylvestris L.) from the Kremenets Hill Ridge and Maloe Poles'e].


    Korshikov, I I; Kalafat, L A; Lisnichuk, A N; Velikorid'ko, T I; Mudrik, E A


    Allozyme variation at ten polymorphic loci and mating system was studied in three small isolated relict populations (4.4 to 22 ha) and in three artificial stands of Pinus sylvestris from the Kremenets Hill Ridge and Maloe Poles'e. It was established that the mean heterozygosity of 130 to 140 year-old trees from natural populations (H(O) = 0.288; H(E) = 0.277) was substantially lower, compared to 30 to 40 year-old trees from artificial stands (H(O) = 0.358; H(E) = 0.330). The observed heterozygosity of seed embryos (H(O) = 0.169 and 0.180) was substantially lower than of the mature trees from populations and artificial stands, respectively. In the embryo samples, irrespectively of the forest stand origin, substantial hetedrozygote deficiency was observed (at six to eight loci), compared to the Hardy-Weinberg expectations. The proportion of cross pollination in the populations and artificial stands was low, t(m) = 0.588 to 0.721; and t(m) = 0.455 to 0.837, respectively.

  10. Influence of growth on reproductive traits and its effect on fertility and gene diversity in a clonal seed orchard of scots pine, Pinus Sylvestris L.


    Dutkuner, I; Bilir, N; Ulusan, D


    This study was carried out in a clonal seed orchard of scots pine (Pinus sylvestris L.), to determine the difference and interaction for reproductive and growth characters among clones and its impact on fertility variation and gene diversity Numbers of female and male strobili, and height and diameter at breast height were studied on six grafts chosen randomly in each of the 27 clones for the purpose. One-way analysis of variance revealed large differences in both reproductive and growth characters among clones. The differences were higher in growth characters than in reproductive traits. There was significant phenotypic correlation among growth and reproductive characters. So, growth characters had a greater effect on male and female fertility Estimates of total fertility variation (Sibling coefficient = 1.012), status number (26.8) and relative gene diversity (0.981) were computed. Fertility variation among clones was low, which caused a high relative population size (99% of census number). The positive phenotypic correlation between growth and reproductive characters showed that enhanced growth rate could be effective in improving fertility and gene diversity of seed orchard crop. The results of the study have implications in breeding and selection of plus tree and populations, establishment and thinning of seed orchards of the species.

  11. Effects of male fecundity, interindividual distance and anisotropic pollen dispersal on mating success in a Scots pine (Pinus sylvestris) seed orchard.


    Torimaru, T; Wennström, U; Lindgren, D; Wang, X-R


    Quantifying the effect of pollen dispersal and flowering traits on mating success is essential for understanding evolutionary responses to changing environments and establishing strategies for forest tree breeding. This study examined, quantitatively, the effects of male fecundity, interindividual distance and anisotropic pollen dispersal on the mating success of Scots pine (Pinus sylvestris), utilizing a well-mapped Scots pine seed orchard. Paternity analysis of 1021 seeds sampled from 87 trees representing 28 clones showed that 53% of the seeds had at least one potential pollen parent within the orchard. Pronounced variation in paternal contribution was observed among clones. Variations in pollen production explained up to 78% of the variation in mating success, which was 11.2 times greater for clones producing the largest amount of pollen than for clones producing the least pollen. Mating success also varied with intertree distance and direction, which explained up to 28% of the variance. Fertilization between neighboring trees 2.3 m apart was 2.4 times more frequent than between trees 4.6 m apart, and up to 12.4 times higher for trees downwind of the presumed prevailing wind direction than for upwind trees. The effective number of pollen donors recorded in the seed orchard (12.2) was smaller than the theoretical expectation (19.7). Based on the empirical observations, a mating model that best describes the gene dispersal pattern in clonal seed orchards was constructed.

  12. Cavitation induced by a surfactant leads to a transient release of water stress and subsequent 'run away' embolism in Scots pine (Pinus sylvestris) seedlings.


    Hölttä, Teemu; Juurola, Eija; Lindfors, Lauri; Porcar-Castell, Albert


    Cavitation decreases the hydraulic conductance of the xylem and has, therefore, detrimental effects on plant water balance. However, cavitation is also hypothesized to relieve water stress temporarily by releasing water from embolizing conduits to the transpiration stream. Stomatal closure in response to decreasing water potentials in order to avoid excessive cavitation has been well documented in numerous previous studies. However, it has remained unclear whether the stomata sense cavitation events themselves or whether they act in response to a decrease in leaf water potential to a level at which cavitation is initiated. The effects of massive cavitation on leaf water potential, transpiration, and stomatal behaviour were studied by feeding a surfactant into the transpiration stream of Scots pine (Pinus sylvestris) seedlings. The stomatal response to cavitation in connection with the capacitive effect was also studied. A major transient increase in leaf water potential was found due to cavitation in the seedlings. As cavitation was induced by lowering the surface tension, the two mechanisms could be uncoupled, as the usual relation between xylem water potential and the onset of cavitation did not hold. Our results indicate that the seedlings responded more to leaf water potential and less to cavitation itself, as stomatal closure was insufficient to prevent the seedlings from being driven to 'run-away' cavitation in a manner of hours.

  13. Rates and quantities of carbon flux to ectomycorrhizal mycelium following 14C pulse labeling of Pinus sylvestris seedlings: effects of litter patches and interaction with a wood-decomposer fungus.


    Leake, J R; Donnelly, D P; Saunders, E M; Boddy, L; Read, D J


    We used a novel digital autoradiographic technique that enabled, for the first time, simultaneous visualization and quantification of spatial and temporal changes in carbon allocation patterns in ectomycorrhizal mycelia. Mycorrhizal plants of Pinus sylvestris L. were grown in microcosms containing non-sterile peat. The time course and spatial distribution of carbon allocation by P. sylvestris to mycelia of its mycorrhizal partners, Paxillus involutus (Batsch) Fr. and Suillus bovinus (L.): Kuntze, were quantified following 14C pulse labeling of the plants. Litter patches were used to investigate the effects of nutrient resource quality on carbon allocation. The wood-decomposer fungus Phanerochaete velutina (D.C.: Pers.) Parmasto was introduced to evaluate competitive and territorial interactions between its mycelial cords and the mycelial system of S. bovinus. Growth of ectomycorrhizal mycelium was stimulated in the litter patches. Nearly 60% of the C transferred from host plant to external mycorrhizal mycelium (> 2 mm from root surfaces) was allocated to mycelium in the patches, which comprised only 12% of the soil area available for mycelial colonization. Mycelia in the litter patch most recently colonized by mycorrhizal mycelium received the largest investment of carbon, amounting to 27 to 50% of the total 14C in external mycorrhizal mycelium. The amount of C transfer to external mycelium of S. bovinus following pulse labeling was reduced from a maximum of 167 nmol in systems with no saprotroph to a maximum of 61 nmol in systems interacting with P. velutina. The 14C content of S. bovinus mycelium reached a maximum 24-36 h after labeling in control microcosms, but allocation did not reach a peak until 56 h after labeling, when S. bovinus interacted with mycelium of P. velutina. The mycelium of S. bovinus contained 9% of the total 14C in the plants (including mycorrhizae) at the end of the experiment, but this was reduced to 4% in the presence of P. velutina. The

  14. Influence of copper on root growth and morphology of Pinus pinea L. and Pinus pinaster Ait. seedlings.


    Arduini, I; Godbold, D L; Onnis, A


    We assessed the effects of Cu on root growth and morphology of stone pine (Pinus pinea L.) and maritime pine (Pinus pinaster Ait.) seedlings grown in culture solutions supplied with 0.012 (control), 0.1, 1 or 5 micro M CuSO(4). The presence of 5 micro M Cu in the nutrient solution completely inhibited root growth of both species within 3 days. In both species, taproot elongation was reduced in the presence of 1 micro M Cu, although partial growth recovery occurred after 7 days of treatment. The presence of 0.1 micro M Cu in the culture solution slightly enhanced root elongation in P. pinaster, but did not significantly influence root elongation in P. pinea. In both species, root weight per unit length increased in response to Cu exposure, and in P. pinaster, root diameter was significantly increased. The Cu treatments also affected lateral root number and length. In the presence of 1 micro M Cu, both species formed only short lateral primordia. The 1 micro M Cu treatment increased the lateral root index (number of roots per cm of root length) of P. pinaster, but decreased that of P. pinea, compared with control values. Neither the 0.1 nor 1 micro M Cu treatment had a significant effect on the mitotic index of either species. We conclude that cell elongation is more sensitive to Cu than cell division. Cell membrane damage, as indicated by Trypan blue staining, occurred after 10 days of exposure to 1 micro M Cu.

  15. Online investigation of respiratory quotients in Pinus sylvestris and Picea abies during drought and shading by means of cavity-enhanced Raman multi-gas spectrometry.


    Hanf, Stefan; Fischer, Sarah; Hartmann, Henrik; Keiner, Robert; Trumbore, Susan; Popp, Jürgen; Frosch, Torsten


    Photosynthesis and respiration are major components of the plant carbon balance. During stress, like drought, carbohydrate supply from photosynthesis is reduced and the Krebs cycle respiration must be fueled with other stored carbon compounds. However, the dynamics of storage use are still unknown. The respiratory quotient (RQ, CO2 released per O2 consumed during respiration) is an excellent indicator of the nature of the respiration substrate. In plant science, however, online RQ measurements have been challenging or even impossible so far due to very small gas exchange fluxes during respiration. Here we apply cavity-enhanced multi-gas Raman spectrometry (CERS) for online in situ RQ measurements in drought-tolerant pine (Pinus sylvestris [L.]) and drought-intolerant spruce (Picea abies [L. H. Karst]). Two different treatments, drought and shading, were applied to reduce photosynthesis and force dependency on stored substrates. Changes in respiration rates and RQ values were continuously monitored over periods of several days with low levels of variance. The results show that both species switched from COH-dominated respiration (RQ = 1.0) to a mixture of substrates during shading (RQ = 0.77-0.81), while during drought only pine did so (RQ = 0.75). The gas phase measurements were complemented by concentration measurements of non-structural carbohydrates and lipids. These first results suggest a physiological explanation for greater drought tolerance in pine. CERS was proven as powerful technique for non-consumptive and precise real-time monitoring of respiration rates and respirational quotients for the investigation of plant metabolism under drought stress conditions that are predicted to increase with future climate change.

  16. Characterisation of the initial degradation stage of Scots pine (Pinus sylvestris L.) sapwood after attack by brown-rot fungus Coniophora puteana.


    Irbe, Ilze; Andersone, Ingeborga; Andersons, Bruno; Noldt, Guna; Dizhbite, Tatiana; Kurnosova, Nina; Nuopponen, Mari; Stewart, Derek


    In our study, early period degradation (10 days) of Scots pine (Pinus sylvestris L.) sapwood by the brown-rot fungus Coniophora puteana (Schum.: Fr.) Karst. (BAM Ebw.15) was followed at the wood chemical composition and ultrastructure-level, and highlighted the generation of reactive oxygen species (ROS). An advanced decay period of 50 days was chosen for comparison of the degradation dynamics. Scanning UV microspectrophotometry (UMSP) analyses of lignin distribution in wood cells revealed that the linkages of lignin and polysaccharides were already disrupted in the early period of fungal attack. An increase in the lignin absorption A(280) value from 0.24 (control) to 0.44 in decayed wood was attributed to its oxidative modification which has been proposed to be generated by Fenton reaction derived ROS. The wood weight loss in the initial degradation period was 2%, whilst cellulose and lignin content decreased by 6.7% and 1%, respectively. Lignin methoxyl (-OCH3) content decreased from 15.1% (control) to 14.2% in decayed wood. Diffuse reflectance Fourier-transform infrared (DRIFT) spectroscopy corroborated the moderate loss in the hemicellulose and lignin degradation accompanying degradation. Electron paramagnetic resonance spectra and spin trapping confirmed the generation of ROS, such as hydroxyl radicals (HO∙), in the early wood degradation period. Our results showed that irreversible changes in wood structure started immediately after wood colonisation by fungal hyphae and the results generated here will assist in the understanding of the biochemical mechanisms of wood biodegradation by brown-rot fungi with the ultimate aim of developing novel wood protection methods.

  17. Levels of selected trace elements in Scots pine (Pinus sylvestris L.), silver birch (Betula pendula L.), and Norway maple (Acer platanoides L.) in an urbanized environment.


    Kosiorek, Milena; Modrzewska, Beata; Wyszkowski, Mirosław


    The aim of the study was to determine the concentrations of selected trace elements in needles and bark of Scots pine (Pinus sylvestris L.), leaves and bark of silver birch (Betula pendula L.), and Norway maple (Acer platanoides L.), as well as in the soil in which the trees grew, depending on their localization and hence the distribution of local pollution sources. The content of trace elements in needles of Scots pine, leaves of silver birch, and Norway maple and in bark of these trees depended on the location, tree species, and analyzed organ. The content of Fe, Mn, and Zn in needles, leaves, and bark of the examined tree species was significantly higher than that of the other elements. The highest average content of Fe and Mn was detected in leaves of Norway maple whereas the highest average content of Zn was found in silver birch leaves. The impact of such locations as the center of Olsztyn or roadside along Road 51 on the content of individual elements tended to be more pronounced than the influence of the other locations. The influence of the sampling sites on the content of trace elements in tree bark was less regular than the analogous effect in needles and leaves. Moreover, the relevant dependences were slightly different for Scots pine than for the other two tree species. The concentrations of heavy metals determined in the soil samples did not exceed the threshold values set in the Regulation of the Minister for the Environment, although the soil along Road 51 and in the center of Olsztyn typically had the highest content of these elements. There were also significant correlations between the content of some trace elements in soil and their accumulation in needles, leaves, and bark of trees.

  18. Toxic effects of cadmium and zinc on ectomycorrhizal colonization of Scots pine (Pinus sylvestris L.) from soil inoculum

    SciTech Connect

    Hartley-Whitaker, J.; Cairney, J.W.G.; Meharg, A.A.


    Scots pine seedlings colonized by ectomycorrhizal (ECM) fungi from natural soil inoculum were exposed to a range of Cd or Zn concentrations to investigate the effects of metals on ECM fungi-Scots pine associations in a realistic soil environment. Experiments focused on the relationship between the sensitivity of ECM fungi and their host plants, the influence of metals on ECM community dynamics on Scots pine roots, and the effects of metal exposure on ECM colonization from soil-borne propagules. Ectomycorrhizal colonization was inhibited by Cd and Zn, with a decrease in the proportion of ECM-colonized root tips. Shoot and root biomass, total root length, and total root-tip density, however, were unaffected by Cd or Zn. A decrease in the diversity of ECM morphotypes also occurred, which could have a negative effect on tree vigor. Overall, colonization by ECM fungi was more sensitive than seedling growth to Cd and Zn, and this could have serious implications for successful tree establishment on metal-contaminated soils.

  19. Drought effects on fine-root and ectomycorrhizal-root biomass in managed Pinus oaxacana Mirov stands in Oaxaca, Mexico.


    Valdés, María; Asbjornsen, Heidi; Gómez-Cárdenas, Martín; Juárez, Margarita; Vogt, Kristiina A


    The effects of a severe drought on fine-root and ectomycorrhizal biomass were investigated in a forest ecosystem dominated by Pinus oaxacana located in Oaxaca, Mexico. Root cores were collected during both the wet and dry seasons of 1998 and 1999 from three sites subjected to different forest management treatments in 1990 and assessed for total fine-root biomass and ectomycorrhizal-root biomass. Additionally, a bioassay experiment with P. oaxacana seedlings was conducted to assess the ectomycorrhizal inoculum potential of the soil for each of the three stands. Results indicated that biomasses of both fine roots and ectomycorrhizal roots were reduced by almost 60% in the drought year compared to the nondrought year. There were no significant differences in ectomycorrhizal and fine-root biomass between the wet and dry seasons. Further, the proportion of total root biomass consisting of ectomycorrhizal roots did not vary between years or seasons. These results suggest that both total fine-root biomass and ectomycorrhizal-root biomass are strongly affected by severe drought in these high-elevation tropical pine forests, and that these responses outweigh seasonal effects. Forest management practices in these tropical pine forests should consider the effects of drought on the capacity of P. oaxacana to maintain sufficient levels of ectomycorrhizae especially when there is a potential for synergistic interactions between multiple disturbances that may lead to more severe stress in the host plant and subsequent reductions in ectomycorrhizal colonization.

  20. Bioindication of the anthropogenic effects on micropopulations of Pinus sylvestris, L. in the vicinity of a plant for the storage and processing of radioactive waste and in the Chernobyl NPP zone.


    Geraskin, S A; Zimina, L M; Dikarev, V G; Dikareva, N S; Zimin, V L; Vasiliyev, D V; Oudalova, A A; Blinova, L D; Alexakhin, R M


    Results of a comparative analysis of the frequency and spectrum of cytogenetic anomalies are presented for reproductive (seeds) and vegetative (needles) samples taken from Scotch pine (Pinus sylvestris, L.) micropopulations growing at sites with differing levels of radioactive contamination in the Chernobyl NPP 30 km zone, and at the location of a facility for the processing and storage of radioactive wastes (the 'Radon' LWPE, near the town of Sosnovy Bor in the Leningrad Region). The data obtained indicate the presence of genotoxic contaminants in the environment of the tree micropopulations. Chemical toxins make the main contribution to the environmental contamination in the Sosnovy Bor area as compared with the influence of ionising radiation in the Chernobyl 30 km zone. The higher radioresistance of seeds of Scotch pine growing on the area of the 'Radon' LWPE and in the centre of Sosnovy Bor town was revealed with acute gamma-radiation.

  1. Heterologous Array Analysis in Pinaceae: Hybridization of Pinus Taeda cDNA Arrays With cDNA From Needles and Embryogenic Cultures of P. Taeda, P. Sylvestris or Picea Abies

    PubMed Central

    van Zyl, Leonel; von Arnold, Sara; Bozhkov, Peter; Chen, Yongzhong; Egertsdotter, Ulrika; MacKay, John; Sederoff, Ronald R.; Shen, Jing; Zelena, Lyubov


    Hybridization of labelled cDNA from various cell types with high-density arrays of expressed sequence tags is a powerful technique for investigating gene expression. Few conifer cDNA libraries have been sequenced. Because of the high level of sequence conservation between Pinus and Picea we have investigated the use of arrays from one genus for studies of gene expression in the other. The partial cDNAs from 384 identifiable genes expressed in differentiating xylem of Pinus taeda were printed on nylon membranes in randomized replicates. These were hybridized with labelled cDNA from needles or embryogenic cultures of Pinus taeda, P. sylvestris and Picea abies, and with labelled cDNA from leaves of Nicotiana tabacum. The Spearman correlation of gene expression for pairs of conifer species was high for needles (r2 = 0.78 − 0.86), and somewhat lower for embryogenic cultures (r2 = 0.68 − 0.83). The correlation of gene expression for tobacco leaves and needles of each of the three conifer species was lower but sufficiently high (r2 = 0.52 − 0.63) to suggest that many partial gene sequences are conserved in angiosperms and gymnosperms. Heterologous probing was further used to identify tissue-specific gene expression over species boundaries. To evaluate the significance of differences in gene expression, conventional parametric tests were compared with permutation tests after four methods of normalization. Permutation tests after Z-normalization provide the highest degree of discrimination but may enhance the probability of type I errors. It is concluded that arrays of cDNA from loblolly pine are useful for studies of gene expression in other pines or spruces. PMID:18629264

  2. Correlation between infection by ophiostomatoid fungi and the presence of subterranean termites in Loblolly pine (Pinus taeda L.) roots

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Observations of subterranean termites feeding in pine sapwood containing ophiostomatoid fungi prompted a study to investigate the effect of infection by Leptographium fungi on the probability of encountering subterranean termites in loblolly pine (Pinus taeda L.) roots. Root samples were collected f...

  3. Accumulative response of Scots pine (Pinus sylvestris L.) and silver birch (Betula pendula Roth) to heavy metals enhanced by Pb-Zn ore mining and processing plants: Explicitly spatial considerations of ordinary kriging based on a GIS approach.


    Pająk, Marek; Halecki, Wiktor; Gąsiorek, Michał


    Plants have an accumulative response to heavy metals present in soils or deposited from airborne sources of emissions. Therefore, their tissues are very often used in studies of heavy metal contamination originating from different sources as a bioindicator of environmental pollution. This research was undertaken to examine accumulation capacities of Pb, Zn, Cd, Cu and Cr in washed and unwashed needles of Scots pine (Pinus sylvestris L.) and leaves of silver birch (Betula pendula Roth) growing in a contaminated area. We collected needles of Scots pine and leaves of silver birch in an area around a sedimentation pond and metallurgic plant processing Pb and Zn ores near Olkusz, Poland. Concentrations of heavy metals, which have been linked with exposure to emissions, were determined from foliar samples collected at 33 sites. These sites were established at various distances (0.5-3.6 km) from the pond and metallurgic plant so as to identify the predominant accumulative response of plants. Spatial gradients for Pb and Zn were calculated using an ordinary kriging interpolation algorithm. A spatial pattern was identified by a GIS method to visualize maps over the Pb-Zn ore mining area. The accumulation of Zn (R(2) = 0.74, p < 0.05) and Pb (R(2) = 0.85, p < 0.01) in plant tissues correlated with soil concentrations. This tendency was not found in the case of Cu, Cd and Cr.

  4. Tree Growth and Climate Relationship: Dynamics of Scots Pine (Pinus Sylvestris L.) Growing in the Near-Source Region of the Combined Heat and Power Plant During the Development of the Pro-Ecological Strategy in Poland.


    Sensuła, Barbara; Wilczyński, Sławomir; Opała, Magdalena

    Since the 1990s, the emission of pollutants was reduced in a majority of Polish and developing country factories whereas the level of energy production was similar to that prior to the 1990s. The conifer investigated in this study has grown for many years under the stress of industrial pollution. Despite this, the trees are preserved, to a large extent, sensitive to the natural climatic factors. We present a complex analysis of the climatic (sunshine, temperature, precipitation, humidity, and wind circulation) and anthropogenic factors influencing the radial increment dynamics of Scots pine (Pinus sylvestris L.) growing in the vicinity of the combined heat and power station in Łaziska (Poland). We analyzed the spatiotemporal distribution of growth reductions, the depth of reduction with respect to the distance from the emitter, the relationship between tree growth and climate during the industry development period and during proecological strategy application . Samples of carbon isotopic composition in pine needles from 2012 to 2013 were additionally determined. Pines series of 3 positions indicate that they have a similar sensitivity to most climatic elements of the previous and given year, but there is also a different rhythm between the studied populations of incremental growth of pines. The causes of diversity are due to the different types of habitat (site types) and industrial pollution. The variation in carbon stable isotopic composition in pine needles was connected with an increase of CO2.

  5. Actual evapotranspiration estimation in a Mediterranean mountain region by means of Landsat-5 TM and TERRA/AQUA MODIS imagery and Sap Flow measurements in Pinus sylvestris forest stands.

    NASA Astrophysics Data System (ADS)

    Cristóbal, J.; Poyatos, R.; Ninyerola, M.; Pons, X.; Llorens, P.


    Evapotranspiration monitoring has important implications on global and regional climate modelling, as well as in the knowledge of the hydrological cycle and in the assessment of environmental stress that affects forest and agricultural ecosystems. An increase of evapotranspiration while precipitation remains constant, or is reduced, could decrease water availability for natural and agricultural systems and human needs. Consequently, water balance methods, as the evapotranspiration modelling, have been widely used to estimate crop and forest water needs, as well as the global change effects. Nowadays, radiometric measurements provided by Remote Sensing and GIS analysis are the technologies used to compute evapotranspiration at regional scales in a feasible way. Currently, the 38% of Catalonia (NE of the Iberian Peninsula) is covered by forests, and one of the most important forest species is Scots Pine (Pinus sylvestris) which represents the 18.4% of the area occupied by forests. The aim of this work is to model actual evapotranspiration in Pinus sylvestris forest stands, in a Mediterranean mountain region, using remote sensing data, and compare it with stand-scale sap flow measurements measured in the Vallcebre research area (42° 12' N, 1° 49' E), in the Eastern Pyrenees. To perform this study a set of 30 cloud-free TERRA-MODIS images and 10 Landsat-5 TM images of path 198 and rows 31 and 32 from June 2003 to January 2005 have been selected to perform evapotranspiration modelling in Pinus sylvestris forest stands. TERRA/AQUA MODIS images have been downloaded by means of the EOS Gateway. We have selected two different types of products which contain the remote sensing data we have used to model daily evapotranspiration, daily LST product and daily calibrated reflectances product. Landsat-5 TM images have been corrected by means of conventional techniques based on first order polynomials taking into account the effect of land surface relief using a Digital

  6. δ²H, δ¹³C and δ¹⁸O from whole wood, α-cellulose and lignin methoxyl groups in Pinus sylvestris: a multi-parameter approach.


    Mischel, Maria; Esper, Jan; Keppler, Frank; Greule, Markus; Werner, Willy


    Novel tree ring parameters - δ(13)C and δ(2)H from methoxyl groups - have been developed to reconstruct palaeoclimate. Tests with δ(13)C and δ(18)O derived from whole wood and cellulose samples, however, indicated differences in the isotopic composition and climate signal, depending on the extracted wood component. We assess this signal dependency by analysing (i) δ(13)C and δ(18)O from whole wood and cellulose and (ii) δ(13)C and δ(2)H from methoxyl groups, using Pinus sylvestris L. growing near Altenkirchen (Germany). Results indicate significant correlations among the time series derived from whole wood, cellulose, and lignin methoxyl groups. Compared with the whole wood samples, δ(13)C from methoxyl groups showed a different and overall lower response to climate parameters. On the other hand, δ(2)H from methoxyl groups showed high correlations with temperature and was also correlated with ring width, indicating its potential as a temperature proxy. Isotope time series with the highest correlation with climatic parameter were: (i) whole wood and cellulose δ(13)C with growing season precipitation and summer temperature; (ii) methoxyl groups with spring precipitation; (iii) whole wood and cellulose δ(18)O correlates with annual evapotranspiration and water balance; and (iv) methoxyl group δ(2)H with spring temperatures. These findings reveal that multiple climate elements can be reconstructed from different wood components and that whole wood proxies perform comparably to cellulose time series.

  7. Effects of warming treatment and precipitation manipulation on fine root length of Pinus densiflora seedlings.

    NASA Astrophysics Data System (ADS)

    Han, S. H.; Yoon, S. J.; Lee, J.; Kim, S.; Li, G.; Park, M.; An, J.; Son, Y.


    Fine roots are important for water and nutrient uptake and storage of carbon and nutrients in terrestrial ecosystems. In order to examine effects of climate change on fine root of Pinus densiflora seedlings, an open-field experiment with the warming treatment and precipitation manipulation had been conducted at a nursery in Seoul, South Korea. Two-year-old P. seedlings were planted in April, 2013. The air temperature of the warmed plots (W) was set to increase by 3°C compared to the temperature control plots (C) using infrared lamps. The precipitation manipulation consisted of the precipitation decreased using transparent panel (-30%; P-), the precipitation increased using pump and drip-irrigation (+30%; P+), and the precipitation control (0%; P0). The fine root length of the seedlings near the soil surface (0-15 cm depth) was estimated from January, 2014 to January, 2015 trimonthly using minirhizotrons. The mean fine root length (mm mm-2) were 115.0 (WP0), 163.7 (WP-), 90.5 (WP+), 114.4 (CP0), 130.2 (CP-), and 100.6 (CP+) during the study period, respectively. The mean fine root length was significantly affected by the precipitation manipulation (P<0.0001); however, it was not influenced by the warming treatment (P>0.1). There was no interaction between warming and precipitation effects in fine root length. The fine root length in P- plot was higher than those in P0 plot and P+ plot, regardless of the warming treatment, which indicated that water stress caused by P- might stimulate the fine root growth. Meanwhile, the no consistent patterns of fine root length by warming treatment was found under P+ plot and P0 plot, but a positive effect of warming on fine root length was observed under P+ plot only. Estimations of fine root production and mortality are required to determine the interaction between warming and precipitation effects on fine root dynamics more exactly. This study was supported by Korea Ministry of Environment (2014001310008).


    EPA Science Inventory

    The effects of elevated CO-2 and N fertilization on fine root growth of Pinus ponderosa Dougl. ex P. Laws. C. Laws., grown in native soil in open-top field-exposure chambers at Placerville, CA, were monitored for a 2-year period using minirhizotrons. The experimental design was a...

  9. Elevational trends in hydraulic efficiency and safety of Pinus cembra roots.


    Losso, Adriano; Nardini, Andrea; Nolf, Markus; Mayr, Stefan


    In alpine regions, elevational gradients in environmental parameters are reflected by structural and functional changes in plant traits. Elevational changes in plant water relations have also been demonstrated, but comparable information on root hydraulics is generally lacking. We analyzed the hydraulic efficiency (specific hydraulic conductivity k s, entire root system conductance K R) and vulnerability to drought-induced embolism (water potential at 50 % loss of conductivity Ψ 50) of the roots of Pinus cembra trees growing along an elevational transect of 600 m. Hydraulic parameters of the roots were compared with those of the stem and related to anatomical traits {mean conduit diameter (d), wall reinforcement [(t/b)(2)]}. We hypothesized that temperature-related restrictions in root function would cause a progressive limitation of hydraulic efficiency and safety with increasing elevation. We found that both root k s and K R decreased from low (1600 m a.s.l.: k s 5.6 ± 0.7 kg m(-1) s(-1) MPa(-1), K R 0.049 ± 0.005 kg m(-2) s (-1) MPa(-1)) to high elevation (2100 m a.s.l.: k s 4.2 ± 0.6 kg m(-1) s(-1) MPa(-1), K R 0.035 ± 0.006 kg m(-2) s(-1) MPa(-1)), with small trees showing higher K R than large trees. k s was higher in roots than in stems (0.5 ± 0.05 kg m(-1)s(-1)MPa(-1)). Ψ 50 values were similar across elevations and overall less negative in roots (Ψ 50 -3.6 ± 0.1 MPa) than in stems (Ψ 50 -3.9 ± 0.1 MPa). In roots, large-diameter tracheids were lacking at high elevation and (t/b)(2) increased, while d did not change. The elevational decrease in root hydraulic efficiency reflects a limitation in timberline tree hydraulics. In contrast, hydraulic safety was similar across elevations, indicating that avoidance of hydraulic failure is important for timberline trees. As hydraulic patterns can only partly be explained by the anatomical parameters studied, limitations and/or adaptations at the pit level are likely.

  10. Identification of genes differentially expressed in ectomycorrhizal roots during the Pinus pinaster-Laccaria bicolor interaction.


    Flores-Monterroso, Aranzazu; Canales, Javier; de la Torre, Fernando; Ávila, Concepción; Cánovas, Francisco M


    Ectomycorrhizal associations are of major ecological importance in temperate and boreal forests. The development of a functional ectomycorrhiza requires many genetic and biochemical changes. In this study, suppressive subtraction hybridization was used to identify differentially expressed genes in the roots of maritime pine (Pinus pinaster Aiton) inoculated with Laccaria bicolor, a mycorrhizal fungus. A total number of 200 unigenes were identified as being differentially regulated in maritime pine roots during the development of mycorrhiza. These unigenes were classified into 10 categories according to the function of their homologues in the GenBank database. Approximately, 40 % of the differentially expressed transcripts were genes that coded for unknown proteins in the databases or that had no homology to known genes. A group of these differentially expressed genes was selected to validate the results using quantitative real-time PCR. The transcript levels of the representative genes were compared between the non-inoculated and inoculated plants at 1, 5, 15 and 30 days after inoculation. The observed expression patterns indicate (1) changes in the composition of the wall cell, (2) tight regulation of defence genes during the development of mycorrhiza and (3) changes in carbon and nitrogen metabolism. Ammonium excess or deficiency dramatically affected the stability of ectomycorrhiza and altered gene expression in maritime pine roots.

  11. The role of below-ground competition during early stages of secondary succession: the case of 3-year-old Scots pine (Pinus sylvestris L.) seedlings in an abandoned grassland.


    Picon-Cochard, Catherine; Coll, Lluis; Balandier, Philippe


    In abandoned or extensively managed grasslands, the mechanisms involved in pioneer tree species success are not fully explained. Resource competition among plants and microclimate modifications have been emphasised as possible mechanisms to explain variation of survivorship and growth. In this study, we evaluated a number of mechanisms that may lead to successful survival and growth of seedlings of a pioneer tree species (Pinus sylvestris) in a grass-dominated grassland. Three-year-old Scots pines were planted in an extensively managed grassland of the French Massif Central and for 2 years were either maintained in bare soil or subjected to aerial and below-ground interactions induced by grass vegetation. Soil temperatures were slightly higher in bare soil than under the grass vegetation, but not to an extent explaining pine growth differences. The tall grass canopy reduced light transmission by 77% at ground level and by 20% in the upper part of Scots pine seedlings. Grass vegetation presence also significantly decreased soil volumetric water content (Hv) and soil nitrate in spring and in summer. In these conditions, the average tree height was reduced by 5% compared to trees grown in bare soil, and plant biomass was reduced by 85%. Scots pine intrinsic water-use efficiency (A/g), measured by leaf gas-exchange, increased when Hv decreased owing to a rapid decline of stomatal conductance (g). This result was also confirmed by delta 13C analyses of needles. A summer 15N labelling of seedlings and grass vegetation confirmed the higher NO3 capture capacity of grass vegetation in comparison with Scots pine seedlings. Our results provide evidence that the seedlings' success was linked to tolerance of below-ground resource depletion (particularly water) induced by grass vegetation based on morphological and physiological plasticity as well as to resource conservation.

  12. Effects of the Indole-3-Acetic Acid (IAA) Transport Inhibitors N-1-Naphthylphthalamic Acid and Morphactin on Endogenous IAA Dynamics in Relation to Compression Wood Formation in 1-Year-Old Pinus sylvestris (L.) Shoots.

    PubMed Central

    Sundberg, B.; Tuominen, H.; Little, CHA.


    Both N-1-naphthylphthalamic acid (NPA) and methyl-2-chloro-9-hydroxyfluorene-9-carboxylic acid (CF) inhibit the polar transport of indole-3-acetic acid (IAA) and, therefore, are attractive tools for investigating IAA's role in the regulation of plant growth. Ringing an intact conifer shoot with lanolin containing NPA or CF induces the formation of compression wood above the ring. This induction has been attributed to a postulated accumulation of IAA above the application site of the IAA transport inhibitor, but the validity of this postulation has never been confirmed. Using gas chromatography-selected ion monitoring-mass spectroscopy with [13C6]IAA as an internal standard, we measured the levels of endogenous free and conjugated IAA in 1-year-old Pinus sylvestris (L.) shoots ringed with NPA or CF. The level of free IAA was dramatically decreased below the ring, indicating that the polar transport of endogenous IAA was inhibited by the treatment. However, the free IAA level above the ring, where compression wood was formed, was also slightly lower than in control shoots. The lack of IAA accumulation above the site of the IAA transport inhibitor could not be explained by an increase in IAA conjugation. Furthermore, the turnover of [2-14C]IAA, measured using high-performance liquid chromatography with on-line radioactivity monitoring, was the same in NPA-treated and control shoots. The decrease in IAA level above a NPA or CF ring is attributed to these substances being transported acropetally and interfering with polar IAA transport along the shoot. It is concluded that compression wood formation above a NPA or CF ring is not associated with an overall increase in cambial region IAA level or increased IAA turnover. Instead, we suggest that acropetally transported NPA and CF induce compression wood formation by interacting with the NPA receptor in differentiating tracheids, thereby locally increasing IAA in these cells. PMID:12232343

  13. Binding of RDX to Cell Wall Components of Pinus sylvestris and Picea glauca and Three-Year Mineralisation Study of Tissue-Associated RDX Residues.


    Schoenmuth, Bernd; Schenke, Detlef; Scharnhorst, Tanja; Combrinck, Sandra; McCrindle, Robert I; Mueller, Jakob O; Büttner, Carmen; Pestemer, Wilfried


    Contamination of soils with the explosive hexahydro-1,3,5-trinitro-1,3,5-triazine (RDX, Research Department Explosive) as a result of military applications is a large-area problem globally. Since coniferous trees dominate the vegetation of large areas of military land in Central Europe, particularly in Germany, the long-term fate of (14)C-RDX in the conifers Scots pine and Dwarf Alberta spruce was studied. Acetic acid was the most effective solvent for the removal of extractable RDX residues from homogenates of RDX-laden tree material (85%, 80-90% and 64-80% for roots, wood and needles, respectively). On average, only a fifth of RDX-derived (14)C was bound in non-extractable residues (NER). Within the main cell wall compartments, lignin was the dominant binding site for NER (needles: 32-62%; roots: 38-42%). Hemicellulose (needles: 11-18%; roots: 6-11%) and cellulose (needles: 12-24%; roots: 1-2%) were less involved in binding and a considerable proportion of NER (needles: 15-24%; roots: 59-51%) was indigestible. After three-year incubation in rot chambers, mineralisation of tree-associated (14)C-RDX to (14)CO2 clearly dominated the mass balance in both tree species with 48-83%. 13-33% of (14)C-RDX-derived radioactivity remained in an unleachable form and the remobilisation by water leaching was negligible (< 2%).

  14. Adaptation of fine roots to annual fertilization and irrigation in a 13-year-old Pinus pinaster stand.


    Bakker, M R; Jolicoeur, E; Trichet, P; Augusto, L; Plassard, C; Guinberteau, J; Loustau, D


    Effects of fertilization and irrigation on fine roots and fungal hyphae were studied in 13-year-old maritime pine (Pinus pinaster Aït. in Soland), 7 years after the initiation of the treatments. The fertilization trials consisted of a phosphorus treatment, a complete fertilizer treatment (N, P, K, Ca and Mg), and an unfertilized treatment (control). Fertilizers were applied annually and were adjusted according to foliar target values. Two irrigation regimes (no irrigation and irrigation of a set amount each day) were applied from May to October. Root samples to depths of 120 cm were collected in summer of 2005, and the biomass of small roots (diameter 2-20 mm) and fine roots (diameter root morphology were assessed. Biomass and length of hyphae were studied by a mesh ingrowth bag technique. Total fine root biomass in the litter and in the 0-120 cm soil profile ranged between 111 and 296 g m(-2). Results derived from the measurements of biomass and root length, or root area, showed that both fertilizer treatments reduced the size of the fine root system, especially in the top soil layers, but did not affect small roots. Compared with control treatments, fine root morphology was affected by both fertilizer treatments with the fine roots having increased specific root length/area, and irrigation tended to reinforce this finer morphology. The amount of hyphae in the mesh ingrowth bags was higher in the fertilization and irrigation treatments than in the controls, suggesting further extension of the root system (ectomycorrhizal infection) and thus of the uptake system. Irrigation had no significant effect on the size of the fine root system, but resulted in a shallower rooting system. Total root to shoot ratios were unaffected by the treatments, but fine root mass:needle mass and fine root area index:leaf area index ratios decreased with increasing nutrient supply. Overall, compared with the control fine roots, increased nutrient supply resulted in a

  15. The evaluation of different forest structural indices to predict the stand aboveground biomass of even-aged Scotch pine (Pinus sylvestris L.) forests in Kunduz, Northern Turkey.


    Ercanli, İlker; Kahriman, Aydın


    We assessed the effect of stand structural diversity, including the Shannon, improved Shannon, Simpson, McIntosh, Margelef, and Berger-Parker indices, on stand aboveground biomass (AGB) and developed statistical prediction models for the stand AGB values, including stand structural diversity indices and some stand attributes. The AGB prediction model, including only stand attributes, accounted for 85 % of the total variance in AGB (R (2)) with an Akaike's information criterion (AIC) of 807.2407, Bayesian information criterion (BIC) of 809.5397, Schwarz Bayesian criterion (SBC) of 818.0426, and root mean square error (RMSE) of 38.529 Mg. After inclusion of the stand structural diversity into the model structure, considerable improvement was observed in statistical accuracy, including 97.5 % of the total variance in AGB, with an AIC of 614.1819, BIC of 617.1242, SBC of 633.0853, and RMSE of 15.8153 Mg. The predictive fitting results indicate that some indices describing the stand structural diversity can be employed as significant independent variables to predict the AGB production of the Scotch pine stand. Further, including the stand diversity indices in the AGB prediction model with the stand attributes provided important predictive contributions in estimating the total variance in AGB.

  16. Association of Pinus banksiana Lamb. and Populus tremuloides Michx. seedling fine roots with Sistotrema brinkmannii (Bres.) J. Erikss. (Basidiomycotina).


    Potvin, Lynette R; Richter, Dana L; Jurgensen, Martin F; Dumroese, R Kasten


    Sistotrema brinkmannii (Bres.) J. Erikss. (Basidiomycotina, Hydanaceae), commonly regarded as a wood decay fungus, was consistently isolated from bareroot nursery Pinus banksiana Lamb. seedlings. S. brinkmannii was found in ectomycorrhizae formed by Thelephora terrestris Ehrh., Laccaria laccata (Scop.) Cooke, and Suillus luteus (L.) Roussel. In pure culture combinations with sterile P. banksiana and Populus tremuloides Michx. seedlings, S. brinkmannii colonized root cortical cells while not killing seedlings. Colonization by S. brinkmannii appeared to be intracellular but typical endo- or ectomycorrhizae were not formed. The fungus did not decay roots, although it was shown to produce cellulase in enzyme tests. Results suggest a unique association between S. brinkmannii and seedling roots that is neither mycorrhizal nor detrimental; its exact function remains to be elucidated.

  17. Soil respiration patterns in root gaps 27 years after small scale experimental disturbance in Pinus contorta forests

    NASA Astrophysics Data System (ADS)

    Baker, S.; Berryman, E.; Hawbaker, T. J.; Ewers, B. E.


    While much attention has been focused on large scale forest disturbances such as fire, harvesting, drought and insect attacks, small scale forest disturbances that create gaps in forest canopies and below ground root and mycorrhizal networks may accumulate to impact regional scale carbon budgets. In a lodgepole pine (Pinus contorta) forest near Fox Park, WY, clusters of 15 and 30 trees were removed in 1988 to assess the effect of tree gap disturbance on fine root density and nitrogen transformation. Twenty seven years later the gaps remain with limited regeneration present only in the center of the 30 tree plots, beyond the influence of roots from adjacent intact trees. Soil respiration was measured in the summer of 2015 to assess the influence of these disturbances on carbon cycling in Pinus contorta forests. Positions at the centers of experimental disturbances were found to have the lowest respiration rates (mean 2.45 μmol C/m2/s, standard error 0.17 C/m2/s), control plots in the undisturbed forest were highest (mean 4.15 μmol C/m2/s, standard error 0.63 C/m2/s), and positions near the margin of the disturbance were intermediate (mean 3.7 μmol C/m2/s, standard error 0.34 C/m2/s). Fine root densities, soil nitrogen, and microclimate changes were also measured and played an important role in respiration rates of disturbed plots. This demonstrates that a long-term effect on carbon cycling occurs when gaps are created in the canopy and root network of lodgepole forests.

  18. Soil properties and root biomass responses to prescribed burning in young Corsican pine (Pinus nigra Arn.) stands.


    Tufekcioglu, Aydin; Kucuk, Mehmet; Saglam, Bulent; Bilgili, Ertugrul; Altun, Lokman


    Fire is an important tool in the management of forest ecosystems. Although both prescribed and wildland fires are common in Turkey, few studies have addressed the influence of such disturbances on soil properties and root biomass dynamics. In this study, soil properties and root biomass responses to prescribed fire were investigated in 25-year-old corsican pine (Pinus nigra Arn.) stands in Kastamonu, Turkey. The stands were established by planting and were subjected to prescribed burning in July 2003. Soil respiration rates were determined every two months using soda-lime method over a two-year period. Fine (0-2 mm diameter) and small root (2-5 mm diameter) biomass were sampled approximately bimonthly using sequential coring method. Mean daily soil respiration ranged from 0.65 to 2.19 g Cm(-2) d(-1) among all sites. Soil respiration rates were significantly higher in burned sites than in controls. Soil respiration rates were correlated significantly with soil moisture and soil temperature. Fine root biomass was significantly lower in burned sites than in control sites. Mean fine root biomass values were 4940 kg ha(-1) for burned and 5450 kg ha(-1) for control sites. Soil pH was significantly higher in burned sites than in control sites in 15-35 cm soil depth. Soil organic matter content did not differ significantly between control and burned sites. Our results indicate that, depending on site conditions, fire could be used successfully as a tool in the management of forest stands in the study area.

  19. Understanding Trichoderma in the root system of Pinus radiata: associations between rhizosphere colonisation and growth promotion for commercially grown seedlings.


    Hohmann, Pierre; Jones, E Eirian; Hill, Robert A; Stewart, Alison


    Two Trichoderma isolates (T. hamatum LU592 and T. atroviride LU132) were tested for their ability to promote the growth and health of commercially grown Pinus radiata seedlings. The colonisation behaviour of the two isolates was investigated to relate rhizosphere competence and root penetration to subsequent effects on plant performance. Trichoderma hamatum LU592 was shown to enhance several plant health and growth parameters. The isolate significantly reduced seedling mortality by up to 29%, and promoted the growth of shoots (e.g. height by up to 16%) and roots (e.g. dry weight by up to 31%). The introduction of LU592 as either seed coat or spray application equally improved seedling health and growth demonstrating the suitability of both application methods for pine nursery situations. However, clear differences in rhizosphere colonisation and root penetration between the two application methods highlighted the need for more research on the impact of inoculum densities. When spray-applied, LU592 was found to be the predominant Trichoderma strain in the plant root system, including bulk potting mix, rhizosphere and endorhizosphere. In contrast, T. atroviride LU132 was shown to colonise the root system poorly, and no biological impact on P. radiata seedlings was detected. This is the first report to demonstrate rhizosphere competence as a useful indicator for determining Trichoderma bio-inoculants for P. radiata. High indigenous Trichoderma populations with similar population dynamics to the introduced strains revealed the limitations of the dilution plating technique, but this constraint was alleviated to some extent by the use of techniques for morphological and molecular identification of the introduced isolates.

  20. Immunolocalization of IAA and ABA in roots and needles of radiata pine (Pinus radiata) during drought and rewatering.


    De Diego, N; Rodríguez, J L; Dodd, I C; Pérez-Alfocea, F; Moncaleán, P; Lacuesta, M


    Anatomical, physiological and phytohormonal changes involved in drought tolerance were examined in different Pinus radiata D. Don breeds subjected to soil drying and rewatering. Breeds with the smallest stomatal chamber size had the lowest transpiration rate and the highest intrinsic water-use efficiency. Xylem cell size was positively correlated with leaf hydraulic conductance and needle indole-3-acetic acid (IAA) concentrations, whereas transpiration rate was negatively correlated with needle abscisic acid (ABA) levels. Since these two phytohormones seem important in regulating the P. radiata drought response, they were simultaneously immunolocalized in roots and needles of the most tolerant breed (P. radiata var. radiata × var. cedrosensis) during two sequential drought cycles and after rewatering. During drought, IAA was unequally distributed into the pointed area of the needle cross-section and mainly located in mesophyll and vascular tissue cells of needles, possibly inducing needle epinasty, whereas ABA was principally located in guard cells, presumably to elicit stomata closure. In the roots, at the end of the first drought cycle, while strong IAA accumulation was observed in the cortex, ABA levels decreased probably due to translocation to the leaves. Rewatering modified the distribution of both IAA and ABA in the needles, causing an accumulation principally in vascular tissue, with residual concentrations in mesophyll, likely favouring the acclimatization of the plants for further drought cycles. Contrarily, in the roots IAA and ABA were located in the exodermis, a natural barrier that regulates the phytohormone translocation to other plant tissues and hormone losses to the soil solution after rewatering. These results confirm that immunolocalization is an efficient tool to understand the translocation of IAA and ABA in plants subjected to different water stress situations, and clarify their role in regulating physiological responses such as stomata

  1. Root distribution of Pinus pinaster, P. radiata, Eucalyptus globulus and E. kochii and associated soil chemistry in agricultural land adjacent to tree lines.


    Sudmeyer, R A; Speijers, J; Nicholas, B D


    We quantified the extent and distribution of roots of four commonly planted tree species (Eucalyptus globulus Labill., Pinus radiata D. Don, P. pinaster Aiton and E. kochii Maiden & Blakely subsp. plenissima C.A. Gardner) in agricultural land adjacent to tree lines, and examined the effect of soil type and root pruning on root morphology. Root distribution in soil adjacent to tree lines was mapped by a trench profile method at 13 sites on the south coast of Western Australia. Soil samples were collected to determine water content and fertility. The lateral extent of tree roots ranged from 10 m for E. kochii to 44 m for P. pinaster. This equated to between 1.5 and 2.5 times tree height (H) for E. globulus and Pinus spp. to 4H for E. kochii. Root density declined logarithmically with distance from the trees and was greatest for P. pinaster and least for E. globulus (P < 0.001). The rate of decrease in root density with distance from the trees was greatest for the Pinus spp. and least for E. kochii (P < 0.05). Root density was generally greatest in the top 0.5 m of the soil profile and decreased with increasing depth. This decrease was relatively gradual in the deep sands, but abrupt in clay subsoil. Root dry mass in the sandy top soil beyond 0.5H ranged between 1.0 and 55.5 Mg km(treeline) (-1) for 6-year-old E. kochii and 50-year-old P. pinaster, respectively. Soil water content generally increased with distance from the trees (P < 0.001). There was no evidence of reduced soil fertility in the top 1.4 m of the soil profile adjacent to the trees. Two to four years after trees had been root pruned, both the lateral extent and vertical distribution of roots were similar for pruned and unpruned trees. The density of roots < 2 mm in diameter was greater for root-pruned trees than for unpruned trees (P < 0.05). We conclude that the study species can compete with agricultural crops based on the lateral extent of their roots and the occurrence of greatest root density

  2. Diterpenoids from Casearia sylvestris

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Two highly oxygenated clerodane diterpenes casearins U (1) and V (2) and two ent-kaurane diterpene glucosides sylvestrisides A (3) and B (4) were isolated from the leaves of Casearia sylvestris, together with 13 known compounds. Their structures were established on the basis of 1D and 2D NMR spectro...


    EPA Science Inventory

    Despite extensive studies on the response of plants to elevated CO2, climate change and N deposition, little is known about the response of roots and mycorrhizae in spite of their key role in plant water and nutrient acquisition. The effects of elevated CO2 and N fertilization on...


    EPA Science Inventory

    Exposure to(ozone 0-3)has been shown to decrease the allocation of carbon to tree roots. Decreased allocation of carbon to roots might disrupt root metabolism and rhizosphere organisms. The effects of soil type and shoot 0, exposure on below-ground respiration and soil microbial ...

  5. Effect of Loblolly Pine (Pinus taeda L.) Root Pruning on Alley Cropped Herbage Production and Tree Growth

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The competitive irradiance constraint of trees on the understory can be reduced by imposing standard silvicultural practices like pruning and thinning. Use of tillage to disrupt tree roots is an intensive practice which may improve herbage productivity at the crop-tree interface by reducing competi...

  6. Effect of Loblolly Pine (Pinus taeda L.) Root Pruning on Alley Cropped Herbage Production and Tree Growth

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The competitive irradiance constraint of trees on the understory can be reduced by foliar pruning. Use of tillage to disrupt (prune) tree roots is an intensive practice which could improve herbage productivity at the crop-tree interface by reducing competition for water. Our objective was to compa...

  7. Indole-3-acetic acid producing root-associated bacteria on growth of Brazil Pine (Araucaria angustifolia) and Slash Pine (Pinus elliottii).


    Gumiere, Thiago; Ribeiro, Carlos Marcelo; Vasconcellos, Rafael Leandro Figueiredo; Cardoso, Elke Jurandy Bran Nogueira


    Araucaria forests in Brazil today correspond to only 0.7 % of the original 200 km(2) of natural forest that covered a great part of the southern and southeastern area of the Atlantic Forest and, although Araucaria angustifolia is an endangered species, illegal exploitation is still going on. As an alternative to the use of hardwoods, Pinus elliottii presents rapid growth and high tolerance to climatic stress and low soil fertility or degraded areas. Thus, the objective of this study was to evaluate the effect of IAA-producing bacteria on the development of A. angustifolia and P. elliottii. We used five bacterial strains previously isolated from the rhizosphere of A. angustifolia, which produce quantities of IAA ranging from 3 to 126 μg mL(-1). Microbiolized seeds were sown in a new gnotobiotic system developed for this work, that allowed the quantification of the plant hormone IAA produced by bacteria, and the evaluation of its effect on seedling development. Also, it was shown that P. elliottii roots were almost as satisfactory as hosts for these IAA producers as A. angustifolia, while different magnitudes of mass increases were found for each species. Thus, we suggest that these microbial groups can be helpful for the development and reestablishment of already degraded forests and that PGPR isolated from Araucaria rhizosphere have the potential to be beneficial in seedling production of P. elliottii. Another finding is that our newly developed gnotobiotic system is highly satisfactory for the evaluation of this effect.

  8. Root penetration through sealing layers at mine deposit sites.


    Stoltz, Eva; Greger, Maria


    To prevent acid mine drainage arising from oxygen and water penetration of sulphide-rich mine tailings, the tailings are covered with layers of dry sealing material. Plant roots have a great ability to penetrate dense materials, and if the roots are able to penetrate the sealing layer of a tailings deposit, its oxygen-shielding properties could be reduced. The objective of this study was to evaluate whether plant roots are able to penetrate sealing layers covering mine tailings deposits. Root penetration into layers of various sealing materials, such as clayey moraine (clay, 8-10%; silt, 22-37%; sand, 37-55%; gravel, 15-18%), moraine (unspecified), 6-mm bentonite (kaolin clay) fabric, lime and clay, Cefyll (mixture of pulverized coal fly ash, cement and water) and a mixture containing biosludge (30-35%) and bioashes (65-70%), was investigated. In the field, roots were studied by digging trenches alongside vegetation growing in 3- and 10-year-old mine sites. In the greenhouse root growth of Betula pendula, Pinus sylvestris, Poa pratensis and Salix viminalis were studied in compartments where the plants had been growing for 22 months. The results from the field experiment indicated that roots are able to penetrate both deep down in the cover layer (1.7 m) and also into the sealing layers of various materials, and even to penetrate hard Cefyll. The addition of nutrients in the top cover reduced deep root growth and thereby also penetration through the sealing layer. Low hydraulic conductivity of the sealing layer or a thick cover layer had less effect on root penetration. In the greenhouse experiment roots did not penetrate the thin bentonite fabric, due to low pH (2.1-2.7) that was created from the underlying weathered mine tailings. The clayey moraine was penetrated by all species used in the greenhouse experiment; Pinus sylvestris had the greatest ability to penetrate. To prevent root penetration of the other sealing layer, a suitable condition for the plants

  9. Water stress-responsive genes in loblolly pine (Pinus taeda) roots identified by analyses of expressed sequence tag libraries.


    Lorenz, W Walter; Sun, Feng; Liang, Chun; Kolychev, Dmitri; Wang, Haiming; Zhao, Xin; Cordonnier-Pratt, Marie-Michele; Pratt, Lee H; Dean, Jeffrey F D


    Drought stress is the principal cause of seedling mortality in pine forests of the southeastern United States and in many other forested regions around the globe. As part of a larger effort to discover loblolly pine genes, this study subjected rooted cuttings of three unrelated pine genotypes to three watering regimens. Expressed sequence tags (ESTs) were obtained from both the 3' and 5' ends of 12,918 randomly selected cDNAs generated from root tissues. These ESTs were clustered to identify 6,765 unique transcripts (UniScripts) derived from 6,202 putative unique genes (UniGenes-S). Tentative annotations were assigned on the basis of BLASTX comparisons to the Protein Information Resource Nonredundant Reference (PIR-NREF) database. Expression levels of 42 UniScripts varied with high statistical significance with respect to treatment. Many of them resembled gene products shown to be important for drought tolerance in other species, including dehydrins, endochitinases, cytochrome P450 enzymes, pathogenesis-related proteins and various late-embryogenesis abundant (LEA) gene products. Similarly, expression levels of 110 UniScripts varied with high statistical significance among genotypes, indicating that gene expression patterns in this species are much more dependent on genotype than on treatment. Most of the water stress-induced pine UniScripts that appeared to encode products resembling drought tolerance factors in other species were most highly induced in a single genotype, suggesting that particularly useful adaptive alleles for drought tolerance might exist within the collection of cDNAs characterized from this genotype. Mining and visualizing the complete data set, as well as downloading of both EST and UniScript contig sequences, are possible using MAGIC Gene Discovery at

  10. Ectomycorrhizal fungal communities of native and non-native Pinus and Quercus species in a common garden of 35-year-old trees.


    Trocha, Lidia K; Kałucka, Izabela; Stasińska, Małgorzata; Nowak, Witold; Dabert, Mirosława; Leski, Tomasz; Rudawska, Maria; Oleksyn, Jacek


    Non-native tree species have been widely planted or have become naturalized in most forested landscapes. It is not clear if native trees species collectively differ in ectomycorrhizal fungal (EMF) diversity and communities from that of non-native tree species. Alternatively, EMF species community similarity may be more determined by host plant phylogeny than by whether the plant is native or non-native. We examined these unknowns by comparing two genera, native and non-native Quercus robur and Quercus rubra and native and non-native Pinus sylvestris and Pinus nigra in a 35-year-old common garden in Poland. Using molecular and morphological approaches, we identified EMF species from ectomycorrhizal root tips and sporocarps collected in the monoculture tree plots. A total of 69 EMF species were found, with 38 species collected only as sporocarps, 18 only as ectomycorrhizas, and 13 both as ectomycorrhizas and sporocarps. The EMF species observed were all native and commonly associated with a Holarctic range in distribution. We found that native Q. robur had ca. 120% higher total EMF species richness than the non-native Q. rubra, while native P. sylvestris had ca. 25% lower total EMF species richness than non-native P. nigra. Thus, across genera, there was no evidence that native species have higher EMF species diversity than exotic species. In addition, we found a higher similarity in EMF communities between the two Pinus species than between the two Quercus species. These results support the naturalization of non-native trees by means of mutualistic associations with cosmopolitan and novel fungi.

  11. Morphological and physiological responses of Scots pine fine roots to water supply in a dry climatic region in Switzerland.


    Brunner, Ivano; Pannatier, Elisabeth Graf; Frey, Beat; Rigling, Andreas; Landolt, Werner; Zimmermann, Stephan; Dobbertin, Matthias


    In recent decades, Scots pine (Pinus sylvestris L.) forests in inner-Alpine dry valleys of Switzerland have suffered from drought and elevated temperatures, resulting in a higher mortality rate of trees than the mean mortality rate in Switzerland. We investigated the responses of fine roots (standing crop, morphological and physiological features) to water supply in a Scots pine forest in the Rhone valley. Before irrigation started in 2003, low- and high-productivity Scots pine trees were selected based on their crown transparency. The fine root standing crop measured in spring from 2003 to 2005 was unaffected by the irrigation treatment. However, irrigation significantly enhanced the fine root standing crop during the vegetation period when values from spring were compared with values from fall in 2005. Irrigation slightly increased specific root length but decreased root tissue density. Fine root O2-consumption capacity decreased slightly in response to the irrigation treatment. Using ingrowth cores to observe the responses of newly produced fine roots, irrigation had a significantly positive effect on the length of fine roots, but there were no differences between the low- and high-productivity trees. In contrast to the weak response of fine roots to irrigation, the aboveground parts responded positively to irrigation with more dense crowns. The lack of a marked response of the fine root biomass to irrigation in the low- and high-productivity trees suggests that fine roots have a high priority for within-tree carbon allocation.

  12. Scots pine fine roots adjust along a 2000-km latitudinal climatic gradient.


    Zadworny, Marcin; McCormack, M Luke; Mucha, Joanna; Reich, Peter B; Oleksyn, Jacek


    Patterns of plant biomass allocation and functional adjustments along climatic gradients are poorly understood, particularly belowground. Generally, low temperatures suppress nutrient release and uptake, and forests under such conditions have a greater proportion of their biomass in roots. However, it is not clear whether 'more roots' means better capacity to acquire soil resources. Herein we quantified patterns of fine-root anatomy and their biomass distribution across Scots pine (Pinus sylvestris) populations both along a 2000-km latitudinal gradient and within a common garden experiment with a similar range of populations. We found that with decreasing mean temperature, a greater percentage of Scots pine root biomass was allocated to roots with higher potential absorptive capacity. Similar results were seen in the common experimental site, where cold-adapted populations produced roots with greater absorptive capacity than populations originating from warmer climates. These results demonstrate that plants growing in or originated from colder climates have more acquisitive roots, a trait that is likely adaptive in the face of the low resource availability typical of cold soils.

  13. Changes in very fine root respiration and morphology with time since last fire in a boreal forest

    NASA Astrophysics Data System (ADS)

    Makita, Naoki; Pumpanen, Jukka; Köster, Kajar; Berninger, Frank


    We examined the physiological and morphological responses of individual fine root segments in boreal forests stands with different age since the last fire to determine changes in specific fine root respiration and morphological traits during forest succession. We investigated the respiration of fine roots divided into three diameter classes (<0.5, 0.5-1.0, and 1.0-2.0 mm) in a Finnish boreal Pinus sylvestris L. in forest stands with 5, 45, 63, and 155 years since the last fire. Specific respiration rates of <0.5 mm roots in 155-year-old stands were 74%, 38%, and 31% higher than in 5-, 45-, and 63-year-old stands, respectively. However, the respiration rates of thicker diameter roots did not significantly change among stands with respect to time after fire. Similarly, fire disturbance had a strong impact on morphological traits of <0.5 mm roots, but not on thicker roots. Root respiration rates correlated positively with specific root length (length per unit mass) and negatively with root tissue density (mass per unit volume) in all stand ages. The linear regression lines fitted to the relationships between root respiration and specific root length or root tissue density showed significantly higher intercepts in 63- and 155-year-old than in 5-year-old stands. Significant shifts in the intercept of the common slope of respiration vs. morphology indicate the different magnitude of the changes in physiological performance among the fire age class. Despite a specific small geographic area, we suggest that the recovery of boreal forests following wildfire induces a strategy that favors carbon investment in nutrient and water exploitation efficiency with consequences for higher respiration, length, and lower tissue density of very fine roots.

  14. Mycelial production, spread and root colonisation by the ectomycorrhizal fungi Hebeloma crustuliniforme and Paxillus involutus under elevated atmospheric CO2.


    Fransson, Petra M A; Taylor, Andy F S; Finlay, Roger D


    Effects of elevated atmospheric carbon dioxide (CO2) levels on the production and spread of ectomycorrhizal fungal mycelium from colonised Scots pine roots were investigated. Pinus sylvestris (L.) Karst. seedlings inoculated with either Hebeloma crustuliniforme (Bull:Fr.) Quel. or Paxillus involutus (Fr.) Fr. were grown at either ambient (350 ppm) or elevated (700 ppm) levels of CO2. Mycelial production was measured after 6 weeks in pots, and mycelial spread from inoculated seedlings was studied after 4 months growth in perlite in shallow boxes containing uncolonised bait seedlings. Plant and fungal biomass were analysed, as well as carbon and nitrogen content of seedling shoots. Mycelial biomass production by H. crustuliniforme was significantly greater under elevated CO2 (up to a 3-fold increase was observed). Significantly lower concentrations and total amounts of N were found in plants exposed to elevated CO2.

  15. Genome size and base composition of five Pinus species from the Balkan region.


    Bogunic, F; Muratovic, E; Brown, S C; Siljak-Yakovlev, S


    The 2C DNA content and base composition of five Pinus (2 n=24) species and two Pinus subspecies from the Balkan region have been estimated by flow cytometry. P. heldreichii (five populations) and P. peuce (one population) were assessed for the first time, as also were subspecies of P. nigra (three populations-two of subspecies nigra and one of subspecies dalmatica) along with P. sylvestris, and P. mugo from the same region. The 2C DNA values of these Pinus ranged from 42.5 pg to 54.9 pg (41.7-53.8 x 10(9)bp), and the base composition was quite stable (about 39.5% GC). Significant differences were observed between two subspecies of P. nigra and even between two populations of subsp. nigra. The two other species (P. sylvestris and P. mugo) had 2C values of 42.5 pg and 42.8 pg, respectively, while that of P. peuce was 54.9 pg. These genome sizes are in accordance with published values except for P. sylvestris, which was 20% below estimates made by other authors.

  16. Concentrations of sulphur and heavy metals in needles and rooting soils of Masson pine (Pinus massoniana L.) trees growing along an urban-rural gradient in Guangzhou, China.


    Sun, Fang Fang; Wen, Da Zhi; Kuang, Yuan Wen; Li, Jiong; Zhang, Ji Guang


    Current (C) and previous year (C + 1) needles and soils (organic horizon, 0-10 cm and 10-20 cm mineral depth) of Masson pine (Pinus massoniana L.) trees were sampled at four forested sites (Huang Pu industrial district, HP; South China Botanical Garden, BG; Mao Feng Mt., MF; and Nan Kun Mt., NK) in Guangzhou along a urban-rural gradient and analyzed for sulfur (S) and heavy metals (Cu, Zn, Ni, Cd, Cr and Pb) concentrations. Needle concentrations of all the elements were significantly higher at industrial HP than at other three sites, except for Cu and Pb which were highest at the traffic site (BG). The C + 1 needles generally had higher Cu, Cd, Pb, Zn, Cr than the C needles while the opposite was for Ni and S. Total and available Cd, Pb, Zn in soils peaked at the urban sites (HP and BG) and decreased at suburban MF and rural NK. Heavy metals were generally higher in the organic soils than in the mineral soils at all sites. Zinc and Pb at all sites, and Cd, S and Cu at the urban sites (HP and BG) in soils or pine needles were above or near their respective natural background levels, implying that threats resulted from these toxic elements occurred on local particularly urban forests, but did not for Cr and Ni due to their presence below their background values. Our results demonstrated that elements concentrations in needles and soils had reflected the variability of pollutants and the environmental quality change along the urban-rural transect, and were efficient as biomonitors to assess the influence of anthropogenic activities along the urbanization course on forest health.

  17. Quantification of large vertical tree roots with borehole radar

    NASA Astrophysics Data System (ADS)

    Butnor, J. R.; Johnsen, K. H.; Wikström, P.; Lundmark, T.; Linder, S.


    Ground-penetrating radar can be used to detect tree roots provided there is sufficient electromagnetic contrast to separate roots from soil. Forest researchers need root biomass, distribution and architecture data to assess the effects of forest management practices on productivity and resource allocation in trees. Ground-penetrating radar is a non-destructive alternative to laborious excavations that are commonly employed. Tree roots are not ideal subjects for radar studies; clutter from non-target materials can degrade the utility of GPR profiles. On amenable soils, rapid root biomass surveys provide valuable information in a short period time, though some destructive ground-truthing may be required. Surface-based GPR can provide excellent resolution of lateral roots. However, some forest trees have significant allocation to large vertical taproots roots (i.e. loblolly pine, Pinus taeda L., longleaf pine, Pinus palustris Mill.), which cannot be accurately assessed by surface measures. A collaborative project between the USDA Forest Service, Southern Research Station, Radarteam AB and the Swedish Experimental Forest system was undertaken in 2003 to assess the potential of high-frequency borehole radar to detect vertical near surface reflectors (0-2 m). A variety of borehole methods were assessed to identify the most promising technique to image large vertical roots. We used a 1000 mhz transducer (Radarteam tubewave-1000) along with a GSSI ground-penetrating radar unit (Sir-20) to collect reflective data in boreholes adjacent to trees as well as cross-hole travel time measurements. This research was conducted near Vindeln in northern Sweden in August 2003. Six trees (Pinus sylvestris) whose DBH ranged from approximately 20-60 cm were intensively measured to provide information on a variety of size classes. On either side of each tree a 5 cm diameter hole was excavated to a depth of 2 m with a soil auger. One antenna was configured as a transmitter (Tx), the other

  18. Nine Years of Irrigation Cause Vegetation and Fine Root Shifts in a Water-Limited Pine Forest

    PubMed Central

    Herzog, Claude; Steffen, Jan; Graf Pannatier, Elisabeth; Hajdas, Irka; Brunner, Ivano


    Scots pines (Pinus sylvestris L.) in the inner-Alpine dry valleys of Switzerland have suffered from increased mortality during the past decades, which has been caused by longer and more frequent dry periods. In addition, a proceeding replacement of Scots pines by pubescent oaks (Quercus pubescens Willd.) has been observed. In 2003, an irrigation experiment was performed to track changes by reducing drought pressure on the natural pine forest. After nine years of irrigation, we observed major adaptations in the vegetation and shifts in Scots pine fine root abundance and structure. Irrigation permitted new plant species to assemble and promote canopy closure with a subsequent loss of herb and moss coverage. Fine root dry weight increased under irrigation and fine roots had a tendency to elongate. Structural composition of fine roots remained unaffected by irrigation, expressing preserved proportions of cellulose, lignin and phenolic substances. A shift to a more negative δ13C signal in the fine root C indicates an increased photosynthetic activity in irrigated pine trees. Using radiocarbon (14C) measurement, a reduced mean age of the fine roots in irrigated plots was revealed. The reason for this is either an increase in newly produced fine roots, supported by the increase in fine root biomass, or a reduced lifespan of fine roots which corresponds to an enhanced turnover rate. Overall, the responses belowground to irrigation are less conspicuous than the more rapid adaptations aboveground. Lagged and conservative adaptations of tree roots with decadal lifespans are challenging to detect, hence demanding for long-term surveys. Investigations concerning fine root turnover rate and degradation processes under a changing climate are crucial for a complete understanding of C cycling. PMID:24802642

  19. Nine years of irrigation cause vegetation and fine root shifts in a water-limited pine forest.


    Herzog, Claude; Steffen, Jan; Graf Pannatier, Elisabeth; Hajdas, Irka; Brunner, Ivano


    Scots pines (Pinus sylvestris L.) in the inner-Alpine dry valleys of Switzerland have suffered from increased mortality during the past decades, which has been caused by longer and more frequent dry periods. In addition, a proceeding replacement of Scots pines by pubescent oaks (Quercus pubescens Willd.) has been observed. In 2003, an irrigation experiment was performed to track changes by reducing drought pressure on the natural pine forest. After nine years of irrigation, we observed major adaptations in the vegetation and shifts in Scots pine fine root abundance and structure. Irrigation permitted new plant species to assemble and promote canopy closure with a subsequent loss of herb and moss coverage. Fine root dry weight increased under irrigation and fine roots had a tendency to elongate. Structural composition of fine roots remained unaffected by irrigation, expressing preserved proportions of cellulose, lignin and phenolic substances. A shift to a more negative δ13C signal in the fine root C indicates an increased photosynthetic activity in irrigated pine trees. Using radiocarbon (14C) measurement, a reduced mean age of the fine roots in irrigated plots was revealed. The reason for this is either an increase in newly produced fine roots, supported by the increase in fine root biomass, or a reduced lifespan of fine roots which corresponds to an enhanced turnover rate. Overall, the responses belowground to irrigation are less conspicuous than the more rapid adaptations aboveground. Lagged and conservative adaptations of tree roots with decadal lifespans are challenging to detect, hence demanding for long-term surveys. Investigations concerning fine root turnover rate and degradation processes under a changing climate are crucial for a complete understanding of C cycling.

  20. New insights into the mycorrhizal Rhizoscyphus ericae aggregate: spatial structure and co-colonization of ectomycorrhizal and ericoid roots.


    Grelet, Gwen-Aëlle; Johnson, David; Vrålstad, Trude; Alexander, Ian J; Anderson, Ian C


    • Fungi in the Rhizoscyphus ericae aggregate have been recovered from the roots of co-occurring ericaceous shrubs and ectomycorrhizal trees. However, to date, there is no evidence that the same individual genotypes colonize both hosts, and no information on the extent of the mycelial networks that might form. • Using spatially explicit core sampling, we isolated fungi from neighbouring Pinus sylvestris (ectomycorrhizal) and Vaccinium vitis-idaea (ericoid mycorrhizal) roots and applied intersimple sequence repeat (ISSR) typing to assess the occurrence and extent of shared genets. • Most isolates were identified as Meliniomyces variabilis, and isolates with identical ISSR profiles were obtained from neighbouring ericoid and ectomycorrhizal roots on a number of occasions. However, genet sizes were small (< 13  cm), and several genets were found in a single soil core. Genetic relatedness was independent of spatial separation at the scales investigated (< 43  m) and M. variabilis populations from sites 20  km apart were genetically indistinguishable. • We conclude that individual genets of M. variabilis can simultaneously colonize Scots pine and Vaccinium roots, but there is no evidence for the formation of large mycelial networks. Our data also suggest significant genotypic overlap between widely separated populations of this ubiquitous root-associated fungus.

  1. Fungal Infection Increases the Rate of Somatic Mutation in Scots Pine (Pinus sylvestris L.).


    Ranade, Sonali Sachin; Ganea, Laura-Stefana; Razzak, Abdur M; García Gil, M R


    Somatic mutations are transmitted during mitosis in developing somatic tissue. Somatic cells bearing the mutations can develop into reproductive (germ) cells and the somatic mutations are then passed on to the next generation of plants. Somatic mutations are a source of variation essential to evolve new defense strategies and adapt to the environment. Stem rust disease in Scots pine has a negative effect on wood quality, and thus adversely affects the economy. It is caused by the 2 most destructive fungal species in Scandinavia: Peridermium pini and Cronartium flaccidum. We studied nuclear genome stability in Scots pine under biotic stress (fungus-infected, 22 trees) compared to a control population (plantation, 20 trees). Stability was assessed as accumulation of new somatic mutations in 10 microsatellite loci selected for genotyping. Microsatellites are widely used as molecular markers in population genetics studies of plants, and are particularly used for detection of somatic mutations as their rate of mutation is of a much higher magnitude when compared with other DNA markers. We report double the rate of somatic mutation per locus in the fungus-infected trees (4.8×10(-3) mutations per locus), as compared to the controls (2.0×10(-3) mutations per locus) when individual samples were analyzed at 10 different microsatellite markers. Pearson's chi-squared test indicated a significant effect of the fungal infection which increased the number of mutations in the fungus-infected trees (χ(2) = 12.9883, df = 1, P = 0.0003134).

  2. Ecotypic variation in response to light spectra in Scots pine (Pinus sylvestris L.).


    Ranade, Sonali S; García-Gil, M R


    We investigated Scots pine adaptive responses to the light spectra by measuring hypocotyl length in seeds sampled from three natural Scots pine ecotypes across a latitudinal cline ranging from 63° to 68° N in Sweden where the adaptive cline is known to be steeper. Seeds were germinated under dark (D) and three monochromatic continuous light wavelengths: blue (B), red (R) and far-red (FR). Analysis of variance revealed a northward decrease in the inhibitory effect of FR with respect to D, the so-called far red high irradiance response. Ecotypic variation for hypocotyl development was observed under the FR and D treatments, while the trends for the B and R treatments were not statistically significant. Under FR the ecotypic variation showed an increase in hypocotyl length northwards, in contrast to the treatment under D which showed a decrease in the hypocotyl length northwards. These results could be interpreted in view of the previously reported northward increase in FR requirement to maintain growth in Norway spruce and Scots pine. Prior to the performance of the main light experiment, the maternal effect on progeny performance was investigated, which showed the absence of maternal environment effect on the performance of the seedlings.

  3. Cytogenetic response of Scots pine (Pinus sylvestris Linnaeus, 1753) (Pinaceae) to heavy metals.


    Belousov, Mikhail Vladimirovich; Mashkina, Olga Sergeyevna; Popov, Vasily Nikolayevich


    We studied cytogenetic reactions of Scots pine seedlings to heavy metals - lead, cupric and zinc nitrates applied at concentrations 0.5 to 2000 µM. We determined the range of concentrations of heavy metals that causes mutagenic effect. Lead was found to cause the strongest genotoxicity as manifested by significant increase in the frequency of pathological mitosis, occurrence of fragmentations and agglutinations of chromosomes, various types of bridges, and a significant number of the micronuclei which were absent in the control. Possible cytogenetic mechanisms of the cytotoxic action of heavy metals are discussed.

  4. Pinus sylvestris switches respiration substrates under shading but not during drought.


    Fischer, Sarah; Hanf, Stefan; Frosch, Torsten; Gleixner, Gerd; Popp, Jürgen; Trumbore, Susan; Hartmann, Henrik


    Reduced carbon (C) assimilation during prolonged drought forces trees to rely on stored C to maintain vital processes like respiration. It has been shown, however, that the use of carbohydrates, a major C storage pool and apparently the main respiratory substrate in plants, strongly declines with decreasing plant hydration. Yet no empirical evidence has been produced to what degree other C storage compounds like lipids and proteins may fuel respiration during drought. We exposed young scots pine trees to C limitation using either drought or shading and assessed respiratory substrate use by monitoring the respiratory quotient, δ(13) C of respired CO2 and concentrations of the major storage compounds, that is, carbohydrates, lipids and amino acids. Only shaded trees shifted from carbohydrate-dominated to lipid-dominated respiration and showed progressive carbohydrate depletion. In drought trees, the fraction of carbohydrates used in respiration did not decline but respiration rates were strongly reduced. The lower consumption and potentially allocation from other organs may have caused initial carbohydrate content to remain constant during the experiment. Our results suggest that respiratory substrates other than carbohydrates are used under carbohydrate limitation but not during drought. Thus, respiratory substrate shift cannot provide an efficient means to counterbalance C limitation under natural drought.

  5. Cytogenetic response of Scots pine (Pinus sylvestris Linnaeus, 1753) (Pinaceae) to heavy metals

    PubMed Central

    Belousov, Mikhail Vladimirovich; Mashkina, Olga Sergeyevna; Popov, Vasily Nikolayevich


    Abstract We studied cytogenetic reactions of Scots pine seedlings to heavy metals – lead, cupric and zinc nitrates applied at concentrations 0.5 to 2000 µM. We determined the range of concentrations of heavy metals that causes mutagenic effect. Lead was found to cause the strongest genotoxicity as manifested by significant increase in the frequency of pathological mitosis, occurrence of fragmentations and agglutinations of chromosomes, various types of bridges, and a significant number of the micronuclei which were absent in the control. Possible cytogenetic mechanisms of the cytotoxic action of heavy metals are discussed. PMID:24260654

  6. Delayed soil thawing affects root and shoot functioning and growth in Scots pine.


    Repo, Tapani; Lehto, Tarja; Finér, Leena


    In boreal regions, soil can remain frozen after the start of the growing season. We compared relationships between root characteristics and water relations in Scots pine (Pinus sylvestris L.) saplings subjected to soil frost treatments before and during the first week of the growing period in a controlled environment experiment. Delayed soil thawing delayed the onset of sap flow or totally blocked it if soil thawing lagged the start of the growing period by 7 days. This effect was reflected in the electrical impedance of needles and trunks and in the relative electrolyte leakage of needles. Prolonged soil frost reduced or completely inhibited root growth. In unfrozen soil, limited trunk sap flow was observed despite unfavorable aboveground growing conditions (low temperature, low irradiance, short photoperiod). Following the earliest soil thaw, sap flow varied during the growing season, depending on light and temperature conditions, phenological stage of the plant and the amount of live needles in the canopy. The results suggest that delayed soil thawing can reduce tree growth, and if prolonged, it can be lethal.

  7. Reconstructing the plant mitochondrial genome for marker discovery: a case study using Pinus.


    Donnelly, Kevin; Cottrell, Joan; Ennos, Richard A; Vendramin, Giovanni Guiseppe; A'Hara, Stuart; King, Sarah; Perry, Annika; Wachowiak, Witold; Cavers, Stephen


    Whole-genome-shotgun (WGS) sequencing of total genomic DNA was used to recover ~1 Mbp of novel mitochondrial (mtDNA) sequence from Pinus sylvestris (L.) and three members of the closely-related Pinus mugo species complex. DNA was extracted from megagametophyte tissue from six mother trees from locations across Europe and 100 bp paired-end sequencing was performed on the Illumina HiSeq platform. Candidate mtDNA sequences were identified by their size and coverage characteristics, and by comparison with published plant mitochondrial genomes. Novel variants were identified, and primers targeting these loci were trialled on a set of 28 individuals from across Europe. In total, 31 SNP loci were successfully resequenced, characterising 15 unique haplotypes. This approach offers a cost effective means of developing marker resources for mitochondrial genomes in other plant species where reference sequences are unavailable. This article is protected by copyright. All rights reserved.

  8. Hydraulic architecture and tracheid allometry in mature Pinus palustris and Pinus elliottii trees.


    Gonzalez-Benecke, C A; Martin, T A; Peter, G F


    Pinus palustris Mill. (longleaf pine, LL) and Pinus elliottii Engelm. var. elliottii (slash pine, SL) frequently co-occur in lower coastal plain flatwoods of the USA, with LL typically inhabiting slightly higher and better-drained microsites than SL. The hydraulic architecture and tracheid dimensions of roots, trunk and branches of mature LL and SL trees were compared to understand their role in species microsite occupation. Root xylem had higher sapwood-specific hydraulic conductivity (k(s)) and was less resistant to cavitation compared with branches and trunk sapwood. Root k(s) of LL was significantly higher than SL, whereas branch and trunk k(s) did not differ between species. No differences in vulnerability to cavitation were observed in any of the organs between species. Across all organs, there was a significant but weak trade-off between water conduction efficiency and safety. Tracheid hydraulic diameter (D(h)) was strongly correlated with k(s) across all organs, explaining >73% of the variation in k(s). In contrast, tracheid length (L(t)) explained only 2.4% of the variability. Nevertheless, for trunk xylem, k(s) was 39.5% higher at 20 m compared with 1.8 m; this increase in k(s) was uncorrelated with D(h) and cell-wall thickness but was strongly correlated with the difference in L(t). Tracheid allometry markedly changed between sapwood of roots, trunks and branches, possibly reflecting different mechanical constraints. Even though vulnerability to cavitation was not different for sapwood of roots, branches or the trunks of LL and SL, higher sapwood to leaf area ratio and higher maximum sapwood-specific hydraulic conductivity in roots of LL are functional traits that may provide LL with a competitive advantage on drier soil microsites.

  9. Holocene variability in the range distribution and abundance of Pinus, Picea abies, and Quercus in Romania; implications for their current status

    NASA Astrophysics Data System (ADS)

    Feurdean, Angelica; Tanţău, Ioan; Fărcaş, Sorina


    This paper examines fourteen fossil pollen datasets from Romania. It aims to investigate the temporal and spatial variability in the range distribution and abundance of three forest taxa, Pinus, Picea abies, and Quercus, during the Holocene. This is essential for understanding their current status in the forests of Eastern Europe, the conditions under which they arose, and the timing and processes responsible for their variability. Results from this synthesis do not indicate any apparent time lag in the establishment of Pinus diploxylon type ( Pinus sylvestris and Pinus mugo), Pinus cembra, P. abies, and Quercus across Romania within the limits of the dating resolution. However, the onset of the mass expansion of P. abies was not uniform, spreading earlier from sites in the western and north-western Carpathians (11,000-10,500 yr BP) than in the east (10,000 yr BP). We found that sites from the western, north-western, and northern Carpathians contained higher abundances of P. abies, whilst Quercus was in higher abundances in sites from the east, but there was no regional distinctiveness in the abundance of Pinus across the study area. However, P. diploxylon type was found in much higher abundance than P. cembra. Additionally, results indicate a greater proportion of Pinus (mainly P. diplxylon type) at high elevations, P. abies at mid to high elevations, and Quercus at low elevations (<500 m). The dominance of Pinus in the early Holocene boreal forest is likely the legacy of its local glacial refugia, fast life history strategies, high stress tolerance, and large habitat availability. In contrast, Pinus exhibited poor competitive abilities and was quickly replaced with P. abies and temperate deciduous taxa after 10,500 yr BP. P. abies has persisted in large abundances at higher elevations (above 1000 m) until the present day, as a result of good competitive abilities, and resilience to climate change and disturbance. The long-term dominance of P. abies appears to

  10. Bioactivity of Malva Sylvestris L., a Medicinal Plant from Iran

    PubMed Central

    Razavi, Seyed Mehdi; Zarrini, Gholamreza; Molavi, Ghader; Ghasemi, Ghader


    Objective(s) Malva sylvestris L. (Malvaceae), an annual plant, has been already commonly used as a medicinal plant in Iran. In the present work, we evaluate some bioactivities of the plant extracts. Materials and Methods The aired-dried plant flowers and leaves were extracted by soxhlet apparatus with n-hexane, dichloromethane and methanol. The antimicrobial, cytotoxic, and phytotoxic of the plant extracts were evaluated using disk diffusion method, MTT, and Lettuce assays, respectively. Results Both flowers and leaves of M. sylvestris methanol extracts exhibited strong antibacterial effects against Erwinia carotovora, a plant pathogen, with MIC value of 128 and 256 µg/ml, respectively. The flowers extract also showed high antibacterial effects against some human pathogen bacteria strains such as Staphylococcus aureus, Streptococcus agalactiae, Entrococcus faecalis, with MIC value of 192, 200 and 256 µg/ml, respectively. The plant methanol extracts had relatively high cytotoxic activity against MacCoy cell line. Conclusion We concluded that Malva sylvestris can be candidated as an antiseptic, a chemopreventive or a chemotherapeutic agent. PMID:23493458

  11. Seasonal monoterpene and sesquiterpene emissions from Pinus taeda and Pinus virginiana

    EPA Science Inventory

    Seasonal volatile organic compound emission data from loblolly pine (Pinus taeda) and Virginia pine (Pinus virginiana) were collected using branch enclosure techniques in Central North Carolina, USA. Pinus taeda monoterpene emission rates were at least ten times higher than oxyge...

  12. Development of SCAR markers for the discrimination of three species of medicinal plants, Angelica decursiva (Peucedanum decursivum), Peucedanum praeruptorum and Anthricus sylvestris, based on the internal transcribed spacer (ITS) sequence and random amplified polymorphic DNA (RAPD).


    Choo, Byung Kil; Moon, Byeong Cheol; Ji, Yunui; Kim, Bo Bae; Choi, Goya; Yoon, Taesook; Kim, Ho Kyoung


    Angelicae decursivae radix ('Jeonho' in Korean) is prescribed as the root of Angelica decursiva (= Peucedanum decursivum) and Peucedanum praeruptorum in Korean pharmacopoeia. However, Anthricus sylvestris has been usually distributed on the market because it is identical to the Korean plant name 'Jeonho'. Furthermore, due to the morphological similarity of the aerial parts and herbal medicines, the correct identification of these roots is difficult. Therefore, to develop a reliable method for discriminating among A. decursiva (= P. decursivum), P. praeruptorum and A. sylvestris, we applied the tools of molecular genetics, such as the analysis of ribosomal DNA internal transcribed spacer (rDNA-ITS) and random amplified polymorphic DNA (RAPD). In the comparison of rDNA-ITS sequences, we found a specific primer region for the identification of A. sylvestris among three varieties of the herb that produced a 273 bp strand of DNA specific to A. sylvestris. As the result of RAPD analysis, we developed one sequence characterized amplified region (SCAR) marker for A. decursiva and P. praeruptorum that amplified a 363 bp DNA fragment specific to both A. decursiva and P. praeruptorum and two markers for P. praeruptorum that amplified 145 bp and 305 bp DNA fragments specific to P. praeruptorum. Furthermore, we established the SCAR markers for the simultaneous discrimination of the three species by applying a multiplex-polymerase chain reaction (PCR) with a combination of primers. This method of discrimination would be useful in preventing the distribution of adulterates because it can identify each herb and distinguish it from inauthentic substitutions.

  13. Contribution of root and rhizosphere respiration to the annual variation of carbon balance of a boreal Scots pine forest

    NASA Astrophysics Data System (ADS)

    Korhonen, J. F. J.; Pumpanen, J.; Kolari, P.; Juurola, E.; Nikinmaa, E.


    A large part of gross primary production (GPP) is consumed in root and rhizosphere respiration (Rr). To measure Rr, a group of evergreen coniferous Scots pine (Pinus sylvestris) trees were girdled in a 45-year-old even aged forest in Hyytiälä, Southern Finland. In the girdling, phloem and bark were removed from breast height around the trees. We measured soil CO2 effluxes with a dynamic chamber at the girdled plot and at a non-girdled control plot in close vicinity. Before the girdling, effluxes were 22% higher at the plot to be girdled compared to the control plot. We scaled the measurements so that before girdling the effluxes representing total soil respiration (Rs) were at the same level. We compared the Rr and Rd to GPP measured with eddy covariance system. Our results show that Rr has higher seasonal variation than Rd, and also spatial variability was higher for Rr. The annual Rr:Rs and Rr:GPP-ratios were 0.36 and 0.21, respectively. Rr:Rd varied seasonally and in late summer and in autumn Rr exceeded Rd. Rr followed GPP with a delay of several weeks. During winter and spring Rr was very low, even when GPP and soil temperature had significantly risen. We conclude that Rr and Rd have different response to the environment and that for Rr the substrate availability is a more important explaining variable than soil temperature.

  14. Effect of Certain Nematodes on the Growth of Pinus edulis and Juniperus monosperma seedlings

    PubMed Central

    Riffle, J. W.


    Pinus edulis and Juniperus monosperma seedlings were inoculated separately with each of seven nematode species, and grown for 9 months at 20 C soil temperature. Hoplolaimus galeatus, Rotylenchus pumilis, Tylenchus exiguus, and Xiphinema americanum parasitized P. edulis seedlings, but did not significantly reduce seedling growth. Pinus edulis was not a host for Tylenchorhynchus cylindricus, Aphelenchoides cibolensis, or Criconemoides humilis. Xiphinema americanum and R. pumilis parasitized J. monosperma seedlings, and reduced their root weights and root collar diameters. Juniperus monosperma was not a host for A. cibolensis and T. exiguus, and parasitism of this tree species by T. cylindricus and C. humilis remains uncertain. PMID:19319253

  15. Antioxidant and radical scavenging properties of Malva sylvestris.


    DellaGreca, Marina; Cutillo, Francesca; D'Abrosca, Brigida; Fiorentino, Antonio; Pacifico, Severina; Zarrelli, Armando


    Antioxidant capacity of the aqueous extract of Malva sylvestris was measured by its ability to scavenge the DPPH and superoxide anion radicals and to induce the formation of a phosphomolybdenum complex. Analysis of the extract, carried out by different chromatographic techniques, led to the isolation of eleven compounds: 4-hydroxybenzoic acid, 4-methoxybenzoic acid, 4-hydroxy-3-methoxybenzoic acid, 4-hydroxycinnamic acid, ferulic acid, methyl 2-hydroxydihydrocinnamate, scopoletin, N-trans-feruloyl tyramine, a sesquiterpene, (3R,7E)-3-hydroxy-5,7-megastigmadien-9-one, and (10E,15Z)-9,12,13-trihydroxyoctadeca-10,15-dienoic acid. The antioxidant activities of all these compounds are reported.

  16. Malvone A, a phytoalexin found in Malva sylvestris (family Malvaceae).


    Veshkurova, Olga; Golubenko, Zamira; Pshenichnov, Egor; Arzanova, Irina; Uzbekov, Vyacheslav; Sultanova, Elvira; Salikhov, Shavkat; Williams, Howard J; Reibenspies, Joseph H; Puckhaber, Lorraine S; Stipanovic, Robert D


    The isolation and structure of a phytoalexin, malvone A (2-methyl-3-methoxy-5,6-dihydroxy-1,4-naphthoquinone) is reported. Malvone A formation is induced in Malva sylvestris L. by the plant pathogen Verticillium dahliae. In a turbimetric assay for toxicity to V. dahliae, it had an ED50 value of 24 microg/ml. The structure of malvone A was determined by MS and NMR spectroscopy, and by X-ray crystallographic analysis. The X-ray analysis showed water molecules were located in channels that run along the a-axis.

  17. Somatic Embryogenesis in Pinus spp.


    Montalbán, Itziar Aurora; García-Mendiguren, Olatz; Moncaleán, Paloma


    Somatic embryogenesis (SE) has been the most important development for plant tissue culture, not only for mass propagation but also for enabling the implementation of biotechnological tools that can be used to increase the productivity and wood quality of plantation forestry. Development of SE in forest trees started in 1985 and nowadays many studies are focused on the optimization of conifer SE system. However, these advances for many Pinus spp. are not sufficiently refined to be implemented commercially. In this chapter, a summary of the main systems used to achieve SE in Pinus spp. is reported.

  18. Some physicochemical characteristics of pinus (Pinus halepensis Mill., Pinus pinea L., Pinus pinaster and Pinus canariensis) seeds from North Algeria, their lipid profiles and volatile contents.


    Kadri, Nabil; Khettal, Bachra; Aid, Yasmine; Kherfellah, Souraya; Sobhi, Widad; Barragan-Montero, Veronique


    Physicochemical characteristics of seeds of some pinus species (Pinus halepensis Mill., Pinus pinea L., Pinus pinaster and Pinus canariensis) grown in North Algeria were determined. The results showed that the seeds consist of 19.8-36.7% oil, 14.25-26.62% protein, 7.8-8.6% moisture. Phosphorus, potassium and magnesium were the predominant elements present in seeds. Pinus seed's oil physicochemical properties show acid values (4.9-68.9), iodine values (93.3-160.4) and saponification values (65.9-117.9). Oil analysis showed that the major unsaturated fatty acids for the four species were linoleic acid (30-59%) and oleic acid (17.4-34.6%), while the main saturated fatty acid was palmitic acid (5-29%). Gas Chromatography and Mass Spectrometry analysis of P. halepensis Mill., P. pinaster and P. canariensis volatile oils indicated that the major volatile compound was the limonene with relative percentage of 3.1, 7.5 and 10.8, respectively.


    EPA Science Inventory

    Loblolly pine (Pinus taeda L.) Has co-evolved a high dependency on ectomycorrhizal (ECM) associations most likely because its natural range includes soils of varying moisture that are P- and/or N-deficient. Because of its wide geographic distrubition, we would expect its roots t...

  20. An arabinogalactan-protein from cell culture of Malva sylvestris.


    Classen, Birgit; Blaschek, Wolfgang


    An arabinogalactan-protein (AGP) from suspension culture medium of Malva sylvestris was isolated by precipitation with beta-glucosyl Yariv reagent, followed by gel-permeation chromatography. It revealed characteristic features of AGPs: a high amount of polysaccharide with a ratio of galactose to arabinose of 1.9 : 1, some uronic acids, and a small protein moiety with the main amino acids serine, alanine and hydroxyproline. The molecular weight was estimated to be 1.3 x 10(6) Da. Linkage analyses showed that the AGP is composed of a highly branched core polysaccharide of 3-, 6-, and 3,6-linked Galp residues with terminal Araf, GlcAp and Galp. Partial acid hydrolysis resulted in loss of Araf residues at the periphery of the molecule and heavily reduced its reactivity with beta-glucosyl Yariv antigen.

  1. Genetic diversity of stilbene metabolism in Vitis sylvestris

    PubMed Central

    Duan, Dong; Halter, David; Baltenweck, Raymonde; Tisch, Christine; Tröster, Viktoria; Kortekamp, Andreas; Hugueney, Philippe; Nick, Peter


    Stilbenes, as important secondary metabolites of grapevine, represent central phytoalexins and therefore constitute an important element of basal immunity. In this study, potential genetic variation in Vitis vinifera ssp. sylvestris, the ancestor of cultivated grapevine, was sought with respect to their output of stilbenes and potential use for resistance breeding. Considerable variation in stilbene inducibility was identified in V. vinifera ssp. sylvestris. Genotypic differences in abundance and profiles of stilbenes that are induced in response to a UV-C pulse are shown. Two clusters of stilbene ‘chemovars’ emerged: one cluster showed quick and strong accumulation of stilbenes, almost exclusively in the form of non-glycosylated resveratrol and viniferin, while the second cluster accumulated fewer stilbenes and relatively high proportions of piceatannol and the glycosylated piceid. For all 86 genotypes, a time dependence of the stilbene pattern was observed: piceid, resveratrol, and piceatannol accumulated earlier, whereas the viniferins were found later. It was further observed that the genotypic differences in stilbene accumulation were preceded by differential accumulation of the transcripts for chalcone synthase (CHS) and stilbene-related genes: phenylalanine ammonium lyase (PAL), stilbene synthase (StSy), and resveratrol synthase (RS). A screen of the population with respect to susceptibility to downy mildew of grapevine (Plasmopara viticola) revealed considerable variability. The subpopulation of genotypes with high stilbene inducibility was significantly less susceptible as compared with low-stilbene genotypes, and for representative genotypes it could be shown that the inducibility of stilbene synthase by UV correlated with the inducibility by the pathogen. PMID:25873669

  2. Particulate pollutants are capable to 'degrade' epicuticular waxes and to decrease the drought tolerance of Scots pine (Pinus sylvestris L.).


    Burkhardt, Juergen; Pariyar, Shyam


    Air pollution causes the amorphous appearance of epicuticular waxes in conifers, usually called wax 'degradation' or 'erosion', which is often correlated with tree damage symptoms, e.g., winter desiccation. Previous investigations concentrated on wax chemistry, with little success. Here, we address the hypothesis that both 'wax degradation' and decreasing drought tolerance of trees may result from physical factors following the deposition of salt particles onto the needles. Pine seedlings were sprayed with dry aerosols or 50 mM solutions of different salts. The needles underwent humidity changes within an environmental scanning electron microscope, causing salt expansion on the surface and into the epistomatal chambers. The development of amorphous wax appearance by deliquescent salts covering tubular wax fibrils was demonstrated. The minimum epidermal conductance of the sprayed pine seedlings increased. Aerosol deposition potentially 'degrades' waxes and decreases tree drought tolerance. These effects have not been adequately considered thus far in air pollution research.

  3. Long-term evaluation of the needle surface wax condition of Pinus sylvestris around different industries in Lithuania.


    Kupcinskiene, Eugenija; Huttunen, Satu


    The aim of our study was to evaluate the annual dynamics of needle surface wax erosion and wettability in Scots pines exposed to a gradient of industrial pollutants emitted from the main factories of Lithuania: a nitrogen fertilizer factory, an oil refinery and a cement factory. Decreased emissions (in the case of the oil refinery and the cement factory) were reflected in the increased structural surface area (SSA, i.e. area covered by tubular waxes) on the needles. The nearly constant amount of emissions from the nitrogen fertilizer factory within the 1994-2000 period corresponded to negligible annual differences in SSA. Annual changes in the hydrophobicity of needles on the investigated transects were small. Despite the decreased pollution within the 7-year period, industrial emissions are still causing significantly accelerated wax erosion and increased wettability in needles sampled from the stands most heavily affected by pollutants.


    SciTech Connect

    Farfan, E.; Jannik, T.


    To identify effects of chronic internal and external radiation exposure for components of terrestrial ecosystems, a comprehensive study of Scots pine trees in the Chernobyl Exclusion Zone was performed. The experimental plan included over 1,100 young trees (up to 20 years old) selected from areas with varying levels of radioactive contamination. These pine trees were planted after the 1986 Chernobyl Nuclear Power Plant accident mainly to prevent radionuclide resuspension and soil erosion. For each tree, the major morphological parameters and radioactive contamination values were identified. Cytological analyses were performed for selected trees representing all dose rate ranges. A specially developed dosimetric model capable of taking into account radiation from the incorporated radionuclides in the trees was developed for the apical meristem. The calculated dose rates for the trees in the study varied within three orders of magnitude, from close to background values in the control area (about 5 mGy y{sup -1}) to approximately 7 Gy y{sup -1} in the Red Forest area located in the immediate vicinity of the Chernobyl Nuclear Power Plant site. Dose rate/effect relationships for morphological changes and cytogenetic defects were identified and correlations for radiation effects occurring on the morphological and cellular level were established.

  5. Effect of Malva sylvestris cream on burn injury and wounds in rats

    PubMed Central

    Nasiri, Ebrahim; Hosseinimehr, Seyed Jalal; Azadbakht, Mohammad; Akbari, Jafar; Enayati-fard, Reza; Azizi, Sohail


    Objectives: Burn injury is one of the most health-threatening problems in the world. Malva sylvestris (M. sylvestris) flowers have a high mucilage content and are used as a remedy for cut wound and dermal infected wounds in Iranian folklore Medicine. The purpose of this study was to investigate the effect of M. sylvestris cream on the second degree burn injury in rats. Materials and Methods: Five groups of 10 rats per group were burned with hot metal plate. Animals were administrated divided as control, normal saline, standard silver sulfadiazine 1% (SSD), 5% M. sylvestris, and 10% M. sylvestris into separate groups. Wound area, percentage of wound contraction, and histological and bacteriological assessments were evaluated. Results: Wound sizes were not significantly different among groups on 1st and 3rd days after burn injury, while they were significantly different among groups after 7th day post-burn injury. The average areas of wounds on the 15th day were 7.5±2.9, 6.7±2, 10.5±1.6, 4.7±2, and 4.5±2 cm2 for base cream, normal saline, SSD, 5% M. sylvestris, and 10% M. sylvestris, respectively. The results of histology exhibited well-formed horizontally-oriented collagen fibers in MS topical treatment groups. Microorganisms existed in the SSD group were most probably Staphilococcus epidermitis and for NS group were staphylococcus saprophiteccus. Conclusion: M. sylvestris cream improved histological changes of tissue components in the process of healing when compared with SSD cream. Therefore, it can be used as a topical treatment agent for burn wound. PMID:26909337

  6. Malva sylvestris extract protects upon lithium carbonate-induced kidney damages in male rat.


    Ben Saad, Anouar; Rjeibi, Ilhem; Brahmi, Dalel; Smida, Amani; Ncib, Sana; Zouari, Nacim; Zourgui, Lazher


    Malva sylvestris has recently attracted special attention due to its potential activities in many chronic disorders. We aimed to assess the beneficial effects of Malva sylvestris extract against lithium carbonate induced renal damage in male Wistar rats. For this purpose, Malva sylvestris extract at a dose of 0.2g/kg was orally administrated, followed by 25mg/kg of lithium carbonate (intraperitoneal injection) for 30 days. Malva sylvestris extract was proved to contain large amounts of K(+), Na(+), Ca(++) and the existence of phenolic acids and flavonoids shown by the obtained HPLC-based analysis. The antioxidant capacities in vitro showed high level of radical scavenging activity and reducing power. The in vivo results showed that intraperitoneal injection of lithium carbonate exhibited a significant increase (p<0.01) of serum creatinine and urea and reduced serum sodium and potassium concentrations. Lithium carbonate also induced oxidative damage as indicated by a significant raise in LPO level associated with a decrease in superoxide dismutase (SOD), catalase (CAT), and glutathione peroxidase (GPx) activities in the kidney. However, pretreatment with Malva sylvestris extract restored the status of all parameters studied. It can be concluded that lithium carbonate has induced oxidative stress, biochemical changes and histopathological damage but the supplementation with Malva sylvestris extract has prevented such toxicity.

  7. Movement analyses of wood cricket ( Nemobius sylvestris) (Orthoptera: Gryllidae).


    Brouwers, N C; Newton, A C


    Information on the dispersal ability of invertebrate species associated with woodland habitats is severely lacking. Therefore, a study was conducted examining the movement patterns of wood cricket (Nemobius sylvestris) (Orthoptera: Gryllidae) on the Isle of Wight, UK. Juvenile (i.e. nymphs) and adult wood crickets were released and observed over time within different ground surface substrates. Their movement paths were recorded and subsequently analysed using random walk models. Nymphs were found to move more slowly than adults did; and, when given a choice, both nymphs and adults showed a preference for moving through or over leaf litter compared to bare soil or grass. A correlated random walk (CRW) model accurately described the movement pattern of adult wood crickets through leaf litter, indicating a level of directional persistence in their movements. The estimated population spread through leaf litter for adults was 17.9 cm min-1. Movements of nymphs through leaf litter could not accurately be described by a random walk model, showing a change in their movement pattern over time from directed to more random movements. The estimated population spread through leaf litter for nymphs was 10.1 cm min-1. The results indicate that wood cricket adults can be considered as more powerful dispersers than nymphs; however, further analysis of how the insects move through natural heterogeneous environments at a range of spatio-temporal scales needs to be performed to provide a complete understanding of the dispersal ability of the species.

  8. Severely reduced gravitropism in dark-grown hypocotyls of a starch-deficient mutant of Nicotiana sylvestris

    NASA Technical Reports Server (NTRS)

    Kiss, J. Z.; Sack, F. D.


    Gravitropism in dark-grown hypocotyls of the wild type was compared with a starch-deficient Nicotiana sylvestris mutant (NS 458) to test the effects of starch deficiency on gravity sensing. In a time course of curvature measured using infrared video, the response of the mutant was greatly reduced compared to the wild type; 72 hours after reorientation, curvature was about 10 degrees for NS 458 and about 70 degrees for wild type. In dishes maintained in a vertical orientation, wild-type hypocotyls were predominantly vertical, whereas NS 458 hypocotyls were severely disoriented with about 5 times more orientational variability than wild type. Since the growth rates were equal for both genotypes and phototropic curvature was only slightly inhibited in NS 458, the mutation probably affects gravity perception rather than differential growth. Our data suggest that starch deficiency reduces gravitropic sensitivity more in dark-grown hypocotyls than in dark- or light-grown roots in this mutant and support the hypothesis that amyloplasts function as statoliths in shoots as well as roots.

  9. Different patterns of genetic structure of relict and isolated populations of endangered peat-bog pine (Pinus uliginosa Neumann).


    Wachowiak, W; Prus-Glowacki, W


    Recent changes in environmental conditions in populations of peat-bog pine (Pinus uliginosa Neumann) caused rapid decline or even extinction of the species in several stands in Central Europe. Conservation strategies for P. uliginosa require information about the evolutionary history and genetic structure of its populations. Using isozymes we assessed the genetic structure of P. uliginosa from four isolated stands in Poland and compared the results to genetic structures of other closely related pine species including eight populations of Pinus mugo, ten of Pinus sylvestris and one of Pinus uncinata. The level of genetic variability of P. uliginosa measured by the mean number of alleles per locus and average heterozygosity was similar to others related to P. uliginosa taxa from the reference group but it differs among populations. High genetic similarity was found between two populations of P. uliginosa from Low Silesian Pinewood. The populations were genetically distinct as compared to other populations including locus classicus of the species from the peat bog at Batorów Reserve. Very low genetic distance (DN = 0.002) and small genetic differentiation (GST = 0.003) were found between P. uliginosa and P. mugo in the sympatric populations of the species from Zieleniec peat bog suggesting the ongoing natural hybridisation and genetic contamination of peat-bog pine from this area. Some evidence for skew in allele frequency distribution potentially due to recent bottleneck was found in population from Low Silesian Pinewood. The analysed open pollinated progeny derived from two P. uliginosa stands from Low Silesian Pinewood showed the excess of homozygotes as compared to the maternal trees indicating high level of inbreeding (F = 0.105, F = 0.081). The results are discussed in the context of evolution of P. uliginosa populations, taxonomic relationships between the analysed species and conservation strategies for active protection of peat-bog pine.

  10. Evaluation of cutaneous wound healing activity of Malva sylvestris aqueous extract in BALB/c mice

    PubMed Central

    Afshar, Mohammad; Ravarian, Behdad; Zardast, Mahmoud; Moallem, Seyed Adel; Fard, Mohammad Hasanpour; Valavi, Masoomeh


    Objective(s): The aim of this study was to evaluate the effects of Malva sylvestris aqueous extract on cutaneous wound healing in BALB/c mice. Materials and Methods: Twenty seven male BALB/c mice (2.5 months of age) were used. A cut wound (superficial fascia depth) was made locally. The mice were then divided into three groups: the first, second and third groups received topical administration of M. sylvestris 1% aqueous extract, silver sulfadiazine topical cream and cold cream (positive and negative control groups), respectively. On days 4, 7 and 10 excisional biopsies were performed and wound healing was evaluated histopathologically. The data were analyzed by the ANOVA and Tukey statistical tests. Results: On days 4 and 7, the numbers of inflammatory cells in the silver sulfadiazine and M. sylvestris-treated groups were significantly lower than the control group and keratinization at the edges of the wound in both groups was significantly higher than the control group. On the tenth day of the study, the Malva-treated mice showed better healing features and less fibrosis and scar formation, and also fewer hair follicles were damaged in this group. On the tenth day of the study, the numbers of inflammatory cells in M. sylvestris and silver sulfadiazine-treated groups were significantly lower than the control group. Conclusion: The present study supports the beneficial effects of M. sylvestris on the wound healing process and suggests a potential clinical application. PMID:26221487

  11. Response of Pinus ponderosa Seedlings to Stylet-Bearing Nematodes

    PubMed Central

    Viglierchio, D. R.


    Of 12 stylet-bearing nematodes used for inoculations, Pratylenchus penetrans, P. brachyurus, P. vulnus, Ditylenchus destructor, Meloidogyne incognita, M. javanica, and M. hapla reproduced on Pinus ponderosa, while Xiphinema index, Aphelenchus avenae, Paratylenehus neoamblycephalus, Tylenchulus semipenetrans, and Macroposthonia xenoplax did not. P. vulnus, P. brachyurus, P. penetrans, A. avenae, D. destructor, T. semipenetrans, and P. neoamblycephalus significantly suppressed both the shoot and root wet weights of ponderosa pine seedlings obtained from stands in five different locations. X. index significantly suppressed root wet weights, M. xenoplax siguificantly suppressed shoot wet weight, and M. incognita, M. javanica, and M. hapla suppressed neither at the inoculation levels used. Injurious nematodes tended to suppress root growth more than shoot growth. Seedlings from two locations produced greater shoot growth wet weight than did seedlings from the other three locations. The more injurious nematodes tended to cause an increase in the water content of shoots. Frequency analyses of seedling population shoot-root ratios indicated that ponderosa pine seedlings could be selected for better shoot-root ratios as well as for resistance to several pathogenic nematodes. PMID:19300659

  12. Discrete shoot and root stem cell-promoting WUS/WOX5 functions are an evolutionary innovation of angiosperms.


    Nardmann, Judith; Reisewitz, Pascal; Werr, Wolfgang


    The morphologically diverse bodies of seed plants comprising gymnosperms and angiosperms, which separated some 350 Ma, grow by the activity of meristems containing stem cell niches. In the dicot model Arabidopsis thaliana, these are maintained by the stem cell-promoting functions of WUS and WUSCHEL-related homeobox 5 (WOX5) in the shoot and the root, respectively. Both genes are members of the WOX gene family, which has a monophyletic origin in green algae. The establishment of the WOX gene phylogeny from basal land plants through gymnosperms to basal and higher angiosperms reveals three major branches: a basal clade consisting of WOX13-related genes present in some green algae and throughout all land plant genomes, a second clade containing WOX8/9/11/12 homologues, and a modern clade restricted to seed plants. The analysis of the origin of the modern branch in two basal angiosperms (Amborella trichopoda and Nymphaea jamesoniana) and three gymnosperms (Pinus sylvestris, Ginkgo biloba, and Gnetum gnemon) shows that all members of the modern clade consistently found in monocots and dicots exist at the base of the angiosperm lineage, including WUS and WOX5 orthologues. In contrast, our analyses identify a single WUS/WOX5 homologue in all three gymnosperm genomes, consistent with a monophyletic origin in the last common ancestor of gymnosperms and angiosperms. Phylogenetic data, WUS- and WOX5-specific evolutionary signatures, as well as the expression pattern and stem cell-promoting function of the single gymnosperm WUS/WOX5 pro-orthologue in Arabidopsis indicate a gene duplication event followed by subfunctionalization at the base of angiosperms.

  13. Fossil records of subsection Pinus (genus Pinus, Pinaceae) from the Cenozoic in Japan.


    Yamada, Toshihiro; Yamada, Mariko; Tsukagoshi, Minoru


    Extant pines of subsection Pinus (section Pinus, genus Pinus, Pinaceae) are predominantly distributed in Eastern Asia. However, the extent of diversification in the section has yet to be fully clarified. We reviewed fossil records of subsection Pinus from Japan and collected permineralized materials, in which anatomical details are preserved for better understanding of the diversification. Our results suggest that this subsection appeared in Japan no earlier than the Middle Eocene, with extant species (i.e., Pinus densiflora and Pinus thunbergii) appearing around the beginning of the Pleistocene. Pinus fujiii (Early Miocene to Early Pleistocene) is inferred to have a close affinity to P. thunbergii based on the medial arrangement of its leaf resin canals. Additionally, P. fujiii has a similar cone morphology to those of extant species living in China, bridging the morphological gap between P. thunbergii and Chinese relatives of P. thunbergii as inferred by molecular phylogenetic analyses. Our results also suggest that taxonomic revisions of Pinus miocenica and Pinus oligolepis are required among the Japanese fossil species reported to date.

  14. Fatty acids of Pinus elliottii tissues.

    NASA Technical Reports Server (NTRS)

    Laseter, J. L.; Lawler, G. C.; Walkinshaw, C. H.; Weete, J. D.


    The total fatty constituents of slash pine (Pinus elliottii) tissue cultures, seeds, and seedlings were examined by GLC and MS. Qualitatively, the fatty acid composition of these tissues was found to be very similar to that reported for other pine species. The fatty acid contents of the tissue cultures resembled that of the seedling tissues. The branched-chain C(sub 17) acid reported for several other Pinus species was confirmed as the anteiso isomer.

  15. Clerodane and Ent-kaurane Diterpene Glycosyl and Glycoside Derivatives from the Leaves of Casearia sylvestris

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Five new clerodane diterpene glycosides caseariasides A-E (1-4) and three new ent-kaurane diterpene glucosides sylvestrisides C-E (6-8) were isolated from the leaves of Casearia sylvestris. Their structures were determined on the basis of chemical and spectroscopic analyses....

  16. Wound healing activity of Malva sylvestris and Punica granatum in alloxan-induced diabetic rats.


    Pirbalouti, Abdollah Ghasemi; Azizi, Shahrzad; Koohpayeh, Abed; Hamedi, Behzad


    The flowers of Malva sylvestris Linn. (Malvaceae) and Punica granatum Linn. (Punicaceae) are important medicinal plants in Iranian traditional medicine (Unani) whose have been used as remedy against edema, bum, wound and for their carminative, antimicrobial and anti-inflammatory activities. The diethyl ether extract of M. sylvestris and P. granatum flowers were used to evaluate the wound healing activity at 200 mg/kg/day dose in alloxan-induced diabetic rats. Wounds were induced in Wister rats divided into six groups as following; Group I, normal rats were treated with simple ointment base. Group II, diabetic rats were treated with simple ointment base (control). Groups III and IV, diabetic rats were treated with simple ointment base containing of extracts (diabetic animals), Groups V, diabetic rats were treated with simple ointment base containing of mixed extracts (1:1), Group VI, diabetic rats received the standard drug (nitrofurazone). The efficacy of treatment was evaluated based on wound area relative and histopathological characteristics. The extract-treated diabetic animals showed significant reduction in the wound area when compared with control. Also, histological studies of the tissue obtained on days 9th and 18th from the extract-treated by extract of M. sylvestris showed increased well organized bands of collagen, more fibroblasts and few inflammatory cells. These findings demonstrate that extract of M. sylvestis effectively stimulates wound contraction as compared to control group and other groups. M. sylvestris accelerated wound healing in rats and thus supports its traditional use.

  17. Investigation of Dynamics Biosynthesis of Phytoalexins induced in Malva Sylvestris by the Verticilium Dahliae

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Biosynthesis of phytoalexins is an active mechanism utilized by plants to protect against pathogens. Phytoalexins from wild plant species may be more potent than those produced in cultivated plants. Two terpenoid substances from the pathogen-infected plant Malva sylvestris L. were isolated using t...

  18. The protective effect of Malva sylvestris on rat kidney damaged by vanadium

    PubMed Central


    Background The protective effect of the common mallow (Malva sylvestris) decoction on renal damages in rats induced by ammonium metavanadate poisoning was evaluated. On the one hand, vanadium toxicity is associated to the production of reactive oxygen species, causing a lipid peroxidation and an alteration in the enzymatic antioxidant defence. On the other hand, many medicinal plants are known to possess antioxidant and radical scavenging properties, thanks to the presence of flavonoids. These properties were confirmed in Malva sylvestris by two separate methods; namely, the Diphenyl-2-picrylhydrazyl assay and the Nitroblue Tetrazolium reduction assay. Results In 80 rats exposed to ammonium metavanadate (0.24 mmol/kg body weight in drinking water) for 90 days, lipid peroxidation levels and superoxide dismutase, catalase and glutathione peroxidase activities were measured in kidney. A significant increase in the formation of free radicals and antioxidant enzyme activities was noticed. In addition, a histological examination of kidney revealed a structural deterioration of the renal cortical capsules and a shrinking of the Bowman space. In animals intoxicated by metavanadate but also given a Malva sylvestris decoction (0.2 g dry mallow/kg body weight), no such pathologic features were observed: lipid peroxidation levels, antioxidant enzyme activities and histological features appeared normal as compared to control rats. Conclusion Malva sylvestris is proved to have a high antioxidative potential thanks to its richness in phenolic compounds. PMID:21513564

  19. Volcanic mercury in Pinus canariensis

    NASA Astrophysics Data System (ADS)

    Rodríguez Martín, José Antonio; Nanos, Nikos; Miranda, José Carlos; Carbonell, Gregoria; Gil, Luis


    Mercury (Hg) is a toxic element that is emitted to the atmosphere by both human activities and natural processes. Volcanic emissions are considered a natural source of mercury in the environment. In some cases, tree ring records taken close to volcanoes and their relation to volcanic activity over time are contradictory. In 1949, the Hoyo Negro volcano (La Palma-Canary Islands) produced significant pyroclastic flows that damaged the nearby stand of Pinus canariensis. Recently, 60 years after the eruption, we assessed mercury concentrations in the stem of a pine which survived volcano formation, located at a distance of 50 m from the crater. We show that Hg content in a wound caused by pyroclastic impacts (22.3 μg kg-1) is an order of magnitude higher than the Hg concentrations measured in the xylem before and after the eruption (2.3 μg kg-1). Thus, mercury emissions originating from the eruption remained only as a mark—in pyroclastic wounds—and can be considered a sporadic and very high mercury input that did not affect the overall Hg input in the xylem. In addition, mercury contents recorded in the phloem (9.5 μg kg-1) and bark (6.0 μg kg-1) suggest that mercury shifts towards non-living tissues of the pine, an aspect that can be related to detoxification in volcanism-adapted species.

  20. Soil type affects Pinus ponderosa var. scopulorum (Pinaceae) seedling growth in simulated drought experiments1

    PubMed Central

    Lindsey, Alexander J.; Kilgore, Jason S.


    • Premise of the study: Effects of drought stress and media type interactions on growth of Pinus ponderosa var. scopulorum germinants were investigated. • Methods and Results: Soil properties and growth responses under drought were compared across four growth media types: two native soils (dolomitic limestone and granite), a soil-less industry standard conifer medium, and a custom-mixed conifer medium. After 35 d of growth, the seedlings under drought stress (reduced watering) produced less shoot and root biomass than watered control seedlings. Organic media led to decreased root biomass, but increased root length and shoot biomass relative to the mineral soils. • Conclusions: Media type affected root-to-shoot biomass partitioning of P. ponderosa var. scopulorum, which may influence net photosynthetic rates, growth, and long-term seedling survival. Further work should examine how specific soil properties like bulk density and organic matter influence biomass allocation in greenhouse studies. PMID:25202578

  1. Genetic diversity of Casearia sylvestris populations in remnants of the Atlantic Forest.


    Araujo, F L; Siqueira, M V B M; Grando, C; Viana, J P G; Pinheiro, J B; Alves-Pereira, A; Campos, J B; Brancalion, P H S; Zucchi, M I


    Guaçatonga (Casearia sylvestris) is a native plant of the Atlantic Forest, with high medicinal potential and relevance for reforestation programs. The aim of this study was to characterize, with microsatellite markers, two populations of C. sylvestris from remaining areas of the Atlantic Forest in the State of São Paulo. High allelic variation was found in both populations (NA = 101 and 117; AR = 12.5 and 14.4), although with high endogamy coefficients (f = 0.640 and 0.363). Estimates of genetic structure suggested the presence of considerable genetic divergence between the populations (FST = 0.103); however, there was no spatial genetic structure within the populations. Genetic divergence may have occurred due to decreased gene flow between the fragmented populations as the result of deforestation. The results of this study demonstrate the importance of genetic diversity and its characterization in native plants within remaining forest areas for the management and restoration of such areas.

  2. Antinociceptive and neuropharmacological activities of methanol extract of Phoenix sylvestris fruit pulp.


    Shajib, Md Shafiullah; Akter, Saleha; Ahmed, Tajnin; Imam, Mohammad Zafar


    Fruits of Phoenix sylvestris Roxb. (Arecaceae) are used to treat back pain, toothache, headache, arthritis, nervous debility and as sedative. The aim of this study was to evaluate the antinociceptive and neuropharmacological activities of methanol extract of P. sylvestris fruit pulp (MEPS). The antinociceptive activity of MEPS was evaluated by heat-induced (hot plate, tail immersion test) and chemical-induced pain models (acetic acid-induced writhing, formalin-induced nociception, glutamate-induced nociception and paw edema test). The effect of MEPS on central nervous system (CNS) was studied using hole cross test, open field test, sodium thiopental-induced sleeping time and elevated plus maze test. MEPS showed strong, significant and dose-dependent antinociceptive activity in all heat-induced and chemical-induced pain models at all experimental doses. Involvement of opioid receptor mediated analgesia was evident from the reversal of analgesic effect by naloxone. MEPS also showed reduced locomotor activity in both hole cross and open field tests. The increase in sleeping time in sodium thiopental-induced sleeping test and anxiolytic activity in elevated plus maze test were also significant. So, it is evident that MEPS possesses strong central and peripheral antinociceptive activity as well as CNS depressant, sedative and anxiolytic activity. The results justify the ethnomedicinal use of P. sylvestris fruit in different painful conditions and CNS disorders.

  3. Antinociceptive and neuropharmacological activities of methanol extract of Phoenix sylvestris fruit pulp

    PubMed Central

    Shajib, Md. Shafiullah; Akter, Saleha; Ahmed, Tajnin; Imam, Mohammad Zafar


    Fruits of Phoenix sylvestris Roxb. (Arecaceae) are used to treat back pain, toothache, headache, arthritis, nervous debility and as sedative. The aim of this study was to evaluate the antinociceptive and neuropharmacological activities of methanol extract of P. sylvestris fruit pulp (MEPS). The antinociceptive activity of MEPS was evaluated by heat-induced (hot plate, tail immersion test) and chemical-induced pain models (acetic acid-induced writhing, formalin-induced nociception, glutamate-induced nociception and paw edema test). The effect of MEPS on central nervous system (CNS) was studied using hole cross test, open field test, sodium thiopental-induced sleeping time and elevated plus maze test. MEPS showed strong, significant and dose-dependent antinociceptive activity in all heat-induced and chemical-induced pain models at all experimental doses. Involvement of opioid receptor mediated analgesia was evident from the reversal of analgesic effect by naloxone. MEPS also showed reduced locomotor activity in both hole cross and open field tests. The increase in sleeping time in sodium thiopental-induced sleeping test and anxiolytic activity in elevated plus maze test were also significant. So, it is evident that MEPS possesses strong central and peripheral antinociceptive activity as well as CNS depressant, sedative and anxiolytic activity. The results justify the ethnomedicinal use of P. sylvestris fruit in different painful conditions and CNS disorders. PMID:26483687


    EPA Science Inventory

    Root minirhizotron tubes were installed in two ponderosa pine (Pinus ponderosa Laws.) stands around three different tree age classes (16, 45, and > 250 yr old) to examine root spatial distribution in relation to canopy size and tree distribution, and to determine if rates of fine...


    EPA Science Inventory

    Root minirhizotron tubs were installed in two ponderosa pine (Pinus ponderosa Laws.) Stands of different ages to examine patterns of root growth and death. The old-growth site (OS) consists of a mixture of old (>250 years) and young trees (ca.45 yrs)< and is located near clamp S...

  6. An allelopathic substance in red pine needles (Pinus densiflora).


    Kato-Noguchi, Hisashi; Fushimi, Yoshiko; Shigemori, Hideyuki


    Aqueous methanol extracts of red pine (Pinus densiflora) needles inhibited the growth of roots and shoots of cress (Lepidium sativum), lettuce (Lactuca sativa), alfalfa (Medicago sativa), ryegrass (Lolium multiflorum), timothy (Pheleum pratense), Digitaria sanguinalis and Echinochloa crus-galli. Increasing the extract concentration increased inhibition, suggesting that the pine needles may have growth inhibitory substances and possess allelopathic potential. The aqueous methanol extract of the pine needles was purified, and a main inhibitory substance was isolated and determined by spectral data as 9alpha,13beta-epidioxyabeit-8(14)en-18-oic acid. This substance inhibited root and shoot growth of cress and Echinochloa crus-galli seedlings at concentrations greater than 0.1 mM. The endogenous concentration of the substance was 0.13 mmol/kg pine needle. These results suggest that 9alpha,13beta-epidioxyabeit-8(14)en-18-oic acid may contribute to the growth inhibitory effect of the pine needles and may play an important role in the allelopathy of red pine.

  7. Effect of Root Moisture Content and Diameter on Root Tensile Properties

    PubMed Central

    Yang, Yuanjun; Chen, Lihua; Li, Ning; Zhang, Qiufen


    The stabilization of slopes by vegetation has been a topical issue for many years. Root mechanical characteristics significantly influence soil reinforcement; therefore it is necessary to research into the indicators of root tensile properties. In this study, we explored the influence of root moisture content on tensile resistance and strength with different root diameters and for different tree species. Betula platyphylla, Quercus mongolica, Pinus tabulaeformis, and Larix gmelinii, the most popular tree species used for slope stabilization in the rocky mountainous areas of northern China, were used in this study. A tensile test was conducted after root samples were grouped by diameter and moisture content. The results showedthat:1) root moisture content had a significant influence on tensile properties; 2) slightly loss of root moisture content could enhance tensile strength, but too much loss of water resulted in weaker capacity for root elongation, and consequently reduced tensile strength; 3) root diameter had a strong positive correlation with tensile resistance; and4) the roots of Betula platyphylla had the best tensile properties when both diameter and moisture content being controlled. These findings improve our understanding of root tensile properties with root size and moisture, and could be useful for slope stabilization using vegetation. PMID:27003872

  8. Pre-clinical anti-inflammatory aspects of a cuisine and medicinal millennial herb: Malva sylvestris L.


    Prudente, Arthur S; Loddi, Alliete M V; Duarte, Márcia R; Santos, Adair R S; Pochapski, Marcia T; Pizzolatti, Moacir G; Hayashi, Sirlei S; Campos, Francinete R; Pontarolo, Roberto; Santos, Fabio A; Cabrini, Daniela A; Otuki, Michel F


    Malva sylvestris has been used since ancient times for its emollient, laxative and anti-inflammatory properties, being extensively used as salads, soups and teas. The preset study evaluated the topical anti-inflammatory action of M. sylvestris hydroalcoholic extract (HE) and its compounds in mice ear inflammation caused by 12-O-tetradecanoylphorbol-acetate in mice. The LC-MS analysis of the HE confirmed the presence of scopoletin, quercetin and malvidin 3-glucoside compounds in the HE of M. sylvestris. Topical application of the HE reduced ear oedema, polymorphonuclear cells influx (myeloperoxydase activity and histological analysis) and interleukin-1β levels in the tissue. The topical application of the compound present in the HE, malvidin 3-glucoside was also able to inhibit ear oedema and leukocytes migration. The other tested compounds, scopoletin, quercetin and malvidin 3,5-glucoside were able to prevent the formation of oedema and cell infiltration, but with less effectiveness when compared to HE and malvidin 3-glucoside. Therefore, these results consistently support the notion that M. sylvestris leaves possesses topical anti-inflammatory activity, the compound malvidin 3-glucoside seems to be major responsible for this effect, with the participation of other anti-inflammatory compounds in the extract. Thus, as recommended by population, M. sylvestris can be used as a future treatment to skin disorders.

  9. Exceptional inheritance of plastids via pollen in Nicotiana sylvestris with no detectable paternal mitochondrial DNA in the progeny.


    Thyssen, Gregory; Svab, Zora; Maliga, Pal


    Plastids and mitochondria, the DNA-containing cytoplasmic organelles, are maternally inherited in the majority of angiosperm species. Even in plants with strict maternal inheritance, exceptional paternal transmission of plastids has been observed. Our objective was to detect rare leakage of plastids via pollen in Nicotiana sylvestris and to determine if pollen transmission of plastids results in co-transmission of paternal mitochondria. As father plants, we used N. sylvestris plants with transgenic, selectable plastids and wild-type mitochondria. As mother plants, we used N. sylvestris plants with Nicotiana undulata cytoplasm, including the CMS-92 mitochondria that cause cytoplasmic male sterility (CMS) by homeotic transformation of the stamens. We report here exceptional paternal plastid DNA in approximately 0.002% of N. sylvestris seedlings. However, we did not detect paternal mitochondrial DNA in any of the six plastid-transmission lines, suggesting independent transmission of the cytoplasmic organelles via pollen. When we used fertile N. sylvestris as mothers, we obtained eight fertile plastid transmission lines, which did not transmit their plastids via pollen at higher frequencies than their fathers. We discuss the implications for transgene containment and plant evolutionary histories inferred from cytoplasmic phylogenies.

  10. Perennial roots to immortality.


    Munné-Bosch, Sergi


    Maximum lifespan greatly varies among species, and it is not strictly determined; it can change with species evolution. Clonal growth is a major factor governing maximum lifespan. In the plant kingdom, the maximum lifespans described for clonal and nonclonal plants vary by an order of magnitude, with 43,600 and 5,062 years for Lomatia tasmanica and Pinus longaeva, respectively. Nonclonal perennial plants (those plants exclusively using sexual reproduction) also present a huge diversity in maximum lifespans (from a few to thousands of years) and even more interestingly, contrasting differences in aging patterns. Some plants show a clear physiological deterioration with aging, whereas others do not. Indeed, some plants can even improve their physiological performance as they age (a phenomenon called negative senescence). This diversity in aging patterns responds to species-specific life history traits and mechanisms evolved by each species to adapt to its habitat. Particularities of roots in perennial plants, such as meristem indeterminacy, modular growth, stress resistance, and patterns of senescence, are crucial in establishing perenniality and understanding adaptation of perennial plants to their habitats. Here, the key role of roots for perennial plant longevity will be discussed, taking into account current knowledge and highlighting additional aspects that still require investigation.

  11. Ectomycorrhizal symbiosis in vitro between Tricholoma matsutake and Pinus densiflora seedlings that resembles naturally occurring 'shiro'.


    Yamada, Akiyoshi; Maeda, Ken; Kobayashi, Hisayasu; Murata, Hitoshi


    We established an in vitro ectomycorrhizal symbiosis between Tricholoma matsutake and Pinus densiflora. Mycorrhiza formed in a substrate of Modified Norkrans' C medium and granite-based soil had features similar to those observed previously only in naturally occurring mycorrhizal system called 'shiro,' and promoted the growth of plants with smaller root/shoot ratios. The in vitro formation of 'shiro' is essential for the development of T. matsutake system to produce mushrooms and is useful for the propagation and plantation of the mycorrhizal seedlings.

  12. Experimental data of biomaterial derived from Malva sylvestris and charcoal tablet powder for Hg(2+) removal from aqueous solutions.


    Rahbar, Alireza; Farjadfard, Sima; Leili, Mostafa; Kafaei, Raheleh; Haghshenas, Vajiheh; Ramavandi, Bahman


    In this experimental data article, a novel biomaterial was provided from Malva sylvestris and characterized its properties using various instrumental techniques. The operating parameters consisted of pH and adsorbent dose on Hg(2+) adsorption from aqueous solution using M. sylvestris powder (MSP) were compared with charcoal tablet powder (CTP), a medicinal drug. The data acquired showed that M. sylvestris is a viable and very promising alternative adsorbent for Hg(2+) removal from aqueous solutions. The experimental data suggest that the MSP is a potential adsorbent to use in medicine for treatment of poisoning with heavy metals; however, the application in animal models is a necessary step before the eventual application of MSP in situations involving humans.

  13. Chemical composition of Pinus sibirica (Pinaceae).


    Rogachev, Artem D; Salakhutdinov, Nariman F


    Siberian pine (Pinus sibirica), also known as Siberian cedar pine and Siberian cedar, is an important plant that has been long used as a source of natural compounds and materials (wood, needles, soft resin, turpentine, colophony). Its chemical composition has been studied well enough; however, to our surprise, no articles that compile the phytochemical data have been published so far. Presumably, this is due to the fact that most of the studies were published in journals difficult to access and not indexed by search systems. This review, for the first time, presents a systematic compilation of available data of secondary metabolites occurring in the needles, shoots, bark, wood, seeds, and oleoresin of Pinus sibirica.

  14. Ectomycorrhizal Fungal Communities of Red Pine (Pinus densiflora) Seedlings in Disturbed Sites and Undisturbed Old Forest Sites.


    Lee, Eun-Hwa; Eom, Ahn-Heum


    This study aimed to investigate differences in ectomycorrhizal (ECM) fungal communities between disturbed sites and undisturbed old forest sites. ECM root tips of Pinus densiflora were collected from 4 sites disturbed by human activities and 3 undisturbed old forest sites adjacent to the disturbed sites. Results in this study showed that the number of ECM root tips, species diversity, and number of species were significantly higher in the disturbed sites than in the undisturbed sites, suggesting that the ECM fungal community structure was affected by the degree of disturbance.

  15. Hydraulic redistribution of water from Pinus ponderosa trees to seedlings: evidence for an ectomycorrhizal pathway.


    Warren, Jeffrey M; Brooks, J Renée; Meinzer, Frederick C; Eberhart, Joyce L


    While there is strong evidence for hydraulic redistribution (HR) of soil water by trees, it is not known if common mycorrhizal networks (CMN) can facilitate HR from mature trees to seedlings under field conditions. Ponderosa pine (Pinus ponderosa) seedlings were planted into root-excluding 61-microm mesh barrier chambers buried in an old-growth pine forest. After 2 yr, several mature trees were cut and water enriched in D(2)O and acid fuchsin dye was applied to the stumps. Fine roots and mycorrhizal root tips of source trees became heavily dyed, indicating reverse sap flow in root xylem transported water from stems throughout root systems to the root hyphal mantle that interfaces with CMN. Within 3 d, D(2)O was found in mesh-chamber seedling foliage > 1 m from source trees; after 3 wk, eight of 10 mesh-chamber seedling stem samples were significantly enriched above background levels. Average mesh-chamber enrichment was 1.8 x greater than that for two seedlings for which the connections to CMN were broken by trenching before D(2)O application. Even small amounts of water provided to mycorrhizas by HR may maintain hyphal viability and facilitate nutrient uptake under drying conditions, which may provide an advantage to seedlings hydraulically linked by CMN to large trees.

  16. Flavonoids and Other Phenolic Compounds in Needles of Pinus peuce and Other Pine Species from the Macedonian Flora.


    Karapandzova, Marija; Stefkov, Gjose; Cvetkovikj, Ivana; Stanoeva, Jasmina Petreska; Stefova, Marina; Kulevanova, Svetlana


    Flavonoids and other phenolic compounds in young needles of four pine species, Pinus peuce, P. nigra, P. mugo and P. sylvestris from the Macedonian flora were investigated. The amount of total phenols and total flavonoids were determined using Folin-Ciocalteau and aluminum chloride assay, respectively. The obtained results revealed that the total phenolic content (TPC) and total flavonoids content (TFC) varied among different pine species ranging from 9.8 to 14.0 mg GAE/g and from 3.3 to 7.2 mg CE/g of dried plant material, respectively. Qualitative analysis of flavonoids and other phenolic components was made by a LC-DAD/ESI-MS(n) optimized chromatographic method. A total of 17 phenolic components were identified and classified as: acids (2), procyanidins (2) and flavonoid glycosides (13). The most prevalent components were flavonoid glycosides, especially flavonols and methylated flavonols (9). Additionally, 3 components were found as acylated flavonol glycosides with ferulic and p-coumaric acid. The last one was found not only in esterified form but also in the free form. Only one flavone-apigenin glycoside was detected. Procyanidins were identified as catechin derivatives, both dimers and trimers.

  17. Spatial variability of throughfall in a stand of Scots pine (Pinus sylvestris L.) with deciduous admixture as influenced by canopy cover and stem distance

    NASA Astrophysics Data System (ADS)

    Kowalska, Anna; Boczoń, Andrzej; Hildebrand, Robert; Polkowska, Żaneta


    Vegetation cover affects the amount of precipitation, its chemical composition and its spatial distribution, and this may have implications for the distribution of water, nutrients and contaminants in the subsurface soil layer. The aim of this study was a detailed diagnosis of the spatio-temporal variability in the amount of throughfall (TF) and its chemical components in a 72-year-old pine stand with an admixture of oak and birch. The spatio-temporal variability in the amount of TF water and the concentrations and deposition of the TF components were studied. The components that are exchanged in canopy (H+, K, Mg, Mn, DOC, NH4+) were more variable than the components whose TF deposition is the sum of wet and dry (including gas) deposition and which undergo little exchange in the canopy (Na, Cl, NO3-, SO42-). The spatial distribution was temporally stable, especially during the leafed period. This study also investigated the effect of the selected pine stand characteristics on the spatial distribution of throughfall and its chemical components; the characteristics included leaf area index (LAI), the proportion of the canopy covered by deciduous species and pine crowns, and the distance from the nearest tree trunk. The LAI measured during the leafed and leafless periods had the greatest effect on the spatial distribution of TF deposition. No relationship was found between the spatial distribution of the amount of TF water and (i) the LAI; (ii) the canopy cover of broadleaf species or pines; or (iii) the distance from the trunks.

  18. Processing of pine (Pinus sylvestris) and birch (Betula pubescens) leaf material in a small river system in the northern Cairngorms, Scotland

    NASA Astrophysics Data System (ADS)

    Collen, P.; Keay, E. J.; Morrison, B. R. S.

    Processing rates, and macroinvertebrate colonisation, of pine needles and birch leaves were studied at eight sites on the river Nethy, a small river system in the Cairngorm region of north-eastern Scotland. Throughout this river system, processing rates were slow for pine (k values 0.0015-0.0034 day-1) and medium to fast for birch (k values 0.0085-0.0331 day-1). Plecopteran shredders dominated both pine and birch leaf packs during the early part of the experiment while chironomids were more important in the latter stages. It is suggested that the slow processing rate of pine needles could adversely affect the productivity of streams, particularly where needles provide the major allochthonous energy source and retentive features are limited. Forest managers should consider this when creating new pinewoods in treeless areas as it will take many years for the trees to reach a size at which they can effectively contribute retentive features, in the form of woody debris, to streams.

  19. Synergistic, additive and antagonistic impacts of drought and herbivory on Pinus sylvestris: leaf, tissue and whole-plant responses and recovery

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Synergies among stressors could result in catastrophic dysfunction of plant and ecosystem processes from an otherwise recoverable situation. To date, studies that have specifically tested for synergies among multiple stressors have almost exclusively focused on the presence or absences of specific s...

  20. Root Hairs

    PubMed Central

    Grierson, Claire; Nielsen, Erik; Ketelaarc, Tijs; Schiefelbein, John


    Roots hairs are cylindrical extensions of root epidermal cells that are important for acquisition of nutrients, microbe interactions, and plant anchorage. The molecular mechanisms involved in the specification, differentiation, and physiology of root hairs in Arabidopsis are reviewed here. Root hair specification in Arabidopsis is determined by position-dependent signaling and molecular feedback loops causing differential accumulation of a WD-bHLH-Myb transcriptional complex. The initiation of root hairs is dependent on the RHD6 bHLH gene family and auxin to define the site of outgrowth. Root hair elongation relies on polarized cell expansion at the growing tip, which involves multiple integrated processes including cell secretion, endomembrane trafficking, cytoskeletal organization, and cell wall modifications. The study of root hair biology in Arabidopsis has provided a model cell type for insights into many aspects of plant development and cell biology. PMID:24982600

  1. Effects of Ectomycorrhizal Fungi on Growth of Seedlings of Pinus densiflora.


    Sim, Mi-Yeong; Eom, Ahn-Heum


    This study was conducted to investigate the different effects of ectomycorrhizal fungal (ECMF) species on the growth of seedlings of Pinus densiflora, and the effects of ECMF diversity on plant productivity. A total of five species of ECMF were isolated from root tips of pine seedlings collected from Mt. Songni and used as inocula. Pots containing pine seedlings were inoculated with either a single ECMF species or a mixture of five ECMF species. All of the seedlings formed ECM on their roots except for the control plants. The pine seedlings' growth responses varied by the different ECMF species. Also, pine seedlings inoculated with a mixture of five ECMF species showed the highest growth response. The results of the study suggest that the colonization of diverse species of ECMF will increase plant productivity, and the selection of suitable ECMF species could be an important factor for plant growth.

  2. Needle terpenes as chemotaxonomic markers in Pinus: subsections Pinus and Pinaster.


    Mitić, Zorica S; Jovanović, Snežana Č; Zlatković, Bojan K; Nikolić, Biljana M; Stojanović, Gordana S; Marin, Petar D


    Chemical compositions of needle essential oils of 27 taxa from the section Pinus, including 20 and 7 taxa of the subsections Pinus and Pinaster, respectively, were compared in order to determine chemotaxonomic significance of terpenes at infrageneric level. According to analysis of variance, six out of 31 studied terpene characters were characterized by a high level of significance, indicating statistically significant difference between the examined subsections. Agglomerative hierarchical cluster analysis has shown separation of eight groups, where representatives of subsect. Pinaster were distributed within the first seven groups on the dendrogram together with P. nigra subsp. laricio and P. merkusii from the subsect. Pinus. On the other hand, the eighth group included the majority of the members of subsect. Pinus. Our findings, based on terpene characters, complement those obtained from morphological, biochemical and molecular parameters studied over the past two decades. In addition, results presented in this paper confirmed that terpenes are good markers at infrageneric level. This article is protected by copyright. All rights reserved.

  3. Chronic ozone exacerbates the reduction in photosynthesis and acceleration of senescence caused by limited N availability in Nicotiana sylvestris

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Elevated ozone (O3) and limiting soil nitrogen (N) availability both negatively affect crop performance. However, little is known about how the combination of elevated O3 and limiting N affect crop growth and metabolism. In this study, we grew tobacco (Nicotiana sylvestris) in ambient and elevated O...

  4. Malva sylvestris Inhibits Inflammatory Response in Oral Human Cells. An In Vitro Infection Model.


    Benso, Bruna; Rosalen, Pedro Luiz; Alencar, Severino Matias; Murata, Ramiro Mendonça


    The aim of this study was to investigate the in vitro anti-inflammatory activity of Malva sylvestris extract (MSE) and fractions in a co-culture model of cells infected by Aggregatibacter actinomycetemcomitans. In addition, we evaluated the phytochemical content in the extract and fractions of M. sylvestris and demonstrated that polyphenols were the most frequent group in all samples studied. An in vitro dual-chamber model to mimic the periodontal structure was developed using a monolayer of epithelial keratinocytes (OBA-9) and a subepithelial layer of fibroblasts (HGF-1). The invasive periodontopathogen A. actinomycetemcomitans (D7S-1) was applied to migrate through the cell layers and induce the synthesis of immune factors and cytokines in the host cells. In an attempt to analyze the antimicrobial properties of MSE and fractions, a susceptibility test was carried out. The extract (MIC 175 μg/mL, MBC 500μg/mL) and chloroform fraction (MIC 150 μg/mL, MBC 250 μg/mL) were found to have inhibitory activity. The extract and all fractions were assessed using a cytotoxicity test and results showed that concentrations under 100 μg/mL did not significantly reduce cell viability compared to the control group (p > 0.05, viability > 90%). In order to analyze the inflammatory response, transcriptional factors and cytokines were quantified in the supernatant released from the cells. The chloroform fraction was the most effective in reducing the bacterial colonization (p< 0.05) and controlling inflammatory mediators, and promoted the down-regulation of genes including IL-1beta, IL-6, IL-10, CD14, PTGS, MMP-1 and FOS as well as the reduction of the IL-1beta, IL-6, IL-8 and GM-CSF protein levels (p< 0.05). Malva sylvestris and its chloroform fraction minimized the A. actinomycetemcomitans infection and inflammation processes in oral human cells by a putative pathway that involves important cytokines and receptors. Therefore, this natural product may be considered as a

  5. Malva sylvestris Inhibits Inflammatory Response in Oral Human Cells. An In Vitro Infection Model

    PubMed Central

    Benso, Bruna; Rosalen, Pedro Luiz; Alencar, Severino Matias; Murata, Ramiro Mendonça


    The aim of this study was to investigate the in vitro anti-inflammatory activity of Malva sylvestris extract (MSE) and fractions in a co-culture model of cells infected by Aggregatibacter actinomycetemcomitans. In addition, we evaluated the phytochemical content in the extract and fractions of M. sylvestris and demonstrated that polyphenols were the most frequent group in all samples studied. An in vitro dual-chamber model to mimic the periodontal structure was developed using a monolayer of epithelial keratinocytes (OBA-9) and a subepithelial layer of fibroblasts (HGF-1). The invasive periodontopathogen A. actinomycetemcomitans (D7S-1) was applied to migrate through the cell layers and induce the synthesis of immune factors and cytokines in the host cells. In an attempt to analyze the antimicrobial properties of MSE and fractions, a susceptibility test was carried out. The extract (MIC 175 μg/mL, MBC 500μg/mL) and chloroform fraction (MIC 150 μg/mL, MBC 250 μg/mL) were found to have inhibitory activity. The extract and all fractions were assessed using a cytotoxicity test and results showed that concentrations under 100 μg/mL did not significantly reduce cell viability compared to the control group (p > 0.05, viability > 90%). In order to analyze the inflammatory response, transcriptional factors and cytokines were quantified in the supernatant released from the cells. The chloroform fraction was the most effective in reducing the bacterial colonization (p< 0.05) and controlling inflammatory mediators, and promoted the down-regulation of genes including IL-1beta, IL-6, IL-10, CD14, PTGS, MMP-1 and FOS as well as the reduction of the IL-1beta, IL-6, IL-8 and GM-CSF protein levels (p< 0.05). Malva sylvestris and its chloroform fraction minimized the A. actinomycetemcomitans infection and inflammation processes in oral human cells by a putative pathway that involves important cytokines and receptors. Therefore, this natural product may be considered as a

  6. Effects of Malva sylvestris and Its Isolated Polysaccharide on Experimental Ulcerative Colitis in Rats.


    Hamedi, Azadeh; Rezaei, Hossein; Azarpira, Negar; Jafarpour, Mehrnaz; Ahmadi, Fatemeh


    Malva sylvestris is an edible plant that is consumed as a herbal supplement for its antiulcer and colon cleansing properties in traditional Persian medicine. This study was designed to evaluate its effects on ulcerative colitis, which is a chronic gastrointestinal inflammation. Colitis was induced by rectal instillation of acetic acid solution. Rats in different groups received aqueous, n-hexane, or ethanolic fractions of the plant before induction of colitis. Isolated polysaccharide of plant was also tested in 2 groups before and after induction of colitis. Macroscopic and microscopic evaluation of colitis showed that the aqueous fraction was very effective in preventing the inflammation and efficacy was lower for ethanolic and n-hexane fractions. Polysaccharide was effective in reducing signs of inflammation, especially as pretreatment. These beneficial effects provide evidences that this plant can be suggested for patients with this disease to improve their health condition or to reduce adverse effects of their medication.

  7. Somatic Embryogenesis in Olive (Olea europaea L. subsp. europaea var. sativa and var. sylvestris).


    Rugini, Eddo; Silvestri, Cristian


    Protocols for olive somatic embryogenesis from zygotic embryos and mature tissues have been described for both Olea europaea sub. europaea var. sativa and var. sylvestris. Immature zygotic embryos (no more than 75 days old), used after fruit collection or stored at 12-14 °C for 2-3 months, are the best responsive explants and very slightly genotype dependent, and one single protocol can be effective for a wide range of genotypes. On the contrary, protocols for mature zygotic embryos and for mature tissue of cultivars are often genotype specific, so that they may require many adjustments according to genotypes. The use of thidiazuron and cefotaxime seems to be an important trigger for induction phase particularly for tissues derived from cultivars. Up to now, however, the application of this technique for large-scale propagation is hampered also by the low rate of embryo germination; it proves nonetheless very useful for genetic improvement.

  8. Optimisation of conditions for the extraction of casearins from Casearia sylvestris using response surface methodology.


    Bandeira, Karin F; Tininis, Aristeu G; Da Bolzani, Vanderlan S; Cavalheiro, Alberto J


    Optimal conditions for the extraction of casearins from Casearia sylvestris were determined using response surface methodology. The maceration and sonication extraction techniques were performed using a 3 x 3 x 3 full factorial design including three acidity conditions, three solvents of different polarities and three extraction times. The yields and selectivities of the extraction of casearins were significantly influenced by acidity conditions. Taking into account all variables tested, the optimal conditions for maceration extraction were estimated to involve treatment with dichloromethane saturated with ammonium hydroxide for 26 h. Similar yields and selectivities for casearins were determined for sonication extraction using the same solvent but for the much shorter time of 1 h. The best results for stabilisation of the fresh plant material were obtained using leaves that had been oven dried at 40 degrees C for 48 h.

  9. Ethylene and the Regulation of Senescence Processes in Transgenic Nicotiana sylvestris Plants

    PubMed Central

    Yang, Thomas F.; Gonzalez-Carranza, Zinnia H.; Maunders, Martin J.; Roberts, Jeremy A.


    Background and Aims Exposure of plants to ethylene can influence a spectrum of developmental processes including organ senescence and abscission. The aim of this study was to examine the role of the gaseous regulator in Nicotiana sylvestris plants exhibiting a silenced or constitutive ethylene response. Methods Transgenic N. sylvestris plants were generated that either ectopically expressed the Arabidopsis mutant ethylene receptor ETR1-1 or the tomato EIN3-like (LeEIL1) gene. Highly expressing homozygous lines were selected and the time-course of development, from germination to organ senescence, was studied. Key Results Fifty percent of the homozygous Pro35S:ETR1-1 lines examined showed a high susceptibility to collapse prior to flowering, with plant death occurring within a few days of leaf wilting. The time-course of leaf senescence in the remaining Pro35S:ETR1-1 lines was visibly arrested compared to wild type (negative segregant) plants and this observation was reaffirmed by chlorophyll and protein analysis. Petal necrosis was also delayed in Pro35S:ETR1-1 lines and corolla abscission did not take place. When senescence of Pro35S:ETR1-1 plants did take place this was accompanied by leaf bleaching, but tissues remained fully turgid and showed no signs of collapse. A single Pro35S:LeEIL1 line was found to exhibit consistently accelerated leaf and flower senescence and precocious flower bud shedding. Conclusions These observations support a role for ethylene in regulating a spectrum of developmental events associated with organ senescence and tissue necrosis. Furthermore, the transgenic lines generated during this study may provide a valuable resource for exploring how senescence processes are regulated in plants. PMID:17901061

  10. Regulation of catalase activity in leaves of Nicotiana sylvestris by high CO sub 2

    SciTech Connect

    Havir, E.A.; McHale, N.A. )


    The effect of high CO{sub 2} (1% CO{sub 2}/21% O{sub 2}) on the activity of specific forms of catalase (CAT-1, -2, and -3) in seedling leaves of tobacco (Nicotiana sylvestris, Nicotiana tabacum) was examined. In high CO{sub 2} total catalase activity decreased by 50% in the first 2 days, followed by a more gradual decline in the next 4 days. The loss of total activity resulted primarily from a decrease in CAT-1 catalase. In contrast, the activity of CAT-3 catalase, a form with enhanced peroxidatic activity, increased 3-fold in high CO{sub 2} relative to air controls after 4 days. Short-term exposure to high CO{sub 2} indicated that the 50% loss of total activity occurs in the firs 12 hours. Catalase levels increased to normal within 12 hours after seedlings were returned to air. When seedlings were transferred to air after prolonged exposure to high CO{sub 2} (13 days), the levels of CAT-1 catalase were partially restored while CAT-3 remained at its elevated level. Levels of superoxide dismutase activity and those of several peroxisomal enzymes were not affected by high CO{sub 2}. Total catalase levels did not decline when seedlings were exposed to atmospheres of 0.04% CO{sub 2}/5% O{sub 2} or 0.04% CO{sub 2}/1% O{sub 2}, indicating that regulation of catalase in high CO{sub 2} is not related directly to suppression of photorespiration. Antibodies prepared against CAT-1 catalase from N. tabacum reacted strongly against CAT-1 catalase from both N. sylvestris and N. tabacum but not against CAT-3 catalase from either species.

  11. Novel taxa in the Fusarium fujikuroi species complex from Pinus spp.

    PubMed Central

    Herron, D.A.; Wingfield, M.J.; Wingfield, B.D.; Rodas, C.A.; Marincowitz, S.; Steenkamp, E.T.


    The pitch canker pathogen Fusarium circinatum has caused devastation to Pinus spp. in natural forests and non-natives in commercially managed plantations. This has drawn attention to the potential importance of Fusarium species as pathogens of forest trees. In this study, we explored the diversity of Fusarium species associated with diseased Pinus patula, P. tecunumanii, P. kesiya and P. maximinoi in Colombian plantations and nurseries. Plants displaying symptoms associated with a F. circinatum-like infection (i.e., stem cankers and branch die-back on trees in plantations and root or collar rot of seedlings) were sampled. A total of 57 isolates were collected and characterised based on DNA sequence data for the translation elongation factor 1-α and β-tubulin gene regions. Phylogenetic analyses of these data allowed for the identification of more than 10 Fusarium species. These included F. circinatum, F. oxysporum, species within the Fusarium solani species complex and seven novel species in the Fusarium fujikuroi species complex (formerly the Gibberella fujikuroi species complex), five of which are described here as new. Selected isolates of the new species were tested for their pathogenicity on Pinus patula and compared with that of F. circinatum. Of these, F. marasasianum, F. parvisorum and F. sororula displayed levels of pathogenicity to P. patula that were comparable with that of F. circinatum. These apparently emerging pathogens thus pose a significant risk to forestry in Colombia and other parts of the world. PMID:26955193


    EPA Science Inventory

    Respiratory responses of fine ponderosa pine (Pinus ponderosa Laws) roots of differing morphology were measured to evaluate response to excision and to changes in the shoot light environment. Ponderosa pine seedlings were subject to either a 15:9 h light/dark environment over 24...


    EPA Science Inventory

    We used minihizaotrons to assess the effects of elevated CO2N and season on the life-span of ponderosa pine (Pinus ponderosa Dougl. Ex Laws.) fine roots. CO2 levels were ambient air (A), ambient air + 175 ?mol mol-1 (A+175) and ambient air + 350 ?mol mol-1 (A+350). N treatments ...


    EPA Science Inventory

    The effects of elevated CO2 and N fertilization on architecture of Pinus ponderosa fine roots and their associated mycorrhizal symbionts were measured over a 4-year period. The study was conducted in open-top field-exposure chambers located near Placerville, CA. A replicated (thr...

  15. [Individual biomass of natural Pinus densiflora].


    Wang, C; Jin, Y; Jin, C; Liu, J; Jin, Y


    The aboveground biomass of individuals with different growth potentials in natural Pinus densiflora forest with different stand densities was measured in Yanbian, Jilin Province. The variation of individual biomass affected by densities was in order of dominant tree < intermediate tree < suppressed tree, while the distribution proportion of biomass in different organs affected by densities was: in order of trunk > branch > needle > bark. The biomass components of P. densifliora with different growth potentials varied markedly with the approaching of density class III, and the change of intermediate trees was similar to the whole stand. The vertical distributions of biomass of different trees were different from each other, but all showed that the biomass of trunks and barks was mainly distributed below 6 m high from ground, that of branches was within 6-10 m high, that of needles was uniform in the upper, middle and lower layers, and that of branches and needles in upper layer was least affected by density.

  16. Phytochemical analysis of Pinus eldarica bark

    PubMed Central

    Iravani, S.; Zolfaghari, B.


    Bark extract of Pinus pinaster contains numerous phenolic compounds such as catechins, taxifolin, and phenolic acids. These compounds have received considerable attentions because of their anti-inflammatory, antimutagenic, anticarcinogenic, antimetastatic and high antioxidant activities. Although P. pinaster bark has been intensely investigated in the past; there is comparably less information available in the literature in regard to P. eldarica bark. Therefore, the aim of this study was to determine the chemical composition of P. eldarica commonly found in Iran. A reversed-phase high pressure liquid chromatography (RP-HPLC) method for the determination of catechin, caffeic acid, ferulic acid, and taxifolin in P. pinaster and P. eldarica was developed. A mixture of 0.1% formic acid in deionized water and 0.1% formic acid in acetonitrile was used as the mobile phase, and chromatographic separation was achieved on a Nova pack C18 at 280 nm. The two studied Pinus species contained high amounts of polyphenolic compounds. Among four marker compounds, the main substances identified in P. pinaster and P. eldarica were taxifolin and catechin, respectively. Furthermore, the composition of the bark oil of P. eldarica obtained by hydrodistillation was analyzed by gas chromatography/mass spectroscopy (GC/MS). Thirty-three compounds accounting for 95.1 % of the oil were identified. The oils consisted mainly of mono- and sesquiterpenoid fractions, especially α-pinene (24.6%), caryophyllene oxide (14.0%), δ-3-carene (10.7%), (E)-β-caryophyllene (7.9%), and myrtenal (3.1%). PMID:25657795

  17. Late Eocene white pines (Pinus subgenus Strobus) from southern China

    PubMed Central

    Xu, Qingqing; Zhou, Wenjun; Kodrul, Tatiana M.; Naugolnykh, Serge V.; Jin, Jianhua


    Fossil records indicate that the genus Pinus L. split into two subgenera by the Late Cretaceous, although subgenus Strobus (D. Don) Lemmon is less well documented than subgenus Pinus L., especially in eastern Asia. In this paper, Pinus maomingensis sp. nov. is established based on a compressed seed cone from the upper Eocene of the Maoming Basin of southern China. This species is attributed to genus Pinus, subgenus Strobus, section Quinquefoliae Duhamel, subsection Strobus Loudon based on the combination of morphological characters obtained from the cone scales, specifically from the terminal umbo, rhombic apophysis, and cuticle structure. Associated fascicles of needle leaves with deciduous sheaths and bulbous bases are recognized as Pinus sp. and also represent Pinus subgenus Strobus. This new discovery from the Maoming Basin constitutes the first megafossil record of subgenus Strobus from southern China and implies that the members of this subgenus arrived in the southern region of China by the late Eocene. The extant species of subgenus Strobus are mainly distributed in northern temperate and tropical to subtropical mountainous regions. We propose that the Maoming Basin was adjacent to a mountainous region during the late Eocene. PMID:26548658

  18. Late Eocene white pines (Pinus subgenus Strobus) from southern China.


    Xu, Qingqing; Zhou, Wenjun; Kodrul, Tatiana M; Naugolnykh, Serge V; Jin, Jianhua


    Fossil records indicate that the genus Pinus L. split into two subgenera by the Late Cretaceous, although subgenus Strobus (D. Don) Lemmon is less well documented than subgenus Pinus L., especially in eastern Asia. In this paper, Pinus maomingensis sp. nov. is established based on a compressed seed cone from the upper Eocene of the Maoming Basin of southern China. This species is attributed to genus Pinus, subgenus Strobus, section Quinquefoliae Duhamel, subsection Strobus Loudon based on the combination of morphological characters obtained from the cone scales, specifically from the terminal umbo, rhombic apophysis, and cuticle structure. Associated fascicles of needle leaves with deciduous sheaths and bulbous bases are recognized as Pinus sp. and also represent Pinus subgenus Strobus. This new discovery from the Maoming Basin constitutes the first megafossil record of subgenus Strobus from southern China and implies that the members of this subgenus arrived in the southern region of China by the late Eocene. The extant species of subgenus Strobus are mainly distributed in northern temperate and tropical to subtropical mountainous regions. We propose that the Maoming Basin was adjacent to a mountainous region during the late Eocene.

  19. Effects of an orabase formulation with ethanolic extract of Malva sylvestris L. in oral wound healing in rats.


    Kovalik, Ana Cristina; Bisetto, Paula; Pochapski, Márcia Thaís; Campagnoli, Eduardo Baulm; Pilatti, Gibson Luiz; Santos, Fábio André


    Malva sylvestris L. is widely used in medicine for treatment of inflammatory processes. The plant has anti-inflammatory properties due to substances such as mucilage, flavonoids, and tannins. A mouthwash with leaves from the plant can be used for the treatment of wounds in the oral mucosa. The aim of this study was to assess the wound healing effect of Malva sylvestris L. on a palate mucosa wound in rats. After intraperitoneal anesthesia, a 4-mm-diameter excisional wound was made in the center of the palatal mucosa of 136 rats, using a punch-out biopsy tool. Eight animals were used as baseline wound. The remaining rats were divided into four groups: CO, control; OB, orabase vehicle; CX, 2% chlorhexidine; and MA, 20% Malva in orabase. At 24 h postoperatively, the animals were immobilized without anesthetic to apply 25 mg of each substance twice a day, totaling 50 mg daily. The wound areas were measured photographically and the reepithelialization rates were determined histologically (%) after 0, 3, 7, 15, and 21 days. The data were analyzed by ANOVA and Tukey post hoc test. Similar healing pattern was observed among the groups (P>.05; ANOVA). According to the methodology, Malva sylvestris L. extract had no effect on wound healing in the palatal mucosa of rats.

  20. Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris.


    Liu, Wei-Hui; Chen, Yan; Bai, Xue-Wei; Yao, Hui-Min; Zhang, Xu-Guang; Yan, Xiu-Wen; Lai, Ren


    The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.

  1. The mycorrhizal fungus Tricholoma matsutake stimulates Pinus densiflora seedling growth in vitro.


    Guerin-Laguette, Alexis; Shindo, Katsumi; Matsushita, Norihisa; Suzuki, Kazuo; Lapeyrie, Frédéric


    While it has been suggested that Matsutake mycorrhizae might not be functional and that Matsutake may behave as a saprobic fungus in soil or even have some pathogenic activity on seedlings, we investigated the consequences of Matsutake inoculation on Pinus densiflora growth. Seventy-five days after inoculation, hyphae were anchored on short roots and well-developed Hartig net palmettis were observed. Compared to both control treatments--seedlings treated with distilled water and seedlings treated with autoclaved mycelium--inoculation significantly stimulated seedling total dry weight by 70.9% and 98.0%, respectively. These findings attest that some type of symbiotic relationship must be functional and favour host growth, ruling out claims of pathogenicity under the sterile conditions used here.

  2. Growth response of Pinus densiflora seedlings inoculated with three indigenous ectomycorrhizal fungi in combination.


    Dalong, M; Luhe, W; Guoting, Y; Liqiang, M; Chun, L


    Pinus densiflora seedlings were inoculated with three indigenous ectomycorrhizal fungi (Cenococcum geophilum, Rhizopogon roseolus and Russula densifolia) in single-, two-, and three-species treatments. After 8 months, the colonization rates of each ectomycorrhizal species, seedling growth and the nutrition were assessed in each treatment. P. densiflora seedlings inoculated with different ECM species composition showed an increase in height and basal diameter and improved seedling root and shoot nutrition concentrations compared to control treatment. Generally, combined inoculation had a more positive influence on the seedlings than the single inoculation. The three-species inoculation presented the highest growth and basal diameter and concentration of most nutrients except potassium. In conclusion, the results provided strong evidence for benefits of combined inoculation with the indigenous ectomycorrhizal fungi on P. densiflora seedlings under controlled conditions.

  3. Nitrogen transport in the ectomycorrhiza association: the Hebeloma cylindrosporum-Pinus pinaster model.


    Müller, Tobias; Avolio, Meghan; Olivi, Martin; Benjdia, Mariam; Rikirsch, Enno; Kasaras, Alexis; Fitz, Michael; Chalot, Michel; Wipf, Daniel


    The function of the ectomycorrhizal mutualism depends on the ability of the fungal symbionts to take up nutrients (particularly nitrogen) available in inorganic and/or organic form in the soil and to translocate them (or their metabolites) to the symbiotic roots. A better understanding of the molecular mechanisms underlying nutrient exchanges between fungus and plant at the symbiotic interface is necessary to fully understand the function of the mycorrhizal symbioses. The present review reports the characterization of several genes putatively involved in nitrogen uptake and transfer in the Hebeloma cylindrosporum-Pinus pinaster ectomycorrhizal association. Study of this model system will further clarify the symbiotic nutrient exchange which plays a major role in plant nutrition as well as in resistance of plants against pathogens, heavy metals, drought stress, etc. Ultimately, ecological balance is maintained and/or improved with the help of symbiotic associations, and therefore, warrant further understanding.

  4. Effects of experimentally modified soil temperatures and nutrient availability on growth and mycorrhization of Pinus cembra at the alpine treeline

    NASA Astrophysics Data System (ADS)

    Gruber, Andreas; Peintner, Ursula; Wieser, Gerhard; Oberhuber, Walter


    Soil temperature affects litter decomposition, nutrient uptake, root growth and respiration and it is suggested that soil temperature has direct impact on tree growth at the alpine treeline. We have evaluated the impact of experimentally modified soil temperatures and nutrient availability on growth and mycorrhization of Pinus cembra at the treeline in the Central Eastern Alps (c. 2150 m a.s.l., Tyrol, Austria). Soil temperature in the rooting zone of naturally grown c. 25 year old trees (n=6 trees per treatment) was altered by shading and heat-trapping using non-transparent and glasshouse foils mounted c. 20 cm above soil surface. Additional trees were selected for a nitrogen fertilisation treatment and as controls. During the study period, mean soil temperatures at 10 cm depth were reduced by c. 3°C at the cooled vs. warmed plots. Soil moisture was not influenced due to soil water transport along the slope. Results revealed that changed soil temperatures did not significantly affect tree growth, gas exchange, needle nutrient content and specific leaf area. We also found no significant difference in degree of mycorrhization or number of mycorrhized root tips between treatments. On the other hand, nitrogen fertilization and a reduction of interspecific root competition led to significantly raised radial stem growth. Results indicate that tree growth at the selected study area was not limited by soil temperature, while interspecific competition for nutrients among trees and low stature vegetation (dwarf shrubs, grasses) had significant impact. Therefore, we suggest that root competition with alpine grassland and dwarf-shrub communities will hamper temperature driven advance of alpine treeline in the course of climate warming. Acknowledgements This work was funded by the Austrian Science Fund (FWF Project No. P22836-B16, 'Growth response of Pinus cembra to experimentally modified soil temperatures at the treeline').

  5. Polysaccharide extraction from Malva sylvestris and its anti-oxidant activity.


    Samavati, Vahid; Manoochehrizade, Amir


    The effects of extraction temperature, extraction time, the ratio of water to raw material, and number of extraction on extraction yield of crude polysaccharides from the leaves of Malva sylvestris (MSLCP) were optimized by statistical analysis using response surface methodology. The response surface methodology (RSM) was used to optimize MSLCP extraction yield by implementing the CCD design. The experimental data obtained were fitted to a second-order polynomial equation using multiple regression analysis and also analyzed by appropriate statistical methods (ANOVA). Statistical analysis of the results showed that the linear and quadratic terms of these four variables had significant effects. The optimal conditions for higher extraction yield of MSLCP were extraction temperature: 90 °C, extraction time: 4 h, number of extraction: 2 and the ratio of water to raw material: 21. Under these conditions, the experimental yield was 8.377±0.38%, which is well in close agreement with the value predicted by the model 8.608%. The results demonstrated that MSLCP had strong scavenging activities in vitro on DPPH and hydroxyl radicals. Overall, MSLCP may have potential applications in the medical and food industries.

  6. New steroidal lactones and homomonoterpenic glucoside from fruits of Malva sylvestris L.


    Mustafa, Akhlaq; Ali, Mohammed


    Phytochemical investigation of the ethanolic extract of defatted fruits of Malva sylvestris Linn. (Malvaceae) led to the isolation of six new steroidal lactones and a homomonoterpenic glucoside along with beta-sitosterol-3-beta-D-glucopyranoside. The structures of new phytoconstituents have been elucidated as cholest-5-en-3a-ol-18(21)-olide (sylvestrosterol A), cholest-9(11)-en-3alpha-ol-18(21)-olide (sylvestrosterol B), cholest-4,6,22-trien-3alpha-ol-18(21)-olide (sylvestrosterol C), 2-methyl-6-methylene-n-decan-2-olyl- 3beta-D-glucopyranoside (malvanoyl glucoside), cholest-7-en-18(21)-olide-3alpha-olyl-3beta-D-glucopyranoside (sylvestrogenin A), cholest-9(11)-en-18(21)-olide-3alpha-olyl-3beta-D-glucopyranoside (sylvestrogenin B) and cholest-5-en-8(21)-olide-3alpha-olyl-3beta-D-glucopyranoside (sylvestrogenin C).The structures of all these phytoconstituents have been established on the basis of spectral data analysis and chemical reactions.

  7. Cellulase-assisted extraction of polysaccharides from Malva sylvestris: Process optimization and potential functionalities.


    Rostami, Hosein; Gharibzahedi, Seyed Mohammad Taghi


    Enzyme-assisted extraction process of the water-soluble Malva sylvestris polysaccharides (MSPs) was optimized using response surface methodology (RSM). The highest yield (10.40%) of MSPs was achieved at 5.64% cellulase, 55.65°C temperature, 3.4h time, and 5.22 pH. Three homogeneous polysaccharide fractions (MSP-1, MSP-2, MSP-3) were purified by DEAE-cellulose and Sephadex G-100 chromatography, which were composed of galactose, glucuronic acid, arabinose, rhamnose and mannose in different molar ratios with molecular weight range of 2.6×10(5)-8.8×10(5)Da. The fractions could significantly increase antioxidant, antitumor and antimicrobial activities in a dose-dependent pattern. MSP-2 revealed stronger antioxidant activities than MSP-1 and MSP-3, including reducing power and scavenging activity of DPPH and OH radicals. The antiproliferative activity of MSP-2 (1.0mg/mL) on the growth of A549 and HepG2 cells was 45.1% and 53.2%, respectively. The Gram-positive bacteria (Bacillus cereus PTCC 1015 and Staphylococcus aureus PTCC 1112) compared with Gram-negative ones (Escherichia coli PTCC 1763 and Salmonella typhimurium PTCC 1709) showed less sensitivity against the various MSPs (3-15mg/mL).

  8. [Composition and food value of the flat pea (Lathyrus sylvestris L.)].


    Flachowsky, G; Bähr, H; Anke, M; Gruhn, K; Löhnert, H J; Wolf, I


    Flat pea (Lathyrus sylvestris L.) is suitable as 'pioneer plant' for the recultivation of slag heaps and mining areas for agricultural production. Flat pea contains between 20 and 30% crude protein in the dry matter and is richer in protein than other feed legumes. It is comparable to foxtail clover and lucerne as regards the content of amino acids (g/16 g N) and minerals. The digestibility of the crude nutrients of various dried products of flat pea was ascertained in seven experiments with five rams. The digestibility of the organic matter of the hay (before budding) was 66.2%, energy concentration 526 EFU/kg DM; 55% and 410 EFU/kg DM were ascertained for seed straw. The protein digestibility for hay and dried green fodder varied between 72.3 and 75.8%. Since there have been no reports lathyrogenous substances in the vegetative parts of flat pea, its use as green fodder or dried green fodder for feeding sheep, cattle or wild ruminants is possible.

  9. The morphology and fine structure of the giant interneurons of the wood cricket Nemobius sylvestris.


    Insausti, T C; Lazzari, C R; Casas, J


    The structural and ultrastructural characteristics of giant interneurons in the terminal abdominal ganglion of the cricket Nemobius sylvestris were investigated by means of cobalt and fluorescent dye backfilling and transmission electron microscopy. The projections of the 8 eight pairs of the biggest ascending interneurons (giant interneurons) are described in detail. The somata of all interneurons analyzed are located contralateral to their axons, which project to the posterior region of the terminal ganglion and arborise in the cercal glomerulus. Neuron 7-1a is an exception, because its arborisation is restricted to the anterior region of the ganglion. The fine structure of giant interneurons shows typical features of highly active cells. We observed striking indentations in the perineural layer, enabling the somata of the giant interneurons to be very close to the haemolymph. The cercal glomerulus exhibits a high diversity of synaptic contacts (i.e. axo-dendritic, axo-axonic, dendro-axonic, and dendro-dendritic), as well as areas of tight junctions. Electrical synapses seem to be present, as well as mixed synapses. The anatomical organization of the giant interneurons is finally discussed in terms of functional implications and on a comparative basis.

  10. [Soil carbon cycle of Pinus tabulaeformis forest in Huoditang forest region of Qinling Mountains].


    Kang, Bowen; Liu, Jianjun; Dang, Kunliang; Chen, Haibin


    With soil carbon cycle compartment model,this paper studied the carbon storage and flux of each carbon compartment of soil under Pinus tabulaeformis, a main forest type in the Huoditang forest region of Qinling Mountain. The results showed that the storage of soil organic carbon was 146.071 t x hm(-2), with 130.366 t x hm(-2) in mineral soil layer and 12.626 t x hm(-2) in litter layer. The storage was lower than the average value of forest soils in China and of oak Sharptooth forest soil in Huoditang, but higher than that of the soils under temperate coniferous forest and tropical forest. The annual carbon input into litter layer was 5.939 t x hm(-2), with 56.9% from above-ground litter and 43.1% from underground dead roots, while that into mineral soil layer via humic acid was 2. 034 t x hm(-2). The annual amount of carbon released from the respiration of P. zabulaeformis forest-soil system was 14. 012 t x hm(-2), with litter layer, mineral soil layer, dead root system, and live root system occupied 15.7%, 14.5%, 11.7% and 58.1%, respectively.

  11. Characterization of the volatile fraction emitted by phloems of four pinus species by solid-phase microextraction and gas chromatography-mass spectrometry.


    Santos, A M; Vasconcelos, T; Mateus, E; Farrall, M H; Gomes da Silva, M D R; Paiva, M R; Branco, M


    Pine forests constitute some of the most important renewable resources supplying timber, paper and chemical industries, among other functions. Characterization of the volatiles emitted by different Pinus species has proven to be an important tool to decode the process of host tree selection by herbivore insects, some of which cause serious economic damage to pines. Variations in the relative composition of the bouquet of semiochemicals are responsible for the outcome of different biological processes, such as mate finding, egg-laying site recognition and host selection. The volatiles present in phloem samples of four pine species, P. halepensis, P. sylvestris, P. pinaster and P. pinea, were identified and characterized with the aim of finding possible host-plant attractants for native pests, such as the bark beetle Tomicus piniperda. The volatile compounds emitted by phloem samples of pines were extracted by headspace solid-phase micro extraction, using a 2cm 50/30mm divinylbenzene/carboxen/polydimethylsiloxane table flex solid-phase microextraction fiber and its contents analyzed by high-resolution gas chromatography, using flame ionization and a non polar and chiral column phases. The components of the volatile fraction emitted by the phloem samples were identified by mass spectrometry using time-of-flight and quadrupole mass analyzers. The estimated relative composition was used to perform a discriminant analysis among pine species, by means of cluster and principal component analysis. It can be concluded that it is possible to discriminate pine species based on the monoterpenes emissions of phloem samples.

  12. Automated Root Tracking with "Root System Analyzer"

    NASA Astrophysics Data System (ADS)

    Schnepf, Andrea; Jin, Meina; Ockert, Charlotte; Bol, Roland; Leitner, Daniel


    Crucial factors for plant development are water and nutrient availability in soils. Thus, root architecture is a main aspect of plant productivity and needs to be accurately considered when describing root processes. Images of root architecture contain a huge amount of information, and image analysis helps to recover parameters describing certain root architectural and morphological traits. The majority of imaging systems for root systems are designed for two-dimensional images, such as RootReader2, GiA Roots, SmartRoot, EZ-Rhizo, and Growscreen, but most of them are semi-automated and involve mouse-clicks in each root by the user. "Root System Analyzer" is a new, fully automated approach for recovering root architectural parameters from two-dimensional images of root systems. Individual roots can still be corrected manually in a user interface if required. The algorithm starts with a sequence of segmented two-dimensional images showing the dynamic development of a root system. For each image, morphological operators are used for skeletonization. Based on this, a graph representation of the root system is created. A dynamic root architecture model helps to determine which edges of the graph belong to an individual root. The algorithm elongates each root at the root tip and simulates growth confined within the already existing graph representation. The increment of root elongation is calculated assuming constant growth. For each root, the algorithm finds all possible paths and elongates the root in the direction of the optimal path. In this way, each edge of the graph is assigned to one or more coherent roots. Image sequences of root systems are handled in such a way that the previous image is used as a starting point for the current image. The algorithm is implemented in a set of Matlab m-files. Output of Root System Analyzer is a data structure that includes for each root an identification number, the branching order, the time of emergence, the parent

  13. Gravitational stress on germinating Pinus pinea seeds.


    Ranaldi, Francesco; Giachetti, Eugenio; Guerin, Elizabeth; Bacci, Stefano; Paoletti, Elena; Boddi, Vieri; Vanni, Paolo


    In the germination of lipid-rich seeds, the glyoxylate cycle plays a control role in that, bypassing the two decarboxylative steps of the Krebs cycle; it allows the net synthesis of carbohydrates from lipids. The activity of isocitrate lyase, the key enzyme of the glyoxylate cycle, is an indicator of the state of seed germination: stage of germination, growth of embryo, activation and progress of protein synthesis, depletion of lipidic supplies. In order to investigate the effects of gravity on seed germination, we carried out a study on the time pattern of germination of Pinus pinea seeds that were subjected to a hypergravitational stress (1000 g for 64 h at 4 degrees C), either in a dry or in a wet environment, before to be placed in germination plates. During the whole time of germination, we monitored the state of embryo growth and the most representative enzymes of the main metabolic pathways. In treated wet seeds, we observed an average germination of only 20% with a slowdown of the enzyme activities assayed and a noticeable degradation of lipidic reserves with respect to the controls. These differences in germination are not found for dry seeds.

  14. Spatiotemporal transfer of carbon-14-labelled photosynthate from ectomycorrhizal Pinus densiflora seedlings to extraradical mycelia.


    Wu, Bingyun; Nara, Kazuhide; Hogetsu, Taizo


    Seedlings of Pinus densiflora colonized by an unidentified ectomycorrhizal fungus (T01) were labelled photosynthetically with 14C. Movement of 14C-labelled photosynthates within the underground part of the seedlings was investigated by temporal autoradiography using an imaging plate. Within 1 day, 14C was transferred from the shoot to the underground part that included roots, mycorrhizae, and the extraradical mycelium; within 3 days, the 14C in the underground part reached its maximum density. Mycorrhizae and actively growing root tips were large C sinks. Three days after 14C labelling, counts of 14C radioactivity in the underground part of the mycorrhizal seedlings were 2.6 times those of nonmycorrhizal seedlings. The mycorrhizae of mycorrhizal plants accumulated 5.2 times the 14C counts in the short-root tips of nonmycorrhizal plants. 14C counts in various areas of the extraradical mycelium demonstrated that all 14C-photosynthate transfer from the host root to the extraradical mycelium occurred within 3 days after 14C labelling, and that there was only a short lag of < 1 day between 14C accumulation in the basal and distal parts of the mycelium. Although more 14C accumulated in the distal than in the basal parts, 14C counts per unit hyphal biomass were similar between the two. These results suggest that 14C spread rapidly throughout the entire mycelium. Thirteen days after 14C labelling, we estimated 14C allocation to extraradical mycelia by taking autoradiographs after removing host roots. About 24% of 14C counts in the underground part of the mycorrhizal seedlings had been allocated to extraradical mycelia in this system, indicating that the fugal mycelium is an important sink for photosynthates.

  15. Xylem vulnerability to cavitation in Pseudotsuga menziesii and Pinus ponderosa from contrasting habitats.


    Stout, Deborah H; Sala, Anna


    In the Rocky Mountains, ponderosa pine (Pinus ponderosa (ssp.) ponderosa Dougl. ex P. Laws. & C. Laws) often co-occurs with Douglas-fir (Pseudotsuga menziesii var. glauca (Mayr) Franco). Despite previous reports showing higher shoot vulnerability to water-stress-induced cavitation in ponderosa pine, this species extends into drier habitats than Douglas-fir. We examined: (1) whether roots and shoots of ponderosa pine in riparian and slope habitats are more vulnerable to water-stress-induced cavitation than those of Douglas-fir; (2) whether species-specific differences in vulnerability translate into differences in specific conductivity in the field; and (3) whether the ability of ponderosa pine to extend into drier sites is a result of (a) greater plasticity in hydraulic properties or (b) functional or structural adjustments. Roots and shoots of ponderosa pine were significantly more vulnerable to water-stress-induced cavitation (overall mean cavitation pressure, Psi(50%) +/- SE = -3.11 +/- 0.32 MPa for shoots and -0.99 +/- 0.16 MPa for roots) than those of Douglas-fir (Psi(50%) +/- SE = -4.83 +/- 0.40 MPa for shoots and -2.12 +/- 0.35 MPa for roots). However, shoot specific conductivity did not differ between species in the field. For both species, roots were more vulnerable to cavitation than shoots. Overall, changes in vulnerability from riparian to slope habitats were small for both species. Greater declines in stomatal conductance as the summer proceeded, combined with higher allocation to sapwood and greater sapwood water storage, appeared to contribute to the ability of ponderosa pine to thrive in dry habitats despite relatively high vulnerability to water-stress-induced cavitation.

  16. Lithium induced, oxidative stress and related damages in testes and heart in male rats: The protective effects of Malva sylvestris extract.


    Saad, Anouar Ben; Rjeibi, Ilhem; Alimi, Hichem; Ncib, Sana; Smida, Amani; Zouari, Nacim; Zourgui, Lazhar


    Malva sylvestris is widely used in Mediterranean and European traditional medicine and ethnoveterinary for the treatment of various diseases. This study, carried out on male Wistar rats, evaluates the beneficial effects of Malva sylvestris extract upon lithium carbonate-induced damages in testes and heart. For this purpose, Malva sylvestris extract at a dose of 0.2g/kg was orally administrated, followed by 25mg/kg lithium carbonate (intraperitoneal injection, twice daily). Lithium carbonate treatment significantly (p<0.01) decreased the weight of testes, accessory sex organ and heart, sperm count and motility, and serum testosterone level. In addition, exposure to lithium carbonate significantly (p<0.01) increased lipid peroxidation level (LPO) and decreased superoxide dismutase (SOD), catalase (CAT), and glutathione peroxidase (GPx) activities in testes and heart. Treatment with M. sylvestris extract affords substantial protection in testes and heart by altering all the parameters to near normal levels that were further confirmed by histological examination. The beneficial effect of M. Sylvestris extract in several organs could be attributed to the interaction of antioxidant components, such as complex polysaccharides, as confirmed by phytochemical analysis.

  17. Regeneration in a mixed stand of native Pinus canariensis and introduced Pinus pinea species

    NASA Astrophysics Data System (ADS)

    Arévalo, José Ramón; Naranjo-Cigala, Agustín; Pascual, Marcos Salas


    The main objective of our study is to determine whether regeneration of Pinus pinea (an exotic species) is spreading within a Pinus canariensis (native species) stand. The study area is located in the Natural Park of Tamadaba, 1400 m asl., in the NW of Gran Canaria Island (Canary Islands). Stems and regeneration of P. canariensis and P. pinea were mapped in five randomly selected plots where both species were planted together around 45 years ago. Densities and basal areas of both species were also recorded. P. canariensis demonstrated a greater ability to disperse than P. pinea. The two species showed different spatial patterns, with P. pinea tending toward a more aggregate spatial distribution of individuals than P. canariensis. Bivariate spatial relationships showed no difference from a random spatial distribution, indicating the lack of any pattern of aggregation or rejection between the species. These results indicated that P. pinea has not spread because it is less able to disperse (strongly barochorus) than P. canariensis (barochorus and anemochorus). Given that the future ability of P. pinea to disperse cannot be predicted, eradication of this species, together with additional plantings of P. canariensis in open areas, is proposed to restore the P. canariensis stand.

  18. Morphological and physiological damage by surfactant-polluted seaspray on Pinus pinea and Pinus halepensis.


    Nicolotti, Giovanni; Rettori, Andrea; Paoletti, Elena; Gullino, Maria Lodovica


    This paper reports morphological and physiological damage caused by polluted seaspray to coastal pine forests in Liguria (Northern Italy) and suggests the most reliable parameters for surfactant-pollution biomonitoring. Concentrations of surfactants in surface seawater, seaspray, and that deposited on Pinus halepensis and Pinus pinea needles were determined in samples from five sites. Decline of the pines in the Western part of Liguria was greater than in the East, and was associated with higher surfactant levels deposited on the crowns. Chloride content of needles was higher in damaged pines, even if it did not reach toxic levels. Stomata micromorphologies did not differ between species in the crown parts facing the sea, while differences were significant in the back crown parts that were not directly exposed to polluted sea breezes. Water content and noon water potential indicated interference in water relations of damaged trees. In conclusion, none of the investigated parameters was by itself a comprehensive index of surfactant damage. A simultaneous survey of several parameters is suggested to investigate the impact of surfactants on coastal vegetation. The most useful parameters were: directionality of crown damage, surfactant depositions on the needles, chloride accumulation in the needles, structural injury to epistomatal chambers, needle water content and potential.

  19. Postfire regeneration in Pinus pinea L. and Pinus pinaster aiton in Andalucia (Spain).


    Gallegos Pérula, Virginia; Navarro Cerrillo, Rafael M; Fernández Rebolloo, Pilar; Valle Murillo, Gemadel


    The objective of this study was to examine postfire regeneration of tree, shrub, and dwarf shrub species, in relation to levels of damage in four planted pine forests (Pinus pinea, Pinus pinaster) in Andalusia. A prefire vegetation map was used for detailing species composition, vertical structure, and density and another for detailing the extent and intensity of fire damage. Between 3 and 7 years after the fires, an inventory was made of the vegetation in each area, using the step-point method. The information thus obtained was used to determine the amount of cover in the dwarf/shrub and tree layers, the frequency of species in each of the layers, floristic richness, and diversity (Shannon index). The botanical composition of the dwarf and shrub layer was analyzed using TWINSPAN. Variables were poorly correlated with level of fire damage, which suggests that the forests in this study followed the autosuccession model. Because of the artificial origin or seminatural condition, regeneration of the dominant tree species is poor, and it seems unlikely that forests will recover to their prefire state. Therefore action is recommended to restore these ecosystems.

  20. Differential impacts of the southern pine beetle, Dendroctonus frontalis, on Pinus palustris and Pinus taeda

    USGS Publications Warehouse

    Friedenberg, N.A.; Whited, B.M.; Slone, D.H.; Martinson, S.J.; Ayres, M.P.


    Patterns of host use by herbivore pests can have serious consequences for natural and managed ecosystems but are often poorly understood. Here, we provide the first quantification of large differential impacts of the southern pine beetle, Dendroctonus frontalis Zimmermann, on loblolly pine, Pinus taeda L., and longleaf pine, Pinus palustris P. Mill., and evaluate putative mechanisms for the disparity. Spatially extensive survey data from recent epidemics indicate that, per square kilometre, stands of loblolly versus longleaf pine in four forests (380-1273 km2) sustained 3-18 times more local infestations and 3-116 times more tree mortality. Differences were not attributable to size or age structure of pine stands. Using pheromone-baited traps, we found no differences in the abundance of dispersing D. frontalis or its predator Thanasimus dubius Fabricius between loblolly and longleaf stands. Trapping triggered numerous attacks on trees, but the pine species did not differ in the probability of attack initiation or in the surface area of bark attacked by growing aggregations. We found no evidence for postaggregation mechanisms of discrimination or differential success on the two hosts, suggesting that early colonizers discriminate between host species before a pheromone plume is present. ?? 2007 NRC.

  1. Pinus nigra and Pinus pinaster needles as passive samplers of polycyclic aromatic hydrocarbons.


    Piccardo, Maria Teresa; Pala, Mauro; Bonaccurso, Bruna; Stella, Anna; Redaelli, Anna; Paola, Gaudenzio; Valerio, Federico


    Nine polycyclic aromatic hydrocarbons (PAHs) were analysed in pine needles of different ages (from 6 to 30 months) collected from two species, Pinus nigra and Pinus pinaster, in seven sites located along a transect from a suburban to a rural area of Genoa (Italy). In all sites and for both species, concentrations of more volatile PAHs (phenanthrene, anthracene, fluoranthene, pyrene) were higher than those for other less volatile PAHs, which are preferentially sorbed to airborne particulates (benzo[a]anthracene, chrysene, benzofluoranthenes, benzo[a]pyrene). Concentrations of total PAHs found in P. nigra in the rural sites were, on the average, 2.3 times higher than those in P. pinaster growing nearby. In both pine species, concentrations of volatile PAHs increased according to needle age. Annual trends of other PAHs were more variable, with a general decrease in older needles. P. pinaster needles are shown to be more reliable passive samplers, since they are more resistant to plant diseases, and considerable variation in PAH concentration was observed in P. nigra needles with moulds and fungi.

  2. Effect of Soil Ameliorators on Ectomycorrhizal Fungal Communities that Colonize Seedlings of Pinus densiflora in Abandoned Coal Mine Spoils.


    Lee, Eun-Hwa; Eo, Ju-Kyeong; Lee, Chang-Seok; Eom, Ahn-Heum


    In this study, the effect of soil ameliorators on ectomycorrhizal (ECM) fungal communities in coal mine spoils was investigated. Organic fertilizers and slaked lime were applied as soil ameliorators in 3 abandoned coal mine spoils. One year after the initial treatment, roots of Pinus densiflora seedlings were collected and the number of ECM species, colonization rate, and species diversity were assessed. The results showed that the soil ameliorators significantly increased ECM colonization on the roots of P. densiflora. The results suggest that soil ameliorators can have a positive effect on ECM fungi in terms of growth of host plants and show the potential use of soil ameliorator treatment for revegetation with ECM-colonized pine seedlings in the coal mine spoils.


    EPA Science Inventory

    We conducted a 4-year study of Pinus ponderosa fine root (<2 mm) responses to atmospheric CO2 and N-fertilization. Seedlings were grown in open-top chambers at 3 CO2 levels (ambient, ambient+175 mol/mol, ambient+350 mol/mol) and 3 N-fertilization levels (0, 10, 20 g?m-2?yr-1). ...

  4. Specific features of the recent accumulation of 137Cs in tree roots of forest ecosystems within the zone of radioactive contamination

    NASA Astrophysics Data System (ADS)

    Shcheglov, Alexey; Tsvetnova, Ol'ga; Klyashtorin, Alexey; Popova, Evgenia


    Despite numerous studies of the accumulation of technogenic radionuclides in the root systems, no clear regularities of this process have been established. The tendencies found in the works of Russian and foreign researchers are rather discrepant. Some authors argue that the accumulation of radionuclides in the roots is more pronounced than that in the aboveground parts of the plants (Skovorodnikova, 2005; Romantseva, 2012; Sennerby et al., 1994; Mamikhin, 2002; Fircks et al., 2002}. Other works attest to a higher accumulation of radionuclides in the aboveground pars (Juznic et al., 1990; Chibowski, 2000; Zhianski et al., 2005), which is also typical of the stable isotopes of these elements, including 133Cs (Dong Jin Kang, YongJin Seo, Tsukasa Saito et al,2012). It is also stated that the accumulation of radionuclides in the aboveground and underground parts of plants may differ in dependence on the soil-ecological conditions and other factors (Kozhakhanov et al., 2011; Grabovskyi et al., 2013). The aim of our study was to evaluate the accumulation of 137Cs in the root systems of arboreal plants in forest ecosystems within the near zone of the Chernobyl fallout on the plots with similar soil and phytocenotic features. Pine and birch stands were studied within the 30-km-wide exclusion zone of the Chernobyl Nuclear Power Station in Ukraine in 1992-1993, when the density of the radioactive contamination of the upper (0-20 cm) layer with 137Cs reached 2153.8 kBq/m2), and in Bryansk oblast of Russia in 2013-2014, when the density of contamination varied from 1458.4 kBq/m2 (pine stand) to 2578.3 kBq/m2 (birch stand). The tree layer in these ecosystems was dominated by Pinus sylvestris (L.) and Betula pendula (Roth.), respectively. Quercus robur (L.), Picea abies (L.), and Sorbus aucuparia (L.) were also present. The specific activity of 137Cs was measured in the samples from the aboveground parts of model trees and their roots differentiated by size (0-3, 3-10, 10

  5. Elevated CO2 and O3 effects on fine-root survivorship in ponderosa pine mesocosms.


    Phillips, Donald L; Johnson, Mark G; Tingey, David T; Storm, Marjorie J


    Atmospheric carbon dioxide (CO(2)) and ozone (O(3)) concentrations are rising, which may have opposing effects on tree C balance and allocation to fine roots. More information is needed on interactive CO(2) and O(3) effects on roots, particularly fine-root life span, a critical demographic parameter and determinant of soil C and N pools and cycling rates. We conducted a study in which ponderosa pine (Pinus ponderosa) seedlings were exposed to two levels of CO(2) and O(3) in sun-lit controlled-environment mesocosms for 3 years. Minirhizotrons were used to monitor individual fine roots in three soil horizons every 28 days. Proportional hazards regression was used to analyze effects of CO(2), O(3), diameter, depth, and season of root initiation on fine-root survivorship. More fine roots were produced in the elevated CO(2) treatment than in ambient CO(2). Elevated CO(2), increasing root diameter, and increasing root depth all significantly increased fine-root survivorship and median life span. Life span was slightly, but not significantly, lower in elevated O(3), and increased O(3) did not reduce the effect of elevated CO(2). Median life spans varied from 140 to 448 days depending on the season of root initiation. These results indicate the potential for elevated CO(2) to increase the number of fine roots and their residence time in the soil, which is also affected by root diameter, root depth, and phenology.

  6. [Lactate as competitive inhibitor of Pinus pinea isocitrate lyase].


    Ranaldi, F; Iacoviello, C; Vanni, P


    We studied the effect of L-lactate on both the cleavage and the condensation reactions of Pinus pinea isocitrate lyase. This compound is a competitive of Pinus pinea isocitrate lyase towards both isocitrate and glyoxylate, whereas is a mixed type inhibitor towards succinate. Assuming that L-lactate acts as a glyoxylate analogue, our finding agrees with an uni-bi ordered mechanism of isocitrate lyase, with glyoxylate first substrate to enter the active site in the condensation reaction. Results are discussed and compared with those known in the literature about other structurally related metabolites.

  7. [Storage proteins from seeds of Pinus pinea L].


    Nasri, Nizar; Triki, Saïda


    The Mediterranean stone pine Pinus pinea L. (gymnosperm, Pinaceae) is much appreciated for its seed production, widely used in food preparation in the Mediterranean Basin. Seeds contain 25% proteins on a dry-weight basis. Pinus pinea accumulate globulins as major storage proteins in seeds (75% of total storage proteins), composed of several subunits of 10 to 150 kDa, revealed by SDS-PAGE. The albumin fraction (15%) represents three subunits of 14, 24 and 46 kDa. Glutelins, the least soluble fraction, represents a small proportion (10%). Their constitutive units have frequent PM of 43 kDa. Prolamins also represent a very small percentage (1 to 2%).

  8. Organ-specific metabolic responses to drought in Pinus pinaster Ait.


    de Miguel, Marina; Guevara, M Ángeles; Sánchez-Gómez, David; de María, Nuria; Díaz, Luis Manuel; Mancha, Jose A; Fernández de Simón, Brígida; Cadahía, Estrella; Desai, Nalini; Aranda, Ismael; Cervera, María-Teresa


    Drought is an important driver of plant survival, growth, and distribution. Water deficit affects different pathways of metabolism, depending on plant organ. While previous studies have mainly focused on the metabolic drought response of a single organ, analysis of metabolic differences between organs is essential to achieve an integrated understanding of the whole plant response. In this work, untargeted metabolic profiling was used to examine the response of roots, stems, adult and juvenile needles from Pinus pinaster Ait. full-sib individuals, subjected to a moderate and long lasting drought period. Cyclitols content showed a significant alteration, in response to drought in all organs examined, but other metabolites increased or decreased differentially depending on the analyzed organ. While a high number of flavonoids were only detected in aerial organs, an induction of the glutathione pathway was mainly detected in roots. This result may reflect different antioxidant mechanisms activated in aerial organs and roots. Metabolic changes were more remarkable in roots than in the other organs, highlighting its prominent role in the response to water stress. Significant changes in flavonoids and ascorbate metabolism were also observed between adult and juvenile needles, consistent with previously proven differential functional responses between the two developmental stages. Genetic polymorphisms in candidate genes coding for a Myb1 transcription factor and a malate dehydrogenase (EC were associated with different concentration of phenylalanine, phenylpropanoids and malate, respectively. The results obtained will support further research on metabolites and genes potentially involved in functional mechanisms related to drought tolerance in trees.

  9. Effects of Open-field Warming and Precipitation Manipulation on the Growth of Pinus densiflora Seedlings

    NASA Astrophysics Data System (ADS)

    Park, M. J.; Yoon, S. J.; Han, S. H.; Yun, H. M.; Chang, H.; Son, Y.


    The objective of this study was to investigate the effects of open-field artificial warming and precipitation manipulation on Pinus densiflora seedling growth. The temperature in warming plots have been set to be 3°C higher than control plots using infrared lamps since April, 2013. Precipitation manipulation consisted of precipitation decrease plots (-30%) with deployment of rain-capturing transparent panels, precipitation increase plots (+30%) with pump installation and drip-irrigation, and control plots. Two-year-old P. densiflora seedlings were planted in April, 2013. Seedling height and root collar diameter were measured in April and November, 2013 and April, 2014, and biomass were measured in April, 2013 and April, 2014. During the period of April to November, 2013, increments of seedling height and root collar diameter were not significantly different between control and warming plots. However, in April, 2014 seedling heights, new shoot lengths and weights were higher in warming plots than in control plots, with all precipitation manipulation treatments (p<0.05). Shoot to root ratio was lower in warming plots than in control plots with the precipitation decrease treatment (p<0.05). The seedling height growth observed in 2013 and 2014 might be explained by the previous year's fixed growth of P. densiflora. Lower shoot to root ratio in warming plots with precipitation decrease treatment might be resulted from water stress. In previous studies about artificial warming and/or precipitation manipulation, the effects were increase, decrease or no difference in growth. As these results suggest, responses of growth are species-specific and/or are dependent on the stage of growth and the treatment types of climate change experiments. Therefore, to examine the effects of climate changes on plant growth, multi-factor and long-term studies on diverse species are needed.

  10. Differences in hydraulic architecture between mesic and xeric Pinus pinaster populations at the seedling stage.


    Corcuera, Leyre; Gil-Pelegrín, Eustaquio; Notivol, Eduardo


    We studied the intraspecific variability of maritime pine in a set of morphological and physiological traits: soil-to-leaf hydraulic conductance, intrinsic water-use efficiency (WUE, estimated by carbon isotope composition, δ(13)C), root morphology, xylem anatomy, growth and carbon allocation patterns. The data were collected from Pinus pinaster Aiton seedlings (25 half-sib families from five populations) grown in a greenhouse and subjected to water and water-stress treatments. The aims were to relate this variability to differences in water availability at the geographic location of the populations, and to study the potential trade-offs among traits. The drought-stressed seedlings demonstrated a decrease in hydraulic conductance and root surface area and increased WUE and root tip number. The relationships among the growth, morphological, anatomical and physiological traits changed with the scale of study: within the species, among/within populations. The populations showed a highly significant relationship between the percentage reduction in whole-plant hydraulic conductance and WUE. The differences among the populations in root morphology, whole-plant conductance, carbon allocation, plant growth and WUE were significant and consistent with dryness of the site of seed origin. The xeric populations exhibited lower growth and a conservative water use, as opposed to the fast-growing, less water-use-efficient populations from mesic habitats. The xeric and mesic populations, Tamrabta and San Cipriano, respectively, showed the most contrasting traits and were clustered in opposite directions along the main axis in the canonical discriminant analysis under both the control and drought treatments. The results suggest the possibility of selecting the Arenas population, which presents a combination of traits that confer increased growth and drought resistance.

  11. Carbon allocation belowground in Pinus pinaster using stable carbon isotope pulse labeling technique

    NASA Astrophysics Data System (ADS)

    Dannoura, M.; Bosc, A.; Chipeaux, C.; Sartore, M.; Lambrot, C.; Trichet, P.; Bakker, M.; Loustau, D.; Epron, D.


    Carbon allocation belowground competes with aboveground growth and biomass production. In the other hand, it contributes to resource acquisition such as nutrient, water and carbon sequestration in soil. Thus, a better characterization of carbon flow from plant to soil and its residence time within each compartment is an important issue for understanding and modeling forest ecosystem carbon budget. 13C pulse labeling of whole crown was conducted at 4 seasons to study the fate of assimilated carbon by photosynthesis into the root on 12 year old Pinus pinaster planted in the INRA domain of Pierroton. Maritime pine is the most widely planted species in South-West Europe. Stem, root and soil CO2 effluxes and their isotope composition were measured continuously by tunable diode laser absorption spectroscopy with a trace gas analyzer (TGA 100A; Campbell Scientific) coupled to flow-through chambers. 13CO2 recovery and peak were observed in respiration of each compartment after labeling. It appeared sequentially from top of stem to bottom, and to coarse root. The maximum velocity of carbon transfer was calculated as the difference in time lag of recovery between two positions on the trunk or on the root. It ranged between 0.08-0.2 m h-1 in stem and between 0.04-0.12 m h-1 in coarse root. This velocity was higher in warmer season, and the difference between time lag of recovery and peak increased after first frost. Photosynthates arrived underground 1.5 to 5 days after labeling, at similar time in soil CO2 effluxes and coarse root respiration. 0.08-1.4 g of carbon was respired per tree during first 20 days following labeling. It presented 0.6 -10% of 13C used for labeling and it is strongly related to seasons. The isotope signal was detected in fine root organs and microbial biomass by periodical core sampling. The peak was observed 6 days after labeling in early summer while it was delayed more than 10 days in autumn and winter with less amount of carbon allocated

  12. In vitro mycorrhization and acclimatization of Amanita caesareoides and its relatives on Pinus densiflora.


    Endo, Naoki; Gisusi, Seiki; Fukuda, Masaki; Yamada, Akiyoshi


    Amanita caesareoides is a sister species of Amanita caesarea, also known as Caesar's mushroom and one of the most desirable edible mycorrhizal mushrooms. However, cultivation of Caesar's mushrooms has not yet been successful due to the difficulties involved in establishing pure cultures. In this study, we established pure cultures of four Asian Caesar's mushroom species, i.e., A. caesareoides, Amanita javanica, Amanita esculenta, and Amanita similis, which were identified by sequence analysis of their rDNA internal transcribed spacer (ITS) region. Five selected isolates in A. caesareoides, A. javanica, and A. esculenta were tested for ectomycorrhizal syntheses with axenic Pinus densiflora seedlings in vitro. Ectomycorrhizal tips of each fungal isolate tested were observed on pine lateral roots within 5 months of inoculation. Seventeen pine seedlings that formed ectomycorrhizas in vitro with these three Amanita species were acclimatized under non-sterile conditions. Seven months following acclimatization, ectomycorrhizal colonization by A. caesareoides was observed on newly grown root tips, which was confirmed by polymerase chain reaction restriction fragment length polymorphism analysis of the fungal rDNA ITS region. Two other Amanita species also survived during ectomycorrhizal acclimatization. These results suggest that the cultivation of A. caesareoides and its relatives can be attempted through mycorrhizal synthesis using P. densiflora as a host. This is the first report of in vitro mycorrhization of Asian Caesar's mushrooms and their acclimatization under non-sterile conditions.

  13. Compensation processes of Aleppo pine (Pinus halepensis Mill.) to ozone exposure and drought stress.


    Inclán, R; Gimeno, B S; Dizengremel, P; Sanchez, M


    A long-term experiment was performed to study the effects of O3 and drought-stress (DS) on Aleppo pine seedlings (Pinus halepensis Mill.) exposed in open-top chambers. Ozone reduced gas exchange rates, ribulose-1,5-biphosphate carboxylase/oxygenase activity (Rubisco), aboveground C and needle N concentrations and C/N ratio and Ca concentrations of the twigs under 3 mm (twigs<3) and the aerial biomass. Also it increased phosphoenolpyruvate carboxylase (PEPc) and N and K concentrations of the twigs<3. Water stress decreased gas exchange rates, predawn needle water potential (PsiPd), C/N ratio, twigs<3 Ca, plant growth, aerial biomass and increased N, twigs with a diameter above 3 mm P and Mg concentrations. The combined exposure to both stresses increased N concentrations of twigs<3 and roots and aboveground biomass K content and decreased root C, maximum daily assimilation rate and instantaneous water use efficiency. The sensitivity of Aleppo pine to both stresses is determined by plant internal resource allocation and compensation mechanisms to cope with stress.

  14. Elevated CO2 and ozone reduce nitrogen acquisition by Pinus halepensis from its mycorrhizal symbiont.


    Kytöviita, Minna-Maarit; Le Thiec, Didier; Dizengremel, Pierre


    The effects of 700 µmol mol-1 CO2 and 200 nmol mol-1 ozone on photosynthesis in Pinus halepensis seedlings and on N translocation from its mycorrhizal symbiont, Paxillus involutus, were studied under nutrient-poor conditions. After 79 days of exposure, ozone reduced and elevated CO2 increased net assimilation rate. However, the effect was dependent on daily accumulated exposure. No statistically significant differences in total plant mass accumulation were observed, although ozone-treated plants tended to be smaller. Changes in atmospheric gas concentrations induced changes in allocation of resources: under elevated ozone, shoots showed high priority over roots and had significantly elevated N concentrations. As a result of different shoot N concentration and net carbon assimilation rates, photosynthetic N use efficiency was significantly increased under elevated CO2 and decreased under ozone. The differences in photosynthesis were mirrored in the growth of the fungus in symbiosis with the pine seedlings. However, exposure to CO2 and ozone both reduced the symbiosis-mediated N uptake. The results suggest an increased carbon cost of symbiosis-mediated N uptake under elevated CO2, while under ozone, plant N acquisition is preferentially shifted towards increased root uptake.

  15. A new C-methylated flavonoid glycoside from Pinus densiflora.


    Jung, M J; Choi, J H; Chung, H Y; Jung, J H; Choi, J S


    A new C-methyl flavonol glycoside, 5,7,8,4'-tetrahydroxy-3-methoxy-6-methylflavone 8-O-beta-D-glucopyranoside (1), has been isolated from the needles of Pinus densiflora, together with kaempferol 3-O-beta-(6"-acetyl)-galactopyranoside.

  16. Isolation and characterization of Korean pine (Pinus koraiensis)convicilin

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A vicilin-like globulin seed storage protein, termed convicilin, was isolated for the first time from Korean pine (Pinus koraiensis) by a combination of anion exchange, hydrophobic interaction, and gel filtration chromatography. The protein is less abundant than vicilin in low-salt extracts of matur...

  17. Rainfall interception and partitioning by pinus monophylla and juniperus osteosperma

    Technology Transfer Automated Retrieval System (TEKTRAN)

    This study investigated canopy interception of simulated rainfall by singleleaf piñon (Pinus monophylla) and Utah juniper (Juniperus osteosperma) in central Nevada. Research has shown that although piñon and juniper occurred historically throughout the western United States, the infilling of woodlan...

  18. Chloroplast DNA Diversity among Trees, Populations and Species in the California Closed-Cone Pines (Pinus Radiata, Pinus Muricata and Pinus Attenuata)

    PubMed Central

    Hong, Y. P.; Hipkins, V. D.; Strauss, S. H.


    The amount, distribution and mutational nature of chloroplast DNA polymorphisms were studied via analysis of restriction fragment length polymorphisms in three closely related species of conifers, the California closed-cone pines-knobcone pine: Pinus attenuata Lemm.; bishop pine: Pinus muricata D. Don; and Monterey pine: Pinus radiata D. Don. Genomic DNA from 384 trees representing 19 populations were digested with 9-20 restriction enzymes and probed with cloned cpDNA fragments from Douglas-fir [Pseudotsuga menziesii (Mirb.) Franco] that comprise 82% of the chloroplast genome. Up to 313 restriction sites were surveyed, and 25 of these were observed to be polymorphic among or within species. Differences among species accounted for the majority of genetic (haplotypic) diversity observed [G(st) = 84(+/-13)%]; nucleotide diversity among species was estimated to be 0.3(+/-0.1)%. Knobcone pine and Monterey pine displayed almost no genetic variation within or among populations. Bishop pine also showed little variability within populations, but did display strong population differences [G(st) = 87(+/-8)%] that were a result of three distinct geographic groups. Mean nucleotide diversity within populations was 0.003(+/-0.002)%; intrapopulation polymorphisms were found in only five populations. This pattern of genetic variation contrasts strongly with findings from study of nuclear genes (allozymes) in the group, where most genetic diversity resides within populations rather than among populations or species. Regions of the genome subject to frequent length mutations were identified; estimates of subdivision based on length variant frequencies in one region differed strikingly from those based on site mutations or allozymes. Two trees were identified with a major chloroplast DNA inversion that closely resembled one documented between Pinus and Pseudotsuga. PMID:7905846

  19. The gymnosperm Pinus pinea contains both AOX gene subfamilies, AOX1 and AOX2.


    Frederico, António Miguel; Zavattieri, Maria Amely; Campos, Maria Doroteia; Cardoso, Hélia Guerra; McDonald, Allison E; Arnholdt-Schmitt, Birgit


    The gymnosperm Pinus pinea L. (stone pine) is a typical Mediterranean pine used for nuts and timber production, and as an ornamental around the world. Pine genomes are large in comparison to other species. The hypothesis that retrotransposons, such as gymny, made a large contribution to this alteration in genome size was recently confirmed. However, P. pinea is unique in other various aspects. P. pinea demonstrates a different pattern of gymny organization than other Pinus subgenera. Additionally, P. pinea has a highly recalcitrant behaviour in relation to standard conifer protocols for the induction of somatic embryogenesis or rooting. Because such types of cell reprogramming can be explained as a reaction of plant cells to external stress, it is of special interest to study sequence peculiarities in stress-inducible genes, such as the alternative oxidase (AOX). This is the first report containing molecular evidence for the existence of AOX in gymnosperms at the genetic level. P. pinea AOXs were isolated by a polymerase chain reaction (PCR) approach and three genes were identified. Two of the genes belong to the AOX1 subfamily and one belongs to the AOX2 subfamily. The existence of both AOX subfamilies in gymnosperms is reported here for the first time. This discovery supports the hypothesis that AOX1 and AOX2 subfamilies arose prior to the separation of gymnosperms and angiosperms, and indicates that the AOX2 is absent in monocots because of subsequent gene loss events. Polymorphic P. pinea AOX1 sequences from a selected genetic clone are presented indicating non-allelic, non-synonymous and synonymous translation products.

  20. Fine root branch orders respond differentially to carbon source-sink manipulations in a longleaf pine forest.


    Guo, Dali L; Mitchell, Robert J; Hendricks, Joseph J


    Fine roots are a key component of carbon (C) flow and nitrogen (N) cycling in forest ecosystems. However, the complexity and heterogeneity of the fine root branching system have hampered the assessment and prediction of C and N dynamics at ecosystem scales. We examined how root morphology, biomass, and chemistry differed with root branch orders (1-5 with root tips classified as first order roots) and how different root orders responded to increased C sink strength (via N fertilization) and reduced carbon source strength (via canopy scorching) in a longleaf pine (Pinus palustris L.) ecosystem. With increasing root order, the diameter and length of individual roots increased, whereas the specific root length decreased. Total root biomass on an areal basis was similar among the first four orders but increased for the fifth order roots. Consequently, total root length and total root surface area decreased systematically with increasing root order. Fine root N and lignin concentrations decreased, while total non-structural carbohydrate (TNC) and cellulose concentrations increased with increasing root order. N addition and canopy disturbance did not alter root morphology, but they did influence root chemistry. N fertilization increased fine root N concentration and content per unit area in all five orders, while canopy scorching decreased root N concentration. Moreover, TNC concentration and content in fifth order roots were also reduced by canopy scorching. Our results indicate that the small, fragile, and more easily overlooked first and second order roots may be disproportionately important in ecosystem scale C and N fluxes due to their large proportions of fine root biomass, high N concentrations, relatively short lifespans, and potentially high decomposition rates.

  1. Leaves, flowers, immature fruits and leafy flowered stems of Malva sylvestris: a comparative study of the nutraceutical potential and composition.


    Barros, Lillian; Carvalho, Ana Maria; Ferreira, Isabel C F R


    Malva sylvestris is widely used in Mediterranean and European traditional medicine and ethnoveterinary for the treatment of external and internal inflammation, as well as injuries. Moreover, its use is not only limited to therapeutic purposes; but also the species is locally regarded as a food wild herb. Considering that antioxidants and free radical scavengers can exert also an anti-inflammatory effect, the extracts of different parts of the medicinal/edible plant M. sylvestris (leaves, flowers, immature fruits and leafy flowered stems) were compared for their nutraceutical potential (antioxidant properties) and chemical composition. Particularly, mallow leaves revealed very strong antioxidant properties including radical-scavenging activity (EC(50)=0.43 mg/mL), reducing power (0.07 mg/mL) and lipid peroxidation inhibition in lipossomes (0.04 mg/mL) and brain cells homogenates (0.09 mg/mL). This part of the plant is also the richest in nutraceuticals such as powerful antioxidants (phenols, flavonoids, carotenoids, and tocopherols), unsaturated fatty acids (e.g. alpha-linolenic acid), and minerals measured in ash content.

  2. Postglacial recolonization history of the European crabapple (Malus sylvestris Mill.), a wild contributor to the domesticated apple.


    Cornille, A; Giraud, T; Bellard, C; Tellier, A; Le Cam, B; Smulders, M J M; Kleinschmit, J; Roldan-Ruiz, I; Gladieux, P


    Understanding the way in which the climatic oscillations of the Quaternary Period have shaped the distribution and genetic structure of extant tree species provides insight into the processes driving species diversification, distribution and survival. Deciphering the genetic consequences of past climatic change is also critical for the conservation and sustainable management of forest and tree genetic resources, a timely endeavour as the Earth heads into a period of fast climate change. We used a combination of genetic data and ecological niche models to investigate the historical patterns of biogeographic range expansion of a wild fruit tree, the European crabapple (Malus sylvestris), a wild contributor to the domesticated apple. Both climatic predictions for the last glacial maximum and analyses of microsatellite variation indicated that M. sylvestris experienced range contraction and fragmentation. Bayesian clustering analyses revealed a clear pattern of genetic structure, with one genetic cluster spanning a large area in Western Europe and two other genetic clusters with a more limited distribution range in Eastern Europe, one around the Carpathian Mountains and the other restricted to the Balkan Peninsula. Approximate Bayesian computation appeared to be a powerful technique for inferring the history of these clusters, supporting a scenario of simultaneous differentiation of three separate glacial refugia. Admixture between these three populations was found in their suture zones. A weak isolation by distance pattern was detected within each population, indicating a high extent of historical gene flow for the European crabapple.

  3. Genetic diversity, structure and differentiation within and between cultivated (Vitis vinifera L. ssp. sativa) and wild (Vitis vinifera L. ssp. sylvestris) grapes

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Genetic characterization of 502 diverse grape accessions including 342 cultivated (V. vinifera ssp. sativa) and 160 wild (V. vinifera ssp. sylvestris) grapes showed considerable genetic diversity among accessions. A total of 117 alleles were detected with the average of 14 alleles per locus. The tot...

  4. Nitrogen addition shifts the microbial community in the rhizosphere of Pinus tabuliformis in Northwestern China

    PubMed Central

    Lv, Fenglian; Xue, Sha; Wang, Guoliang; Zhang, Chao


    Atmospheric nitrogen (N) deposition profoundly alters the soil microbial communities and will thus affect nutrient cycles. The effects of N availability on microbial community, however, are not clear. We used PLFA analysis to evaluate the effects of a gradient of N addition (0, 2.8, 5.6, 11.2, and 22.4 g N m-2 y-1) for three years on the rhizospheric microbial community of Pinus tabuliformis seedlings. The main factors influencing the community were quantified using structural equation modelling and redundancy analysis. At the microbial-community level, N addition increased the total phospholipid fatty acids content by increasing the dissolved organic carbon (DOC) and root biomass. Increases in soil microbial biomass carbon and N, however, was attributed to the increased DOC, N content and decreased pH. At the microbial-groups level, Fungal, arbuscular mycorrhizal fungal (AMF), gram-positive bacterial (GP) abundances and the GP:GN ratio first increased and then decreased with N addition. Nitrogen addition increased the abundances of bacteria, fungi, and actinomycetes mainly by increasing the DOC content and decreasing root biomass. Additionally, the decrease of pH and ammonium N caused by N addition increased the fungal abundances and reduced actinomycete abundances, respectively. Nitrogen addition shifted the rhizospheric microbial community mainly by altering the DOC content and root biomass. The current rate of N deposition (2.5 g N m-2 y-1) benefits plant growth and increases the abundances of fungi, arbuscular mycorrhizal fungi, GP, actinomycetes and the GP:GN ratio. PMID:28234932

  5. Linking carbon and water limitations to drought-induced mortality of Pinus flexilis seedlings

    USGS Publications Warehouse

    Reinhardt, Keith; Germino, Matthew J.; Kueppers, Lara M.; Domec, Jean-Christophe; Mitton, Jeffry


    Survival of tree seedlings at high elevations has been shown to be limited by thermal constraints on carbon balance, but it is unknown if carbon relations also limit seedling survival at lower elevations, where water relations may be more important. We measured and modeled carbon fluxes and water relations in first-year Pinus flexilis seedlings in garden plots just beyond the warm edge of their natural range, and compared these with dry-mass gain and survival across two summers. We hypothesized that mortality in these seedlings would be associated with declines in water relations, more so than with carbon-balance limitations. Rather than gradual declines in survivorship across growing seasons, we observed sharp, large-scale mortality episodes that occurred once volumetric soil-moisture content dropped below 10%. By this point, seedling water potentials had decreased below −5 MPa, seedling hydraulic conductivity had decreased by 90% and seedling hydraulic resistance had increased by >900%. Additionally, non-structural carbohydrates accumulated in aboveground tissues at the end of both summers, suggesting impairments in phloem-transport from needles to roots. This resulted in low carbohydrate concentrations in roots, which likely impaired root growth and water uptake at the time of critically low soil moisture. While photosynthesis and respiration on a leaf area basis remained high until critical hydraulic thresholds were exceeded, modeled seedling gross primary productivity declined steadily throughout the summers. At the time of mortality, modeled productivity was insufficient to support seedling biomass-gain rates, metabolism and secondary costs. Thus the large-scale mortality events that we observed near the end of each summer were most directly linked with acute, episodic declines in plant hydraulic function that were linked with important changes in whole-seedling carbon relations.

  6. Defoliation negatively affects plant growth and the ectomycorrhizal community of Pinus pinaster in Spain.


    Pestaña, Montserrat; Santolamazza-Carbone, Serena


    In this work, by artificially reproducing severe (75%) and moderate (25%) defoliation on maritime pines Pinus pinaster in NW Spain, we investigated, under natural conditions, the consequences of foliage loss on reproduction, abundance, diversity and richness of the fungal symbionts growing belowground and aboveground. The effect of defoliation on tree growth was also assessed. Mature needles were clipped during April 2007 and 2008. Root samples were collected in June-July 2007 and 2008. Collection of sporocarps was performed weekly from April 2007 to April 2009. Taxonomic identity of ectomycorrhizal fungi was assessed by using the internal transcribed spacer (ITS) regions of rDNA through the polymerase chain reaction (PCR) method, subsequent direct sequencing and BLAST search. Ectomycorrhizal colonization was significantly reduced (from 54 to 42%) in 2008 by 75% defoliation, accompanied with a decline in species richness and diversity. On the other hand, sporocarp abundance, richness and diversity were not affected by foliage loss. Some ECM fungal symbionts, which are assumed to have a higher carbon cost according to the morphotypes structure, were reduced due to severe (75%) defoliation. Furthermore, 75% foliage loss consistently depressed tree growth, which in turn affected the ectomycorrhizal growth pattern. Defoliation impact on ECM symbionts largely depends on the percentage of foliage removal and on the number of defoliation bouts. Severe defoliation (75%) in the short term (2 years) changed the composition of the ECM community likely because root biomass would be adjusted to lower levels in parallel with the depletion of the aboveground plant biomass, which probably promoted the competition among mycorrhizal types for host resources. The persistence of fungal biomass in mycorrhizal roots would be crucial for nutrient up-take and recovery from defoliation stress of the host plants.

  7. Linking carbon and water relations to drought-induced mortality in Pinus flexilis seedlings.


    Reinhardt, Keith; Germino, Matthew J; Kueppers, Lara M; Domec, Jean-Christophe; Mitton, Jeffry


    Survival of tree seedlings at high elevations has been shown to be limited by thermal constraints on carbon balance, but it is unknown if carbon relations also limit seedling survival at lower elevations, where water relations may be more important. We measured and modeled carbon fluxes and water relations in first-year Pinus flexilis seedlings in garden plots just beyond the warm edge of their natural range, and compared these with dry-mass gain and survival across two summers. We hypothesized that mortality in these seedlings would be associated with declines in water relations, more so than with carbon-balance limitations. Rather than gradual declines in survivorship across growing seasons, we observed sharp, large-scale mortality episodes that occurred once volumetric soil-moisture content dropped below 10%. By this point, seedling water potentials had decreased below -5 MPa, seedling hydraulic conductivity had decreased by 90% and seedling hydraulic resistance had increased by >900%. Additionally, non-structural carbohydrates accumulated in aboveground tissues at the end of both summers, suggesting impairments in phloem-transport from needles to roots. This resulted in low carbohydrate concentrations in roots, which likely impaired root growth and water uptake at the time of critically low soil moisture. While photosynthesis and respiration on a leaf area basis remained high until critical hydraulic thresholds were exceeded, modeled seedling gross primary productivity declined steadily throughout the summers. At the time of mortality, modeled productivity was insufficient to support seedling biomass-gain rates, metabolism and secondary costs. Thus the large-scale mortality events that we observed near the end of each summer were most directly linked with acute, episodic declines in plant hydraulic function that were linked with important changes in whole-seedling carbon relations.

  8. Terpene chemodiversity of relict conifers Picea omorika, Pinus heldreichii, and Pinus peuce, endemic to Balkan.


    Nikolić, Biljana; Ristić, Mihailo; Tešević, Vele; Marin, Petar D; Bojović, Srdjan


    Terpenes are often used as ecological and chemotaxonomic markers of plant species, as well as for estimation of geographic variability. Essential oils of relic and Balkan endemic/subendemic conifers, Picea omorika, Pinus heldreichii, and P. peuce, in central part of Balkan Peninsula (Serbia and Montenegro), on the level of terpene classes and common terpene compounds were investigated. In finding terpene combinations, which could show the best diversity between species and their natural populations, several statistical methods were applied. Apart from the content of different terpene classes (P. omorika has the most abundant O-containing monoterpenes and sesquiterpenes; P. heldreichii and P. peuce have the largest abundance of sesquiterpene and monoterpene hydrocarbons, resp.), the species are clearly separated according to terpene profile with 22 common compounds. But, divergences in their populations were established only in combination of several compounds (specific for each species), and they were found to be the results of geomorphologic, climatic, and genetic factors. We found similarities between investigated species and some taxa from literature with respect to terpene composition, possibly due to hybridization and phylogenetic relations. Obtained results are also important regarding to chemotaxonomy, biogeography, phylogeny, and evolution of these taxa.

  9. Two differentially regulated phosphate transporters from the symbiotic fungus Hebeloma cylindrosporum and phosphorus acquisition by ectomycorrhizal Pinus pinaster.


    Tatry, Marie-Violaine; El Kassis, Elie; Lambilliotte, Raphaël; Corratgé, Claire; van Aarle, Ingrid; Amenc, Laurie K; Alary, Rémi; Zimmermann, Sabine; Sentenac, Hervé; Plassard, Claude


    Ectomycorrhizal symbiosis markedly improves plant phosphate uptake, but the molecular mechanisms underlying this benefit are still poorly understood. We identified two ESTs in a cDNA library prepared from the ectomycorrhizal basidiomycete Hebeloma cylindrosporum with significant similarities to phosphate transporters from the endomycorrhizal fungus Glomus versiforme and from non-mycorrhizal fungi. The full-length cDNAs corresponding to these two ESTs complemented a yeast phosphate transport mutant (Deltapho84). Measurements of (33)P-phosphate influx into yeast expressing either cDNA demonstrated that the encoded proteins, named HcPT1 and HcPT2, were able to mediate Pi:H(+) symport with different affinities for Pi (K(m) values of 55 and 4 mum, respectively). Real-time RT-PCR showed that Pi starvation increased the levels of HcPT1 transcripts in H. cylindrosporum hyphae grown in pure culture. Transcript levels of HcPT2 were less dependent on Pi availability. The two transporters were expressed in H. cylindrosporum associated with its natural host plant, Pinus pinaster, grown under low or high P conditions. The presence of ectomycorrhizae increased net Pi uptake rates into intact Pinus pinaster roots at low or high soil P levels. The expression patterns of HcPT1 and HcPT2 indicate that the two fungal phosphate transporters may be involved in uptake of phosphate from the soil solution under the two soil P availability conditions used.

  10. Genetic transformation and gene expression in white pine (pinus strobus)

    SciTech Connect

    Minocha, R.


    The objectives of the study were: (1) to develop protocols for transformation of white pine (Pinus strobus) embryonic tissue; and (2) to analyze the regulation of foreign gene expression in Pinus strobus. A number of Agrobacterium tumefaciens strains containing chimeric genes for neomycin phosphotransferase (NPTII for kanamycin resistance) and chloramphenicol acetyl transferase (CAT) under the control of either a constitutive promoter (NOS-nopaline synthase) or light-inducible promoters (RuBisCO small subunit and chlorophyll a/b binding protein) were used. A variety of tissues from white pine seedlings and mature trees was used. The techniques for transformation were modified from those used for tobacco transformation. The results show that white pine tissue from young seedlings is high suitable for transformation by A. tumefaciens. Whereas the normal tissues are very sensitive to kanamycin, transformed callus was quite resistant to this antibiotic.

  11. Determination of major and minor elements in the Malva sylvestris L. from Turkey using ICP-OES techniques.


    Hiçsönmez, U; Ereeş, F S; Ozdemir, C; Ozdemir, A; Cam, S


    In this work, Malva sylvestris var. mauritiana (L.) leaves were collected from different points in Muradiye region of Manisa-Turkey. The leaves were dissolved by wet digestion method using a mixture of mineral acid. Concentrations of Ag, Al, B, Ba, Bi, Ca, Cd, Co, Cr, Cu, Fe, K, La, Mg, Mn, Na, Ni, Pb, Sn, Sr, Sb, Si, Ti, U, Zn, and Zr in prepared solutions were determined by using inductively coupled plasma optical emission spectrometry (ICP-OES). High Ca (13,848 mg/kg) and Mg (1,936 mg/kg) concentrations were found at the leaves. Obtained values were compared with the internationally permitted (standard) values. The results of elements were analyzed statistically (analysis of variance test). For different leaf sizes, concentration factors were calculated.

  12. Uptake of trifluoroacetate by Pinus ponderosa via atmospheric pathway

    NASA Astrophysics Data System (ADS)

    Benesch, J. A.; Gustin, M. S.

    Trifluoroacetate (TFA, CF 3COO -), a break down product of hydro(chloro)-fluorocarbons (HFC/HCFCs), has been suggested to contribute to forest decline syndrome. To investigate the possible effects, Pinus ponderosa was exposed to TFA applied as mist (150 and 10,000 ng l -1) to foliar surfaces. Needles accumulated TFA as a function of concentration and time. However, no adverse physiological responses, as plant morphology, photosynthetic and conductance rates, were observed at the TFA concentrations used in this study.

  13. Fumonisin production by Gibberella fujikuroi strains from Pinus species.


    Mirete, S; Patiño, B; Vázquez, C; Jiménez, M; Hinojo, M J; Soldevilla, C; González-Jaén, M T


    Fumonisins are important mycotoxins basically produced by strains from the Gibberella fujikuroi species complex (with anamorphs in Fusarium genus) which contaminate food and feed products representing a risk to human and animal health. In this work, we report for the first time the fumonisin production of Fusarium moniliforme Sheldon strains associated to edible pine nuts of Pinus pinea. P. pinea is an important and widely distributed Pinus species in the Mediterranean area where their pine nuts are consumed raw or slightly processed in diverse food products. In this work, characterization and further identification of those strains were performed by polymerase chain reaction-restriction fragment length polymorphisms (PCR-RFLPs) of the intergenic spacer region of the rDNA (IGS) with the aid of the eight mating populations (A-H) described for G. fujikuroi species complex. The method was powerful to detect polymorphism, allowing discrimination between individuals and could be used to study the genetic relationships among them and within the G. fujikuroi species complex. Fusarium strains associated to Pinus radiata were also included in the present study. These strains did not produce fumonisins and showed no close relation with the strains isolated from P. pinea. The approach used in this work was rapid and proved to be efficient to assist identification and to characterize and analyse relatedness of new isolates within the G. fujikuroi species complex.

  14. Glacial Refugium of Pinus pumila (Pall.) Regel in Northeastern Siberia

    SciTech Connect

    Shilo, N A; Lozhkin, A V; Anderson, P M; Brown, T A; Pakhomov, A Y; Solomatkina, T B


    One of the most glowing representatives of the Kolyma flora [1], ''Pinus pumila'' (Pall.) Regel (Japanese stone pine), is a typical shrub in larch forests of the northern Okhotsk region, basins of the Kolyma and Indigirka rivers, and high-shrub tundra of the Chukchi Peninsula. It also forms a pine belt in mountains above the forest boundary, which gives way to the grass-underbrush mountain tundra and bald mountains. In the southern Chukchi Peninsula, ''Pinus pumila'' along with ''Duschekia fruticosa'' (Rupr.) Pouzar and ''Betula middendorffii'' Trautv. et C. A. Mey form trailing forests transitional between tundra and taiga [2]. Pinus pumila pollen, usually predominating in subfossil spore-and-pollen spectra of northeastern Siberia, is found as single grains or a subordinate component (up 2-3%, rarely 10%) in spectra of lacustrine deposits formed during the last glacial stage (isotope stage 2) in the Preboreal and Boreal times of the Holocene. Sometimes, its content increases to 15-22% in spectra of lacustrine deposits synchronous to the last glacial stage near the northern coast of the Sea of Okhotsk [3], evidently indicating the proximity of Japanese stone pine thickets.

  15. Mineral Analysis of Pine Nuts (Pinus spp.) Grown in New Zealand.


    Vanhanen, Leo P; Savage, Geoffrey P


    Mineral analysis of seven Pinus species grown in different regions of New Zealand; Armand pine (Pinus armandii Franch), Swiss stone pine (Pinus cembra L.), Mexican pinyon (Pinus cembroides Zucc. var. bicolor Little), Coulter pine (Pinus coulteri D. Don), Johann's pine (Pinus johannis M.F. Robert), Italian stone pine (Pinus pinea L.) and Torrey pine (Pinus torreyana Parry ex Carrière), was carried out using an inductively coupled plasma optical emission spectrophotometer (ICP-OES) analysis. Fourteen different minerals (Al, B, Ca, Cr, Cu, Fe, K, Mg, Mn, Na, Ni, P, S and Zn) were identified in all seven varieties, except that no Al or Na was found in Pinus coulteri D. Don. New Zealand grown pine nuts are a good source of Cu, Mg, Mn, P and Zn, meeting or exceeding the recommended RDI for these minerals (based on an intake of 50 g nuts/day) while they supplied between 39%-89% of the New Zealand RDI for Fe. Compared to other commonly eaten tree-nuts New Zealand grown pine nuts are an excellent source of essential minerals.

  16. Ectomycorrhizal diversity associated with Cedrus deodara and Pinus wallichiana in the Kashmir Himalaya, India.


    Itoo, Zahoor Ahmad; Reshi, Zafar A


    The present study was undertaken to document the ectomycorrhizal diversity associated with the Cedrus deodara and Pinus wallichiana in the Kashmir Himalaya, India. The extensive field surveys carried out in the Kashmir Himalaya at five study sites resulted in the collection and identification of 76 potential ectomycorrhizal fungal species associated with the Cedrus deodara and Pinus wallichiana. Maximum 32 number of species were found associated with Pinus wallichiana, 19 with Cedrus deodara and 25 species were found growing in association with both the conifers. The present study reveals that Cedrus deodara and Pinus wallichiana in the Kashmir Himalaya, India harbour diverse ectomycorrhizal fungal species.

  17. Chemical composition, antimicrobial, insecticidal, phytotoxic and antioxidant activities of Mediterranean Pinus brutia and Pinus pinea resin essential oils.


    Ulukanli, Zeynep; Karabörklü, Salih; Bozok, Fuat; Ates, Burhan; Erdogan, Selim; Cenet, Menderes; Karaaslan, Merve Göksin


    Essential oils of the resins of Pinus brutia and Pinus pinea were evaluated for their biological potential. Essential oils were characterized using GC-MS and GC/FID. in vitro antimicrobial, phytotoxic, antioxidant, and insecticidal activities were carried out using the direct contact and the fumigant assays, respectively. The chemical profile of the essential oils of the resins of P. pinea and P. brutia included mainly α-pinene (21.39% and 25.40%), β-pinene (9.68% and 9.69%), and caryophyllene (9.12% and 4.81%). The essential oils of P. pinea and P. brutia exerted notable antimicrobial activities on Micrococcus luteus and Bacillus subtilis, insecticidal activities on Ephestia kuehniella eggs, phytotoxic activities on Lactuca sativa, Lepidium sativum, and Portulaca oleracea, as well as antioxidant potential. Indications of the biological activities of the essential oils suggest their use in the formulation of ecofriendly and biocompatible pharmaceuticals.

  18. Spatial patterns of ectomycorrhizal fungal inoculum in arbuscular mycorrhizal barrens communities: implications for controlling invasion by Pinus virginiana.


    Thiet, Rachel K; Boerner, R E J


    Invasion of globally threatened ecosystems dominated by arbuscular mycorrhizal plants, such as the alkaline prairies and serpentine barrens of eastern North America, by species of ectomycorrhizal (ECM) pine (Pinus) seriously threatens the persistence, conservation, and ongoing restoration of these rare plant communities. Using Maryland serpentine barrens and an Ohio alkaline prairie complex as model systems, we tested the hypothesis that the invasiveness of Virginia pine (Pinus virginiana L.) into such communities is regulated by the spatial pattern of ECM fungal inoculum in the soil. ECM colonization of pine seedlings can occur by (1) hyphae growing from the roots of mature ECM pines colonizing nearby seedlings (contagion model), (2) pine seedlings being infected after germinating in open areas where spores are concentrated in feces of animals that have consumed sporocarps (centers of infection model), and (3) colonization from spores that are wind-dispersed across the landscape (background model). To test these models of dispersal of ECM fungal inoculum into these barrens, we used autocorrelation and spatially explicit mapping techniques (semivariance analysis and kriging) to characterize the distribution and abundance of ECM inoculum in soil. Our results strongly suggest that ECM fungi most often disperse into open barrens by contagion, thereby facilitating rapid pine colonization in an advancing front from mature pine forests bordering the barrens. Spatial patterns consistent with the centers of infection model were present but less common. Thus, current management techniques that rely on cutting and fire to reverse pine invasion may be ineffective because they do not kill or disrupt hyphal mats attached to mature roots of neighboring pines. Management alternatives are discussed.

  19. A 2-component system is involved in the early stages of the Pisolithus tinctorius-Pinus greggii symbiosis.


    Herrera-Martínez, Aseneth; Ruiz-Medrano, Roberto; Galván-Gordillo, Santiago Valentín; Toscano Morales, Roberto; Gómez-Silva, Lidia; Valdés, María; Hinojosa-Moya, Jesús; Xoconostle-Cázares, Beatriz


    Ectomycorrhizal symbiosis results in profound morphological and physiological modifications in both plant and fungus. This in turn is the product of differential gene expression in both co-symbionts, giving rise to specialized cell types capable of performing novel functions. During the precolonization stage, chemical signals from root exudates are sensed by the ectomycorrizal fungus, and vice versa, which are in principle responsible for the observed change in the developmental symbionts program. Little is known about the molecular mechanisms involved in the signaling and recognition between ectomycorrhizal fungi and their host plants. In the present work, we characterized a novel lactone, termed pinelactone, and identified a gene encoding for a histidine kinase in Pisolithus tictorius, which function is proposed to be the perception of the aforementioned metabolites. In this study, the use of closantel, a specific inhibitor of histidine kinase phosphorylation, affected the capacity for fungal colonization in the symbiosis between Pisolithus tinctorius and Pinus greggii, indicating that a 2-component system (TCS) may operate in the early events of plant-fungus interaction. Indeed, the metabolites induced the accumulation of Pisolithus tinctorius mRNA for a putative histidine kinase (termed Pthik1). Of note, Pthik1 was able to partially complement a S. cerevisiae histidine kinase mutant, demonstrating its role in the response to the presence of the aforementioned metabolites. Our results indicate a role of a 2-component pathway in the early stages of ectomycorrhizal symbiosis before colonization. Furthermore, a novel lactone from Pinus greggii root exudates may activate a signal transduction pathway that contributes to the establishment of the ectomycorrhizal symbiosis.

  20. Characterization of the volatile fraction emitted by Pinus spp. by one- and two-dimensional chromatographic techniques with mass spectrometric detection.


    Mateus, E; Barata, R C; Zrostlíková, Jitka; Gomes da Silva, M D R; Paiva, M R


    The chemical composition of the needles of P. pinea, P. pinaster, P. halepensis, P. nigra, P. brutia, P. patula, P. radiata, P. taeda, P. elliotti, P. kesiya, P. sylvestris and P. eldarica was investigated. Headspace solid-phase microextraction and steam distillation extraction were used to collect the volatile fractions. Samples were analyzed using one-dimensional gas chromatography (1D-GC) and comprehensive two-dimensional gas chromatography (GCxGC) associated with a quadrupole and a time-of-flight mass detectors. Results showed that the analytical capabilities of 1D-GC are partially limited by the separation power of the columns. The higher sensibility and the absence of peak skewing of the time-of-flight mass analyzer, with the use of automated peak finding and deconvolution algorithms, allowed for the detection of trace components with qualitative full spectra and the extraction of true mass spectra from coeluting compounds, promoting their reliable identification and thus significantly improving results obtained by 1D-GC/MS, when using a quadrupole mass analyzer. The use of GC x GC resulted in enhanced separation efficiency and increased signal to noise ratio (sensitivity) of the analytes, maximizing mass spectra quality and improving compound detection and identification. This work shows the use of 1D-GC/ToFMS for the analysis of pine needles volatiles, achieving the detection of 177 compounds, that is more than twice the number previously identified by standard 1D-GC/MS. The analysis by GC x GC for the same sample allowed the detection of 212 compounds. The enantioselective GC x GC analysis performed for all the Pinus spp. under study achieved the detection of 422 different compounds. Cross-over phenomena according to operational conditions are highlighted and discussed.

  1. Fertilization with urea, ammonium and nitrate produce different effects on growth, hydraulic traits and drought tolerance in Pinus taeda seedlings.


    Faustino, Laura I; Moretti, Ana P; Graciano, Corina


    Urea fertilization decreases Pinus taeda L. growth in clay soils of subtropical areas. The negative effect of urea is related to changes in some hydraulic traits, similar to those observed in plants growing under drought. The aims of this work were (i) to determine whether different sources of nitrogen applied as fertilizers produce similar changes in growth and hydraulic traits to those observed by urea fertilization and (ii) to analyze the impact of those changes in plant drought tolerance. Plants fertilized with urea, nitrate [Formula: see text] or ammonium [Formula: see text] were grown well watered or with reduced water supply. Urea and [Formula: see text] fertilization reduced plant growth and increased root hydraulic conductance scaled by root dry weight (DW). [Formula: see text] fertilization did not reduce plant growth and increased shoot hydraulic conductance and stem hydraulic conductivity. We conclude that [Formula: see text] is the ion involved in the changes linked to the negative effect of urea fertilization on P. taeda growth. [Formula: see text] fertilization does not change drought susceptibility and it produces changes in shoot hydraulic traits, therefore plants avoid the depressive effect of fertilization. Urea and [Formula: see text] fertilizers induce changes in DW and root hydraulic conductance and consequently plants are less affected by drought.

  2. Tissue chemistry and carbon allocation in seedlings of Pinus palustris subjected to elevated atmospheric CO(2) and water stress.


    Runion, G. B.; Entry, J. A.; Prior, S. A.; Mitchell, R. J.; Rogers, H. H.


    Longleaf pine (Pinus palustris Mill.) seedlings were grown in 45-l pots and exposed to ambient or elevated (365 or 730 &mgr;mol CO(2) mol(-1)) CO(2) concentration in open-top chambers for 20 months. Two water-stress treatments (target values of -0.5 or -1.5 MPa xylem pressure potential) were imposed 19 weeks after initiation of the study. At harvest, tissues (needles, stems, taproots, coarse roots, and fine roots) were analyzed for carbon (C), nitrogen (N), nonpolar extractives (fats, waxes, and oils), nonstructural carbohydrates (sugars and starch), structural components (cellulose and lignin), and tannins. The greatest dry weights and lowest N concentrations occurred in tissues of plants grown at elevated CO(2) or with adequate water. Although allocation of C fractions among tissues was generally unaffected by treatments, concentrations of the analyzed compounds were influenced by treatments in needles and taproots, but not in stems and lateral roots. Needles and taproots of plants exposed to elevated CO(2) had increased concentrations of nonstructural carbohydrates. Among plant tissues, elevated CO(2) caused reductions in structural C concentrations and foliar concentrations of fats, waxes and oils.

  3. A Consensus Genetic Map for Pinus taeda and Pinus elliottii and Extent of Linkage Disequilibrium in Two Genotype-Phenotype Discovery Populations of Pinus taeda.


    Westbrook, Jared W; Chhatre, Vikram E; Wu, Le-Shin; Chamala, Srikar; Neves, Leandro Gomide; Muñoz, Patricio; Martínez-García, Pedro J; Neale, David B; Kirst, Matias; Mockaitis, Keithanne; Nelson, C Dana; Peter, Gary F; Davis, John M; Echt, Craig S


    A consensus genetic map for Pinus taeda (loblolly pine) and Pinus elliottii (slash pine) was constructed by merging three previously published P. taeda maps with a map from a pseudo-backcross between P. elliottii and P. taeda. The consensus map positioned 3856 markers via genotyping of 1251 individuals from four pedigrees. It is the densest linkage map for a conifer to date. Average marker spacing was 0.6 cM and total map length was 2305 cM. Functional predictions of mapped genes were improved by aligning expressed sequence tags used for marker discovery to full-length P. taeda transcripts. Alignments to the P. taeda genome mapped 3305 scaffold sequences onto 12 linkage groups. The consensus genetic map was used to compare the genome-wide linkage disequilibrium in a population of distantly related P. taeda individuals (ADEPT2) used for association genetic studies and a multiple-family pedigree used for genomic selection (CCLONES). The prevalence and extent of LD was greater in CCLONES as compared to ADEPT2; however, extended LD with LGs or between LGs was rare in both populations. The average squared correlations, r(2), between SNP alleles less than 1 cM apart were less than 0.05 in both populations and r(2) did not decay substantially with genetic distance. The consensus map and analysis of linkage disequilibrium establish a foundation for comparative association mapping and genomic selection in P. taeda and P. elliottii.

  4. Screening for putative PGPR to improve establishment of the symbiosis Lactarius deliciosus-Pinus sp.


    Barriuso, J; Pereyra, M T; Lucas García, J A; Megías, M; Gutierrez Mañero, F J; Ramos, B


    A screening for plant growth promoting rhizobacteria (PGPR) was carried out in the mycorrhizosphere of wild populations of Pinus pinea and P. pinaster, and in the mycosphere of associated Lactarius deliciosus. A total of 720 bacteria were isolated, purified, and grouped by morphological criteria. Fifty percent of the isolates were selected and tested for aminocyclopropanecarboxylic acid (ACC) degradation, auxin and siderophore production, and phosphate solubilization. Thirty eight percent of the isolates showed at least one of the evaluated activities. Nutrient-related traits were associated with P. pinaster, whereas hormone production traits predominated in P. pinea. These activities were found mostly in Gram positive isolates. After PCR-RAPDs (random amplified polymorphic DNA) analysis, 10 groups appeared with 85% similiarity when considering all isolates, indicating the low diversity in the system. One strain of each group was identified by 16S rDNA sequencing. Our results suggest that P. pinaster selects for mycorrhizosphere bacteria that mobilize nutrients, whereas P. pinea selects for bacteria that have the capacity to increase root growth via production of plant growth regulators.

  5. [Nutrient transfer and growth of Pinus greggii Engelm. inoculated with edible ectomycorrhizal mushrooms in two substrates].


    Rentería-Chávez, María C; Pérez-Moreno, Jesús; Cetina-Alcalá, Víctor M; Ferrera-Cerrato, Ronald; Xoconostle-Cázares, Beatriz

    An ectomycorrhiza is a mutualistic symbiosis of paramount importance in forestry and tree production. One of the selection criteria of ectomycorrhizal fungi that has currently gained importance is their edibility due to the economic, ecological and cultural relevance of edible ectomycorrhizal mushrooms as a non-timber forest product. The effect of the inoculation with three edible ectomycorrhizal mushrooms: Laccaria laccata, Laccaria bicolor y Hebeloma leucosarx, which are widely sold in Mexico, on the growth and nutrient contents of Pinus greggii grown in an experimental substrate and a commercial substrate enriched with a slow-release fertilizer, was evaluated. Two years after sowing, differences in terms of shoot and root biomass and macro and micronutrient contents between inoculated and non-inoculated plants, were recorded independently of the fungal species and the substrate. Despite the fact that plants grown in the commercial substrate had higher growth and nutrient contents, their ectomycorrhizal colonization percentages were smaller than those of the plants grown in the experimental substrate. The differences in the nutrient transfer to the inoculated plant shoots among the evaluated fungal species were recorded. Ca mobilization by L. laccata, Na by L. bicolor and Mn by H. leucosarx were observed in the plants growing in the experimental substrate. It has been demonstrated that the selection of substrates constitutes an important factor in the production of ectomycorrhizal plants and that the three evaluated species of edible ectomycorrhizal mushrooms have an enormous potential in the controlled mycorrhization of P. greggii.

  6. Modeling the response of mature Pinus ponderosa Laws. to tropospheric ozone: Effects of genotypic variability

    SciTech Connect

    Constable, J.V.H.; Taylor, G.E. Jr. ); Weinstein, D.A.; Laurence, J.A. )


    Regionally distributed pollutants (e.g., tropospheric ozone and CO[sub 2]) can influence the growth of terrestrial plants. The mosaic of genotypes in natural populations makes it difficult to predict the ecological consequences of pollutants throughout a species' distribution. We simulated the response of Pinus ponderosa Laws to ambient, sub-ambient and above-ambient troposopheric O[sub 3] for 3 years using TREGRO, a physiologically based three growth model. Parameters controlling growth and carbon allocation were obtained from the literature and were varied to simulate intravarietal and intervarietal genotypes (western var. Ponderosa and eastern var. Scopulorum) of Ponderosa Pine. Parameter differences between the varieties include physiology, carbon allocation and phenoloy. Ozone altered 3 year biomass gain (+6% to 61%) and fine root to leaf mass ratio ([minus]8% to [minus]14%) in spite of a small effect on photosynthesis ([<=] 10%). Overall, O[sub 3] caused growth differences between varieties to be reduced. The reduction in growth differences between genotypes due to ozone has consequences for regional identification of populations sensitive to the effects of tropospheric ozone.

  7. Intraspecific variation in the use of water sources by the circum-Mediterranean conifer Pinus halepensis.


    Voltas, Jordi; Lucabaugh, Devon; Chambel, Maria Regina; Ferrio, Juan Pedro


    The relevance of interspecific variation in the use of plant water sources has been recognized in drought-prone environments. By contrast, the characterization of intraspecific differences in water uptake patterns remains elusive, although preferential access to particular soil layers may be an important adaptive response for species along aridity gradients. Stable water isotopes were analysed in soil and xylem samples of 56 populations of the drought-avoidant conifer Pinus halepensis grown in a common garden test. We found that most populations reverted to deep soil layers as the main plant water source during seasonal summer droughts. More specifically, we detected a clear geographical differentiation among populations in water uptake patterns even under relatively mild drought conditions (early autumn), with populations originating from more arid regions taking up more water from deep soil layers. However, the preferential access to deep soil water was largely independent of aboveground growth. Our findings highlight the high plasticity and adaptive relevance of the differential access to soil water pools among Aleppo pine populations. The observed ecotypic patterns point to the adaptive relevance of resource investment in deep roots as a strategy towards securing a source of water in dry environments for P. halepensis.

  8. Ostryopsis davidiana seedlings inoculated with ectomycorrhizal fungi facilitate formation of mycorrhizae on Pinus tabulaeformis seedlings.


    Bai, Shu-Lan; Li, Guo-Lei; Liu, Yong; Kasten Dumroese, R; Lv, Rui-Heng


    Reforestation in China is important for reversing anthropogenic activities that degrade the environment. Pinus tabulaeformis is desired for these activities, but survival and growth of seedlings can be hampered by lack of ectomycorrhizae. When outplanted in association with Ostryopsis davidiana plants on reforestation sites, P. tabulaeformis seedlings become mycorrhizal and survival and growth are enhanced; without O. davidiana, pines often remain without mycorrhizae and performance is poorer. To better understand this relationship, we initiated an experiment using rhizoboxes that restricted root and tested the hypothesis that O. davidiana seedlings facilitated ectomycorrhizae formation on P. tabulaeformis seedlings through hyphal contact. We found that without O. davidiana seedlings, inocula of five indigenous ectomycorrhizal fungi were unable to grow and associate with P. tabulaeformis seedlings. Inocula placed alongside O. davidiana seedlings, however, resulted in enhanced growth and nutritional status of O. davidiana and P. tabulaeformis seedlings, and also altered rhizosphere pH and phosphatase activity. We speculate that these species form a common mycorrhizal network and this association enhances outplanting performance of P. tabulaeformis seedlings used for forest restoration.

  9. The effect of ectomycorrhizal fungi forming symbiosis with Pinus pinaster seedlings exposed to cadmium.


    Sousa, Nadine R; Ramos, Miguel A; Marques, Ana P G C; Castro, Paula M L


    Cadmium is one of the most toxic heavy metals and its accumulation in the upper layers of forest soils affects plants, microorganisms and their interactions. Adequate strategies for the reforestation of metal contaminated sites are of vital importance. The aim of this work was to evaluate the response of Pinus pinaster seedlings to Cd exposure and to assess the effect of inoculation with two selected ectomycorrhizal fungi, Suillus bovinus and Rhizopogon roseolus on that response. Seedlings were exposed to soil contaminated at 15 and 30 mg Cd kg(-1). Shoot biomass of P. pinaster decreased ca. 36% when exposed to 15 mg Cd kg(-1). Overall, colonization by S. bovinus significantly enhanced shoot development up to 30% in contaminated soil while colonization by R. roseolus produced no significant effect at both Cd concentrations tested and significantly increased the level of Cd in the shoots at both Cd concentrations. Metal accumulation in the shoots and roots of non-inoculated and S. bovinus-inoculated seedlings increased at the higher Cd levels whereas R. roseolus-inoculated seedlings were not sensitive to Cd variation in the soil. The results from our research show that inoculation with ECM fungi has a significant impact on metal uptake and development of P. pinaster seedlings; the differential response induced by the two tested species highlights the importance of selecting the appropriate strains for nursery inoculation, and, as such, this biological tool ought to be considered in reforestation processes of heavy metal contaminated areas by woody species.

  10. Physiological aspects underlying the improved outplanting performance of Pinus pinaster Ait. seedlings associated with ectomycorrhizal inoculation.


    Sanchez-Zabala, Joseba; Majada, Juan; Martín-Rodrigues, Noemí; Gonzalez-Murua, Carmen; Ortega, Unai; Alonso-Graña, Manuel; Arana, Orats; Duñabeitia, Miren K


    Mycorrhizal inoculation of conifer roots is a key strategy to optimize establishment and performance of forest tree species under both natural and cultivated conditions and also to mitigate transplantation shock. However, despite being a common practice, inoculation in outdoor nursery conditions has been poorly studied. Here, we have evaluated effectiveness of four fungal species (Lactarius deliciosus, Lactarius quieticolor, Pisolithus arhizus, and Suillus luteus) in the production of mycorrhizal Pinus pinaster seedlings in an outdoor commercial nursery and their ability to improve seedling physiology and field performance. All inoculated seedlings showed a significant increase in growth at the end of the nursery stage and these differences remained after 3 years of growth in the field. Differences observed in the content of malondialdehyde, total chlorophyll, carotenoids, anthocyanins, and phenolic compounds from needles of mycorrhizal and control seedlings may reflect a different sensitivity to photo-oxidative damage. We conclude that ectomycorrhizal inoculation improves adaptability to changeable growing conditions of an outdoor nursery and produces a higher quality nursery stock, thereby enhancing seedling performance after planting.

  11. Adjustments in hydraulic architecture of Pinus palustris maintain similar stomatal conductance in xeric and mesic habitats.


    Addington, R N; Donovan, L A; Mitchell, R J; Vose, J M; Pecot, S D; Jack, S B; Hacke, U G; Sperry, J S; Oren, R


    We investigated relationships between whole-tree hydraulic architecture and stomatal conductance in Pinus palustris Mill. (longleaf pine) across habitats that differed in soil properties and habitat structure. Trees occupying a xeric habitat (characterized by sandy, well-drained soils, higher nitrogen availability and lower overstory tree density) were shorter in stature and had lower sapwood-to-leaf area ratio (A(S):A(L)) than trees in a mesic habitat. The soil-leaf water potential gradient (psiS - psiL) and leaf-specific hydraulic conductance (kL) were similar between sites, as was tissue-specific hydraulic conductivity (Ks) of roots. Leaf and canopy stomatal conductance (gs and Gs, respectively) were also similar between sites, and they tended to be somewhat higher at the xeric site during morning hours when vapour pressure deficit (D) was low. A hydraulic model incorporating tree height, A(S):A(L) and psiS-psiL accurately described the observed variation in individual tree G(Sref) (G(S) at D = 1 kPa) across sites and indicated that tree height was an important determinant of G(Sref) across sites. This, combined with a 42% higher root-to-leaf area ratio (A(R):A(L)) at the xeric site, suggests that xeric site trees are hydraulically well equipped to realize equal--and sometimes higher potential for conductance compared with trees on mesic sites. However, a slightly more sensitive stomatal closure response to increasing D observed in xeric site trees suggests that this potential for higher conductance may only be reached when D is low and when the capacity of the hydraulic system to supply water to foliage is not greatly challenged.

  12. Photosynthetic performance of invasive Pinus ponderosa and Juniperus virginiana seedlings under gradual soil water depletion.


    Bihmidine, S; Bryan, N M; Payne, K R; Parde, M R; Okalebo, J A; Cooperstein, S E; Awada, T


    Changes in climate, land management and fire regime have contributed to woody species expansion into grasslands and savannas worldwide. In the USA, Pinus ponderosa P.&C. Lawson and Juniperus virginiana L. are expanding into semiarid grasslands of Nebraska and other regions of the Great Plains. We examined P. ponderosa and J. virginiana seedling response to soil water content, one of the most important limiting factors in semiarid grasslands, to provide insight into their success in the region. Photosynthesis, stomatal conductance, maximum photochemical efficiency of PSII, maximum carboxylation velocity, maximum rate of electron transport, stomatal limitation to photosynthesis, water potential, root-to-shoot ratio, and needle nitrogen content were followed under gradual soil water depletion for 40 days. J. virginiana maintained lower L(s), higher A, g(s), and initial F(v)/F(m), and displayed a more gradual decline in V(cmax) and J(max) with increasing water deficit compared to P. ponderosa. J. virginiana also invested more in roots relative to shoots compared to P. ponderosa. F(v)/F(m) showed high PSII resistance to dehydration in both species. Photoinhibition was observed at approximately 30% of field capacity. Soil water content was a better predictor of A and g(s) than Psi, indicating that there are other growth factors controlling physiological processes under increased water stress. The two species followed different strategies to succeed in semiarid grasslands. P. ponderosa seedlings behaved like a drought-avoidant species with strong stomatal control, while J. virginiana was more of a drought-tolerant species, maintaining physiological activity at lower soil water content. Differences between the studied species and the ecological implications are discussed.

  13. Chemopreventive activity of compounds extracted from Casearia sylvestris (Salicaceae) Sw against DNA damage induced by particulate matter emitted by sugarcane burning near Araraquara, Brazil

    SciTech Connect

    Prieto, A.M.; Santos, A.G.; Csipak, A.R.; Caliri, C.M.; Silva, I.C.; Arbex, M.A.; Silva, F.S.; Marchi, M.R.R.


    Ethanolic extract of Casearia sylvestris is thought to be antimutagenic. In this study, we attempted to determine whether this extract and casearin X (a clerodane diterpene from C. sylvestris) are protective against the harmful effects of airborne pollutants from sugarcane burning. To that end, we used the Tradescantia micronucleus test in meiotic pollen cells of Tradescantia pallida, the micronucleus test in mouse bone marrow cells, and the comet assay in mouse blood cells. The mutagenic compound was total suspended particulate (TSP) from air. For the Tradescantia micronucleus test, T. pallida cuttings were treated with the extract at 0.13, 0.25, or 0.50 mg/ml. Subsequently, TSP was added at 0.3 mg/ml, and tetrads from the inflorescences were examined for micronuclei. For the micronucleus test in mouse bone marrow cells and the comet assay in mouse blood cells, Balb/c mice were treated for 15 days with the extract—3.9, 7.5, or 15.0 mg/kg body weight (BW)—or with casearin X—0.3, 0.25, or 1.2 mg/kg BW—after which they received TSP (3.75 mg/kg BW). In T. pallida and mouse bone marrow cells, the extract was antimutagenic at all concentrations tested. In mouse blood cells, the extract was antigenotoxic at all concentrations, whereas casearin X was not antimutagenic but was antigenotoxic at all concentrations. We conclude that C. sylvestris ethanolic extract and casearin X protect DNA from damage induced by airborne pollutants from sugarcane burning. -- Highlights: ► We assessed DNA protection of C. sylvestris ethanolic extract. ► We assessed DNA protection of casearin X. ► We used Tradescantia pallida micronucleus test as screening. ► We used comet assay and micronucleus test in mice. ► The compounds protected DNA against sugar cane burning pollutants.

  14. One-step synthesis of polydispersed silver nanocrystals using Malva sylvestris: an eco-friendly mosquito larvicide with negligible impact on non-target aquatic organisms.


    Govindarajan, Marimuthu; Hoti, S L; Rajeswary, Mohan; Benelli, Giovanni


    The synthesis of eco-friendly nanoparticles is evergreen branch of nanoscience with a growing number of biomedical implications. In this study, we investigated the synthesis of polydisperse and stable silver nanoparticles (AgNP) using a cheap leaf extract of Malva sylvestris (Malvaceae). Bio-reduced AgNP were characterized by UV-visible spectrophotometry, Fourier transform infrared spectroscopy (FTIR), X-ray diffraction analysis (XRD), atomic force microscopy (AFM), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The acute toxicity of M. sylvestris leaf extract and green-synthesized AgNP was evaluated against larvae of the malaria vector Anopheles stephensi, the dengue vector Aedes aegypti and the filariasis vector Culex quinquefasciatus. Compared to the leaf aqueous extract, AgNP showed higher toxicity against A. stephensi, A. aegypti, and C. quinquefasciatus with LC50 values of 10.33, 11.23, and 12.19 μg/mL, respectively. Green-synthesized AgNP were found safer to non-target organisms Diplonychus indicus and Gambusia affinis, with respective LC50 values ranging from 813.16 to 1044.52 μg/mL. Overall, this research firstly shed light on the mosquitocidal potential of M. sylvestris, a potential bio-resource for rapid, cheap and effective synthesis of polydisperse and highly stable silver nanocrystals.

  15. [Effects of simulated nitrogen deposition on growth and phosphorus efficiency of Pinus massoniana under low phosphorus stress].


    Pang, Li; Zhang, Yi; Zhou, Zhi-Chun; Feng, Zhong-Ping; Chu, De-Yu


    Atmospheric nitrogen (N) deposition dramatically raised in recent decades, resulting in increases of soil N availability and N/P ratio, which would impact plant growth and P efficiency under low P stress. Taking breeding population of Pinus massoniana as test materials, a pot experiment was conducted to simulate two P conditions, i. e., homogeneous low P availability vs. heterogeneous low P among soil layers, in combination with two N deposition levels on growth traits and P absorption and utilization efficiency of P. massoniana. Under the homogeneous low phosphorus condition, growth traits and P efficiency of P. massoniana were not significantly improved by simulated nitrogen deposition, but significant nitrogen x family interaction effect was detected, with the biomass of family 40x44 and 71x20 being increased, 36x29 and 73x23 being decreased. Under the heterogeneous low P condition, significant N effects on the seedling height, biomass and P absorption efficiency were observed, due to promoted root length and root distribution ratio of topsoil. In addition, the effects of simulated N deposition on growth and P efficiency of P. massoniana were relevant to the N/P ratio. Under the homogeneous low P condition, the N/P ratio of P. massoniana plant was 13.8, plants exhibited a low sensitivity to simulated N deposition, root secreted APase activity was increased but the plant growth was not promoted. In comparison, the plant N/P ratio was 9.7 under the heterogeneous low P condition, and the plant growth and P efficiency were significantly promoted, while no obvious change occurred in root secreted APase activity.

  16. Using Square Roots

    ERIC Educational Resources Information Center

    Wilson, William Wynne


    This article describes techniques which enable the user of a comparatively simple calculator to perform calculations of cube roots, nth roots, trigonometric, and inverse trigonometric functions, logarithms, and exponentials. (DT)

  17. The Root Pressure Phenomenon

    ERIC Educational Resources Information Center

    Marsh, A. R.


    Describes experiments demonstrating that root pressure in plants is probably controlled by a circadian rhythm (biological clock). Root pressure phenomenon plays significant part in water transport in contradiction with prevalent belief. (PS)

  18. Hormonal changes throughout maturation and ageing in Pinus pinea.


    Valdés, Ana Elisa; Fernández, Belén; Centeno, María Luz


    Phytohormones, which are responsible for certain age-related changes in plants, play a major role throughout maturation and ageing. Previous results dealing with this topic allowed us to describe an ageing and vigour index in Pinus radiata based on a ratio between different forms of cytokinins (Cks). The aim of the present study was to extend the studies on the changes in the hormonal status throughout maturation and ageing to Stone pine (Pinus pinea L.). With this aim in mind, a number of Cks were analysed in addition to indole-3-acetic acid (IAA) and abscisic acid (ABA) in terminal buds, axillary buds and in the apical portion of needles collected from trees at different stages of development. The results showed an increasing pattern in the levels of various Cks similar to that found in previous studies on P. radiata. Although the maintenance of the same ratio as an ageing and vigour index was not ratified, these results seem to point to Cks as major hormones throughout maturation and related processes in conifers. The distribution of hormones between the two parts of the needle is also discussed.

  19. The oldest know Rocky Mountain bristlecone pines (Pinus aristata Engelm. )

    SciTech Connect

    Brunstein, F.C. ); Yamaguchi, D.K. )


    We have found 12 living Rocky Mountain bristlecone pines (Pinus aristata) more than 1600 yr old, including four that are more than 2 1 00 yr old, on Black Mountain, near South Park, and on Almagre Mountain, in the southern Front Range, Colorado. A core from the oldest of these trees has an inner-ring date of 442 B.C. This tree is therefore at least 2435 yr old and exceeds the age of the oldest previously reported Rocky Mountain bristlecone pine by 846 yr, The ages of these trees show that Rocky Mountain bristlecone pines, under arid environmental conditions, achieve much older ages than have been previously reported. The ages also show that previously inferred trends in bristlecone pine ages, where maximum ages in the eastern range of Rocky Mountain bristlecone pines are much less than maximum ages in the western range of Great Basin bristlecone pines (Pinus longaea), are less strong than previously supposed. Ancient Rocky Mountain bristlecone pines, such as those found in this study, have the potential to expand our knowledge of late Holocene climatic conditions in western North America.

  20. The complete plastid genome of Bunge's pine Pinus bungeana (Pinaceae).


    Li, Zhong-Hu; Zhu, Juan; Yang, Yi-Xin; Yang, Jie; He, Jing-Wen; Zhao, Gui-Fang


    The complete nucleotide sequence of Bunge's pine Pinus bungeana Zucc. ex Endl. chloroplast genome (cp DNA) was determined in this study. The cpDNA was 117 861 bp in length, containing a pair of 475 bp inverted repeat regions (IRa and IRb), which were separated by large and small single copy regions (LSC and SSC) of 65 373 and 51 538 bp, respectively. The cpDNA contained 111 genes, including 71 protein-coding genes (71 PCG species), 4 ribosomal RNA genes (4 rRNA species) and 36 tRNA genes (32 tRNA species). In these genes, 13 harbored a single intron and 1 (ycf3) contained a couple of introns. The overall AT content of Bunge's pine cpDNA is 61.2%, while the corresponding values of the LSC, SSC and IR regions are 61.9%, 60.2% and 62.5%, respectively. A phylogenetic reconstruction based on the maximum parsimony analysis suggested that all the sampled Pinus species clustered a monophyletic clade and have a high bootstrap support, and the cpDNA of P. bungeana is closely related to that of congeneric P. gerardiana.

  1. [Community characteristics of Pinus armandi forest on Qinling Mountains].


    Wang, Dexiang; Liu, Jianjun; Li, Dengwu; Lei, Ruide; Lan, Guoyu


    The community characteristics of Pinus armandi forest distributed on the mid-west zone of Qinling Mountains' south slope were investigated. The results showed that there were 166 seed plants belonging to 51 families, 111 generas. Among them, 65 genera, 66.7% of the total, belonged to temperate biome. There was a closely relationship between Pinus armandi forest and the temperate biome. As regards to the physiognomy of the community, phanerophyte made up 75.9% of the total, dominating the community. In the community, 96 species with middle-sized leaves made up 57.8%, and there were 139 single leaf species, accounted for 83.7% of the total. There was a complicated vertical structure in the community, which could be divided into three layers:arbor layer, shrub layer and herb layer. In addition, there were also a lot of inter-stratum plants in the community. It is also found that the lack of seedlings, saplings and small trees was due to both the self-thinning caused by intra-specific competition and the alien-thinning by inter-specific competition for the light resource in the stand. The population of P. armandi was characterized with the patch size about 100 m2. The dynamics of the community showed that the community was stable and in a process of development.

  2. Complex I impairment, respiratory compensations, and photosynthetic decrease in nuclear and mitochondrial male sterile mutants of Nicotiana sylvestris.


    Sabar, M; De Paepe, R; de Kouchkovsky, Y


    We have previously shown that in Nicotiana sylvestris cytoplasmic male-sterile (CMS) mutants where the mtDNA lacks the nad7 gene coding for a subunit of respiratory Complex I (NADH:ubiquinone oxidoreductase, EC, glycine (Gly) oxidation was lower than in the wild type and insensitive to rotenone, suggesting Complex I dysfunction. In contrast, the oxidation rate of exogenous NADH and the capacity of the cyanide-resistant respiration (AOX) were enhanced. Here we report that, in contrast to Gly, the rate of malate oxidation was not affected, but proceeded totally in a rotenone-insensitive pathway, strongly suggesting that survival of CMS plants depends on the activation of internal and external alternative NAD(P) H dehydrogenases and that Gly decarboxylase activity depends on Complex I functioning. A similar defect in Complex I activity and Gly oxidation was found in the NMS1 nuclear mutant, defective in the processing of the nad4 transcript, but alternative NAD(P) H dehydrogenases were less activated. In CMS and NMS1, the fraction of the AOX pathway was increased, as compared to wild type, associated with higher amounts of aox transcripts, AOX protein, and plant resistance to cyanide. Non-phosphorylating respiratory enzymes maintained normal in vivo respiration levels in both mutants, but photosynthesis was decreased, in correlation with lower leaf conductance, emphasizing mitochondrial control on photosynthesis.

  3. Corky root rot

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Corky root rot (corchosis) was first reported in Argentina in 1985, but the disease was presumably present long before that. The disease occurs in most alfalfa-growing areas of Argentina but is more common in older stands. In space-planted alfalfa trials scored for root problems, corky root rot was ...


    SciTech Connect



    I explore the origins of the unphysical predictions from rooted staggered fermion algorithms. Before rooting, the exact chiral symmetry of staggered fermions is a flavored symmetry among the four 'tastes.' The rooting procedure averages over tastes of different chiralities. This averaging forbids the appearance of the correct 't Hooft vertex for the target theory.

  5. [Response of broadleaved Pinus koraiensis forests in Xiaoxinganling Mt. to global climate change--a dynamic modeling].


    Deng, H; Wu, Z; Zhou, D


    In this paper, the Forest Gap Model and four General Circulation Models (GCMs) were employed to investigate the dynamic response of broadleaved Pinus koraiensis forests in Xiaoxinganling Mountains of China to global climate change. Under CO2 doubling which was simulated by the scenarios of Oregon State University and Goddard Institute for Space Studies, the biomass of broadleaved Pinus koraiensis forest increased and the current Picea-Abies-broadleaved Pinus koraiensis forest would gradually develop to Betula costata-Tilia amurensis-Ulmus laciniata-broadleaved Pinus koraiensis forest. Under the scenarios of Geophysical Fluid Dynamics Laboratory at Princeton University and United Kingdom Meteorological Office, Pinus koraiensis and other coniferous species would be replaced by broadleaved species such as Quercus mongolica, Tilia amurensis and Ulmus laciniata, and the broadleaved Pinus koraiensis forest would change to broadleaved forest, due to the great range increasing temperature by the scenarios. The future warming rate would determine the succession of broadleaved Pinus koraiensis forest.

  6. Rooting gene trees without outgroups: EP rooting.


    Sinsheimer, Janet S; Little, Roderick J A; Lake, James A


    Gene sequences are routinely used to determine the topologies of unrooted phylogenetic trees, but many of the most important questions in evolution require knowing both the topologies and the roots of trees. However, general algorithms for calculating rooted trees from gene and genomic sequences in the absence of gene paralogs are few. Using the principles of evolutionary parsimony (EP) (Lake JA. 1987a. A rate-independent technique for analysis of nucleic acid sequences: evolutionary parsimony. Mol Biol Evol. 4:167-181) and its extensions (Cavender, J. 1989. Mechanized derivation of linear invariants. Mol Biol Evol. 6:301-316; Nguyen T, Speed TP. 1992. A derivation of all linear invariants for a nonbalanced transversion model. J Mol Evol. 35:60-76), we explicitly enumerate all linear invariants that solely contain rooting information and derive algorithms for rooting gene trees directly from gene and genomic sequences. These new EP linear rooting invariants allow one to determine rooted trees, even in the complete absence of outgroups and gene paralogs. EP rooting invariants are explicitly derived for three taxon trees, and rules for their extension to four or more taxa are provided. The method is demonstrated using 18S ribosomal DNA to illustrate how the new animal phylogeny (Aguinaldo AMA et al. 1997. Evidence for a clade of nematodes, arthropods, and other moulting animals. Nature 387:489-493; Lake JA. 1990. Origin of the metazoa. Proc Natl Acad Sci USA 87:763-766) may be rooted directly from sequences, even when they are short and paralogs are unavailable. These results are consistent with the current root (Philippe H et al. 2011. Acoelomorph flatworms are deuterostomes related to Xenoturbella. Nature 470:255-260).

  7. Growth and water relations of three geographically separate origins of maritime pine (Pinus pinaster) under saline conditions.


    Loustau, D; Crepeau, S; Guye, M G; Sartore, M; Saur, E


    Water relations and growth of maritime pine (Pinus pinaster Ait.) were investigated in 2-year-old seedlings of French ('Landes'), Iberian ('Iberian') and Moroccan ('Tamjoute') origin raised for 67 days in a flowing solution culture system containing 0, 50, 150 or 250 mM NaCl. Height growth, and stem, needle and root dry matter were reduced by salinity with minor differences among geographic origins. Predawn needle water potential was decreased by salinity and corresponded approximately to the osmotic potential of the nutrient solution. Stomatal conductance was reduced according to the amount of salinity applied. Whole-plant hydraulic conductance was also reduced, even when expressed on a root dry weight basis. The osmotic potential of xylem sap was five- to sixfold lower than that of the nutrient solution. Seedlings of the most southerly origin (Tamjoute) exhibited a greater ability to decrease osmotic potential under saline conditions than seedlings of more northerly origin (Landes and Iberian) as a result of higher mineral cation transport to the shoot.

  8. Soil warming increased whole-tree water use of Pinus cembra at the treeline in the Central Tyrolean Alps.


    Wieser, Gerhard; Grams, Thorsten E E; Matyssek, Rainer; Oberhuber, Walter; Gruber, Andreas


    This study quantified the effect of soil warming on sap flow density (Qs) of Pinus cembra L. at the treeline in the Central Tyrolean Alps. To enhance soil temperature we installed a transparent roof construction above the forest floor around six trees. Six other trees served as controls in the absence of any manipulation. Roofing enhanced growing season mean soil temperature by 1.6, 1.3 and 1.0 °C at 5, 10 and 20 cm soil depth, respectively, while soil water availability was not affected. Sap flow density (using Granier-type thermal dissipation probes) and environmental parameters were monitored throughout three growing seasons. During the first year of treatment, no warming effect was detected on Qs. However, soil warming caused Qs to increase significantly by 11 and 19% above levels in control trees during the second and third year, respectively. This effect appeared to result from warming-induced root production, a reduction in viscosity and perhaps an increase also in root hydraulic conductivity. Hardly affected were leaf-level net CO2 uptake rate and conductance for water vapour, so that water-use efficiency stayed unchanged as confirmed by needle δ(13)C analysis. We conclude that tree water loss will increase with soil warming, which may alter the water balance within the treeline ecotone of the Central Austrian Alps in a future warming environment.

  9. Structure and species composition of ectomycorrhizal fungal communities colonizing seedlings and adult trees of Pinus montezumae in Mexican neotropical forests.


    Reverchon, Frédérique; Ortega-Larrocea, María del Pilar; Bonilla-Rosso, Germán; Pérez-Moreno, Jesús


    Mexico is a center of diversity for pines, but few studies have examined the ectomycorrhizal (ECM) fungal communities associated with pines in this country. We investigated the ECM communities associated with Pinus montezumae seedlings and mature trees in neotropical forests of central Mexico and compared their structure and species composition. Root tips were sampled on both planted seedlings and naturally occurring adult trees. A total of 42 ECM operational taxonomic units (OTUs) was found on P. montezumae. Diversity and similarity indices showed that community structure was similar for both plant growth stages, but phylogenetic diversity and Chao-estimated richness were higher for seedlings. Species composition differed between communities. The dominant OTUs belonged to the families Atheliaceae, Cortinariaceae, and Sebacinaceae, although different taxa appeared to colonize seedlings and adults. Only 12 OTUs were shared between seedlings and adults, which suggests that ECM fungi which colonize seedlings are still not fully incorporated into mycelial networks and that ECM taxa colonizing young individuals of P. montezumae are likely to come from fungal propagules. Intra-generic diversity could be an insurance mechanism to maintain forest productivity under stressed conditions. This is the first report describing the abundance of Atheliaceae in tree roots in neotropical ecosystems.

  10. Differential responses of three fungal species to environmental factors and their role in the mycorrhization of Pinus radiata D. Don.


    Duñabeitia, Miren K; Hormilla, Susana; Garcia-Plazaola, Jose I; Txarterina, Kepa; Arteche, Unai; Becerril, Jose M


    Three ectomycorrhizal (ECM) isolates of Rhizopogon luteolus, R. roseolus and Scleroderma citrinum were found to differ markedly in their in vitro tolerance to adverse conditions limiting fungal growth, i.e. water availability, pH and heavy metal pollution. S. citrinum was the most sensitive, R. luteolus intermediate and R. roseolus the most tolerant species. Pinus radiata D. Don seedlings were inoculated in the laboratory and in a containerised seedling nursery with spore suspensions of the three ECM species. Colonisation percentage was considerably lower under nursery conditions, probably due to competition by native fungi. The effects of nursery ECM inoculation on seedling growth depended on the fungal species. Only R. roseolus-colonised plants showed a significantly higher shoot growth than non-mycorrhizal plants. All three fungi induced significantly higher root dry weights relative to control plants. Despite the low mycorrhizal colonisation, mycorrhization with all three species improved the physiological status of nursery-grown seedlings, e.g. enhanced root enzyme activity, shoot nutrient and pigment content, net photosynthesis rate and water use efficiency. Of the three fungal species, R. roseolus was the most effective; this species was also the most adaptable and showed the greatest range of tolerance to adverse environmental conditions in pure culture. It is, therefore, proposed as a promising fungal species for ECM inoculation of P. radiata in the nursery.

  11. Use of dendrochronological method in Pinus halepensis to estimate the soil erosion in the South East of Madrid (Spain).


    Pérez-Rodríguez, Raquel; Marques, Maria Jose; Bienes, Ramón


    The rate of soil erosion in pine forests (Pinus halepensis) located in the Southeast of Madrid has been estimated using dendrochronological analysis based on the change in ring-growth pattern from concentric to eccentric when the root is exposed. Using 49 roots spread across five inclined areas, it has been found that the length and direction of the hillsides, as well as their vegetation cover affect the rate of erosion, while the slope itself does not. The erosion rates found for the different areas studied vary between 3.5 and 8.8 mm year(-1), that is between 40 and 101 t ha(-1) year(-1) respectively. These values are between 2 and 3 times greater than those predicted by USLE, for which this equation underestimates soil loss for Central Spain's Mediterranean conditions. Nonetheless, both methods (using dendrochronology to determine actual soil loss and theoretical prediction with USLE) are able to establish the same significant differences among the areas studied, allowing for the comparative estimate of the severity of the area's erosion problem.

  12. Reducing airborne ectomycorrhizal fungi and growing non-mycorrhizal loblolly pine (Pinus taeda L.) seedlings in a greenhouse.


    Stottlemyer, Aaron D; Wang, G Geoff; Wells, Christina E; Stottlemyer, David W; Waldrop, Thomas A


    Atmospheric spores of ectomycorrhizal (ECM) fungi are a potential source of contamination when mycorrhizal studies are performed in the greenhouse, and techniques for minimizing such contamination have rarely been tested. We grew loblolly pine (Pinus taeda L.) from seed in a greenhouse and inside a high-efficiency particulate air-filtered chamber (HFC) constructed within the same greenhouse. Seedlings were germinated in seven different sand- or soil-based and artificially based growth media. Seedlings grown in the HFC had fewer mycorrhizal short roots than those grown in the open greenhouse atmosphere. Furthermore, the proportion of seedlings from the HFC that were completely non-mycorrhizal was higher than that of seedlings from the greenhouse atmosphere. Seedlings grown in sterilized, artificially based growth media (>50% peat moss, vermiculite, and/or perlite by volume) had fewer mycorrhizal short roots than those grown in sand- or soil-based media. The HFC described here can minimize undesirable ECM colonization of host seedlings in greenhouse bioassays. In addition, the number of non-mycorrhizal seedlings can be maximized when the HFC is used in combination with artificially based growth media.

  13. Characterization of juvenile maritime pine (Pinus pinaster Ait.) ectomycorrhizal fungal community using morphotyping, direct sequencing and fruitbodies sampling.


    Pestaña Nieto, Montserrat; Santolamazza Carbone, Serena


    Using ectomycorrhizal root tip morphotyping (anatomical and morphological identification), molecular analysis (internal transcribed spacer region amplification and sequencing), and fruitbody sampling, we assessed diversity and composition of the ectomycorrhizal fungal community colonizing juvenile Pinus pinaster Ait. under natural conditions in NW Spain. Overall, we found 15 Basidiomycetes and two Ascomycetes. Members of the family Thelephoraceae represented up to 59.4% of the samples. The most frequent species was Tomentella sublilacina followed by Thelephora terrestris, Russula drimeia, Suillus bovinus, and Paxillus involutus, while the less frequent were Pseudotomentella tristis, Lactarius subdulcis, Russula ochroleuca, and Entoloma conferendum. From October 2007 to June 2008, we sampled 208 sporocarps belonging to seven genera and nine species: Thelephora terrestris, Paxillus involutus, Suillus bovinus, Xerocomus badius, Scleroderma verrucosum, Amanita gemmata, A. rubescens, Amanita sp., and Russula sp. The species belonging to the genus Amanita, X. badius and S. verrucosum were not found on root samples. By comparing our results with a bibliographic review of papers published from 1922 to 2006, we found five genera and six species which have not been previously reported in symbiosis with P. pinaster. This is the first time that the diversity of the ectomycorrhizal fungal community associated with P. pinaster was investigated using molecular techniques. Considering that only 38% of the genera found by sequencing were found as fruitbodies, we conclude that integrating morphotyping and sporocarps surveys with molecular analysis of ectomycorrhizas is important to documenting the ectomycorrhizal fungus community.

  14. Application of Normal Distribution Model to Estimate Root Water Uptake Profile by an Isotopic Approach

    NASA Astrophysics Data System (ADS)

    Yamanaka, T.; Matsuo, D.; Hirota, M.


    To confirm usefulness of a diagnostic model for estimating root water uptake profile by an isotopic approach, isotopic measurements of plant xylem water, soil water and groundwater were conducted at seven Japanese red pine forest sites and then the model was applied to the measured results. The model assumes that depth profile of relative uptake rate can be approximated by the normal distribution function, and xylem water isotopic composition is computed from interpolated depth profile of isotopic composition of subsurface waters. The peak depth and distribution range of water uptake zone for a given species at a given site are inversely determined by direct search method (assuming depth interval of 5 cm up to 2 m) so as to minimize root mean square error throughout observation period. Estimated water uptake profiles showed that in six sites the uptake zone of Japanese red pine (Pinus densiflora) ranged from 5 to 60 cm depth, while it was changed to deeper depths in the other site where Quercus myrsinaefolia and Pleioblastus chino coexist. On the other hand, Populus sieboldi and Malus sieboldii take up water from depths deeper than those for Pinus densiflora within a community, although the two species are usually considered as shallow rooted plants. These results indicate water source partitioning under inter-species competition, and we conclude that the present model is capable of making clear the plant water use strategy. Estimated water uptake zone also provides useful information for improving/calibrating prognostic, physical models of root water uptake.

  15. [Vertical distribution of fuels in Pinus yunnanensis forest and related affecting factors].


    Wang, San; Niu, Shu-Kui; Li, De; Wang, Jing-Hua; Chen, Feng; Sun, Wu


    In order to understand the effects of fuel loadings spatial distribution on forest fire kinds and behaviors, the canopy fuels and floor fuels of Pinus yunnanensis forests with different canopy density, diameter at breast height (DBH), tree height, and stand age and at different altitude, slope grade, position, and aspect in Southwest China were taken as test objects, with the fuel loadings and their spatial distribution characteristics at different vertical layers compared and the fire behaviors in different stands analyzed. The relationships between the fuel loadings and the environmental factors were also analyzed by canonical correspondence analysis (CCA). In different stands, there existed significant differences in the vertical distribution of fuels. Pinus yunnanensis-Qak-Syzygium aromaticum, Pinus yunnanensis-oak, and Pinus yunnanensis forests were likely to occur floor fire but not crown fire, while Pinus yunnanensis-Platycladus orientalis, Pinus yunnanensis-Keteleeria fortune, and Keteleeria fortune-Pinus yunnanensis were not only inclined to occur floor fire, but also, the floor fire could be easily transformed into crown fire. The crown fuels were mainly affected by the stand age, altitude, DBH, and tree height, while the floor fuels were mainly by the canopy density, slope grade, altitude, and stand age.

  16. Limitations of Photosynthesis in Pinus taeda L. (Loblolly Pine) at Low Soil Temperatures 1

    PubMed Central

    Day, Thomas A.; Heckathorn, Scott A.; DeLucia, Evan H.


    The relative importance of stomatal and nonstomatal limitations to net photosynthesis (A) and possible signals responsible for stomatal limitations were investigated in unhardened Pinus taeda seedlings at low soil temperatures. After 2 days at soil temperatures between 13 and 7°C, A was reduced by 20 to 50%, respectively. The reduction in A at these moderate root-chilling conditions appeared to be the result of stomatal limitations, based on the decrease in intercellular CO2 concentrations (ci). This conclusion was supported by A versus ci analysis and measurements of O2 evolution at saturating CO2, which suggested increases in stomatal but not biochemical limitations at these soil temperatures. Nonuniform stomatal apertures, which were demonstrated with abscisic acid, were not apparent 2 days after root chilling, and results of our A versus ci analysis appear valid. Bulk shoot water potential (ψ) declined as soil temperature dropped below 16°C. When half the root system of seedlings was chilled, shoot ψ and gas-exchange rates did not decline. Thus, nonhydraulic root-shoot signals were not implicated in stomatal limitations. The initial decrease in leaf conductance to water vapor after root chilling appeared to precede any detectable decrease in bulk fascicle ψ, but may be in response to a decrease in turgor of epidermal cells. These reductions in leaf conductance to water vapor, which occurred within 30 minutes of root chilling, could be delayed and temporarily reversed by reducing the leaf-to-air vapor-pressure deficit, suggesting that hydraulic signals may be involved in initiating stomatal closure. By independently manipulating the leaf-to-air vapor-pressure deficit of individual fascicles, we could induce uptake of water vapor through stomata, suggesting that nonsaturated conditions occur in the intercellular airspaces. There was an anomaly in our results on seedlings maintained for 2 days at soil temperatures below 7°C. Lower A appeared primarily the

  17. Molecular response to water stress in two contrasting Mediterranean pines (Pinus pinaster and Pinus pinea).


    Perdiguero, Pedro; Barbero, María Del Carmen; Cervera, María Teresa; Collada, Carmen; Soto, Alvaro


    Adaptation to water stress has determined the evolution and diversification of vascular plants. Water stress is forecasted to increase drastically in the next decades in certain regions, such as in the Mediterranean basin. Consequently, a proper knowledge of the response and adaptations to drought stress is essential for the correct management of plant genetic resources. However, most of the advances in the understanding of the molecular response to water stress have been attained in angiosperms, and are not always applicable to gymnosperms. In this work we analyse the transcriptional response of two emblematic Mediterranean pines, Pinus pinaster and Pinus pinea, which show noticeable differences in their performance under water stress. Using microarray analysis, up to 113 genes have been detected as significantly induced by drought in both species. Reliability of expression patterns has been confirmed by RT-PCR. While induced genes with similar profiles in both species can be considered as general candidate genes for the study of drought response in conifers, genes with diverging expression patterns can underpin the differences displayed by these species under water stress. Most promising candidate genes for drought stress response include genes related to carbohydrate metabolism, such as glycosyltransferases or galactosidases, sugar transporters, dehydrins and transcription factors. Additionally, differences in the molecular response to drought and polyethylene-glycol-induced water stress are also discussed.

  18. Levels and sources of PAHs in selected sites from Portugal: biomonitoring with Pinus pinea and Pinus pinaster needles.


    Ratola, Nuno; Amigo, José Manuel; Alves, Arminda


    Pine needle samples from two pine species (Pinus pinaster Ait. and Pinus pinea L.) were collected at 29 sites scattered throughout Portugal, in order to biomonitor the levels and trends of 16 polycyclic aromatic hydrocarbons (PAHs). The values obtained for the sum of all PAHs ranged from 76 to 1944 ng/g [dry weight (dw)]. Despite the apparent matrix similarities between both pine species, P. pinaster needles revealed higher mean entrapment levels than P. pinea (748 and 399 ng/g (dw) per site, respectively). The urban and industrial sites have the highest average of PAH incidence [for P. pinea, 465 and 433 ng/g (dw) per site, respectively, and for P. pinaster, 1147 and 915 ng/g (dw)], followed by the rural sites [233 ng/g and 711 ng/g (dw) per site, for P. pinea and P. pinaster, respectively]. The remote sites, both from P. pinaster needles, show the least contamination, with 77 ng/g (dw) per site. A predominance of 3-ring and 4-ring PAHs was observed in most samples, with phenanthrene having 30.1% of the total. Naphthalene prevailed in remote sites. Rainfall had no influence on the PAHs levels, but there was a relationship between higher wind speeds and lower concentrations. PAH molecular ratios revealed the influence of both petrogenic and pyrogenic sources.

  19. Impact of solar activity on growth of pine trees (Pinus cembra: 1610 - 1970; Pinus pinaster: 1910 -1989)

    NASA Astrophysics Data System (ADS)

    Surový, P.; Dorotovič, I.; Karlovský, V.; Rodrigues, J. C.; Rybanský, M.; Fleischer, P.


    In this work we have focused on the analysis of the data on the annual growth of cembra pine (Pinus cembra) grown in the Kôprová dolina Valley in the High Tatra Mountains. The database covers the period of 1406 - 1970, however, the sunspot data (minima and maxima) at the NGDC web site are only available since 1610. Moreover, reliable sunspot data are only available since 1749. The results of this analysis agree with the observation made in our previous work, i.e. there is a negative impact of high SA on the pine tree growth. However, it should be noted that statistical significance of the results is low. We also applied wavelet analysis to the data on the tree growth evolution, with the results indicating growth variations' period of about 20 years (duration of approximately two solar cycles or one magnetic cycle, respectively). A negative impact of the SA was also observed in growth of a 90 year-old maritime pine tree (Pinus pinaster) grown in northern Portugal. The width of the annual rings was smaller in the years of maximum SA; furthermore, it was found that it is the latewood growth that it is affected while the earlywood growth is not, and consequently the latewood additions also show a significative negative correlation with SA.

  20. Development of a comprehensive method for analyzing clerodane-type diterpenes and phenolic compounds from Casearia sylvestris Swartz (Salicaceae) based on ultra high performance liquid chromatography combined with chemometric tools.


    Bueno, Paula Carolina Pires; Pereira, Fabiola Manhas Verbi; Torres, Roseli Buzanelli; Cavalheiro, Alberto José


    This work describes the development and optimization of an analytical method utilizing liquid chromatography and chemometrics to evaluate and differentiate two varieties of Casearia sylvestris Swartz (Salicaceae) from São Paulo State (Brazil) based on their secondary metabolite profiles. Previously, analytical studies only concerned the analysis of clerodane-type diterpenes. Therefore, considering the importance of including phenolic compounds in such analysis, we used design of experiments to simultaneously extract and detect the largest number of compounds from both chemical classes. This new strategy allowed a comprehensive chromatographic analysis of C. sylvestris, and the results for the two varieties exhibited an interesting distribution according to their original ecosystems, suggesting a strong correlation to the main metabolites found in each species group. Besides their inherent morphological differences, C. sylvestris variety lingua, mainly found in Cerrado areas, predominantly contains phenolic compounds, while C. sylvestris variety sylvestris, mainly found in Atlantic Forest areas, contains mostly clerodane-type diterpenes. Finally, it was also possible to observe differences in the secondary metabolite composition within each group depending on the place where samples were collected.

  1. Pinus pinaster seedlings and their fungal symbionts show high plasticity in phosphorus acquisition in acidic soils.


    Ali, M A; Louche, J; Legname, E; Duchemin, M; Plassard, C


    Young seedlings of maritime pine (Pinus pinaster Soland in Aït.) were grown in rhizoboxes using intact spodosol soil samples from the southwest of France, in Landes of Gascogne, presenting a large variation of phosphorus (P) availability. Soils were collected from a 93-year-old unfertilized stand and a 13-year-old P. pinaster stand with regular annual fertilization of either only P or P and nitrogen (N). After 6 months of culture in controlled conditions, different morphotypes of ectomycorrhiza (ECM) were used for the measurements of acid phosphatase activity and molecular identification of fungal species using amplification of the ITS region. Total biomass, N and P contents were measured in roots and shoots of plants. Bicarbonate- and NaOH-available inorganic P (Pi), organic P (Po) and ergosterol concentrations were measured in bulk and rhizosphere soil. The results showed that bulk soil from the 93-year-old forest stand presented the highest Po levels, but relatively higher bicarbonate-extractable Pi levels compared to 13-year-old unfertilized stand. Fertilizers significantly increased the concentrations of inorganic P fractions in bulk soil. Ergosterol contents in rhizosphere soil were increased by fertilizer application. The dominant fungal species was Rhizopogon luteolus forming 66.6% of analysed ECM tips. Acid phosphatase activity was highly variable and varied inversely with bicarbonate-extractable Pi levels in the rhizosphere soil. Total P or total N in plants was linearly correlated with total plant biomass, but the slope was steep only between total P and biomass in fertilized soil samples. In spite of high phosphatase activity in ECM tips, P availability remained a limiting nutrient in soil samples from unfertilized stands. Nevertheless young P. pinaster seedlings showed a high plasticity for biomass production at low P availability in soils.

  2. Sampling open-top chambers and plantations for live fine-root biomass of loblolly pine. Forest Service research note

    SciTech Connect

    Zarnoch, S.J.; Marx, D.H.; Ruehle, J.L.; Baldwin, V.C.


    A soil-core sampling protocol was developed for estimating the standing crop of live fine-root biomass in young loblolly pines (Pinus taeda L.). Some of the pines were in ozone experiments in open-top chambers. Others were in young plantations. Attempts were made to find strata that would reduce the variability of estimates. With the pilot study estimates of variability, sampling designs were developed to meet specified criteria of precision. Estimates of fine-root biomass based on three soil-core sizes increased monotonically with core size.

  3. High tocopherol and triacylglycerol contents in Pinus pinea L. seeds.


    Nasri, Nizar; Tlili, Nizar; Ben Ammar, Kamel; Khaldi, Abdelhamid; Fady, Bruno; Triki, Saida


    Oleaginous seeds are among the functional foods most recognized for their tocopherols and triacylglycerols because of their role in lipid metabolism. In this paper, the tocopherol and triacylglycerol contents in seeds of several Pinus pinea L. populations around the Mediterranean Basin were investigated. Lipids were extracted from fully ripen seeds with petroleum ether. The tocopherol (alpha-tocopherol, gamma-tocopherol, and delta-tocopherol) contents were, respectively, 15.34+/-3.75 ppm, 1,681.75+/-404.03 ppm and 41.87+/-9.79 ppm. Lipids (mainly triacylglycerols) in P. pinea seeds averaged 48% on a dry weight basis. Triacylglycerols with an equivalent carbon number of 44 (32.27%) and of 46 (30.91%) were dominant. The major triacylglycerol was LLO (24.06%). Tocopherols and triacylglycerols were present at remarkably high levels, thus making P. pinea oil a valuable source of antioxidants and unsaturated fatty acids with varying levels across the geographical range of P. pinea.

  4. Isolation and characterization of Korean pine (Pinus koraiensis) convicilin.


    Jin, Tengchuan; Wang, Yang; Chen, Yu-Wei; Albillos, Silvia M; Kothary, Mahendra H; Fu, Tong-Jen; Tankersley, Boyce; McHugh, Tara H; Zhang, Yu-Zhu


    A vicilin-like globulin seed storage protein, termed convicilin, was isolated for the first time from Korean pine (Pinus koraiensis). SDS-PAGE analysis revealed that Korean pine convicilin was post-translationally processed. The N-terminal peptide sequences of its components were determined. These peptides could be mapped to a protein translated from an embryo abundant transcript isolated in this study. Similar to vicilin, native convicilin appeared to be homotrimeric. Differential scanning calorimetry (DSC) analyses revealed that this protein is less resistant to thermal treatment than Korean pine vicilin. Its transition temperature was 75.57 °C compared with 84.13 °C for vicilin. The urea induced folding-unfolding equilibrium of pine convicilin monitored by intrinsic fluorescence could be interpreted in terms of a two-state model, with a Cm of 4.41 ± 0.15 M.

  5. Characterization of aroma-active compounds in dry flower of Malva sylvestris L. by GC-MS-O analysis and OAV calculations.


    Usami, Atsushi; Kashima, Yusei; Marumoto, Shinsuke; Miyazawa, Mitsuo


    In this study, the aroma-active compounds in the dried flower of Malva sylvestris L. were extracted by hydrodistillation and analyzed by gas chromatography-mass spectrometry (GC-MS), and gas chromatography-olfactometry (GC-O) and aroma extraction dilution analysis (AEDA). A light yellow oil with a sweet odor was obtained with a percentage yield of 0.039% (w/w), and 143 volatile compounds (89.86%) were identified by GC-MS. The main compounds were hexadecanoic acid (10.1%), pentacosane (4.8%) and 6,10,14-trimethyl-2-pentadecanone (4.1%). The essential oil consisted mainly of hydrocarbons (25.40%) followed by, alcohols (18.78%), acids (16.66%), ethers (5.01%) ketones (7.28%), esters(12.43%), aldehydes (2.30%) and others (2.00%). Of these compounds, 20 were determined by GC-O and AEDA, to be odor-active (FD (flavor dilution) factor ≥ 1). β-Damascenone (FD = 9, sweet), phenylacetaldehyde (FD = 8, floral, honey-like) and (E)-β-ocimene (FD = 8, spicy) were the most intense aroma-active compounds in M. sylvestris. In order to determine the relative contribution of each of the compounds to the aroma of M. sylvestris, odor activity values (OAVs) were used. β-Damascenone had the highest odor activity values (OAV) (50,700), followed by (E)-β-ionone (15,444) and decanal (3,510). In particular, β-damascenone had a high FD factors, and therefore, this compound was considered to be the main aroma-active components of the essential oil. On the basis of AEDA, OAVs, and sensory evaluation results, β-damascenone is estimated to be the main aroma-active compound of the essential oil.

  6. Growth of mycorrhizal jack pine (Pinus banksiana) and white spruce (Picea glauca) seedlings planted in oil sands reclaimed areas.


    Onwuchekwa, Nnenna E; Zwiazek, Janusz J; Quoreshi, Ali; Khasa, Damase P


    The effectiveness of ectomycorrhizal inoculation at the tree nursery seedling production stage on growth and survival was examined in jack pine (Pinus banksiana) and white spruce (Picea glauca) planted in oil sands reclamation sites. The seedlings were inoculated with Hebeloma crustuliniforme strain # UAMH 5247, Suillus tomentosus strain # UAMH 6252, and Laccaria bicolor strain # UAMH 8232, as individual pure cultures and in combinations. These treatments were demonstrated to improve salinity resistance and water uptake in conifer seedlings. The field responses of seedlings to ectomycorrhizal inoculation varied between plant species, inoculation treatments, and measured parameters. Seedling inoculation resulted in higher ectomycorrhizal colonization rates compared with non-inoculated control, which had also a relatively small proportion of roots colonized by the nursery contaminant fungi identified as Amphinema byssoides and Thelephora americana. Seedling inoculation had overall a greater effect on relative height growth rates, dry biomass, and stem volumes in jack pine compared with white spruce. However, when examined after two growing seasons, inoculated white spruce seedlings showed up to 75% higher survival rates than non-inoculated controls. The persistence of inoculated fungi in roots of planted seedlings was examined at the end of the second growing season. Although the inoculation with H. crustuliniforme triggered growth responses, the fungus was not found in the roots of seedlings at the end of the second growing season suggesting a possibility that the observed growth-promoting effect of H. crustuliniforme may be transient. The results suggest that the inoculation of conifer seedlings with ectomycorrhizal fungi could potentially be carried out on a large scale in tree nurseries to benefit postplanting performance in oil sands reclamation sites. However, these practices should take into consideration the differences in responses between the different

  7. Root canal irrigants

    PubMed Central

    Kandaswamy, Deivanayagam; Venkateshbabu, Nagendrababu


    Successful root canal therapy relies on the combination of proper instrumentation, irrigation, and obturation of the root canal. Of these three essential steps of root canal therapy, irrigation of the root canal is the most important determinant in the healing of the periapical tissues. The primary endodontic treatment goal must thus be to optimize root canal disinfection and to prevent reinfection. In this review of the literature, various irrigants and the interactions between irrigants are discussed. We performed a Medline search for English-language papers published untill July 2010. The keywords used were ‘root canal irrigants’ and ‘endodontic irrigants.’ The reference lists of each article were manually checked for additional articles of relevance. PMID:21217955

  8. Greek Pinus essential oils: larvicidal activity and repellency against Aedes albopictus (Diptera: Culicidae).


    Koutsaviti, Katerina; Giatropoulos, Athanassios; Pitarokili, Danae; Papachristos, Dimitrios; Michaelakis, Antonios; Tzakou, Olga


    The needle volatiles metabolites of seven Pinus spp.: Pinus nigra (3 samples), Pinus stankewiczii, Pinus brutia, Pinus halepensis, Pinus canariensis, Pinus pinaster and Pinus strobus from Greece were determined by gas chromatography and gas chromatography-mass spectrometry. P. nigra and P. canariensis essential oils were dominated by α-pinene (24.9-28.9 % and 15 %, respectively) and germacrene D (20.3-31.9 % and 55.8 %, respectively), whereas P. brutia and P. strobus by α-pinene (20.6 % and 31.4 %, respectively) and β-pinene (31.7 % and 33.6 %, respectively). P. halepensis and P. pinaster oils were characterized by β-caryophyllene (28.5 % and 22.5 %, respectively). Finally, β-pinene (31.4 %), germacrene D (23.3 %) and α-pinene (17.5 %) were the most abundant compounds in the needle oil of P. stankewiczii. Additionally the larvicidal and repellent properties of their essential oils were evaluated against Aedes albopictus, a mosquito of great ecological and medical importance. The results of bioassays revealed that repellent abilities of the tested essential oils were more potent than their larvicidal activities. The essential oils of P. brutia, P. halepensis and P. stankewiczii presented considerable larvicidal activity (LC50 values 67.04 mgL(-1) and 70.21 mgL(-1), respectively), while the others were weak to inactive against larvae. The essential oils of P. halepensis, P. brutia, and P. stankewiczii presented a high repellent activity, even at the dose of 0.2 μL cm(-2), while in the dose of 0.4 μL cm(-2), almost all the tested EOs displayed protection against the mosquito.

  9. Lactarius deliciosus and Pinus radiata in New Zealand: towards the development of innovative gourmet mushroom orchards.


    Guerin-Laguette, Alexis; Cummings, Nicholas; Butler, Ruth Catherine; Willows, Anna; Hesom-Williams, Nina; Li, Shuhong; Wang, Yun


    The cultivation of Lactarius deliciosus (saffron milk cap) in New Zealand began in 2002 when fruiting bodies were produced in an Otago plantation of Pinus radiata seedlings artificially mycorrhized by L. deliciosus. In 2007, 42 P. radiata seedlings mycorrhized by L. deliciosus under controlled conditions were planted in a grass field at Plant and Food Research (Lincoln, Canterbury). The effects of pine bark mulch application and initial degree of mycorrhization of seedlings were examined to determine their influence on tree growth, development of mycorrhizae (i.e. their multiplication on the root system and their degree of branching) and fruiting body production. Mulch application increased tree growth significantly over 4 years. High initial mycorrhization slightly stimulated tree growth over 2 years. The initial degree of mycorrhization was positively, but not strongly, related to the persistence and development of L. deliciosus mycorrhizae and rhizomorphs based on root sample analyses 2 years after planting. However, mulching strongly reduced the proportion of highly branched L. deliciosus mycorrhizae compared with poorly ramified ones. A positive correlation was observed between the fruiting of L. deliciosus and the development of mycorrhizae. Mulching delayed the onset of fruiting body production. In 2010, fruiting bodies were produced only from non-mulched trees with eight of these (38 %) producing a total of 12 fruiting bodies. In 2011, 19 non-mulched trees (90 %) and 9 mulched trees (45 %) produced 143 and 47 fruiting bodies, respectively, totalling 190 fruiting bodies. By 2012, 19 non-mulched trees (90 %) and 13 mulched trees (65 %) produced 333 and 236 fruiting bodies, respectively, totalling 569 fruiting bodies (c. 30 kg). This study presents new information on factors influencing the onset of fruiting and the development of yields in a plantation of P. radiata mycorrhized by L. deliciosus. Projected yields as high as c. 300 kg/ha from the

  10. Belowground legacies of Pinus contorta invasion and removal result in multiple mechanisms of invasional meltdown

    PubMed Central

    Dickie, Ian A.; St John, Mark G.; Yeates, Gregor W.; Morse, Chris W.; Bonner, Karen I.; Orwin, Kate; Peltzer, Duane A.


    Plant invasions can change soil biota and nutrients in ways that drive subsequent plant communities, particularly when co-invading with belowground mutualists such as ectomycorrhizal fungi. These effects can persist following removal of the invasive plant and, combined with effects of removal per se, influence subsequent plant communities and ecosystem functioning. We used field observations and a soil bioassay with multiple plant species to determine the belowground effects and post-removal legacy caused by invasion of the non-native tree Pinus contorta into a native plant community. Pinus facilitated ectomycorrhizal infection of the co-occurring invasive tree, Pseudotsuga menziesii, but not conspecific Pinus (which always had ectomycorrhizas) nor the native pioneer Kunzea ericoides (which never had ectomycorrhizas). Pinus also caused a major shift in soil nutrient cycling as indicated by increased bacterial dominance, NO3-N (17-fold increase) and available phosphorus (3.2-fold increase) in soils, which in turn promoted increased growth of graminoids. These results parallel field observations, where Pinus removal is associated with invasion by non-native grasses and herbs, and suggest that legacies of Pinus on soil nutrient cycling thus indirectly promote invasion of other non-native plant species. Our findings demonstrate that multi-trophic belowground legacies are an important but hitherto largely unconsidered factor in plant community reassembly following invasive plant removal. PMID:25228312

  11. Family 34 glycosyltransferase (GT34) genes and proteins in Pinus radiata (radiata pine) and Pinus taeda (loblolly pine).


    Ade, Carsten P; Bemm, Felix; Dickson, James M J; Walter, Christian; Harris, Philip J


    Using a functional genomics approach, four candidate genes (PtGT34A, PtGT34B, PtGT34C and PtGT34D) were identified in Pinus taeda. These genes encode CAZy family GT34 glycosyltransferases that are involved in the synthesis of cell-wall xyloglucans and heteromannans. The full-length coding sequences of three orthologs (PrGT34A, B and C) were isolated from a xylem-specific cDNA library from the closely related Pinus radiata. PrGT34B is the ortholog of XXT1 and XXT2, the two main xyloglucan (1→6)-α-xylosyltransferases in Arabidopsis thaliana. PrGT34C is the ortholog of XXT5 in A. thaliana, which is also involved in the xylosylation of xyloglucans. PrGT34A is an ortholog of a galactosyltransferase from fenugreek (Trigonella foenum-graecum) that is involved in galactomannan synthesis. Truncated coding sequences of the genes were cloned into plasmid vectors and expressed in a Sf9 insect cell-culture system. The heterologous proteins were purified, and in vitro assays showed that, when incubated with UDP-xylose and cellotetraose, cellopentaose or cellohexaose, PrGT34B showed xylosyltransferase activity, and, when incubated with UDP-galactose and the same cello-oligosaccharides, PrGT34B showed some galactosyltransferase activity. The ratio of xylosyltransferase to galactosyltransferase activity was 434:1. Hydrolysis of the galactosyltransferase reaction products using galactosidases showed the linkages formed were α-linkages. Analysis of the products of PrGT34B by MALDI-TOF MS showed that up to three xylosyl residues were transferred from UDP-xylose to cellohexaose. The heterologous proteins PrGT34A and PrGT34C showed no detectable enzymatic activity.

  12. Trees and Roots.

    ERIC Educational Resources Information Center

    Jones, Lethonee A.

    Constructing a family history can be significant in helping persons understand and appreciate the root system that supports and sustains them. Oral history can be a valuable resource in family research as Alex Haley demonstrated in writing "Roots." The major difficulty of using oral tradition in tracing a family history is that family…

  13. Irrational Square Roots

    ERIC Educational Resources Information Center

    Misiurewicz, Michal


    If students are presented the standard proof of irrationality of [square root]2, can they generalize it to a proof of the irrationality of "[square root]p", "p" a prime if, instead of considering divisibility by "p", they cling to the notions of even and odd used in the standard proof?

  14. The Roots of Literacy.

    ERIC Educational Resources Information Center

    Goodman, Yetta M.

    This review of research with children aged two to six on their reading, writing, and oral language development speaks of five roots of a tree of literate life that require nourishment in the soil of a written language environment. The roots discussed are the development of print awareness in situational contexts, the development of print awareness…

  15. Root Nutrient Foraging1

    PubMed Central

    Giehl, Ricardo F.H.; von Wirén, Nicolaus


    During a plant's lifecycle, the availability of nutrients in the soil is mostly heterogeneous in space and time. Plants are able to adapt to nutrient shortage or localized nutrient availability by altering their root system architecture to efficiently explore soil zones containing the limited nutrient. It has been shown that the deficiency of different nutrients induces root architectural and morphological changes that are, at least to some extent, nutrient specific. Here, we highlight what is known about the importance of individual root system components for nutrient acquisition and how developmental and physiological responses can be coupled to increase nutrient foraging by roots. In addition, we review prominent molecular mechanisms involved in altering the root system in response to local nutrient availability or to the plant's nutritional status. PMID:25082891

  16. Root nutrient foraging.


    Giehl, Ricardo F H; von Wirén, Nicolaus


    During a plant's lifecycle, the availability of nutrients in the soil is mostly heterogeneous in space and time. Plants are able to adapt to nutrient shortage or localized nutrient availability by altering their root system architecture to efficiently explore soil zones containing the limited nutrient. It has been shown that the deficiency of different nutrients induces root architectural and morphological changes that are, at least to some extent, nutrient specific. Here, we highlight what is known about the importance of individual root system components for nutrient acquisition and how developmental and physiological responses can be coupled to increase nutrient foraging by roots. In addition, we review prominent molecular mechanisms involved in altering the root system in response to local nutrient availability or to the plant's nutritional status.

  17. Age and site-related patterns of carbon allocation to wood, foliage and roots on reclaimed kaolin mines in Georgia

    SciTech Connect

    Legerski, A.; Hendrick, R.; Ogden, E.


    We quantified merchantable stand volume, leaf area indices (LAI), and root densities in twelve Pinus taeda L. forests growing on reclaimed kaolin mines in Georgia. Stands were 11 to 36 yrs old, and formed two productivity classes, Projected wood volume on the poor sites ranged 104 to 142 m{sup 3}/ha and from 164 to 298 on the better sites. LAI was not related to age on either the good or poor sites, LAIs reach their maximal values early in stand development (<12 yrs). Fine roots (0-1 mm) within the upper 1 m were most abundant on the poorer sites. Roots were nearly absent at depths>50 cm in stands aged 14 or less, but neatly equal in density to surface roots in the older stands. Stand age was strongly and negatively related to fine root density on both site types. Densities of larger, more perennial roots (1-2 mm) decreased with stand age on poor sites and increased on good sites. Stand productivity is closely related to LAI, and root densities show that trees allocate more energy into fine, absorbing roots on the poorer sites. Deep fine root densities indicate that trees must explore progressively greater volumes of soil to meet water and nutritional needs in reclaimed soils.

  18. The role of mesophyll conductance during water stress and recovery in tobacco (Nicotiana sylvestris): acclimation or limitation?


    Galle, Alexander; Florez-Sarasa, Igor; Tomas, Magdalena; Pou, Alicia; Medrano, Hipolito; Ribas-Carbo, Miquel; Flexas, Jaume


    While the responses of photosynthesis to water stress have been widely studied, acclimation to sustained water stress and recovery after re-watering is poorly understood. In particular, the factors limiting photosynthesis under these conditions, and their possible interactions with other environmental conditions, are unknown. To assess these issues, changes of photosynthetic CO(2) assimilation (A(N)) and its underlying limitations were followed during prolonged water stress and subsequent re-watering in tobacco (Nicotiana sylvestris) plants growing under three different climatic conditions: outdoors in summer, outdoors in spring, and indoors in a growth chamber. In particular, the regulation of stomatal conductance (g(s)), mesophyll conductance to CO(2) (g(m)), leaf photochemistry (chlorophyll fluorescence), and biochemistry (V(c,max)) were assessed. Leaf gas exchange and chlorophyll fluorescence data revealed that water stress induced a similar degree of stomatal closure and decreased A(N) under all three conditions, while V(c,max) was unaffected. However, the behaviour of g(m) differed depending on the climatic conditions. In outdoor plants, g(m) strongly declined with water stress, but it recovered rapidly (1-2 d) after re-watering in spring while it remained low many days after re-watering in summer. In indoor plants, g(m) initially declined with water stress, but then recovered to control values during the acclimation period. These differences were reflected in different velocities of recovery of A(N) after re-watering, being the slowest in outdoor summer plants and the fastest in indoor plants. It is suggested that these differences among the experiments are related to the prevailing climatic conditions, i.e. to the fact that stress factors other than water stress have been superimposed (e.g. excessive light and elevated temperature). In conclusion, besides g(s), g(m) contributes greatly to the limitation of photosynthesis during water stress and during

  19. Procerum root disease physiology and disease interactions with ozone

    SciTech Connect

    Carlson, J.A.


    Procerum root disease of eastern white pine (Pinus strobus L.), caused by Leptographium procerum (Kendr.) Wingf., has been epidemic in Virginia Christmas tree plantations since 1990. Symptoms of chlorosis, wilt, and decreased apical growth resemble those of water stress. Resin infiltration of the xylem at the stem base may be responsible for vascular occlusion leading to severe water deficits and mortality. The pathogen has been isolated from the roots of ozone-sensitive eastern white pines in the field, although not from nearby tolerant trees. Ozone sensitivity may predispose the trees to infection. This study investigates the physiology of diseased white pines, and looks at the effects of ozone fumigation on disease development. Impacts of vascular occlusion upon host water relations and gas exchange were investigated in 8-yr-old, plantation-grown, white pine Christmas trees. Disease severity was estimated as the proportion of resin-soaked cross-sectional area at the base of the stem. The linear response of six physiological variables to disease severity was highly significant. Pre-dawn water potential, daily change in pre-dawn to mid-day water potential, stomatal conductance, and photosynthetic and transpiration rates all decreased significantly with increasing disease severity. Fumigation studies were conducted on white and loblolly (P. taeda L.) pine seedlings to determine if ozone exposure increased the incidence of root disease or the amount of stem tissue colonized by L. procerum. Six weeks post-inoculation, root and stem tissue were plated on a medium selective for L. procerum. Ozone treatment did not significantly affect the proportion of diseased roots per seedling or the vertical colonization of stem tissue in seedlings of either species.

  20. Root hydrotropism: an update.


    Cassab, Gladys I; Eapen, Delfeena; Campos, María Eugenia


    While water shortage remains the single-most important factor influencing world agriculture, there are very few studies on how plants grow in response to water potential, i.e., hydrotropism. Terrestrial plant roots dwell in the soil, and their ability to grow and explore underground requires many sensors for stimuli such as gravity, humidity gradients, light, mechanical stimulations, temperature, and oxygen. To date, extremely limited information is available on the components of such sensors; however, all of these stimuli are sensed in the root cap. Directional growth of roots is controlled by gravity, which is fixed in direction and intensity. However, other environmental factors, such as water potential gradients, which fluctuate in time, space, direction, and intensity, can act as a signal for modifying the direction of root growth accordingly. Hydrotropism may help roots to obtain water from the soil and at the same time may participate in the establishment of the root system. Current genetic analysis of hydrotropism in Arabidopsis has offered new players, mainly AHR1, NHR1, MIZ1, and MIZ2, which seem to modulate how root caps sense and choose to respond hydrotropically as opposed to other tropic responses. Here we review the mechanism(s) by which these genes and the plant hormones abscisic acid and cytokinins coordinate hydrotropism to counteract the tropic responses to gravitational field, light or touch stimuli. The biological consequence of hydrotropism is also discussed in relation to water stress avoidance.

  1. Genetic population structure of three Armillaria species at the landscape scale: a case study from Swiss Pinus mugo forests.


    Bendel, Muriel; Kienast, Felix; Rigling, Daniel


    Armillaria species are plant pathogens that cause Armillaria root rot and are known to cause mortality of mountain pines (Pinus mugo) in the Swiss National Park in the Central Alps. The identity of isolates and the spatially explicit population structure of the Armillaria species were investigated in a 3.3km(2) study area in the Swiss National Park. In total, 242 Armillaria isolates, 205 from wood samples and 37 from epiphytic rhizomorphs, were collected. Species were identified using haploid-diploid pairings and genets were determined using intraspecific somatic incompatibility tests. The population structure differed markedly among the Armillaria species. A. cepistipes and A. borealis mainly occurred as genets of small spatial extent (mean 0.2ha, and 0.6ha), whereas A. ostoyae formed significantly larger genets (mean 6.8ha). The largest A. ostoyae genet extended over approx. 37ha. Several disease centres associated with Heterobasidion annosum were found to be embedded within large Armillaria genets. The extension of large A. ostoyae genets suggests that forests that occupy the study area have developed in the presence of these Armillaria genets. The finding of large Armillaria genets supports the assumption that large genets occur in areas with cold climate and little precipitation.

  2. Effect of diflubenzuron on the development of Pinus pinaster seedlings inoculated with the ectomycorrhizal fungus Pisolithus tinctorius.


    Ramos, Miguel A; Sousa, Nadine R; Franco, Albina R; Costa, Vítor; Oliveira, Rui S; Castro, Paula M L


    Diflubenzuron (DFB) is an insecticide commonly used to control forest pests. The objectives of this study were to assess the effect of diflubenzuron on the development of Pinus pinaster seedlings and Pisolithus tinctorius under laboratory conditions and to study the possible protective role of this ectomycorrhizal fungus against the effects of diflubenzuron. In vitro experiments revealed that diflubenzuron inhibited fungal growth at all tested concentrations (0.01, 0.1, 1, 10 and 100 mg L(-1)). Root growth was inhibited at the two highest diflubenzuron concentrations. The activity of the antioxidant defence system of non-inoculated P. pinaster increased at 1 and 10 mg DFB kg(-1) substrate, and inoculation increased the threshold to the highest concentration. The protective role of the ectomycorrhizal fungus was seen in the increase of CAT activity. This study revealed that despite causing no mortality, diflubenzuron has the ability to cause sub-lethal damage to P. pinaster. The disproportionate use of this insecticide may lead to higher amounts of its residues in soil and the biosphere, endangering trees, fungi and their symbiosis.

  3. Urbanization in China drives soil acidification of Pinus massoniana forests.


    Huang, Juan; Zhang, Wei; Mo, Jiangming; Wang, Shizhong; Liu, Juxiu; Chen, Hao


    Soil acidification instead of alkalization has become a new environmental issue caused by urbanization. However, it remains unclear the characters and main contributors of this acidification. We investigated the effects of an urbanization gradient on soil acidity of Pinus massoniana forests in Pearl River Delta, South China. The soil pH of pine forests at 20-cm depth had significantly positive linear correlations with the distance from the urban core of Guangzhou. Soil pH reduced by 0.44 unit at the 0-10 cm layer in urbanized areas compared to that in non-urbanized areas. Nitrogen deposition, mean annual temperature and mean annual precipitation were key factors influencing soil acidification based on a principal component analysis. Nitrogen deposition showed significant linear relationships with soil pH at the 0-10 cm (for ammonium N(NH4+(-N)), P < 0.05; for nitrate N(NO3-(-N)), P < 0.01) and 10-20 cm (for NO3-(-N), P < 0.05) layers. However, there was no significant loss of exchangeable non-acidic cations along the urbanization gradient, instead their levels were higher in urban than in urban/suburban area at the 0-10 cm layer. Our results suggested N deposition particularly under the climate of high temperature and rainfall, greatly contributed to a significant soil acidification occurred in the urbanized environment.

  4. Multisite inhibition of Pinus pinea isocitrate lyase by phosphate.


    Ranaldi, F; Vanni, P; Giachetti, E


    Our results show that the phosphate ion is a nonlinear competitive inhibitor of Pinus pinea isocitrate lyase. In addition, this compound induces a sigmoidal response of the enzyme, which usually exhibits standard Michaelis-Menten kinetics. This peculiar behavior of P. pinea isocitrate lyase could be explained by a dimer (two-site) model, in which phosphate binds cooperatively, but the affinity of the vacant site for substrate (the magnesium-isocitrate complex) remains the same. As a result, the interaction of phosphate with free enzyme produces an inhibitor-enzyme-inhibitor species that is of significant importance in determining reaction rate; a possible regulatory role of the glyoxylate cycle by inorganic phosphate is suggested. The mode of phosphate inhibition is consistent with both the mechanism for magnesium ion activation of P. pinea isocitrate lyase and its site heterogeneity. Our results explain the cooperative effects observed by some authors in kinetic studies of isocitrate lyase carried out in phosphate buffers and also account for the higher K(m) values determined by using such assay systems. Phosphate buffer should be avoided in performing isocitrate lyase kinetics.

  5. [Soil microbial functional diversity of different altitude Pinus koraiensis forests].


    Han, Dong-xue; Wang, Ning; Wang, Nan-nan; Sun, Xue; Feng, Fu-juan


    In order to comprehensively understand the soil microbial carbon utilization characteristics of Pinus koraiensis forests, we took the topsoil (0-5 cm and 5-10 cm) along the 700-1100 m altitude in Changbai Mountains and analyzed the vertical distributed characteristics and variation of microbial functional diversity along the elevation gradient by Biolog microplate method. The results showed that there were significant differences in functional diversity of microbial communities at different elevations. AWCD increased with the extension of incubation time and AWCD at the same soil depth gradually decreased along with increasing altitude; Shannon, Simpson and McIntosh diversity index also showed the same trend with AWCD and three different diversity indices were significantly different along the elevation gradient; Species diversity and functional diversity showed the same variation. The utilization intensities of six categories carbon sources had differences while amino acids were constantly the most dominant carbon source. Principal component analysis (PCA) identified that soil microbial carbon utilization at different altitudes had obvious spatial differentiation, as reflected in the use of carbohydrates, amino acids and carboxylic acids. In addition, the cluster of the microbial diversity indexes and AWCD values of different altitudes showed that the composition of vegetation had a significant impact on soil microbial composition and functional activity.

  6. Urbanization in China drives soil acidification of Pinus massoniana forests

    NASA Astrophysics Data System (ADS)

    Huang, Juan; Zhang, Wei; Mo, Jiangming; Wang, Shizhong; Liu, Juxiu; Chen, Hao


    Soil acidification instead of alkalization has become a new environmental issue caused by urbanization. However, it remains unclear the characters and main contributors of this acidification. We investigated the effects of an urbanization gradient on soil acidity of Pinus massoniana forests in Pearl River Delta, South China. The soil pH of pine forests at 20-cm depth had significantly positive linear correlations with the distance from the urban core of Guangzhou. Soil pH reduced by 0.44 unit at the 0-10 cm layer in urbanized areas compared to that in non-urbanized areas. Nitrogen deposition, mean annual temperature and mean annual precipitation were key factors influencing soil acidification based on a principal component analysis. Nitrogen deposition showed significant linear relationships with soil pH at the 0-10 cm (for ammonium N (-N), P < 0.05 for nitrate N (-N), P < 0.01) and 10-20 cm (for -N, P < 0.05) layers. However, there was no significant loss of exchangeable non-acidic cations along the urbanization gradient, instead their levels were higher in urban than in urban/suburban area at the 0-10 cm layer. Our results suggested N deposition particularly under the climate of high temperature and rainfall, greatly contributed to a significant soil acidification occurred in the urbanized environment.

  7. Association genetics of the loblolly pine (Pinus taeda, Pinaceae) metabolome.


    Eckert, Andrew J; Wegrzyn, Jill L; Cumbie, W Patrick; Goldfarb, Barry; Huber, Dudley A; Tolstikov, Vladimir; Fiehn, Oliver; Neale, David B


    The metabolome of a plant comprises all small molecule metabolites, which are produced during cellular processes. The genetic basis for metabolites in nonmodel plants is unknown, despite frequently observed correlations between metabolite concentrations and stress responses. A quantitative genetic analysis of metabolites in a nonmodel plant species is thus warranted. Here, we use standard association genetic methods to correlate 3563 single nucleotide polymorphisms (SNPs) to concentrations of 292 metabolites measured in a single loblolly pine (Pinus taeda) association population. A total of 28 single locus associations were detected, representing 24 and 20 unique SNPs and metabolites, respectively. Multilocus Bayesian mixed linear models identified 2998 additional associations for a total of 1617 unique SNPs associated to 255 metabolites. These SNPs explained sizeable fractions of metabolite heritabilities when considered jointly (56.6% on average) and had lower minor allele frequencies and magnitudes of population structure as compared with random SNPs. Modest sets of SNPs (n = 1-23) explained sizeable portions of genetic effects for many metabolites, thus highlighting the importance of multi-SNP models to association mapping, and exhibited patterns of polymorphism consistent with being linked to targets of natural selection. The implications for association mapping in forest trees are discussed.

  8. Antioxidative properties of the essential oil from Pinus mugo.


    Grassmann, Johanna; Hippeli, Susanne; Vollmann, Renate; Elstner, Erich F


    The essential oil from Pinus mugo (PMEO) was tested on its antioxidative capacity. For this purpose, several biochemical test systems were chosen (e.g., the Fenton System, the xanthine oxidase assay, or the copper-induced oxidation of low-density lipoprotein (LDL)). The results show that there is moderate or weak antioxidative activity when tested in aqueous environments, like in the Fenton system, xanthine oxidase induced superoxide radical formation, or in the HOCl driven fragmentation of 1-aminocyclopropane-1-carboxylic acid (ACC). In contrast, when tested in more lipophilic environments (e.g., the ACC-cleavage by activated neutrophils in whole blood) the PMEO exhibits good antioxidative activity. PMEO does also show good antioxidative capacity in another lipophilic test system (i.e., the copper induced oxidation of LDL). Some components of PMEO (i.e., Delta(3)-carene, camphene, alpha-pinene, (+)-limonene and terpinolene) were also tested. As the PMEO, they showed weak or no antioxidant activity in aqueous environments, but some of them were effective antioxidants regarding ACC-cleavage by activated neutrophils in whole blood or copper-induced LDL-oxidation. Terpinolene, a minor component of PMEO, exhibited remarkable protection against LDL-oxidation.

  9. Nitrogen metabolism in Lignifying Pinus taeda cell cultures

    NASA Technical Reports Server (NTRS)

    van Heerden, P. S.; Towers, G. H.; Lewis, N. G.


    The primary metabolic fate of phyenylalanine, following its deamination in plants, is conscription of its carbon skeleton for lignin, suberin, flavonoid, and related metabolite formation. Since this accounts for approximately 30-40% of all organic carbon, an effective means of recycling the liberated ammonium ion must be operative. In order to establish how this occurs, the uptake and metabolism of various 15N-labeled precursors (15N-Phe, 15NH4Cl, 15N-Gln, and 15N-Glu) in lignifying Pinus taeda cell cultures was investigated, using a combination of high performance liquid chromatography, 15N NMR, and gas chromatograph-mass spectrometry analyses. It was found that the ammonium ion released during active phenylpropanoid metabolism was not made available for general amino acid/protein synthesis. Rather it was rapidly recycled back to regenerate phenylalanine, thereby providing an effective means of maintaining active phenylpropanoid metabolism with no additional nitrogen requirement. These results strongly suggest that, in lignifying cells, ammonium ion reassimilation is tightly compartmentalized.

  10. [Relationship between selection of Pinus massoniana families and Folium Pini].


    Zhao, Man-xi; Yan, Cui-qi; Wang, Wei; Ye, Jian-ming; Zhong, Yong-kun; Ke, Zun-hong; Hao, Xiao-feng; Ke, Xiao; Ye, Liang; Huang, Lu-qi


    Based on variation of Pinus massoniana families, heritablility and correlation analysis, the contents of shikimic acid and procyanidine (heritability 0.90, 0.70), dry weight of single branch (heritability 0.60) and and leaf length (heritability 0.46) were screened out as quality, yield and harvest cost traits of Folium Pini, respectively. For the different medicinal application of Folium Pini, varied methods were chosen to estimate weight and construct index equation. Weight adjustment based.on equal emphasis were used as economic weight determining method to select the best families, and the index (accuracy 0. 936 4 and heritability 0. 881 6) obtained was a little better than that obtained by equal emphasis, and much better than that by restricted index. The superior families selected with adjustment weight and equal emphasis were No. 46, 43 and 28. Partial regression were used as economic weight determining method to select the best families,and the index obtained had the highest accuracy (0.941 5) , index heritability (0. 889 9) and the genetic gain of shikimic acid content. The superior families selected with this method were No. 46, 27 and 47. No. 46 was the best families with maximal economic benefit. Our study indicated that suitable method for estimate weight and construct index equation can be applied for better accuracy of superior families selection of P. massoniana.

  11. Urbanization in China drives soil acidification of Pinus massoniana forests

    PubMed Central

    Huang, Juan; Zhang, Wei; Mo, Jiangming; Wang, Shizhong; Liu, Juxiu; Chen, Hao


    Soil acidification instead of alkalization has become a new environmental issue caused by urbanization. However, it remains unclear the characters and main contributors of this acidification. We investigated the effects of an urbanization gradient on soil acidity of Pinus massoniana forests in Pearl River Delta, South China. The soil pH of pine forests at 20-cm depth had significantly positive linear correlations with the distance from the urban core of Guangzhou. Soil pH reduced by 0.44 unit at the 0–10 cm layer in urbanized areas compared to that in non-urbanized areas. Nitrogen deposition, mean annual temperature and mean annual precipitation were key factors influencing soil acidification based on a principal component analysis. Nitrogen deposition showed significant linear relationships with soil pH at the 0–10 cm (for ammonium N (-N), P < 0.05; for nitrate N (-N), P < 0.01) and 10–20 cm (for -N, P < 0.05) layers. However, there was no significant loss of exchangeable non-acidic cations along the urbanization gradient, instead their levels were higher in urban than in urban/suburban area at the 0–10 cm layer. Our results suggested N deposition particularly under the climate of high temperature and rainfall, greatly contributed to a significant soil acidification occurred in the urbanized environment. PMID:26400019

  12. Antinociceptive and antiinflammatory activities of pine (Pinus densiflora) pollen extract.


    Choi, Eun-Mi


    The study aimed to evaluate the antinociceptive and antiinflammatory activity of pine (Pinus densiflora) pollen in mice. The antinociceptive activity was determined using acetic acid-induced abdominal constriction and formalin-induced licking, and the hot plate test. Antiinflammatory effects were evaluated using carrageenan- and formalin-induced paw edema, and arachidonic acid-induced ear edema in mice. The ethanol extract of pine pollen (100 and 200 mg/kg, p.o.) produced a significant inhibition of both phases of the formalin pain test in mice, a reduction in mouse writhing induced by acetic acid and an elevation of the pain threshold in the hot plate test in mice. The pine pollen extract also produced a significant inhibition of carrageenan- and formalin-induced paw edema as well as arachidonic acid-induced ear edema in mice. The inhibitions were similar to those produced by aminopyrine and indomethacin, p.o. The different polyphenols found in pine pollen could account for the antinociceptive and antiinflammatory actions. The results obtained indicate that the extract possesses analgesic and antiinflammatory effects.

  13. Antioxidant, antimutagenic, and antitumor effects of pine needles (Pinus densiflora).


    Kwak, Chung Shil; Moon, Sung Chae; Lee, Mee Sook


    Pine needles (Pinus densiflora Siebold et Zuccarini) have long been used as a traditional health-promoting medicinal food in Korea. To investigate their potential anticancer effects, antioxidant, antimutagenic, and antitumor activities were assessed in vitro and/or in vivo. Pine needle ethanol extract (PNE) significantly inhibited Fe(2+)-induced lipid peroxidation and scavenged 1,1-diphenyl- 2-picrylhydrazyl radical in vitro. PNE markedly inhibited mutagenicity of 2-anthramine, 2-nitrofluorene, or sodium azide in Salmonella typhimurium TA98 or TA100 in Ames tests. PNE exposure effectively inhibited the growth of cancer cells (MCF-7, SNU-638, and HL-60) compared with normal cell (HDF) in 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay. In in vivo antitumor studies, freeze-dried pine needle powder supplemented (5%, wt/wt) diet was fed to mice inoculated with Sarcoma-180 cells or rats treated with mammary carcinogen, 7,12-dimethylbenz[a]anthracene (DMBA, 50 mg/kg body weight). Tumorigenesis was suppressed by pine needle supplementation in the two model systems. Moreover, blood urea nitrogen and aspartate aminotransferase levels were significantly lower in pine needle-supplemented rats in the DMBA-induced mammary tumor model. These results demonstrate that pine needles exhibit strong antioxidant, antimutagenic, and antiproliferative effects on cancer cells and also antitumor effects in vivo and point to their potential usefulness in cancer prevention.

  14. [Cold hardiness of Pinus ponderosa, P. banksian and P. tabulaeformis].


    Gong, Yuehua; Zhou, Yongxue; Fan, Junfeng; Liu, Yingzhou; Pang, Kejia


    By the method of artificial freezing, this paper made a comparative study on the cold hardiness of Pinus ponderosa, P. banksiana and P. tabulaeformis, with their inherent mechanisms approached. The results showed that the cold hardiness of these three species was in the sequence of P. banksiana > P. tabulaeformis > P. ponderosa. P. banksiana had high bound water/free water ratio (7.0) and ABA content (164.3 microg x g(-1) FW) but low K+ (2450 microg x g(-1) DW) and soluble sugar (12.0%) , P. tabulaeformis had higher contents of ABA (95.8 microg x g(-1) FW), K+ (4538 microg x g(-1) DW) and soluble sugar (18.68%) but low bound water/free water ratio (2.58), while P. ponderosa had high soluble sugar content (18.05%) but low bound water/free water ratio (2.18) and K+ (2275 microg x g(-1) DW) and ABA (63.3 microg x g(-1) FW) contents. These differences might be the reasons resulting in the different cold hardiness of these three species. Low chlorophyll content and high carotenoid/chlorophyll ratio might also contribute to the cold hardiness of P. banksiana. Therefore, though the test species are all of cold hardiness, their inherent mechanisms may be different.

  15. Flow cytometric and morphological analyses of Pinus pinaster somatic embryogenesis.


    Marum, Liliana; Loureiro, João; Rodriguez, Eleazar; Santos, Conceição; Oliveira, M Margarida; Miguel, Célia


    An approach combining morphological profiling and flow cytometric analysis was used to assess genetic stability during the several steps of somatic embryogenesis in Pinus pinaster. Embryogenic cell lines of P. pinaster were established from immature zygotic embryos excised from seeds obtained from open-pollinated trees. During the maturation stage, phenotype of somatic embryos was characterized as being either normal or abnormal. Based upon the prevalent morphological traits, different types of abnormal embryos underwent further classification and quantification. Nuclear DNA content of maritime pine using the zygotic embryos was estimated to be 57.04 pg/2C, using propidium iodide flow cytometry. According to the same methodology, no significant differences (P< or =0.01) in DNA ploidy were detected among the most frequently observed abnormal phenotypes, embryogenic cell lines, zygotic and normal somatic embryos, and somatic embryogenesis-derived plantlets. Although the differences in DNA ploidy level do not exclude the occurrence of a low level of aneuploidy, the results obtained point to the absence of major changes in ploidy level during the somatic embryogenesis process of this economically important species. Therefore, our primary goal of true-to-typeness was assured at this level.

  16. Pharmaceutical and nutraceutical effects of Pinus pinaster bark extract.


    Iravani, S; Zolfaghari, B


    In everyday life, our body generates free radicals and other reactive oxygen species which are derived either from the endogenous metabolic processes (within the body) or from external sources. Many clinical and pharmacological studies suggest that natural antioxidants can prevent oxidative damage. Among the natural antioxidant products, Pycnogenol(®) (French Pinus pinaster bark extract) has been received considerable attention because of its strong free radical-scavenging activity against reactive oxygen and nitrogen species. P. pinaster bark extract (PBE) contains polyphenolic compounds (these compounds consist of catechin, taxifolin, procyanidins of various chain lengths formed by catechin and epicatechin units, and phenolic acids) capable of producing diverse potentially protective effects against chronic and degenerative diseases. This herbal medication has been reported to have cardiovascular benefits, such as vasorelaxant activity, angiotensin-converting enzyme inhibiting activity, and the ability to enhance the microcirculation by increasing capillary permeability. Moreover, effects on the immune system and modulation of nitrogen monoxide metabolism have been reported. This article provides a brief overview of clinical studies describing the beneficial and health-promoting effects of PBE.

  17. Tree stability under wind: simulating uprooting with root breakage using a finite element method

    PubMed Central

    Yang, Ming; Défossez, Pauline; Danjon, Frédéric; Fourcaud, Thierry


    Background and Aims Windstorms are the major natural hazard affecting European forests, causing tree damage and timber losses. Modelling tree anchorage mechanisms has progressed with advances in plant architectural modelling, but it is still limited in terms of estimation of anchorage strength. This paper aims to provide a new model for root anchorage, including the successive breakage of roots during uprooting. Methods The model was based on the finite element method. The breakage of individual roots was taken into account using a failure law derived from previous work carried out on fibre metal laminates. Soil mechanical plasticity was considered using the Mohr–Coulomb failure criterion. The mechanical model for roots was implemented in the numerical code ABAQUS using beam elements embedded in a soil block meshed with 3-D solid elements. The model was tested by simulating tree-pulling experiments previously carried out on a tree of Pinus pinaster (maritime pine). Soil mechanical parameters were obtained from laboratory tests. Root system architecture was digitized and imported into ABAQUS while root material properties were estimated from the literature. Key Results Numerical simulations of tree-pulling tests exhibited realistic successive root breakages during uprooting, which could be seen in the resulting response curves. Broken roots could be visually located within the root system at any stage of the simulations. The model allowed estimation of anchorage strength in terms of the critical turning moment and accumulated energy, which were in good agreement with in situ measurements. Conclusions This study provides the first model of tree anchorage strength for P. pinaster derived from the mechanical strength of individual roots. The generic nature of the model permits its further application to other tree species and soil conditions. PMID:25006178

  18. Economic strategies of plant absorptive roots vary with root diameter

    NASA Astrophysics Data System (ADS)

    Kong, D. L.; Wang, J. J.; Kardol, P.; Wu, H. F.; Zeng, H.; Deng, X. B.; Deng, Y.


    Plant roots typically vary along a dominant ecological axis, the root economics spectrum, depicting a tradeoff between resource acquisition and conservation. For absorptive roots, which are mainly responsible for resource acquisition, we hypothesized that root economic strategies differ with increasing root diameter. To test this hypothesis, we used seven plant species (a fern, a conifer, and five angiosperms from south China) for which we separated absorptive roots into two categories: thin roots (thickness of root cortex plus epidermis < 247 µm) and thick roots. For each category, we analyzed a range of root traits related to resource acquisition and conservation, including root tissue density, different carbon (C), and nitrogen (N) fractions (i.e., extractive, acid-soluble, and acid-insoluble fractions) as well as root anatomical traits. The results showed significant relationships among root traits indicating an acquisition-conservation tradeoff for thin absorptive roots while no such trait relationships were found for thick absorptive roots. Similar results were found when reanalyzing data of a previous study including 96 plant species. The contrasting economic strategies between thin and thick absorptive roots, as revealed here, may provide a new perspective on our understanding of the root economics spectrum.

  19. Changes in soil quality after converting Pinus to Eucalyptus plantations in southern China

    NASA Astrophysics Data System (ADS)

    Zhang, K.; Zheng, H.; Chen, F. L.; Ouyang, Z. Y.; Wang, Y.; Wu, Y. F.; Lan, J.; Fu, M.; Xiang, X. W.


    Vegetation plays a key role in maintaining soil quality, but long-term changes in soil quality due to plant species change and successive planting are rarely reported. Using the space-for-time substitution method, adjacent plantations of Pinus and first, second, third and fourth generations of Eucalyptus in Guangxi, China were used to study changes in soil quality caused by converting Pinus to Eucalyptus and successive Eucalyptus planting. Soil chemical and biological properties were measured and a soil quality index was calculated using principal component analysis. Soil organic carbon, total nitrogen, alkaline hydrolytic nitrogen, microbial biomass carbon, microbial biomass nitrogen, cellobiosidase, phenol oxidase, peroxidase and acid phosphatase activities were significantly lower in the first and second generations of Eucalyptus plantations compared with Pinus plantation, but they were significantly higher in the third and fourth generations than in the first and second generations and significantly lower than in Pinus plantation. Soil total and available potassium were significantly lower in Eucalyptus plantations (1.8-2.5 g kg-1 and 26-66 mg kg-1) compared to the Pinus plantation (14.3 g kg-1 and 92 mg kg-1), but total phosphorus was significantly higher in Eucalyptus plantations (0.9-1.1 g kg-1) compared to the Pinus plantation (0.4 g kg-1). As an integrated indicator, soil quality index was highest in the Pinus plantation (0.92) and lowest in the first and second generations of Eucalyptus plantations (0.24 and 0.13). Soil quality index in the third and fourth generations (0.36 and 0.38) was between that in Pinus plantation and in first and second generations of Eucalyptus plantations. Changing tree species, reclamation and fertilization may have contributed to the change observed in soil quality during conversion of Pinus to Eucalyptus and successive Eucalyptus planting. Litter retention, keeping understorey coverage, and reducing soil disturbance during

  20. Quantitative measurements of root water uptake and root hydraulic conductivities

    NASA Astrophysics Data System (ADS)

    Zarebanadkouki, Mohsen; Javaux, Mathieu; Meunier, Felicien; Couvreur, Valentin; Carminati, Andrea


    How is root water uptake distributed along the root system and what root properties control this distribution? Here we present a method to: 1) measure root water uptake and 2) inversely estimate the root hydraulic conductivities. The experimental method consists in using neutron radiography to trace deuterated water (D2O) in soil and roots. The method was applied to lupines grown aluminium containers filled with a sandy soil. When the lupines were 4 weeks old, D2O was locally injected in a selected soil regions and its transport was monitored in soil and roots using time-series neutron radiography. By image processing, we quantified the concentration of D2O in soil and roots. We simulated the transport of D2O into roots using a diffusion-convection numerical model. The diffusivity of the roots tissue was inversely estimated by simulating the transport of D2O into the roots during night. The convective fluxes (i.e. root water uptake) were inversely estimating by fitting the experiments during day, when plants were transpiring, and assuming that root diffusivity did not change. The results showed that root water uptake was not uniform along the roots. Water uptake was higher at the proximal parts of the lateral roots and it decreased by a factor of 10 towards the distal parts. We used the data of water fluxes to inversely estimate the profile of hydraulic conductivities along the roots of transpiring plants growing in soil. The water fluxes in the lupine roots were simulated using the Hydraulic Tree Model by Doussan et al. (1998). The fitting parameters to be adjusted were the radial and axial hydraulic conductivities of the roots. The results showed that by using the root architectural model of Doussan et al. (1998) and detailed information of water fluxes into different root segments we could estimate the profile of hydraulic conductivities along the roots. We also found that: 1) in a tap-rooted plant like lupine water is mostly taken up by lateral roots; (2) water

  1. A nitrogen fertilization field study of carbon-13 and nitrogen-15 transfers in ectomycorrhizas of Pinus sabiniana.


    Albarracín, María Victoria; Six, Johan; Houlton, Benjamin Z; Bledsoe, Caroline S


    Ectomycorrhizal (EM) fungi form relationships with higher plants; plants transfer C to fungi, and fungi transfer nutrients to their host. While evidence indicates that this interaction is largely mutualistic, less is known about how nutrient supply and EM associates may alter C and nutrient exchanges, especially in intact plant-soil-microbe systems in the field. In a dual-labeling experiment with N fertilization, we used C and N stable isotopes to examine in situ transfers in EM pine trees in a Pinus sabiniana woodland in northern California. We added (15)NH4SO2 and (13)CO2 to track (13)C transfer from pine needles to EM roots and (15)N transfer from soil to EM roots and pine needles. Transfers of (13)C and (15)N differed with EM morphotype and with N fertilization. The brown morphotype received the least C per unit of N transferred (5:1); in contrast red and gold morphotypes gained more C and transferred less N (17:1 and 25:1, respectively). N fertilization increased N retention by ectomycorrhizas (EMs) but did not increase N transfer from EMs to pine needles. Therefore N fertilization positively affected both nutrient and C gains by EMs, increasing net C flows and N retention in EMs. Our work on intact and native trees/EM associations thereby extends earlier conclusions based on pot studies with young plants and culturable EM fungi; our results support the concept that EM-host relationships depend on species-level differences as well as responses to soil resources such as N.

  2. [Effect of ectomycorrhizae on heavy metals sequestration by thermostable protein in rhizosphere of Pinus tabulaeformis under Cu and Cd stress].


    Zhang, Ying-Wei; Chai, Li-Wei; Wang, Dong-Wei; Wang, Jie; Huang, Yi


    Copper and cadmium in soil is a severe soil pollution problem in China. It is effective to remediate the soil by sequestrating Cu and Cd with tolerant plant and microorganism. Ectomycorrhizae could exude a large number of organic matter to reduce the biological effectiveness of heavy metals. Therefore, under Cu or Cd stress, thermostable protein in rhizosphere exuded by roots of pine seedling (Pinus tabulaeformis) associated with ectomycorrhizal fungi (Xerocomus chrysenteron) can have the potential of sequestration for heavy metals. The results illustrated that the association didn't impact on exudation of thermostable protein but treated with different concentrations of Cu, the total thermostable protein (TTP) and easily extracted thermostable protein (EETP) in mycorrhizal rhizosphere increased by 2.64 to 11.79 times compared with non-mycorrhizal one. While treated with Cd, it was 1.49 to 7.56 times. Further analysis of metal content in rhizosphere showed that association significantly increased the Cu sequestration in mycorrhizal rhizosphere where relative content of Cu was 1.81 to 2.75 times higher than those in non-mycorrhizal rhizosphere while most of Cu was sequestrated by thermostable protein, 4.19 to 43.00 times higher in protein than in root cell. Meanwhile results of Cd treatments showed a similar trend with Cu treatments. That indicated that under excessive heavy metals stress, ectomycorrhizal association facilitated the exudation of thermostable protein so as to extend the capacity of sequestration for excessive heavy metals and mitigate the phytotoxicity from heavy metals polluted soil.

  3. Paleoclimatic implications of glacial and postglacial refugia for Pinus pumila in western Beringia

    SciTech Connect

    Anderson, P M; Lozhkin, A V; Solomatkina, T B; Brown, T A


    Palynological results from Julietta Lake currently provide the most direct evidence to support the existence of a glacial refugium for Pinus pumila in mountains of southwestern Beringia. Both percentages and accumulation rates indicate the evergreen shrub survived until at least {approx}19,000 14C yr B.P. in the Upper Kolyma region. Percentage data suggest numbers dwindled into the late glaciation, whereas pollen accumulation rates point towards a more rapid demise shortly after {approx}19,000 14C yr B.P. Pinus pumila did not re-establish in any great numbers until {approx}8100 14C yr B.P., despite the local presence {approx}9800 14C yr B.P. of Larix dahurica, which shares similar summer temperature requirements. The postglacial thermal maximum (in Beringia {approx}11,000-9000 14C yr B.P.) provided Pinus pumila shrubs with equally harsh albeit different conditions for survival than those present during the LGM. Regional records indicate that in this time of maximum warmth Pinus pumila likely sheltered in a second, lower-elevation refugium. Paleoclimatic models and modern ecology suggest that shifts in the nature of seasonal transitions and not only seasonal extremes have played important roles in the history of Pinus pumila over the last {approx}21,000 14C yr B.P.

  4. Tree mortality patterns following prescribed fire for Pinus and Abies across the southwestern United States

    USGS Publications Warehouse

    van Mantgem, Philip J.; Nesmith, Jonathan C. B.; Keifer, MaryBeth; Brooks, Matthew


    The reintroduction of fire to historically fire-prone forests has been repeatedly shown to reduce understory fuels and promote resistance to high severity fire. However, there is concern that prescribed fire may also have unintended consequences, such as high rates of mortality for large trees and fire-tolerant Pinus species. To test this possibility we evaluated mortality patterns for two common genera in the western US, Pinus and Abies, using observations from a national-scale prescribed fire effects monitoring program. Our results show that mortality rates of trees >50 DBH were similar for Pinus (4.6% yr-1) and Abies (4.0% yr-1) 5 years following prescribed fires across seven sites in the southwestern US. In contrast, mortality rates of trees >50 cm DBH differed between Pinus (5.7% yr-1) and Abies (9.0% yr-1). Models of post-fire mortality probabilities suggested statistically significant differences between the genera (after including differences in bark thickness), but accounting for these differences resulted in only small improvements in model classification. Our results do not suggest unusually high post-fire mortality for large trees or for Pinus relative to the other common co-occurring genus, Abies, following prescribed fire in the southwestern US.

  5. Paleoclimatic implications of glacial and postglacial refugia for Pinus pumila in western Beringia

    NASA Astrophysics Data System (ADS)

    Anderson, Patricia M.; Lozhkin, Anatoly V.; Solomatkina, Tatiana B.; Brown, Thomas A.


    Palynological results from Julietta Lake currently provide the most direct evidence to support the existence of a glacial refugium for Pinus pumila in mountains of southwestern Beringia. Both percentages and accumulation rates indicate the evergreen shrub survived until at least ˜ 19,000 14C yr BP in the Upper Kolyma region. Percentage data suggest numbers dwindled into the late glaciation, whereas pollen accumulation rates point towards a more rapid demise shortly after ˜ 19,000 14C yr BP. Pinus pumila did not re-establish in any great numbers until ˜ 8100 14C yr BP, despite the local presence ˜ 9800 14C yr BP of Larixdahurica, which shares similar summer temperature requirements. The postglacial thermal maximum (in Beringia ˜ 11,000-9000 14C yr BP) provided Pinus pumila shrubs with equally harsh albeit different conditions for survival than those present during the LGM. Regional records indicate that in this time of maximum warmth Pinus pumila likely sheltered in a second, lower-elevation refugium. Paleoclimatic models and modern ecology suggest that shifts in the nature of seasonal transitions and not only seasonal extremes have played important roles in the history of Pinus pumila over the last ˜ 21,000 14C yr BP.

  6. Root lattices and quasicrystals

    NASA Astrophysics Data System (ADS)

    Baake, M.; Joseph, D.; Kramer, P.; Schlottmann, M.


    It is shown that root lattices and their reciprocals might serve as the right pool for the construction of quasicrystalline structure models. All noncrystallographic symmetries observed so far are covered in minimal embedding with maximal symmetry.

  7. Root lattices and quasicrystals

    NASA Astrophysics Data System (ADS)

    Baake, M.; Joseph, D.; Kramer, P.; Schlottmann, M.


    It is shown how root lattices and their reciprocals might serve as the right pool for the construction of quasicrystalline structure models. All non-periodic symmetries observed so far are covered in minimal embedding with maximal symmetry.

  8. A molecular identification protocol for roots of boreal forest tree species1

    PubMed Central

    Randall, Morgan J.; Karst, Justine; Pec, Gregory J.; Davis, Corey S.; Hall, Jocelyn C.; Cahill, James F.


    • Premise of the study: Roots play a key role in many ecological processes, yet our ability to identify species from bulk root samples is limited. Molecular tools may be used to identify species from root samples, but they have not yet been developed for most systems. Here we present a PCR-based method previously used to identify roots of grassland species, modified for use in boreal forests. • Methods: We used repeatable interspecific size differences in fluorescent amplified fragment length polymorphisms of three noncoding chloroplast DNA regions to identify seven woody species common to boreal forests in Alberta, Canada. • Results: Abies balsamea, Alnus crispa, Betula papyrifera, Pinus contorta, and Populus tremuloides were identifiable to species, while Picea glauca and Picea mariana were identifiable to genus. In mixtures of known composition of foliar DNA, species were identified with 98% accuracy using one region. Mixed root samples of unknown composition were identified with 100% accuracy; four species were identified using one region, while three species were identified using two regions. • Discussion: This methodology is accurate, efficient, and inexpensive, and thus a valuable approach for ecological studies of roots. Furthermore, this method has now been validated for both grassland and boreal forest systems, and thus may also have applications in any plant community. PMID:25383267

  9. A national scale estimation of soil carbon stocks of Pinus densiflora forests in Korea: a modelling approach

    NASA Astrophysics Data System (ADS)

    Yi, K.; Park, C.; Ryu, S.; Lee, K.; Yi, M.; Kim, C.; Park, G.; Kim, R.; Son, Y.


    Soil carbon (C) stocks of Pinus densiflora forests in Korea were estimated using a generic forest soil C dynamics model based on the process of dead organic matter input and decomposition. Annual input of dead organic matter to the soil was determined by stand biomass and turnover rates of tree components (stem, branch, twig, foliage, coarse root, and fine root). The model was designed to have a simplified structure consisting of three dead organic matter C (DOC) pools (aboveground woody debris (AWD), belowground woody debris (BWD), and litter (LTR) pool) and one soil organic C (SOC) pool. C flows in the model were regulated by six turnover rates of stem, branch, twig, foliage, coarse root, and fine root, and four decay rates of AWD, BWD, LTR, and SOC. To simulate the soil C stocks of P. densiflora forests, statistical data of forest land area (1,339,791 ha) and growing stock (191,896,089 m3) sorted by region (nine provinces and seven metropolitan cities) and stand age class (11 to 20- (II), 21 to 30- (III), 31 to 40- (IV), 41 to 50- (V), and 51 to 60-year-old (VI)) were used. The growing stock of each stand age class was calculated for every region and representable site index was also determined by consulting the yield table. Other model parameters related to the stand biomass, annual input of dead organic matter and decomposition were estimated from previous studies conducted on P. densiflora forests in Korea, which were also applied for model validation. As a result of simulation, total soil C stock of P. densiflora forests were estimated as 53.9 MtC and soil C stocks per unit area ranged from 28.71 to 47.81 tC ha-1 within the soil depth of 30 cm. Also, soil C stocks in the P. densiflora forests of age class II, III, IV, V, and VI were 16,780,818, 21,450,812, 12,677,872, 2,366,939, and 578,623 tC, respectively, and highly related to the distribution of age classes. Soil C stocks per unit area initially decreased with stand age class and started to increase

  10. Relationships between root diameter, root length and root branching along lateral roots in adult, field-grown maize

    PubMed Central

    Wu, Qian; Pagès, Loïc; Wu, Jie


    Background and Aims Root diameter, especially apical diameter, plays an important role in root development and function. The variation in diameter between roots, and along roots, affects root structure and thus the root system’s overall foraging performance. However, the effect of diameter variation on root elongation, branching and topological connections has not been examined systematically in a population of high-order roots, nor along the roots, especially for mature plants grown in the field. Methods A method combining both excavation and analysis was applied to extract and quantify root architectural traits of adult, field-grown maize plants. The relationships between root diameter and other root architectural characteristics are analysed for two maize cultivars. Key Results The basal diameter of the lateral roots (orders 1–3) was highly variable. Basal diameter was partly determined by the diameter of the bearing segment. Basal diameter defined a potential root length, but the lengths of most roots fell far short of this. This was explained partly by differences in the pattern of diameter change along roots. Diameter tended to decrease along most roots, with the steepness of the gradient of decrease depending on basal diameter. The longest roots were those that maintained (or sometimes increased) their diameters during elongation. The branching density (cm–1) of laterals was also determined by the diameter of the bearing segment. However, the location of this bearing segment along the mother root was also involved – intermediate positions were associated with higher densities of laterals. Conclusions The method used here allows us to obtain very detailed records of the geometry and topology of a complex root system. Basal diameter and the pattern of diameter change along a root were associated with its final length. These relationships are especially useful in simulations of root elongation and branching in source–sink models. PMID:26744490

  11. Development and characterization of SSR markers from Pinus massoniana and their transferability to P. elliottii, P. caribaea and P. yunnanensis.


    Feng, Y H; Yang, Z Q; Wang, J; Luo, Q F; Li, H G


    Pinus massoniana (Masson's pine) is a widespread tree species in central and southern China and northern Vietnam; it is valued for rosin and paper production. Despite the significant economic value of Masson's pine, little work has been done on its molecular genetics. We developed 318 SSR primers from genome sequences of P. massoniana, and we identified 10 polymorphic markers. The number of alleles in the population of P. massoniana that we examined ranged from two to four, and the Shannon diversity index ranged from 0.150 to 1.133. Cross-species transferability of the 318 SSRs was also analyzed in the slash pine (Pinus elliottii), the Caribbean pine (Pinus caribaea) and the Yunnan pine (Pinus yunnanensis); 15, 10, and 10 primer pairs generated polymorphic amplification, respectively. These sets of polymorphic SSR markers will be useful for population genetics studies of P. massoniana, for genetic identification of interspecific hybridization, and for phylogeographic studies of Pinus spp.

  12. Molecular characterization of a glutathione transferase from Pinus tabulaeformis (Pinaceae).


    Zeng, Qing-Yin; Lu, Hai; Wang, Xiao-Ru


    Glutathione transferases (GSTs) play important roles in stress tolerance and detoxification metabolism in plants. To date, studies on GSTs in higher plants have focused largely on agricultural plants. In contrast, there is virtually no information on the molecular characteristics of GSTs in gymnosperms. The present study reports for the first time the cloning, expression and characteristics of a GST gene (PtGSTU1) from a pine, Pinus tabulaeformis, which is widely distributed from northern to central China covering cold temperate and drought regions. The PtGSTU1 gene encodes a protein of 228 amino acid residues with a calculated molecular mass of 26.37 kDa. Reverse transcription PCR revealed that PtGSTU1 was expressed in different tissues, both above and below ground, of P. tabulaeformis. The over-expressed recombinant PtGSTU1 showed high activity towards the substrates 1-chloro-2,4-dinitrobenzene (CDNB) and 7-chloro-4-nitrobenzo-2-oxa-1,3-diazole (NBD-Cl). Kinetic analysis with respect to CDNB as substrate revealed a Km of 0.47 mM and Vmax of 169.1 micromol/min per mg of protein. The recombinant PtGSTU1 retained more than 60% of its maximum enzymatic activity from 15 degrees C to 45 degrees C with a broad optimum Tm range of 25 degrees C - 35 degrees C. The enzyme had a maximum activity at approximately pH 8.5 - 9.0. Site-directed mutagenesis revealed that Ser13 in the N-terminal domain is a critical catalytic residue, responsible for stabilisation of the thiolate anion of enzyme-bound glutathione. Based on comparative analyses of its amino acid sequence, phylogeny and predicted three-dimensional structure, the PtGSTU1 should be classified as a tau class GST.

  13. Phylogeography of Pinus subsection Australes in the Caribbean Basin

    PubMed Central

    Jardón-Barbolla, Lev; Delgado-Valerio, Patricia; Geada-López, Gretel; Vázquez-Lobo, Alejandra; Piñero, Daniel


    Background and Aims Four species of Pinus subsection Australes occur in the Caribbean Basin: P. caribaea, P. cubensis, P. maestrensis and P. occidentalis. This study analyses the phylogeography of these species to assess possible colonization events from Central America to the islands and subsequent population expansions during glacial periods driven by both drier climate and larger emerged land areas. Methods Allele size data were obtained for plastid microsatellites for 314 individuals from 24 populations, covering the distribution range of subsection Australes in the Caribbean Basin. Key Results In total, 113 plastid haplotypes were identified. The highest genetic diversity was found in populations of P. caribaea. Overall, Caribbean Basin populations fit the isolation by distance model. Significant phylogeographical structure was found (RST = 0·671 > permuted RST = 0·101; P < 0·0001). The haplotype network and a Bayesian analysis of population structure (BAPS) indicated different Central American origins for P. caribaea var. bahamensis and P. caribaea var. caribaea plastids, with Central America populations in northern and south-eastern groups. Sudden expansion times for BAPS clusters were close to three glacial maxima. Conclusions Central America contains ancestral plastid haplotypes. Population expansion has played a major role in the distribution of genetic diversity in P. caribaea var. hondurensis. Two colonization events gave rise to the P. caribaea var. bahamensis and P. caribaea var. caribaea lineages. Plastid variation in the eastern species (P. cubensis, P. maestrensis and P. occidentalis) evolved independently from that in P. caribaea var. caribaea. Incomplete lineage sorting between P. cubensis and P. maestrensis is apparent. Inferred expansion times for P. caribaea var. bahamensis and for the eastern lineages correspond to glacial maxima, whereas those for P. caribaea var. hondurensis correspond to the beginning of the temperature decrease that

  14. Controls of fine root dynamics across a gradient of gap sizes in a pine woodland.


    Jones, Robert H; Mitchell, Robert J; Stevens, Glen N; Pecot, Stephen D


    Controls of fine dynamics were investigated in a Pinus palustris Mill. (longleaf pine) woodland subjected to two understory vegetation treatments (control versus removed) and four overstory treatments (no gap control, and canopy gaps of three sizes with constant total gap area per stand). Fine root (<2 mm diameter) dynamics were measured over 11 months using ingrowth cores (all treatments) and minirhizotrons (understory removed in no gap control and large gap treatments only). At the fine (microsite) spatial scale, pine and non-pine root mass production responded negatively to each other (P=0.033). Each life form was significantly (P< or =0.028) related to nearby overstory density, and pine root production compensated for reductions in non-pine roots if understory vegetation was removed. Soil moisture and NO(3) mineralization rate were negatively related to pine root mass production (ingrowth cores; P<0.001 and P=0.052) and positively related to pine root length production, mortality and turnover (minirhizotrons; P from <0.001 to 0.078). Temperature variance was negatively related to pine root lifespan P<0.001) and positively related to pine root turnover (P=0.003). At the ecosystem scale, pattern of overstory disturbance (gap size and number) had no significant effect on non-pine, pine, or total root production. However, the presence of gaps (versus the no-gap control) increased non-pine root mass production (ANOVA, P=0.055) in natural understory conditions, and reduced pine root mass production (P=0.035) where the understory was removed. Ecosystem-wide pine root length production, mortality and turnover were positively related to weekly soil temperature (P< or =0.02). In natural systems, fine root dynamics are highly variable and strongly affected by biotic factors. Roots quickly close belowground gaps because one life form (pine or non-pine) compensates for the absence of the other. When understory vegetation is removed, however, pine roots respond to the local

  15. The "Green" Root Beer Laboratory

    ERIC Educational Resources Information Center

    Clary, Renee; Wandersee, James


    No, your students will not be drinking green root beer for St. Patrick's Day--this "green" root beer laboratory promotes environmental awareness in the science classroom, and provides a venue for some very sound science content! While many science classrooms incorporate root beer-brewing activities, the root beer lab presented in this article has…

  16. How roots respond to gravity.


    Evans, M L; Moore, R; Hasenstein, K H


    Current knowledge about the mechanisms of plant root response to gravity is reviewed. The roles of the columella region and amyloplasts in the root cap are examined. Results of experiments related to gravistimulation in corn roots with and without root caps are explained. The role of auxin, abscisic acid, and calcium also are examined.

  17. Automatic determination of trunk diameter, crown base and height of scots pine (Pinus Sylvestris L.) Based on analysis of 3D point clouds gathered from multi-station terrestrial laser scanning. (Polish Title: Automatyczne okreslanie srednicy pnia, podstawy korony oraz wysokosci sosny zwyczajnej (Pinus Silvestris L.) Na podstawie analiz chmur punktow 3D pochodzacych z wielostanowiskowego naziemnego skanowania laserowego)

    NASA Astrophysics Data System (ADS)

    Ratajczak, M.; Wężyk, P.


    Rapid development of terrestrial laser scanning (TLS) in recent years resulted in its recognition and implementation in many industries, including forestry and nature conservation. The use of the 3D TLS point clouds in the process of inventory of trees and stands, as well as in the determination of their biometric features (trunk diameter, tree height, crown base, number of trunk shapes), trees and lumber size (volume of trees) is slowly becoming a practice. In addition to the measurement precision, the primary added value of TLS is the ability to automate the processing of the clouds of points 3D in the direction of the extraction of selected features of trees and stands. The paper presents the original software (GNOM) for the automatic measurement of selected features of trees, based on the cloud of points obtained by the ground laser scanner FARO. With the developed algorithms (GNOM), the location of tree trunks on the circular research surface was specified and the measurement was performed; the measurement covered the DBH (l: 1.3m), further diameters of tree trunks at different heights of the tree trunk, base of the tree crown and volume of the tree trunk (the selection measurement method), as well as the tree crown. Research works were performed in the territory of the Niepolomice Forest in an unmixed pine stand (Pinussylvestris L.) on the circular surface with a radius of 18 m, within which there were 16 pine trees (14 of them were cut down). It was characterized by a two-storey and even-aged construction (147 years old) and was devoid of undergrowth. Ground scanning was performed just before harvesting. The DBH of 16 pine trees was specified in a fully automatic way, using the algorithm GNOM with an accuracy of +2.1%, as compared to the reference measurement by the DBH measurement device. The medium, absolute measurement error in the cloud of points - using semi-automatic methods "PIXEL" (between points) and PIPE (fitting the cylinder) in the FARO Scene 5.x., showed the error, 3.5% and 5.0%,.respectively The reference height was assumed as the measurement performed by the tape on the cut tree. The average error of automatic determination of the tree height by the algorithm GNOM based on the TLS point clouds amounted to 6.3% and was slightly higher than when using the manual method of measurements on profiles in the TerraScan (Terrasolid; the error of 5.6%). The relatively high value of the error may be mainly related to the small number of points TLS in the upper parts of crowns. The crown height measurement showed the error of +9.5%. The reference in this case was the tape measurement performed already on the trunks of cut pine trees. Processing the clouds of points by the algorithms GNOM for 16 analyzed trees took no longer than 10 min. (37 sec. /tree). The paper mainly showed the TLS measurement innovation and its high precision in acquiring biometric data in forestry, and at the same time also the further need to increase the degree of automation of processing the clouds of points 3D from terrestrial laser scanning.

  18. [Acceleration of Embryonic Development of Pinus sibirica Trees with a One-Year Reproductive Cycle].


    Tret'yakova, I N; Lukina, N V


    The study of the formation of embryonic structures in Pinus sibirica forms with a one-year reproductive cycle showed that the acceleration of the embryonic process manifested itself as a reduction of the coenocytic stage of the female gametophyte development (1.5 months instead of 1 year). The egg was not fertilized because of the asynchronous maturation of male and female gametophytes. Seeds without embryos were formed. We assumed that the acceleration of the reproductive process in Pinus sibirica was caused by a mutation in the female generative organs.

  19. Wild European Apple (Malus sylvestris (L.) Mill.) Population Dynamics: Insight from Genetics and Ecology in the Rhine Valley. Priorities for a Future Conservation Programme

    PubMed Central

    Schnitzler, Annik; Arnold, Claire; Cornille, Amandine; Bachmann, Olivier; Schnitzler, Christophe


    The increasing fragmentation of forest habitats and the omnipresence of cultivars potentially threaten the genetic integrity of the European wild apple (Malus sylvestris (L.) Mill). However, the conservation status of this species remains unclear in Europe, other than in Belgium and the Czech Republic, where it has been declared an endangered species. The population density of M. sylvestris is higher in the forests of the upper Rhine Valley (France) than in most European forests, with an unbalanced age-structure, an overrepresentation of adults and a tendency to clump. We characterize here the ecology, age-structure and genetic diversity of wild apple populations in the Rhine Valley. We use these data to highlight links to the history of this species and to propose guidelines for future conservation strategies. In total, 255 individual wild apple trees from six forest stands (five floodplain forests and one forest growing in drier conditions) were analysed in the field, collected and genotyped on the basis of data for 15 microsatellite markers. Genetic analyses showed no escaped cultivars and few hybrids with the cultivated apple. Excluding the hybrids, the genetically “pure” populations displayed high levels of genetic diversity and a weak population structure. Age-structure and ecology studies of wild apple populations identified four categories that were not randomly distributed across the forests, reflecting the history of the Rhine forest over the last century. The Rhine wild apple populations, with their ecological strategies, high genetic diversity, and weak traces of crop-to-wild gene flow associated with the history of these floodplain forests, constitute candidate populations for inclusion in future conservation programmes for European wild apple. PMID:24827575

  20. Wild European apple (Malus sylvestris (L.) Mill.) population dynamics: insight from genetics and ecology in the Rhine Valley. Priorities for a future conservation programme.


    Schnitzler, Annik; Arnold, Claire; Cornille, Amandine; Bachmann, Olivier; Schnitzler, Christophe


    The increasing fragmentation of forest habitats and the omnipresence of cultivars potentially threaten the genetic integrity of the European wild apple (Malus sylvestris (L.) Mill). However, the conservation status of this species remains unclear in Europe, other than in Belgium and the Czech Republic, where it has been declared an endangered species. The population density of M. sylvestris is higher in the forests of the upper Rhine Valley (France) than in most European forests, with an unbalanced age-structure, an overrepresentation of adults and a tendency to clump. We characterize here the ecology, age-structure and genetic diversity of wild apple populations in the Rhine Valley. We use these data to highlight links to the history of this species and to propose guidelines for future conservation strategies. In total, 255 individual wild apple trees from six forest stands (five floodplain forests and one forest growing in drier conditions) were analysed in the field, collected and genotyped on the basis of data for 15 microsatellite markers. Genetic analyses showed no escaped cultivars and few hybrids with the cultivated apple. Excluding the hybrids, the genetically "pure" populations displayed high levels of genetic diversity and a weak population structure. Age-structure and ecology studies of wild apple populations identified four categories that were not randomly distributed across the forests, reflecting the history of the Rhine forest over the last century. The Rhine wild apple populations, with their ecological strategies, high genetic diversity, and weak traces of crop-to-wild gene flow associated with the history of these floodplain forests, constitute candidate populations for inclusion in future conservation programmes for European wild apple.

  1. Root architecture and root and tuber crop productivity.


    Villordon, Arthur Q; Ginzberg, Idit; Firon, Nurit


    It is becoming increasingly evident that optimization of root architecture for resource capture is vital for enabling the next green revolution. Although cereals provide half of the calories consumed by humans, root and tuber crops are the second major source of carbohydrates globally. Yet, knowledge of root architecture in root and tuber species is limited. In this opinion article, we highlight what is known about the root system in root and tuber crops, and mark new research directions towards a better understanding of the relation between root architecture and yield. We believe that unraveling the role of root architecture in root and tuber crop productivity will improve global food security, especially in regions with marginal soil fertility and low-input agricultural systems.

  2. Nerve root replantation.


    Carlstedt, Thomas


    Traumatic avulsion of nerve roots from the spinal cord is a devastating event that usually occurs in the brachial plexus of young adults following motor vehicle or sports accidents or in newborn children during difficult childbirth. A strategy to restore motor function in the affected arm by reimplanting into the spinal cord the avulsed ventral roots or autologous nerve grafts connected distally to the avulsed roots has been developed. Surgical outcome is good and useful recovery in shoulder and proximal arm muscles occurs. Pain is alleviated with motor recovery but sensory improvement is poor when only motor conduits have been reconstructed. In experimental studies, restoration of sensory connections with general improvement in the outcome from this surgery is pursued.

  3. Coarse root spatial distribution determined using a ground-penetrating radar technique in a subtropical evergreen broad-leaved forest, China.


    Yan, Hui; Dong, Xinliang; Feng, Gang; Zhang, Shouren; Mucciardi, Anthony


    Coarse roots play a critical role in forest ecosystems and both abiotic and biotic factors affect their spatial distribution. To some extent, coarse root density may reflect the quantity of root biomass and biotic competition in forests. However, using traditional methods (e.g., excavation) to study coarse roots is challenging, because those methods are time-consuming and laborious. Furthermore, these destructive methods cannot be repeated in the same forests. Therefore, the discovery of non-destructive methods for root studies will be very significant. In this study, we used a ground-penetrating radar technique to detect the coarse root density of three habitats (ridge, slope and valley) and the dominant tree species (Castanopsis eyrei and Schima superba) in a subtropical forest. We found that (i) the mean of coarse root density for these three habitats was 88.04 roots m(-2), with roots being mainly distributed at depths of 0-40 cm. Coarse root densities were lower in deeper soils and in areas far from the trunk. (ii) Coarse root densities differed significantly among the three habitats studied here with slope habitat having the lowest coarse root density. Compared with S. superba, C. eyrei had more roots distributed in deeper soils. Furthermore, coarse roots with a diameter >3 cm occurred more frequently in the valleys, compared with root densities in ridge and slope habitats, and most coarse roots occurred at soil depths of 20-40 cm. (iii) The coarse root density correlated negatively with tree species richness at soil depths of 40-60 cm. The abundances of the dominant species, such as C. eyrei, Cyclobalanopsis glauca, Pinus massoniana, had significant impacts on coarse root density. (iv) The soil depth of 0-40 cm was the "basic distribution layer" for coarse roots since the majority of coarse roots were found in this soil layer with an average root density of 84.18 roots m(-2), which had no significant linear relationships with topography, tree species richness

  4. Changes in whole-tree water relations during ontogeny of Pinus flexilis and Pinus ponderosa in a high-elevation meadow.


    Fischer, Dylan G; Kolb, Thomas E; DeWald, Laura E


    We measured sap flux in Pinus ponderosa Laws. and Pinus flexilis James trees in a high-elevation meadow in northern Arizona that has been invaded by conifers over the last 150 years. Sap flux and environmental data were collected from July 1 to September 1, 2000, and used to estimate leaf specific transpiration rate (El), canopy conductance (Gc) and whole-plant hydraulic conductance (Kh). Leaf area to sapwood area ratio (LA/SA) increased with increasing tree size in P. flexilis, but decreased with increasing tree size in P. ponderosa. Both Gc and Kh decreased with increasing tree size in P. flexilis, and showed no clear trends with tree size in P. ponderosa. For both species, Gc was lower in the summer dry season than in the summer rainy season, but El did not change between wet and dry summer seasons. Midday water potential (Psi(mid)) did not change across seasons for either species, whereas predawn water potential (Psi(pre)) tracked variation in soil water content across seasons. Pinus flexilis showed greater stomatal response to vapor pressure deficit (VPD) and maintained higher Psi(mid) than P. ponderosa. Both species showed greater sensitivity to VPD at high photosynthetically active radiation (PAR; > 2500 micromol m-2 s-1) than at low PAR (< 2500 micromol m-2 s-1). We conclude that the direction of change in Gc and Kh with increasing tree size differed between co-occurring Pinus species, and was influenced by changes in LA/SA. Whole-tree water use and El were similar between wet and dry summer seasons, possibly because of tight stomatal control over water loss.

  5. Intraspecific variation buffers projected climate change impacts on Pinus contorta

    PubMed Central

    Oney, Brian; Reineking, Björn; O'Neill, Gregory; Kreyling, Juergen


    Species distribution modeling (SDM) is an important tool to assess the impact of global environmental change. Many species exhibit ecologically relevant intraspecific variation, and few studies have analyzed its relevance for SDM. Here, we compared three SDM techniques for the highly variable species Pinus contorta. First, applying a conventional SDM approach, we used MaxEnt to model the subject as a single species (species model), based on presence–absence observations. Second, we used MaxEnt to model each of the three most prevalent subspecies independently and combined their projected distributions (subspecies model). Finally, we used a universal growth transfer function (UTF), an approach to incorporate intraspecific variation utilizing provenance trial tree growth data. Different model approaches performed similarly when predicting current distributions. MaxEnt model discrimination was greater (AUC – species model: 0.94, subspecies model: 0.95, UTF: 0.89), but the UTF was better calibrated (slope and bias – species model: 1.31 and −0.58, subspecies model: 1.44 and −0.43, UTF: 1.01 and 0.04, respectively). Contrastingly, for future climatic conditions, projections of lodgepole pine habitat suitability diverged. In particular, when the species' intraspecific variability was acknowledged, the species was projected to better tolerate climatic change as related to suitable habitat without migration (subspecies model: 26% habitat loss or UTF: 24% habitat loss vs. species model: 60% habitat loss), and given unlimited migration may increase amount of suitable habitat (subspecies model: 8% habitat gain or UTF: 12% habitat gain vs. species model: 51% habitat loss) in the climatic period 2070–2100 (SRES A2 scenario, HADCM3). We conclude that models derived from within-species data produce different and better projections, and coincide with ecological theory. Furthermore, we conclude that intraspecific variation may buffer against adverse effects of climate

  6. Fine root dynamics in lodgepole pine and white spruce stands along productivity gradients in reclaimed oil sands sites.


    Jamro, Ghulam Murtaza; Chang, Scott X; Naeth, M Anne; Duan, Min; House, Jason


    Open-pit mining activities in the oil sands region of Alberta, Canada, create disturbed lands that, by law, must be reclaimed to a land capability equivalent to that existed before the disturbance. Re-establishment of forest cover will be affected by the production and turnover rate of fine roots. However, the relationship between fine root dynamics and tree growth has not been studied in reclaimed oil sands sites. Fine root properties (root length density, mean surface area, total root biomass, and rates of root production, turnover, and decomposition) were assessed from May to October 2011 and 2012 using sequential coring and ingrowth core methods in lodgepole pine (Pinus contorta Dougl.) and white spruce (Picea glauca (Moench.) Voss) stands. The pine and spruce stands were planted on peat mineral soil mix placed over tailings sand and overburden substrates, respectively, in reclaimed oil sands sites in Alberta. We selected stands that form a productivity gradient (low, medium, and high productivities) of each tree species based on differences in tree height and diameter at breast height (DBH) increments. In lodgepole pine stands, fine root length density and fine root production, and turnover rates were in the order of high > medium > low productivity sites and were positively correlated with tree height and DBH and negatively correlated with soil salinity (P < 0.05). In white spruce stands, fine root surface area was the only parameter that increased along the productivity gradient and was negatively correlated with soil compaction. In conclusion, fine root dynamics along the stand productivity gradients were closely linked to stand productivity and were affected by limiting soil properties related to the specific substrate used for reconstructing the reclaimed soil. Understanding the impact of soil properties on fine root dynamics and overall stand productivity will help improve land reclamation outcomes.

  7. Grass Roots Project Evaluation.

    ERIC Educational Resources Information Center

    Wick, John W.

    Some aspects of a grass roots evaluation training program are presented. The program consists of two elements: (1) a series of 11 slide/tape individualized self-paced units, and (2) a six-week summer program. Three points of view on this program are: (1) University graduate programs in quantitative areas are usually consumed by specialists; (2)…

  8. The Roots of Reading.

    ERIC Educational Resources Information Center

    Montoya, Colleen, Ed.


    This newsletter covers educational issues affecting schools in the Western Regional Educational Laboratory's 4-state region (Arizona, California, Nevada, and Utah) and nationwide. The following articles appear in the Volume 4, Number 1 issue: (1) "The Roots of Reading"; (2) "Breaking the Code: Reading Literacy in K-3"; (3)…

  9. Root hair sweet growth

    PubMed Central

    Velasquez, Silvia M; Iusem, Norberto D


    Root hairs are single cells specialized in the absorption of water and nutrients from the soil. Growing root hairs require intensive cell-wall changes to accommodate cell expansion at the apical end by a process known as tip or polarized growth. We have recently shown that cell wall glycoproteins such as extensins (EXTs) are essential components of the cell wall during polarized growth. Proline hydroxylation, an early posttranslational modification of cell wall EXTs that is catalyzed by prolyl 4-hydroxylases (P4Hs), defines the subsequent O-glycosylation sites in EXTs. Biochemical inhibition or genetic disruption of specific P4Hs resulted in the blockage of polarized growth in root hairs. Our results demonstrate that correct hydroxylation and also further O-glycosylation on EXTs are essential for cell-wall self-assembly and, hence, root hair elongation. The changes that O-glycosylated cell-wall proteins like EXTs undergo during cell growth represent a starting point to unravel the entire biochemical pathway involved in plant development. PMID:21918376

  10. Great Plains Roots.

    ERIC Educational Resources Information Center

    Frey, Jennifer


    Sandy White Hawk, Sicangu Lakota, was adopted by white missionaries as an infant and suffered child abuse. After 33 years, she found her birth family and formed First Nations Orphans Association, which uses songs and ceremonies to help adoptees return to their roots. Until the 1970s, federal agencies and welfare organizations facilitated removal…

  11. The Roots Of Alienation

    ERIC Educational Resources Information Center

    Bronfenbrenner, Urie


    Alienation in our society takes several forms--withdrawal, hostility, or efforts to reform. The author traces the roots of alienation to our neglect of many of the needs of children, particularly their need for interaction with adults. Among his many recommendations are: modified work schedules to permit more time with children and systems for…


    Technology Transfer Automated Retrieval System (TEKTRAN)

    The enzyme hydroxycinnamoyl-CoA: shikimate hydroxycinnamoyltransferase (HCT) is involved in the production of methoxylated monolignols that are precursors to guaiacyl and syringyl lignin in angiosperm species. We identified and cloned a putative HCT gene from Pinus radiata, a coniferous gymnosperm, ...

  13. Galactoglucomannan Oligosaccharides (GGMO) from a Molasses Byproduct of Pine (Pinus taeda) Fiberboard Production

    Technology Transfer Automated Retrieval System (TEKTRAN)

    "Temulose" is the trade name for a water-soluble molasses produced on a large scale (300 - 400 tonnes per year) as a byproduct of the fiberboard industry. The feedstock for temulose is predominantly a single species of pine (Pinus taeda) grown and harvested in stands in south-eastern Texas. Becaus...

  14. Galactoglucomannan Oligosaccharides (GGMO) from a Molasses Byproduct of Pine (Pinus taeda) Fiberboard Production

    Technology Transfer Automated Retrieval System (TEKTRAN)

    “Temulose” is the trade name for a water-soluble molasses produced on a large scale (300 - 400 tonnes per year) as a byproduct of the fiberboard industry. The feedstock for temulose is predominantly a single species of pine (Pinus taeda) grown and harvested in stands in southeastern Texas. Because...

  15. DNA analysis for section identification of individual Pinus pollen grains from Belukha glacier, Altai Mountains, Russia

    NASA Astrophysics Data System (ADS)

    Nakazawa, Fumio; Uetake, Jun; Suyama, Yoshihisa; Kaneko, Ryo; Takeuchi, Nozomu; Fujita, Koji; Motoyama, Hideaki; Imura, Satoshi; Kanda, Hiroshi


    Pollen taxon in sediment samples can be identified by analyzing pollen morphology. Identification of related species based on pollen morphology is difficult and is limited primarily to genus or family. Because pollen grains of various ages are preserved at below 0 °C in glaciers and thus are more likely to remain intact or to suffer little DNA fragmentation, genetic information from such pollen grains should enable identification of plant taxa below the genus level. However, no published studies have attempted detailed identification using DNA sequences obtained from pollen found in glaciers. As a preliminary step, this study attempted to analyze the DNA of Pinus pollen grains extracted from surface snow collected from the Belukha glacier in the Altai Mountains of Russia in the summer of 2003. A 150-bp rpoB fragment from the chloroplast genome in each Pinus pollen grain was amplified by polymerase chain reaction, and DNA products were sequenced to identify them at the section level. A total of 105 pollen grains were used for the test, and sequences were obtained from eight grains. From the sequences obtained, the pollen grains were identified as belonging to the section Quinquefoliae. Trees of the extant species Pinus sibirica in the section Quinquefoliae are currently found surrounding the glacier. The consistency of results for this section suggests that the pollen in the glacier originated from the same Pinus trees as those found in the immediate surroundings.


    EPA Science Inventory

    The confounding effect of understory vegetation contributions to satellite-derived estimates of leaf area index (LAI) was investigated on two loblolly pine (Pinus taeda) forest stands located in Virginia and North Carolina. In order to separate NDVI contributions of the dominantc...

  17. Two new sesquiterpene glycosides isolated from the fresh needles of Pinus massoniana Lamb.


    Xiao, Yun-Chuan; Ye, Liang; Zhao, Man-Xi; Yan, Cui-Qi; Wang, Wei; Huang, Quan-Shu; Liang, Kai; Meng, Bao-Hua; Ke, Xiao


    Two new sesquiterpene glycosides, namely massonside A (1) and massonside B (2), were isolated from the n-Bu extract of the fresh needles of Pinus massoniana Lamb. Their structures were established by 1D, 2D nuclear magnetic resonance and high-resolution mass spectrometry. Their biological activities were profiled by the anti-HBV and anti-HCV assays.

  18. Geographic patterns of genetic variation and population structure in Pinus aristata, Rocky Mountain bristlecone pine

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Pinus aristata Engelm., Rocky Mountain bristlecone pine, has a narrow core geographic and elevational distribution, occurs in disjunct populations and is threatened by multiple stresses, including rapid climate change, white pine blister rust, and bark beetles. Knowledge of genetic diversity and pop...

  19. Multi-Season Monoterpene and Sesquiterpene Analysis of Pinus taeda Needle Tissue

    EPA Science Inventory

    Pinus taeda (Loblolly pine) is one of the worlds most important timber crop and accounts for a significant portion of the southeastern U.S. landcover. Biogenic voltile organic compound (BVOC) content was extracted from the tissue material of P. taeda needles and analyzed over a m...

  20. Mitochondrial DNA capture and divergence in Pinus provide new insights into the evolution of the genus.


    Wang, Baosheng; Wang, Xiao-Ru


    The evolution of the mitochondrial (mt) genome is far from being fully understood. Systematic investigations into the modes of inheritance, rates and patterns of recombination, nucleotide substitution, and structural changes in the mt genome are still lacking in many groups of plants. In this study, we sequenced >11kbp mtDNA segments from multiple accessions of 36 pine species to characterize the evolutionary patterns of mtDNA in the genus Pinus. We found extremely low substitution rates and complex repetitive sequences scattered across different genome regions, as well as chimeric structures that were probably generated by multiple intergenomic recombinations. The mtDNA-based phylogeny of the genus differed from that based on chloroplast and nuclear DNA in the placement of several groups of species. Such discordances suggest a series of mtDNA capture events during past range shifts of the pine species and that both vertical and horizontal inheritance are implicated in the evolution of mtDNA in Pinus. MtDNA dating revealed that most extant lineages of the genus originated during Oligocene-Miocene radiation and subgenus Strobus diversified earlier than subgenus Pinus. Our findings illustrate a reticular evolutionary pathway for the mt genome through capture and recombination in the genus Pinus, and provide new insights into the evolution of the genus.


    EPA Science Inventory

    Although central Florida is relatively flat, the distribution of species on the landscape is controlled by subtle changes in elevation. Along a four-meter elevation gradient, xeric sandhill vegetation dominated by Pinus palustris (Longleaf pine) gives way to mesic pine flatwoods...

  2. [Genetic control of the isoenzymes in Cembra pine (Pinus cembra L.) in the Ukrainian Carpathian Mountains].


    Pirko, Ia V; Korshikov, I I


    Genetic control of GOT, GDH, DIA, MDH, SOD, FDH, ADH, ACP, and LAP enzymes was studied in the seed megagametophytes of cembra pine (Pinus cembra L.) from the natural population of the Ukrainian Carpa-thian mountains. Efficient electrophoretic separation was obtained for 21 loci products. The analysis of allele segregation in heterozygous trees confirms monogenic inheritance of the revealed variants.


    EPA Science Inventory

    Stand density reductions have been proposed as a method by which old-growth ponderosa pine (Pinus ponderosa) forests of North America can be converted back to pre-1900 conditions, thereby reducing the danger of catastrophic forest fires and insect attacks while increasing product...

  4. Stand variation in Pinus radiata and its relationship with allometric scaling and critical buckling height

    PubMed Central

    Waghorn, Matthew J.; Watt, Michael S.


    Background and Aims Allometric relationships and the determination of critical buckling heights have been examined for Pinus radiata in the past. However, how they relate to more mature Pinus radiata exhibiting a wide range of stem diameters, slenderness and modulus of elasticity (E) at operationally used stand densities is largely unknown. The aim of this study was to examine the relationship between Pinus radiata stand structure variables and allometric scaling and critical buckling height. Methods Utilizing a Pinus radiata Nelder trial with stand density and genetic breed as variables, critical buckling height was calculated whilst reduced major axis regression was used to determine scaling exponents between critical height (Hcrit), actual height (H), ground line diameter (D), slenderness (S), density-specific stiffness (E/ρ) and modulus of elasticity (E). Key Results Critical buckling height was highly responsive to decreasing diameter and increasing slenderness. Safety factors in this study were typically considerably lower than previously reported margins in other species. As density-specific stiffness scaled negatively with diameter, the exponent of 0·55 between critical height and diameter did not meet the assumed value of 0·67 under constant density-specific stiffness. E scaled positively with stem slenderness to the power of 0·78. Conclusions The findings suggest that within species density-specific stiffness variation may influence critical height and the scaling exponent between critical height and diameter, which is considered so important in assumptions regarding allometric relationships. PMID:23388878


    EPA Science Inventory

    The future productivity of forests will be affected by combinations of elevated atmospheric CO2 and O3. Because productivity of forests will, in part, be determined by growth of young trees, we evaluated shoot growth and biomass responses of Pinus ponderosa seedlings exposed to ...


    EPA Science Inventory

    1. Effects of CO2 and O3 were determined for a key component of ecosystem carbon and water cycling: needle gas exchange (photosynthesis, conductance, transpiration and water use efficiency). The measurements were made on Pinus ponderosa seedlings grown in outdoor, sunlit, mesoc...

  7. Malva sylvestris L. extract suppresses desferrioxamine-induced PGE₂ and PGD₂ release in differentiated U937 cells: the development and validation of an LC-MS/MS method for prostaglandin quantification.


    Martins, Cleverson Antonio Ferreira; Weffort-Santos, Almeriane Maria; Gasparetto, João Cleverson; Trindade, Angela Cristina Leal Badaró; Otuki, Michel Fleith; Pontarolo, Roberto


    Malva sylvestris is a species used worldwide as an alternative to anti-inflammatory therapies; however, its mechanism of action remains unknown. In this paper, the anti-inflammatory effects of M. sylvestris alcoholic extracts were evaluated by measuring the pro-inflammatory mediators PGE₂ and PGD₂ in desferrioxamine-stimulated phorbol 12-myristate 13-acetate-differentiated U937 cells. An HPLC-DAD fingerprint of the M. sylvestris extract was performed and caffeic acid, ferulic acid and scopoletin were identified and quantified. An HPLC-MS/MS method was developed and validated to separate and measure the prostaglandins. The lower limits of detection (~0.5 ng/mL for PGE₂ and PGD₂) and quantification (1.0 ng/mL for PGE₂ and PGD₂) indicated that the method is highly sensitive. The calibration curves showed excellent coefficients of correlation (r > 0.99) over the range of 1.0-500.0 ng/mL, and at different levels, the accuracy ranged from 96.4 to 106.4% with an RSD < 10.0% for the precision study. This method was successfully applied using U937-d cells. A significant dose-dependent reduction of PGE2 and PGD2 levels occurred using 10 µg/mL (10.74 ± 2.86 and 9.60 ± 6.89%) and 50 µg/mL of extract (48.37 ± 3.24 and 53.06 ± 6.15%), suggesting that the anti-inflammatory mechanisms evoked by M. sylvestris may be related to modulation of these mediators.

  8. Advances in root reinforcement experiments

    NASA Astrophysics Data System (ADS)

    Giadrossich, Filippo; Schwarz, Massimiliano; Niedda, Marcello


    Root reinforcement is considered in many situations an important effect of vegetation for slope stability. In the past 20 years many studies analyzed root reinforcement in laboratory and field experiments, as well as through modeling frameworks. Nearby the important contribution of roots to shear strength, roots are recognized to impart stabilization also through lateral (parallel to slope) redistribution of forces under tension. Lateral root reinforcement under tensile solicitations (such as in the upper part of a shallow landslide) was documented and discussed by some studies. The most common method adopted to measure lateral root reinforcement are pullout tests where roots (single or as bundle) are pulled out from a soil matrix. These conditions are indeed representative for the case where roots within the mass of a landslide slip out from the upper stable part of the slope (such in a tension crack). However, there is also the situation where roots anchored at the upper stable part of the slope slip out from the sliding soil mass. In this last case it is difficult to quantify root reinforcement and no study discussed this mechanism so far. The main objective of this study is to quantify the contribution of roots considering the two presented cases of lateral root reinforcement discussed above - roots slipping out from stable soil profile or sliding soil matrix from anchored roots-, and discuss the implication of the results for slope stability modeling. We carried out a series of laboratory experiments for both roots pullout and soil sliding mechanisms using a tilting box with a bundle of 15 roots. Both Douglas (Pseudotsuga menziesii) roots and soil were collected from the study area in Sardinia (Italy), and reconstructed in laboratory, filling the root and soil layer by layer up to 0.4 meter thickness. The results show that the ratio between pullout force and force transferred to the root during soil sliding range from 0.5 to 1. This results indicate that

  9. Angles of multivariable root loci

    NASA Technical Reports Server (NTRS)

    Thompson, P. M.; Stein, G.; Laub, A. J.


    A generalized eigenvalue problem is demonstrated to be useful for computing the multivariable root locus, particularly when obtaining the arrival angles to finite transmission zeros. The multivariable root loci are found for a linear, time-invariant output feedback problem. The problem is then employed to compute a closed-loop eigenstructure. The method of computing angles on the root locus is demonstrated, and the method is extended to a multivariable optimal root locus.

  10. Effect of benfluralin on Pinus pinea seedlings mycorrhized with Pisolithus tinctorius and Suillus bellinii--study of plant antioxidant response.


    Franco, Albina R; Pereira, Sofia I A; Castro, Paula M L


    In this study, Pinus pinea seedlings mycorrhized with selected ectomycorrhizal fungi (ECMF), Pisolithus tinctorius and Suillus bellinii, were exposed to the herbicide benfluralin. Non-mycorrhized P. pinea seedlings and seedlings mycorrhized with ECMF were transferred to benfluralin-spiked soils at levels of 0.165, 1.65 and 16.5 mg kg(-1). Plant growth and the fungal role on plant antioxidant response were assessed. In the presence of benfluralin, higher plant growth was observed in mycorrhized plants compared to non-mycorrhized plants, but ECMF colonisation and nutrient uptake were affected by the herbicide. Benfluralin showed no effect on lipid peroxidation in P. pinea seedlings. However, seedlings mycorrhized with S. bellinii showed higher levels of lipid peroxidation when compared to non-mycorrhized ones, both in the presence and absence of benfluralin. The increase of lipid peroxidation could be related to seedling growth induced by the fungus and not to benfluralin toxicity. A similar trend was observed in seedlings mycorrhized with P. tinctorius when exposed to higher benfluralin concentrations, suggesting that the antioxidant response to benfluralin is related not only to fungus species, but also to the level of stress applied in the soil. The higher amount of superoxide dismutase activity in P. pinea seedlings tissues exposed to benfluralin could indicate a plant adaptative response to benfluralin toxicity. Catalase activity showed no increase with benfluralin exposure. Pre-established P. tinctorius mycorrhization conferred root protection and enhanced plant growth in benfluralin spiked soil, inferring that P. tinctorius - P. pinea association could advantageous for plant growth in soils contaminated with pesticides.

  11. Ecophysiological variation in two provenances of Pinus flexilis seedlings across an elevation gradient from forest to alpine.


    Reinhardt, Keith; Castanha, Cristina; Germino, Matthew J; Kueppers, Lara M


    Climate change is predicted to cause upward shifts in forest tree distributions, which will require seedling recruitment beyond current forest boundaries. However, predicting the likelihood of successful plant establishment beyond current species' ranges under changing climate is complicated by the interaction of genetic and environmental controls on seedling establishment. To determine how genetics and climate may interact to affect seedling establishment, we transplanted recently germinated seedlings from high- and low-elevation provenances (HI and LO, respectively) of Pinus flexilis in common gardens arrayed along an elevation and canopy gradient from subalpine forest into the alpine zone and examined differences in physiology and morphology between provenances and among sites. Plant dry mass, projected leaf area and shoot:root ratios were 12-40% greater in LO compared with HI seedlings at each elevation. There were no significant changes in these variables among sites except for decreased dry mass of LO seedlings in the alpine site. Photosynthesis, carbon balance (photosynthesis/respiration) and conductance increased >2× with elevation for both provenances, and were 35-77% greater in LO seedlings compared with HI seedlings. There were no differences in dark-adapted chlorophyll fluorescence (Fv/Fm) among sites or between provenances. Our results suggest that for P. flexilis seedlings, provenances selected for above-ground growth may outperform those selected for stress resistance in the absence of harsh climatic conditions, even well above the species' range limits in the alpine zone. This indicates that forest genetics may be important to understanding and managing species' range adjustments due to climate change.

  12. Diagravitropism in corn roots

    NASA Technical Reports Server (NTRS)

    Leopold, A. C.; Wettlaufer, S. H.


    The diagravitropic behavior of Merit corn (Zea mays L.) roots grown in darkness provides an opportunity for comparison of two qualitatively different gravitropic systems. As with positive gravitropism, diagravitropism is shown to require the presence of the root cap, have a similar time course for the onset of curvature, and a similar presentation time. In contrast with positive gravitropism, diagravitropism appears to have a more limited requirement for calcium, for it is insensitive to the elution of calcium by EGTA and insensitive to the subsequent addition of a calcium/EGTA complex. These results are interpreted as indicating that whereas the same sensing system is shared by the two types of gravitropism, separate transductive systems are involved, one for diagravitropism, which is relatively independent of calcium, and one for positive gravitropism, which is markedly dependent on calcium.

  13. Springback in root gravitropism

    NASA Technical Reports Server (NTRS)

    Leopold, A. C.; Wettlaufer, S. H.


    Conditions under which a gravistimulus of Merit corn roots (Zea mays L.) is withdrawn result in a subsequent loss of gravitropic curvature, an effect which we refer to as springback.' This loss of curvature begins within 1 to 10 minutes after removal of the gravistimulus. It occurs regardless of the presence or absence of the root cap. It is insensitive to inhibitors of auxin transport (2,3,5-triiodobenzoic acid, naphthylphthalamic [correction of naphthylphthalmaic] acid) or to added auxin (2,4-dichlorophenoxyacetic acid). Springback is prevented if a clinostat treatment is interjected to neutralize gravistimulation during germination, which suggests that the change in curvature is a response to a memory' effect carried over from a prior gravistimulation.

  14. Aquaporins and root water relations

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Water is one of the most critical resources limiting plant growth and crop productivity, and root water uptake is an important aspect of plant physiology governing plant water use and stress tolerance. Pathways of root water uptake are complex and are affected by root structure and physiological res...

  15. Nurturing the Roots of Literacy.

    ERIC Educational Resources Information Center

    Blass, Rosanne J.

    Reflecting the work of Yetta Goodman on child language development, this paper examines Goodman's five "roots of literacy" and offers suggestions on classroom techniques for nurturing these roots. The first half of the paper explains how Goodman identified the roots of literacy and describes each of them, including (1) print awareness in…

  16. Strigolactones Effects on Root Growth

    NASA Astrophysics Data System (ADS)

    Koltai, Hinanit


    Strigolactones (SLs) were defined as a new group of plant hormones that suppress lateral shoot branching. Our previous studies suggested SLs to be regulators of root development. SLs were shown to alter root architecture by regulating lateral root formation and to affect root hair elongation in Arabidopsis. Another important effect of SLs on root growth was shown to be associated with root directional growth. Supplementation of SLs to roots led to alterations in root directional growth, whereas associated mutants showed asymmetrical root growth, which was influenced by environmental factors. The regulation by SLs of root development was shown to be conducted via a cross talk of SLs with other plant hormones, including auxin. SLs were shown to regulate auxin transport, and to interfere with the activity of auxin-efflux carriers. Therefore, it might be that SLs are regulators of root directional growth as a result of their ability to regulated auxin transport. However, other evidences suggest a localized effect of SLs on cell division, which may not necessarily be associated with auxin efflux. These and other, recent hypothesis as to the SLs mode of action and the associated root perception and response to environmental factors will be discussed.

  17. Anti-Inflammatory, Anti-Osteoclastogenic and Antioxidant Effects of Malva sylvestris Extract and Fractions: In Vitro and In Vivo Studies.


    Benso, Bruna; Franchin, Marcelo; Massarioli, Adna Prado; Paschoal, Jonas Augusto Rizzato; Alencar, Severino Matias; Franco, Gilson Cesar Nobre; Rosalen, Pedro Luiz


    Given their medical importance, natural products represent a tremendous source of drug discovery. The aim of this study was to investigate Malva sylvestris L. extract and fractions and their pharmacological activities followed by chemical identification. The aqueous fraction (AF) was identified as the bioactive fraction in the in vitro and in vivo assays. The AF controlled the neutrophil migration to the peritoneal cavity by 66%, inhibited the antiedematogenic activity by 58.8%, and controlled IL-1β cytokine expression by 54%. The in vitro viability tests showed a concentration-dependent effect, where the MSE and fractions at concentrations under 10 μg/mL were non-toxic to cells. Transcriptional factors of carbonic anhydrase II (CAII), cathepsin K (Ctsk) and tartrate-resistant acid phosphatase (TRAP) were analyzed by qPCR in RAW 264.7 cell lines. The gene expression analysis showed that the AF was the only treatment that could downregulate all the study genes: CAII, Ctsk and TRAP (p<0.05). TRAP staining was used to evaluate osteoclast formation. AF treatments reduced the number of osteoclastogenesis 2.6-fold compared to the vehicle control group. Matrix metalloproteinase 9 (MMP-9) activity decreased 75% with the AF treatment. Moreover, the bioactive fraction had the ability to regulate the oxidation pathway in the ABTS (2,2-Azino-bis (3-ethylbenzthiazoline-6-sulfonic acid) assay with an activity equivalent to 1.30 μmol Trolox/g and DPPH (2,2-diphenyl-1-picrylhydrazyl) radicals 1.01 g/L. Positive ion ESI-mass spectrometry for molecular ions at m/z 611 and 633 confirmed rutin as the major compound in the AF. The AF of M. sylvestris presented anti-inflammatory, controlled osteoclastogenic mechanisms and antioxidant abilities in different in vitro and in vivo methods. In addition, we suggest that given its multi-target activity the bioactive fraction may be a good candidate in the therapy of chronic inflammatory diseases.

  18. Anti-Inflammatory, Anti-Osteoclastogenic and Antioxidant Effects of Malva sylvestris Extract and Fractions: In Vitro and In Vivo Studies

    PubMed Central

    Franchin, Marcelo; Massarioli, Adna Prado; Paschoal, Jonas Augusto Rizzato; Alencar, Severino Matias; Franco, Gilson Cesar Nobre; Rosalen, Pedro Luiz


    Given their medical importance, natural products represent a tremendous source of drug discovery. The aim of this study was to investigate Malva sylvestris L. extract and fractions and their pharmacological activities followed by chemical identification. The aqueous fraction (AF) was identified as the bioactive fraction in the in vitro and in vivo assays. The AF controlled the neutrophil migration to the peritoneal cavity by 66%, inhibited the antiedematogenic activity by 58.8%, and controlled IL-1β cytokine expression by 54%. The in vitro viability tests showed a concentration-dependent effect, where the MSE and fractions at concentrations under 10 μg/mL were non-toxic to cells. Transcriptional factors of carbonic anhydrase II (CAII), cathepsin K (Ctsk) and tartrate-resistant acid phosphatase (TRAP) were analyzed by qPCR in RAW 264.7 cell lines. The gene expression analysis showed that the AF was the only treatment that could downregulate all the study genes: CAII, Ctsk and TRAP (p<0.05). TRAP staining was used to evaluate osteoclast formation. AF treatments reduced the number of osteoclastogenesis 2.6-fold compared to the vehicle control group. Matrix metalloproteinase 9 (MMP-9) activity decreased 75% with the AF treatment. Moreover, the bioactive fraction had the ability to regulate the oxidation pathway in the ABTS (2,2-Azino-bis (3-ethylbenzthiazoline-6-sulfonic acid) assay with an activity equivalent to 1.30 μmol Trolox/g and DPPH (2,2-diphenyl-1-picrylhydrazyl) radicals 1.01 g/L. Positive ion ESI-mass spectrometry for molecular ions at m/z 611 and 633 confirmed rutin as the major compound in the AF. The AF of M. sylvestris presented anti-inflammatory, controlled osteoclastogenic mechanisms and antioxidant abilities in different in vitro and in vivo methods. In addition, we suggest that given its multi-target activity the bioactive fraction may be a good candidate in the therapy of chronic inflammatory diseases. PMID:27643502

  19. Continuous measurement of stem-diameter growth response of Pinus pinea seedlings mycorrhizal with Rhizopogon roseolus and submitted to two water regimes.


    Parladé, J; Cohen, M; Doltra, J; Luque, J; Pera, J


    Linear variable differential transformer (LVDT) sensors were used to detect continuous diameter growth responses of Pinus pinea (stone pine) seedlings inoculated with the ectomycorrhizal fungus Rhizopogon roseolus. Colonised and non-colonised seedlings provided with sensors were submitted to different water regimes in two consecutive experiments established in a controlled-temperature greenhouse module (cycle 1), and in an adjacent module without temperature control (cycle 2). Under regular irrigation, colonised seedlings showed significantly higher growth than non-colonised seedlings. Water-stressed seedlings showed no benefit from inoculation in terms of growth. Also, seedlings with a high colonisation level recovered more slowly from water stress than control seedlings. A significant positive relationship between maximum daily shrinkage (amplitude of the daily stem contraction) and global radiation was observed only in the first water-stress period in cycle 1 and in regularly irrigated seedlings in both cycles. However, no differential responses due to inoculation were observed. The mycorrhizal colonisation of the seedlings at the end of the experiment was related with the initial colonisation level. Mycorrhizal colonisation by R. roseolus in old roots was maintained at significantly higher levels in seedlings which had an initial colonisation level >50% than in seedlings with <50% initial colonisation. Also, more newly formed roots became colonised in seedlings which had an initial colonisation level >50% than in seedlings with an initial colonisation <50%, which had almost no new root colonisation. From the results obtained, it can be concluded that LVDT sensors can be used to detect a differential response of plants according to water supply, mycorrhizal status and, in some cases, to their colonisation level. The results are discussed in relation to the predictive possibilities of the method for the selection of efficient mycorrhizal fungi for the

  20. Differential responses of needle and branch order-based root decay to nitrogen addition: dominant effects of acid-unhydrolyzable residue and microbial enzymes

    NASA Astrophysics Data System (ADS)

    Kou, Liang; Chen, Weiwei; Zhang, Xinyu; Gao, Wenlong; Yang, Hao; Li, Dandan; Li, Shenggong


    Both chemical differences between foliage and different orders of fine roots and their contrasting decomposing microenvironments may affect their decomposition. However, little is known about how foliage and branch order-based root decomposition responds to increased N availability and the response mechanisms behind. The effects of different doses of N addition on the decomposition of needles and order-based roots of Pinus elliottii (slash pine) were monitored using the litterbag method for 524 days in a subtropical slash pine plantation in south China. The acid-unhydrolyzable residue (AUR) concentration and microbial extracellular enzymatic activities (EEA) in decomposing needles and roots were also determined. Our results indicate that the responses of needle and order-based root decomposition were N-dose-specific. The decomposition of both needles and lower-order roots was inhibited under the high N dose rate. The retarded decomposition of lower-order roots could be explained more by the increased binding of AUR to inorganic N ions, while the retarded decomposition of needles could be explained more by the reduced microbial EEA. Further, in contrast to lower-order roots, N addition had no effect on the decomposition of higher-order roots. We conclude that the decomposition of foliage and fine roots may fail to mirror each other at ambient conditions or in response to N deposition due to their contrasting decomposition microenvironments and tissue chemistry. Given the differential effects of N addition on order-based roots, our findings highlight the need to consider the tissue chemistry heterogeneity within branching fine root systems when predicting the responses of root decomposition to N loading.

  1. Elevated atmospheric CO2 concentration alters the effect of phosphate supply on growth of Japanese red pine (Pinus densiflora) seedlings.


    Kogawara, Satoshi; Norisada, Mariko; Tange, Takeshi; Yagi, Hisayoshi; Kojima, Katsumi


    We demonstrated that the inorganic phosphate (P(i)) requirement for growth of Japanese red pine (Pinus densiflora Sieb. & Zucc.) seedlings is increased by elevated CO(2) concentration ([CO(2)]) and that responses of the ectomycorrhizal fungus Pisolithus tinctorius (Pers.) Coker & Couch to P(i) supply are also altered. To investigate the growth response of non-mycorrhizal seedlings to P(i) supply in elevated [CO(2)], non-mycorrhizal seedlings were grown for 73 days in ambient or elevated [CO(2)] (350 or 700 micromol mol(-1)) with nutrient solutions containing one of seven phosphate concentrations (0, 0.02, 0.04, 0.06, 0.08, 0.10 and 0.20 mM). In ambient [CO(2)], the growth response to P(i) was saturated at about 0.1 mM P(i), whereas in elevated [CO(2)], the growth response to P(i) supply did not saturate, even at the highest P(i) supply (0.2 mM), indicating that the P(i) requirement is higher in elevated [CO(2)] than in ambient [CO(2)]. The increased requirement was due mainly to an altered shoot growth response to P(i) supply. The enhanced P(i) requirement in elevated [CO(2)] was not associated with a change in photosynthetic response to P(i) or a change in leaf phosphorus (P) status. We investigated the effect of P(i) supply (0.04, 0.08 and 0.20 mM) on the ectomycorrhizal fungus P. tinctorius in mycorrhizal seedlings grown in ambient or elevated [CO(2)]. Root ergosterol concentration (an indicator of fungal biomass) decreased with increasing P(i) supply in ambient [CO(2)], but the decrease was far less in elevated [CO(2)]. In ambient [CO(2)] the ratio of extramatrical mycelium to root biomass decreased with increasing P(i) supply but did not change in elevated [CO(2)]. We conclude that, because elevated [CO(2)] increased the P(i) requirement for shoot growth, the significance of the ectomycorrhizal association was also increased in elevated [CO(2)].

  2. Phytoavailability and speciation of aluminum carried by total suspended particulates (TSP) to Masson pine ( Pinus massoniana L.)

    NASA Astrophysics Data System (ADS)

    Wang, Shuiliang; Wang, Ping; Fan, Chinbay Q.; Xu, Hui


    Aluminum (Al) is an abundant metal in airborne particulate matter. Al concentrations carried by total suspended particulates (TSP) of the Nanjing atmosphere were distinctly higher in soils of industrial areas than the background concentration of the soils. This study aimed to assess the influence of the soils varying in their degree of contamination on the soil-to-plant transfer and translocation of Al to Masson pine ( Pinus massoniana L.). A pot experiment was conducted to investigate the phytoavailability and speciation of Al carried by TSP which was collected at urban and industrial sites over a 12-month period in the atmosphere of Nanjing, China. The extractable noncrystalline Al in environmental particulate samples could be operationally fractionated into insoluble (Alin), oxide (Alox), organic (Alor), carbonate (Alca), and exchangeable species (Alex) using Tessier's sequential extraction procedure. The results showed that relatively high Al concentrations in TSP and soil samples were observed at the industrial site due to emissions from a local industry that manufactures Al-based products. The distribution sequence of Al species was quite similar for TSP and soil samples, which was Alin > Alor > Alox > Alca > Alex. The order of industrial particulate matter (IPM) was Alin > Alox > Alca > Alex > Alor. Alor was not detectable. A greater migration of Alex species entered the pine roots and the highest Al contents were accumulated in the roots and declined in the aerial portions. The soil-to-pine Al transfer was extremely low even when grown on industrial Al-contaminated soils. A significant positive correlation was found between the Al contents in pine seedlings and rhizospheric Alex contents. In contrast, there was a strong negative correlation between rhizospheric Alex contents and seedling biomass. For the spiked soils, under the influence of IPM, Al phytoavailability decreased with elevated rhizospheric Al and Alex. Collectively, this study provided evidence

  3. Identification case of evidence in timber tracing of Pinus radiate, using high-resolution melting (HRM) analysis.


    Solano, Jaime; Anabalón, Leonardo; Encina, Francisco


    Fast, accurate detection of plant species and their hybrids using molecular tools will facilitate assessment and monitoring of timber tracing evidence. In this study the origin of unknown pine samples is determined for a case of timber theft in the region of Araucania southern Chile. We evaluate the utility of the trnL marker region for species identification applied to pine wood based on High Resolution Melting. This efficient tracing methods can be incorporated into forestry applications such as certification of origin. The object of this work was genotype identification using high-resolution melting (HRM) and trnL approaches for Pinus radiata (Don) in timber tracing evidence. Our results indicate that trnL is a very sensitive marker for delimiting species and HRM analysis was used successfully for genotyping Pinus samples for timber tracing purposes. Genotyping samples by HRM analysis with the trnL1 approach allowed us to differentiate two wood samples from the Pinaceae family: Pinus radiata (Don) and Pseudotsuga menziesii (Mirb.) Franco. The same approach with Pinus trnL wood was not able to discriminate between samples of Pinus radiata, indicating that the samples were genetically indistinguishable, possibly because they have the same genotype at this locus. Timber tracing with HRM analysis is expected to contribute to future forest certification schemes, control of illegal trading, and molecular traceability of Pinus spp.

  4. Philosophical Roots of Cosmology

    NASA Astrophysics Data System (ADS)

    Ivanovic, M.


    We shall consider the philosophical roots of cosmology in the earlier Greek philosophy. Our goal is to answer the question: Are earlier Greek theories of pure philosophical-mythological character, as often philosophers cited it, or they have scientific character. On the bases of methodological criteria, we shall contend that the latter is the case. In order to answer the question about contemporary situation of the relation philosophy-cosmology, we shall consider the next question: Is contemporary cosmology completely independent of philosophical conjectures? The answer demands consideration of methodological character about scientific status of contemporary cosmology. We also consider some aspects of the relation contemporary philosophy-cosmology.

  5. Rooting an Android Device

    DTIC Science & Technology


    this feature on an Android device, go to “Settings” and then “About Phone ” or “About tablet”. Find “Build Number”, then tab on the “Build Number” 7...flag, which should not affect phone operation. Ensure that the phone or tablet is on and active while the rooting process is underway, and monitor...the Android device and host computer for progress of the script to determine whether the installation succeeded or failed. Do not unplug the phone

  6. The Roots of Beowulf

    NASA Technical Reports Server (NTRS)

    Fischer, James R.


    The first Beowulf Linux commodity cluster was constructed at NASA's Goddard Space Flight Center in 1994 and its origins are a part of the folklore of high-end computing. In fact, the conditions within Goddard that brought the idea into being were shaped by rich historical roots, strategic pressures brought on by the ramp up of the Federal High-Performance Computing and Communications Program, growth of the open software movement, microprocessor performance trends, and the vision of key technologists. This multifaceted story is told here for the first time from the point of view of NASA project management.

  7. Phytochemical evaluation, antioxidant assay, antibacterial activity and determination of cell viability (J774 and THP1 alpha cell lines) of P. sylvestris leaf crude and methanol purified fractions

    PubMed Central

    Sharma, Dinesh C.; Shukla, Ritu; Ali, Jasarat; Sharma, Swati; Bajpai, Priti; Pathak, Neelam


    Phoenix sylvestris (Arecaceae family) known as Indian Date Palm has been identified as a component of traditional medicine against various ailments. The present study was focused on phytochemical screening of crude hexane, dichloromethane and methanol leaf extracts. The crude extracts showed the presence of alkaloids, flavonoids, and phenols in the plant leaves. In the study methanol extract was found most potent, so this extract was further fractionated by column chromatography and 9 methanol purified fractions (MPFs) were isolated. Most potential MPF8 (20:80 chloroform: methanol ratio fraction) significantly enhanced free radicals and antibacterial activity. The best MIC (Minimum inhibitory concentration) of MPF8 was investigated against M. luteus and E. coli at 1 mg/ml concentration. However, against other bacteria the MIC ranged from 1 mg/ml to 3 mg/ml. The GC-MS analysis showed the presence of many biologically active compounds such as alcohols, flavonoids, aromatic compounds, aldehydes, terpenoids fatty acid methyl esters, and phenolics. Pentadecanoic acid occupied maximum (52 %) area in GC-MS profiling. MPF8 was assayed for in-vitro cytotoxicity by MTT assay which confirms its less cytotoxicity at lower concentration and also significant ROS determination against J774 and THP1 cell lines after 2 and 4 hours. PMID:27047320

  8. Identification and mapping of a novel blackleg resistance locus LepR4 in the progenies from Brassica napus × B. rapa subsp. sylvestris.


    Yu, Fengqun; Gugel, Richard K; Kutcher, H Randy; Peng, Gary; Rimmer, S Roger


    Blackleg, caused by Leptosphaeria maculans, is one of the most economically important diseases of Brassica napus worldwide. Two blackleg-resistant lines, 16S and 61446, were developed through interspecific hybridization between B. napus and B. rapa subsp. sylvestris and backcrossing to B. napus. Classical genetic analysis demonstrated that a single recessive gene in both lines conferred resistance to L. maculans and that the resistance alleles were allelic. Using BC(1) progeny derived from each resistant plant, this locus was mapped to B. napus linkage group N6 and was flanked by microsatellite markers sN2189b and sORH72a in an interval of about 10 cM, in a region equivalent to about 6 Mb of B. rapa DNA sequence. This new resistance gene locus was designated as LepR4. The two lines were evaluated for resistance to a wide range of L. maculans isolates using cotyledon inoculation tests under controlled environment conditions, and for stem canker resistance in blackleg field nurseries. Results indicated that line 16S, carrying LepR4a, was highly resistant to all isolates tested on cotyledons and had a high level of stem canker resistance under field conditions. Line 61446, carrying LepR4b, was only resistant to some of the isolates tested on cotyledons and was weakly resistant to stem canker under field conditions.

  9. Fatty acids from seeds of Pinus pinea L.: composition and population profiling.


    Nasri, Nizar; Khaldi, Abdelhamid; Fady, Bruno; Triki, Saida


    Pinus pinea L. is widely disseminated all over the Mediterranean Basin. Qualitatively, P. pinea fatty acid seed composition is identical and typical of the genus Pinus. This composition is made of unsaturated oil with several unusual polymethylene-interrupted unsaturated fatty acids. Linoleic acid is the major fatty acid followed by oleic, palmitic and stearic acids. Quantitatively, for all Mediterranean populations, total amounts of fatty acids seem to be fairly constant and independent from their origin. When applying principal component analysis, it seems that there is not a distinct geographical variability. Tunisian populations appear to be integral part of the Mediterranean populations without any particular structuring. Taking into account this research and the data reported in the literature, we can confirm that P. pinea expresses no significant variability. This low genetic diversity revealed by fatty acid composition can be explained by anthropogenetic diffusion of genetically homogeneous reproductive material as early as the first explorations.

  10. Characterization of polymorphic microsatellite markers in Pinus armandii (Pinaceae), an endemic conifer species to China1

    PubMed Central

    Dong, Wan-Lin; Wang, Ruo-Nan; Yan, Xiao-Hao; Niu, Chuan; Gong, Lin-Lin; Li, Zhong-Hu


    Premise of the study: Pinus armandii (Pinaceae) is an important conifer tree species in central and southwestern China, and it plays a key role in the local forest ecosystems. To investigate its population genetics and design effective conservation strategies, we characterized 18 polymorphic microsatellite markers for this species. Methods and Results: Eighteen novel polymorphic and 16 monomorphic microsatellite loci of P. armandii were isolated using Illumina MiSeq technology. The number of alleles per locus ranged from two to five. The expected heterozygosity ranged from 0.061 to 0.609 with an average of 0.384, and the observed heterozygosity ranged from 0.063 to 0.947 with an average of 0.436. Seventeen loci could be successfully transferred to five related Pinus species (P. koraiensis, P. griffithii, P. sibirica, P. pumila, and P. bungeana). Conclusions: These novel microsatellites could potentially be used to investigate the population genetics of P. armandii and related species. PMID:27785387

  11. Postpyrogenic transformation of soils under Pinus sibirica forests in the southern Lake Baikal basin

    NASA Astrophysics Data System (ADS)

    Krasnoshchekov, Yu. N.; Cherednikova, Yu. S.


    The results of experimental investigations of the postpyrogenic dynamics of the widespread rawhumus podzols under Pinus sibirica forests in the southern Lake Baikal basin are discussed. Ground fires transform the diagnostic surface organic soil horizons into organic pyrogenic horizons (Opir, OL/Opir, and AOpir). The adverse effect of ground fires of different intensities on the changes in the reserves, the fractional composition of the litters, and the chemical composition of the organic horizons is shown. The soils of dark coniferous forests are inclined to long-lasting restoration. The Pinus sibirica regrowth under the canopy of deciduous species serves as the basis for the restoration of native stands and the formation of the soils characteristic of the southern part of the Lake Baikal basin.

  12. Volatiles as Chemosystematic Markers for Distinguishing Closely Related Species within the Pinus mugo Complex.


    Celiński, Konrad; Bonikowski, Radosław; Wojnicka-Półtorak, Aleksandra; Chudzińska, Ewa; Maliński, Tomasz


    Headspace solid-phase microextraction (HS-SPME) coupled to GC/MS analysis was used to identify the constituents of pine-needle volatiles differentiating three closely-related pine species within the Pinus mugo complex, i.e., P. uncinata Ramond ex DC., P. uliginosa G.E.Neumann ex Wimm., and P. mugo Turra. Moreover, chemosystematic markers were proposed for the three analyzed pine species. The major constituents of the pine-needle volatiles were α-pinene (28.4%) and bornyl acetate (10.8%) for P. uncinata, δ-car-3-ene (21.5%) and α-pinene (16.1%) for P. uliginosa, and α-pinene (20%) and δ-car-3-ene (18.1%) for P. mugo. This study is the first report on the application of the composition of pine-needle volatiles for the reliable identification of closely-related pine species within the Pinus mugo complex.

  13. Mineral Nutrient Requirements of a Loblolly Pine (Pinus taeda) Cell Suspension Culture 1

    PubMed Central

    Teasdale, Robert D.; Dawson, Pamela A.; Woolhouse, Harold W.


    The mineral nutrient requirements of Pinus taeda cells were explored using quantitative cell culture growth measurements. An appraisal was thereby made of the critical features of a novel and successful medium which was developed specifically for this gymnosperm using chemical composition data for developing seeds, and characterized by generally high concentration of all micronutrients, high magnesium, and low calcium. The high magnesium concentration was found not to be detrimental and possibly beneficial whereas the calcium level bordered on a deficiency threshold. Within the microelements high iodide was found to be essential, as was a higher borate level than is present in media developed for angiosperms. High zinc concentrations were also beneficial, with normal levels permitting slower but nevertheless healthy growth. An improved medium was thereby formulated which was stress-free and exhibited broader genotype specificity. This new formulation has proved very successful in maintaining long-term growth of highly uniform and apparently meristematic suspension cultures of Pinus radiata. PMID:16665170

  14. Photosynthetic acclimation to enriched CO{sub 2} concentrations in Pinus Ponderosa

    SciTech Connect

    Torres, M.P.


    By the middle of the 21st century earth`s ambient CO{sub 2} level is expected to increase two-fold ({approximately}350 umol/L). Higher levels of CO{sub 2} are expected to cause major changes in the morphological, physiological, and biochemical traits of the world`s vegetation. Therefore, we constructed an experiment designed to measure the long-term acclimation processes of Pinus Ponderosa. As a prominent forest conifer, Pinus Ponderosa is useful when assessing a large scale global carbon budget. Eighteen genetically variable families were exposed to 3 different levels of CO{sub 2} (350 umol/L, 525 umol/L, 700 umol/L), for three years. Acclimation responses were quantified by assays of photosynthetic rate, chlorophyll fluorescence, and chlorophyll pigment concentrations.

  15. Development and characterization of nine microsatellites for an endangered tree, Pinus wangii (Pinaceae)1

    PubMed Central

    Dou, Jing-Jing; Zhou, Ren-Chao; Tang, An-Jun; Ge, Xue-Jun; Wu, Wei


    • Premise of the study: Pinus wangii is an endemic and endangered species in southwestern China, and microsatellite primers were developed to characterize its genetic diversity and population structure. • Methods and Results: Using the Fast Isolation by AFLP of Sequences COntaining repeats (FIASCO) protocol, nine sets of microsatellite primers were developed in P. wangii. One population with 26 individuals of P. wangii, as well as 11 individuals each for two congeneric species, P. taiwanensis and P. squamata, were used to test their polymorphism and transferability. The number of alleles per locus ranged from one to seven with an average of 3.7, and the observed heterozygosity and expected heterozygosity ranged from 0 to 0.91 and 0 to 0.75, respectively. • Conclusions: We developed nine sets of polymorphic microsatellite loci that are suitable for investigating genetic diversity and population structure of P. wangii, and these markers may be useful for other Pinus species. PMID:25202511

  16. Numerical simulations of fire spread in a Pinus pinaster needles fuel bed

    NASA Astrophysics Data System (ADS)

    Menage, D.; Chetehouna, K.; Mell, W.


    The main aim of this paper is to extend the cases of WFDS model validation by comparing its predictions to literature data on a ground fire spreading in a Pinus pinaster needles fuel bed. This comparison is based on the experimental results of Mendes-Lopes and co-workers. This study is performed using the same domain as in the experiments (3.0m×1.2m×0.9m) with a mesh of 49,280 cells. We investigate the influence of wind (varied between 0 and 2 m/s) and moisture content (10 and 18%) on the rate of spread. The WFDS rate of spread is determined using a cross-correlation function of ground temperature profiles. The simulated rate of spread, as well as temperature, compared favourably to experimental values and show the WFDS model capacity to predict ground fires in Pinus Pinaster fuel beds.

  17. Matching roots to their environment

    PubMed Central

    White, Philip J.; George, Timothy S.; Gregory, Peter J.; Bengough, A. Glyn; Hallett, Paul D.; McKenzie, Blair M.


    Background Plants form the base of the terrestrial food chain and provide medicines, fuel, fibre and industrial materials to humans. Vascular land plants rely on their roots to acquire the water and mineral elements necessary for their survival in nature or their yield and nutritional quality in agriculture. Major biogeochemical fluxes of all elements occur through plant roots, and the roots of agricultural crops have a significant role to play in soil sustainability, carbon sequestration, reducing emissions of greenhouse gasses, and in preventing the eutrophication of water bodies associated with the application of mineral fertilizers. Scope This article provides the context for a Special Issue of Annals of Botany on ‘Matching Roots to Their Environment’. It first examines how land plants and their roots evolved, describes how the ecology of roots and their rhizospheres contributes to the acquisition of soil resources, and discusses the influence of plant roots on biogeochemical cycles. It then describes the role of roots in overcoming the constraints to crop production imposed by hostile or infertile soils, illustrates root phenotypes that improve the acquisition of mineral elements and water, and discusses high-throughput methods to screen for these traits in the laboratory, glasshouse and field. Finally, it considers whether knowledge of adaptations improving the acquisition of resources in natural environments can be used to develop root systems for sustainable agriculture in the future. PMID:23821619

  18. Morphometric analysis of root shape.


    Grabov, A; Ashley, M K; Rigas, S; Hatzopoulos, P; Dolan, L; Vicente-Agullo, F


    Alterations in the root shape in plant mutants indicate defects in hormonal signalling, transport and cytoskeleton function. To quantify the root shape, we introduced novel parameters designated vertical growth index (VGI) and horizontal growth index (HGI). VGI was defined as a ratio between the root tip ordinate and the root length. HGI was the ratio between the root tip abscissa and the root length. To assess the applicability of VGI and HGI for quantification of root shape, we analysed root development in agravitropic Arabidopsis mutants. Statistical analysis indicated that VGI is a sensitive morphometric parameter enabling detection of weak gravitropic defects. VGI dynamics were qualitatively similar in auxin-transport mutants aux1, pin2 and trh1, but different in the auxin-signalling mutant axr2. Analysis of VGI and HGI of roots grown on tilted plates showed that the trh1 mutation affected downstream cellular responses rather than perception of the gravitropic stimulus. All these tests indicate that the VGI and HGI analysis is a versatile and sensitive method for the study of root morphology.

  19. Timing and magnitude of C partitioning through a young loblolly pine (Pinus taeda L.) stand using 13C labeling and shade treatments


    Warren, Jeffrey M.; Iversen, Colleen M.; Garten, Jr., Charles T.; ...


    The dynamics of rapid changes in carbon (C) partitioning within forest ecosystems are not well understood, which limits improvement of mechanistic models of C cycling. Our objective was to inform model processes by describing relationships between C partitioning and accessible environmental or physiological measurements, with a special emphasis on short-term C flux through a forest ecosystem. We exposed eight 7-year-old loblolly pine (Pinus taeda L.) trees to air enriched with 13CO2 and then implemented adjacent light shade (LS) and heavy shade (HS) treatments in order to manipulate C uptake and flux. The impacts of shading on photosynthesis, plant water potential,more » sap flow, basal area growth, root growth, and soil CO2 efflux rate (CER) were assessed for each tree over a three-week period. The progression of the 13C label was concurrently tracked from the atmosphere through foliage, phloem, roots, and surface soil CO2 efflux. The HS treatment significantly reduced C uptake, sap flow, stem growth and fine root standing crop, and resulted in greater residual soil water content to 1 m depth. Sap flow was strongly correlated with CER on the previous day, but not the current day, with no apparent treatment effect on the relationship. Although there were apparent reductions in new C flux belowground, the heavy shade treatment did not noticeably reduce the magnitude of belowground autotrophic and heterotrophic respiration based on surface soil CO2 efflux rate (CER), which was overwhelmingly driven by soil temperature and moisture. The 13C label was immediately detected in foliage on label day (half-life = 0.5 d), progressed through phloem by day 2 (half-life = 4.7 d), roots by day 2-4, and subsequently was evident as respiratory release from soil which peaked between days 3-6. The δ13C of soil CO2 efflux was strongly correlated with phloem 13C on the previous day, or two days earlier. While the 13C label was readily tracked through the ecosystem, the fate of root

  20. Labdane-type diterpenes active against acne from pine cones (Pinus densiflora).


    Sultan, Md Zakir; Jeon, Young-Min; Moon, Surk-Sik


    Bioassay-guided extraction and fractionation of the aqueous methanolic extract of the cones of Pinus densiflora (Pinaceae) afforded one new labdane-type diterpene aldehyde, 15-nor-14-oxolabda-8(17),12 E-diene-18-oic acid, along with eight known diterpenes. Their structures were elucidated using spectroscopic methods as well as by comparison with previously reported data. The isolates showed antibacterial (Propionibacterium acnes) and antifungal activities.

  1. Geophysical Imaging of Root Architecture and Root-soil Interaction

    NASA Astrophysics Data System (ADS)

    Wu, Y.; Dafflon, B.; Hubbard, S. S.


    Roots play a critical role in controlling water and nutrient uptake, soil biogeochemical processes, as well as the physical anchorage for plants. While important processes, such as root hydraulic redistribution for optimal growth and survival have been recognized, representation of roots in climate models, e.g. its carbon storage, carbon resilience, root biomass, and role in regulating water and carbon fluxes across the rhizosphere and atmosphere interface is still challenging. Such a challenge is exacerbated because of the large variations of root architecture and function across species and locations due to both genetic and environmental controls and the lack of methods for quantifying root mass, distribution, dynamics and interaction with soils at field scales. The scale, complexity and the dynamic nature of plant roots call for minimally invasive methods capable of providing quantitative estimation of root architecture, dynamics over time and interactions with the soils. We present a study on root architecture and root-soil interactions using geophysical methods. Parameters and processes of interests include (1) moisture dynamics around root zone and its interaction with plant transpiration and environmental controls and (2) estimation of root structure and properties based on geophysical signals. Both pot and field scale studies were conducted. The pot scale experiments were conducted under controlled conditions and were monitored with cross-well electrical resistivity tomography (ERT), TDR moisture sensors and temperature probes. Pots with and without a tree were compared and the moisture conditions were controlled via a self regulated pumping system. Geophysical monitoring revealed interactions between roots and soils under dynamic soil moisture conditions and the role of roots in regulating the response of the soil system to changes of environmental conditions, e.g. drought and precipitation events. Field scale studies were conducted on natural trees using

  2. Inoculation of containerized Pinus pinea L. seedlings with seven ectomycorrhizal fungi.


    Rincón, A; Alvarez, I F; Pera, J


    Containerized Pinus pinea L. seedlings are commonly used for reforestation in the Mediterranean area. While there is an increasing knowledge of the potential ectomycorrhizal fungi associated with Pinus pinea, few studies exist of inoculation techniques with selected ectomycorrhizal fungi. We tested seven ectomycorrhizal fungi for their effectiveness with containerized Pinus pinea seedlings. Hebeloma crustuliniforme, Laccaria laccata and Pisolithus tinctorius were applied as vegetative inocula while Melanogaster ambiguus, Pisolithus tinctorius, Rhizopogon luteolus, Rhizopogon roseolus and Scleroderma verrucosum were tested as spore inocula. The inoculum of each fungus was tested at several application rates. Among the fungi tested as vegetative inocula, the highest percentages of ectomycorrhizas were obtained with H. crustuliniforme at all rates tested. The ectomycorrhizas formed by L. laccata varied from 11% to 40% depending on the inoculum rate applied. Vegetative inoculum of Pisolithus tinctorius was only effective at the highest inoculum rates and gave mycorrhization percentages around 60%. Pisolithus tinctorius applied as a spore inoculum formed ectomycorrhizas at a frequency of about 50% at the effective inoculum rates. The rest of the fungi applied as spore inocula produced more than 50% of ectomycorrhizas at the effective spore concentrations. These included the highest percentages of ectomycorrhizas (>80%) obtained with both Rhizopogon species. Differences in growth due to inoculation with the different fungi were not detected and in some cases inoculation even reduced the total biomass accumulated by seedlings. All seedlings reached a size suitable for transplantation.

  3. Dissipation of excess excitation energy of the needle leaves in Pinus trees during cold winters

    NASA Astrophysics Data System (ADS)

    Zhang, AO; Cui, Zhen-Hai; Yu, Jia-Lin; Hu, Zi-Ling; Ding, Rui; Ren, Da-Ming; Zhang, Li-Jun


    Photooxidative damage to the needle leaves of evergreen trees results from the absorption of excess excitation energy. Efficient dissipation of this energy is essential to prevent photodamage. In this study, we determined the fluorescence transients, absorption spectra, chlorophyll contents, chlorophyll a/ b ratios, and relative membrane permeabilities of needle leaves of Pinus koraiensis, Pinus tabulaeformis, and Pinus armandi in both cold winter and summer. We observed a dramatic decrease in the maximum fluorescence ( F m) and substantial absorption of light energy in winter leaves of all three species. The F m decline was not correlated with a decrease in light absorption or with changes in chlorophyll content and chlorophyll a/ b ratio. The results suggested that the winter leaves dissipated a large amount of excess energy as heat. Because the cold winter leaves had lost normal physiological function, the heat dissipation depended solely on changes in the photosystem II supercomplex rather than the xanthophyll cycle. These findings imply that more attention should be paid to heat dissipation via changes in the photosystem complex structure during the growing season.

  4. Chloroplast evolution in the Pinus montezumae complex: a coalescent approach to hybridization.


    Matos, J A; Schaal, B A


    This study addresses the evolutionary history of the chloroplast genomes of two closely related pine species, Pinus hartwegii Lindl. and P. montezumae Lamb (subsect. Ponderosae) using coalescent theory and some of the statistical tools that have been developed from it during the past two decades. Pinus hartwegii and P. montezumae are closely related species in the P. montezumae complex (subsect. Ponderosae) of Mexico and Central America. Pinus hartwegii is a high elevation species, whereas P. montezumae occurs at lower elevations. The two species occur on many of the same mountains throughout Mexico. A total of 350 individuals of P. hartwegii and P. montezumae were collected from Nevado de Colima (Jalisco), Cerro Potosí (Nuevo León), Iztaccihuatl/Popocatepetl (México), and Nevado de Toluca (México). The chloroplast genome of P. hartwegii and P. montezumae was mapped using eight restriction enzymes. Fifty-one different haplotypes were characterized; 38 of 160 restriction sites were polymorphic. Clades of most parsimoniously related chloroplast haplotypes are geographically localized and do not overlap in distribution, and the geographically localized clades of haplotypes include both P. hartwegii and P. montezumae. Some haplotypes in the clades occur in only one of the two species, whereas other haplotypes occur in both species. These data strongly suggest ancient and/or ongoing hybridization between P. hartwegii and P. montezumae and a shared chloroplast genome history within geographic regions of Mexico.

  5. Chemical composition changes in eucalyptus and pinus woods submitted to heat treatment.


    Brito, J O; Silva, F G; Leão, M M; Almeida, G


    This study investigated the influence of heat treatment on the chemical composition of Eucalyptus saligna and Pinus caribaea var. hondurensis woods to understand its role in wood processing. E. saligna and P. caribaea var. hondurensis woods were treated in a laboratorial electric furnace at 120, 140, 160 and 180 degrees C to induce their heat treatment. The chemical composition of the resulting products and those from original wood were determined by gas chromatography. Eucalyptus and Pinus showed a significant reduction in arabinose, manose, galactose and xylose contents when submitted to increasing temperatures. No significant alteration in glucose content was observed. Lignin content, however, increased during the heat process. There was a significant reduction in extractive content for Eucalyptus. On the other hand, a slight increase in extractive content has been determined for the Pinus wood, and that only for the highest temperature. These different behaviors can be explained by differences in chemical constituents between softwoods and hardwoods. The results obtained in this study provide important information for future research and utilization of thermally modified wood.

  6. Soil compaction and organic matter affect conifer seedling nonmycorrhizal and ectomycorrhizal root tip abundance and diversity. Forest Service research paper

    SciTech Connect

    Amaranthus, M.P.; Page-Dumroese, D.; Harvey, A.; Cazares, E.; Bednar, L.F.


    Three levels of organic matter removal (bole only; bole and crowns; and bole, crowns, and forest floor) and three levels of mechanical soil compaction (no compaction, moderate compaction, and severe soil compaction) were studied as they influence Douglas-fir (Pseudotsuga menziesii var. glauca (Beissn.) Franco) and western white pine (Pinus monticola Dougl. ex D. Don) seedlings following outplanting. Moderate and severe soil compaction significantly reduced nonmycorrhizal root tip abundance on both Douglas-fir and western white pine seedlings (p less than or equal to 0.05). Ectomycorrhizal root tip abundance was significantly reduced on Douglas-fir seedlings in severely compacted areas with bole and crowns and bole, crowns, and forest floor removed. Ectomycorrhizal diversity also was significantly reduced on Douglas-fir seedlings in all severely compacted areas.

  7. Biomarker genes highlight intraspecific and interspecific variations in the responses of Pinus taeda L. and Pinus radiata D. Don to Sirex noctilio F. acid gland secretions.


    Bordeaux, John Michael; Lorenz, W Walter; Dean, Jeffrey F D


    Sirex noctilio F., a Eurasian horntail woodwasp recently introduced into North America, oviposits in pines and other conifers and in the process spreads a phytopathogenic fungus that serves as a food source for its larvae. During oviposition the woodwasp also deposits mucus produced in its acid (venom) gland that alters pine defense responses and facilitates infection by the fungus. A 26,496-feature loblolly pine cDNA microarray was used to survey gene expression of pine tissue responding to S. noctilio venom. Six genes were selected for further assessment by quantitative real-time polymerase chain reaction (qRT-PCR), including one that encoded an apparent PR-4 protein and another that encoded a thaumatin-like protein. Expression of both was strongly induced in response to venom, while expression of an apparent actin gene (ACT1) was stable in response to the venom. The pattern of gene response was similar in Pinus taeda L. and Pinus radiata D. Don, but the magnitude of response in P. radiata was significantly stronger for each of the induced genes. The magnitude of the biomarker gene response to venom also varied according to genotype within these two species. The qRT-PCR assay was used to demonstrate that the primary bioactive component in S. noctilio venom is a polypeptide.

  8. Composition and Bioactivity of Lipophilic Metabolites from Needles and Twigs of Korean and Siberian Pines (Pinus koraiensis Siebold & Zucc. and Pinus sibirica Du Tour).


    Shpatov, Alexander V; Popov, Sergey A; Salnikova, Olga I; Kukina, Tatyana P; Shmidt, Emma N; Um, Byung Hun


    Lipophilic extractive metabolites in different parts of the shoot system (needles and defoliated twigs) of Korean pine, Pinus koraiensis, and Siberian pine, Pinus sibirica, were studied by GC/MS. Korean pine needles comprised mainly bornyl p-coumarate, heterocyclic 15-O-functionalized labdane type acids (lambertianic acid), 10-nonacosanol, sterols and their esters. While Siberian pine needles contained less bornyl p-coumarate, lambertianic acid, sterols and their esters, but were richer in other 15-O-functionalized labdane type acids. The major components of the twig extract of P. koraiensis were lambertianic acid, abietane and isopimarane type acids, cembrane type alcohols, 8-O-functionalized labdanoids, sterols, sterol esters, and acylglycerols. The same extract of P. sibirica differed in larger amounts of other 15-O-functionalized labdane type acids and pinolenic acid glycerides, but in less quantities of cembranoids and 8-O-functionalized labdanoids. The labdane type pinusolic acid was detected for the first time in Korean pine. P. koraiensis was found to be unique in the genus for an ability to synthesize phyllocladane diterpenoids. The content of bound Δ(5) -unsaturated polymethylene-interrupted fatty acids in the twig extracts of the both pines was similar or superior to that in their seed oil. Among the pines' metabolites tested isocembrol was strongest in inhibition of both α-glucosidase (IC50 2.9 μg/ml) and NO production in activated macrophages (IC50 3.6 μg/ml).

  9. Differences in defence responses of Pinus contorta and Pinus banksiana to the mountain pine beetle fungal associate Grosmannia clavigera are affected by water deficit.


    Arango-Velez, Adriana; El Kayal, Walid; Copeland, Charles C J; Zaharia, L Irina; Lusebrink, Inka; Cooke, Janice E K


    We tested the hypotheses that responses to the mountain pine beetle fungal associate Grosmannia clavigera will differ between the evolutionarily co-evolved host lodgepole pine (Pinus contorta var. latifolia) and the naïve host jack pine (Pinus banksiana) and that these responses will be influenced by water availability. G. clavigera inoculation resulted in more rapid stem lesion development in lodgepole than in jack pine; water deficit delayed lesion development in both species. Decreased hydraulic conductivity was observed in inoculated lodgepole pine seedlings, likely because of tracheid occlusion by fungal hyphae and/or metabolite accumulation. Drought but not inoculation significantly impacted bark abscisic acid levels. Jasmonic and salicylic acid were implicated in local and systemic responses of both species to G. clavigera, with salicylic acid appearing to play a greater role in jack pine response to G. clavigera than lodgepole pine. Water deficit increased constitutive levels and/or attenuated induced responses to G. clavigera for several monoterpenes in lodgepole but not jack pine. Instead, inoculation of well-watered but not water deficit jack pine resulted in a greater number of xylem resin ducts. These findings reveal mechanisms underlying differences in G. clavigera-induced responses between lodgepole and jack pine hosts, and how water availability modulates these responses.

  10. Assimilation, Distribution, and Root Exudation of C by Ponderosa Pine Seedlings under Induced Water Stress.


    Reid, C P


    The effect of specific levels of induced water stress on the root exudation of (14)C from 9-month-old and 12-month-old ponderosa pine (Pinus ponderosa Laws.) seedlings was examined. Polyethylene glycol (PEG-4000) was used to decrease root solution water potentials by 0, -1.9, -2.6, -5.5, -9.6 and -11.9 bars in either aerated 0.25X Hoagland's nutrient solution or aerated distilled water.Assimilation of (14)CO(2) by plants under stress and subsequent translocation of (14)C label to the roots were both inhibited by a decrease in substrate water potential. Six days after (14)CO(2) introduction essentially no (14)C was detected in the roots of plants maintained at solution potentials of -5.5 bars or below. In subsequent studies (14)CO(2) was introduced 4 days prior to induction of stress. This allowed sufficient time for distribution of (14)C label throughout the root system.Root exudation of (14)C-labeled sugars, amino acids, and organic acids from plants in nutrient solution showed an increase from 0 to -1.9 bars, a decline from -1.9 to about -5.5 bars, and then an increase again from -5.5 to -11.9 bars. As substrate potential decreased, sugars as a percentage of total exudate increased, organic acids decreased and amino acids showed a slight decrease. Marked changes in percentages occurred between 0 and -2.6 bars. The exudation of sugars, amino acids, and organic acids from plants in distilled water showed similar trends in response to water stress as those in nutrient solution, but the quantity of total (14)C exuded was greater.

  11. Accelerated Stem Growth Rates and Improved Fiber Properties of Loblolly Pine: Functional Analysis Of CyclinD from Pinus taeda

    SciTech Connect

    Dr. John Cairney, School of Biology and Institute of Paper Science and Technology @ Georgia Tech, Georgia Institute of Technology; Dr. Gary Peter, University of Florida; Dr. Ulrika Egertsdotter, Dept. of Forestry, Virgina Tech; Dr. Armin Wagner, New Zealand Forest Research Institute Ltd.


    A sustained supply of low-cost, high quality raw materials is essential for the future success of the U.S. forest products industry. To maximize stem (trunk) growth, a fundamental understanding of the molecular mechanisms that regulate cell divisions within the cambial meristem is essential. We hypothesize that auxin levels within the cambial meristem regulate cyclin gene expression and this in turn controls cell cycle progression as occurs in all eukaryotic cells. Work with model plant species has shown that ectopic overexpression of cyclins promotes cell division thereby increasing root growth > five times. We intended to test whether ectopic overexpression of cambial cyclins in the cambial zone of loblolly pine also promotes cell division rates that enhance stem growth rates. Results generated in model annual angiosperm systems cannot be reliably extrapolated to perennial gymnosperms, thus while the generation and development of transgenic pine is time consuming, this is the necessary approach for meaningful data. We succeeded in isolating a cyclin D gene and Clustal analysis to the Arabidopsis cyclin D gene family indicates that it is more closely related to cyclin D2 than D1 or D3 Using this gene as a probe we observed a small stimulation of cyclin D expression in somatic embryo culture upon addition of auxin. We hypothesized that trees with more cells in the vascular cambial and expansion zones will have higher cyclin mRNA levels. We demonstrated that in trees under compressive stress where the rates of cambial divisions are increased on the underside of the stem relative to the top or opposite side, there was a 20 fold increase in the level of PtcyclinD1 mRNA on the compressed side of the stem relative to the opposite. This suggests that higher secondary growth rates correlate with PtcyclinD1 expression. We showed that larger diameter trees show more growth during each year and that the increased growth in loblolly pine trees correlates with more cell

  12. The host plant Pinus pinaster exerts specific effects on phosphate efflux and polyphosphate metabolism of the ectomycorrhizal fungus Hebeloma cylindrosporum: a radiotracer, cytological staining and (31) P NMR spectroscopy study.


    Torres-Aquino, Margarita; Becquer, Adeline; Le Guernevé, Christine; Louche, Julien; Amenc, Laurie K; Staunton, Siobhan; Quiquampoix, Hervé; Plassard, Claude


    Ectomycorrhizal (ECM) association can improve plant phosphorus (P) nutrition. Polyphosphates (polyP) synthesized in distant fungal cells after P uptake may contribute to P supply from the fungus to the host plant if they are hydrolyzed to phosphate in ECM roots then transferred to the host plant when required. In this study, we addressed this hypothesis for the ECM fungus Hebeloma cylindrosporum grown in vitro and incubated without plant or with host (Pinus pinaster) and non-host (Zea mays) plants, using an experimental system simulating the symbiotic interface. We used (32) P labelling to quantify P accumulation and P efflux and in vivo and in vitro nuclear magnetic resonance (NMR) spectroscopy and cytological staining to follow the fate of fungal polyP. Phosphate supply triggered a massive P accumulation as newly synthesized long-chain polyP in H. cylindrosporum if previously grown under P-deficient conditions. P efflux from H. cylindrosporum towards the roots was stimulated by both host and non-host plants. However, the host plant enhanced (32) P release compared with the non-host plant and specifically increased the proportion of short-chain polyP in the interacting mycelia. These results support the existence of specific host plant effects on fungal P metabolism able to provide P in the apoplast of ectomycorrhizal roots.

  13. A Split-Root Technique for Measuring Root Water Potential

    PubMed Central

    Adeoye, Kingsley B.; Rawlins, Stephen L.


    Water encounters various resistances in moving along a path of decreasing potential energy from the soil through the plant to the atmosphere. The reported relative magnitudes of these pathway resistances vary widely and often these results are conflicting. One reason for such inconsistency is the difficulty in measuring the potential drop across various segments of the soil-plant-atmosphere continuum. The measurement of water potentials at the soil-root interface and in the root xylem of a transpiring plant remains a challenging problem. In the divided root experiment reported here, the measured water potential of an enclosed, nonabsorbing branch of the root system of young corn (Bonanza) plants to infer the water potential of the remaining roots growing in soil was used. The selected root branch of the seedling was grown in a specially constructed Teflon test tube into which a screen-enclosed thermocouple psychrometer was inserted and sealed to monitor the root's water potential. The root and its surrounding atmosphere were assumed to be in vapor equilibrium. Images PMID:16661886

  14. Maximum-rank root subsystems of hyperbolic root systems

    SciTech Connect

    Tumarkin, P V


    A Kac-Moody algebra is said to be hyperbolic if it corresponds to a generalized Cartan matrix of hyperbolic type. Root subsystems of root systems of algebras of this kind are studied. The main result of the paper is the classification of the maximum-rank regular hyperbolic subalgebras of hyperbolic Kac-Moody algebras.

  15. The roots of predictivism.


    Barnes, Eric Christian


    In The Paradox of Predictivism (2008, Cambridge University Press) I tried to demonstrate that there is an intimate relationship between predictivism (the thesis that novel predictions sometimes carry more weight than accommodations) and epistemic pluralism (the thesis that one important form of evidence in science is the judgments of other scientists). Here I respond to various published criticisms of some of the key points from Paradox from David Harker, Jarret Leplin, and Clark Glymour. Foci include my account of predictive novelty (endorsement novelty), the claim that predictivism has two roots, the prediction per se and predictive success, and my account of why Mendeleev's predictions carried special weight in confirming the Periodic Law of the Elements.

  16. Lumbosacral nerve root avulsion.


    Chin, C H; Chew, K C


    Lumbosacral nerve root avulsion is a rare clinical entity. Since the first description in 1955, only 35 cases have been reported. It is often associated with pelvic fractures and may be missed in the initial clinical examination as these patients usually present with multiple injuries. We present three such cases with clinical and radiological findings. These patients were involved in road traffic accidents. Two had fractures of the sacroiliac joint with diastasis of the symphysis pubis (Tile type C 1.2) and one had fractures of the public rami (Tile type B 2.1). All three had various degrees of sensory and motor deficit of the lower limbs. Lumbar myelogram shows characteristic pseudomeningoceles in the affected lumboscral region. Magnetic resonance (MR) imaging provides an additional non-invasive modality to diagnose this condition.

  17. New roots for agriculture: exploiting the root phenome.


    Lynch, Jonathan P; Brown, Kathleen M


    Recent advances in root biology are making it possible to genetically design root systems with enhanced soil exploration and resource capture. These cultivars would have substantial value for improving food security in developing nations, where yields are limited by drought and low soil fertility, and would enhance the sustainability of intensive agriculture. Many of the phenes controlling soil resource capture are related to root architecture. We propose that a better understanding of the root phenome is needed to effectively translate genetic advances into improved crop cultivars. Elementary, unique root phenes need to be identified. We need to understand the 'fitness landscape' for these phenes: how they affect crop performance in an array of environments and phenotypes. Finally, we need to develop methods to measure phene expression rapidly and economically without artefacts. These challenges, especially mapping the fitness landscape, are non-trivial, and may warrant new research and training modalities.

  18. New roots for agriculture: exploiting the root phenome

    PubMed Central

    Lynch, Jonathan P.; Brown, Kathleen M.


    Recent advances in root biology are making it possible to genetically design root systems with enhanced soil exploration and resource capture. These cultivars would have substantial value for improving food security in developing nations, where yields are limited by drought and low soil fertility, and would enhance the sustainability of intensive agriculture. Many of the phenes controlling soil resource capture are related to root architecture. We propose that a better understanding of the root phenome is needed to effectively translate genetic advances into improved crop cultivars. Elementary, unique root phenes need to be identified. We need to understand the ‘fitness landscape’ for these phenes: how they affect crop performance in an array of environments and phenotypes. Finally, we need to develop methods to measure phene expression rapidly and economically without artefacts. These challenges, especially mapping the fitness landscape, are non-trivial, and may warrant new research and training modalities. PMID:22527403

  19. Osmolarity and root canal antiseptics.


    Rossi-Fedele, G; Guastalli, A R


    Antiseptics used in endodontics for disinfection purposes include root canal dressings and irrigants. Osmotic shock is known to cause the alteration of microbial cell viability and might have a role in the mechanism of action of root canal antiseptics. The aim of this review was to determine the role of osmolarity on the performance of antiseptics in root canal treatment. A literature search using the Medline electronic database was conducted up to 30 May 2013 using the following search terms and combinations: 'osmolarity AND root canal or endodontic or antiseptic or irrigation or irrigant or medication or dressing or biofilm; osmolality AND root canal or endodontic or antiseptic or irrigation or irrigant or medication or dressing or biofilm; osmotic AND root canal or endodontic or antiseptic or irrigation or irrigant or medication or dressing or biofilm; osmosis AND root canal or endodontic or antiseptic or irrigation or irrigant or medication or dressing or biofilm; sodium chloride AND root canal or endodontic or antiseptic or irrigation or irrigant or medication or dressing or biofilm'. Publications were included if the effects of osmolarity on the clinical performance of antiseptics in root canal treatment were stated, if preparations with different osmolarities values were compared and if they were published in English. A hand search of articles published online, 'in press' and 'early view', and in the reference list of the included papers was carried out following the same criteria. A total of 3274 publications were identified using the database, and three were included in the review. The evidence available in endodontics suggests a possible role for hyperosmotic root canal medicaments as disinfectants, and that there is no influence of osmolarity on the tissue dissolution capacity of sodium hypochlorite. There are insufficient data to obtain a sound conclusion regarding the role of hypo-osmosis in root canal disinfection, or osmosis in any further desirable

  20. Potassium nutrition of ectomycorrhizal Pinus pinaster: overexpression of the Hebeloma cylindrosporum HcTrk1 transporter affects the translocation of both K(+) and phosphorus in the host plant.


    Garcia, Kevin; Delteil, Amandine; Conéjéro, Geneviève; Becquer, Adeline; Plassard, Claude; Sentenac, Hervé; Zimmermann, Sabine


    Mycorrhizal associations are known to improve the hydro-mineral nutrition of their host plants. However, the importance of mycorrhizal symbiosis for plant potassium nutrition has so far been poorly studied. We therefore investigated the impact of the ectomycorrhizal fungus Hebeloma cylindrosporum on the potassium nutrition of Pinus pinaster and examined the involvement of the fungal potassium transporter HcTrk1. HcTrk1 transcripts and proteins were localized in ectomycorrhizas using in situ hybridization and EGFP translational fusion constructs. Importantly, an overexpression strategy was performed on a H. cylindrosporum endogenous gene in order to dissect the role of this transporter. The potassium nutrition of mycorrhizal pine plants was significantly improved under potassium-limiting conditions. Fungal strains overexpressing HcTrk1 reduced the translocation of potassium and phosphorus from the roots to the shoots of inoculated plants in mycorrhizal experiments. Furthermore, expression of HcTrk1 and the phosphate transporter HcPT1.1 were reciprocally linked to the external inorganic phosphate and potassium availability. The development of these approaches provides a deeper insight into the role of ectomycorrhizal symbiosis on host plant K(+) nutrition and in particular, the K(+) transporter HcTrk1. The work augments our knowledge of the link between potassium and phosphorus nutrition via the mycorrhizal pathway.

  1. Tricholoma matsutake in a natural Pinus densiflora forest: correspondence between above- and below-ground genets, association with multiple host trees and alteration of existing ectomycorrhizal communities.


    Lian, Chunlan; Narimatsu, Maki; Nara, Kazuhide; Hogetsu, Taizo


    Tricholoma matsutake (matsutake) is an ectomycorrhizal (ECM) fungus that produces economically important mushrooms in Japan. Here, we use microsatellite markers to identify genets of matsutake sporocarps and below-ground ECM tips, as well as associated host genotypes of Pinus densiflora. We also studied ECM fungal community structure inside, beneath and outside the matsutake fairy rings, using morphological and internal transcribed spacer (ITS) polymorphism analysis. Based on sporocarp samples, one to four genets were found within each fairy ring, and no genetic differentiation among six sites was detected. Matsutake ECM tips were only found beneath fairy rings and corresponded with the genotypes of the above-ground sporocarps. We detected nine below-ground matsutake genets, all of which colonized multiple pine trees (three to seven trees per genet). The ECM fungal community beneath fairy rings was species-poor and significantly differed from those inside and outside the fairy rings. We conclude that matsutake genets occasionally establish from basidiospores and expand on the root systems of multiple host trees. Although matsutake mycelia suppress other ECM fungi during expansion, most of them may recover after the passage of the fairy rings.

  2. Molecular cloning and functional analysis of two phosphate transporter genes from Rhizopogon luteolus and Leucocortinarius bulbiger, two ectomycorrhizal fungi of Pinus tabulaeformis.


    Zheng, Rong; Wang, Jugang; Liu, Min; Duan, Guozhen; Gao, Xiaomin; Bai, Shulan; Han, Yachao


    Inorganic phosphorus (Pi) is essential for plant growth, and phosphate (P) deficiency is a primary limiting factor in Pinus tabulaeformis development in northern China. P acquisition in mycorrhizal plants is highly dependent on the activities of phosphate transporters of their root-associated fungi. In the current study, two phosphate transporter genes, RlPT and LbPT, were isolated from Rhizopogon luteolus and Leucocortinarius bulbiger, respectively, two ectomycorrhizal fungi forming symbiotic interactions with the P. tabulaeformis. Phylogenetic analysis suggested that the sequence of the phosphate transporter of L. bulbiger is most closely related to a phosphate transporter of Hebeloma cylindrosporum, whereas the phosphate transporter of R. luteolus is most closely related to that of Piloderma croceum. The subcellular localization indicated that RlPT and LbPT were expressed in the plasma membrane. The complementation assay in yeast indicated that both RlPT and LbPT partially compensated for the absence of phosphate transporter activity in the MB192 yeast strain, with a K m value of 57.90 μmol/L Pi for RlPT and 35.87 μmol/L Pi for LbPT. qPCR analysis revealed that RlPT and LbPT were significantly up-regulated at lower P availability, which may enhance P uptake and transport under Pi starvation. Our results suggest that RlPT and LbPT presumably play a key role in Pi acquisition by P. tabulaeformis via ectomycorrhizal fungi.

  3. Compensatory Root Water Uptake of Overlapping Root Systems

    NASA Astrophysics Data System (ADS)

    Agee, E.; Ivanov, V. Y.; He, L.; Bisht, G.; Shahbaz, P.; Fatichi, S.; Gough, C. M.; Couvreur, V.; Matheny, A. M.; Bohrer, G.


    Land-surface models use simplified representations of root water uptake based on biomass distributions and empirical functions that constrain water uptake during unfavorable soil moisture conditions. These models fail to capture the observed hydraulic plasticity that allows plants to regulate root hydraulic conductivity and zones of active uptake based on local gradients. Recent developments in root water uptake modeling have sought to increase its mechanistic representation by bridging the gap between physically based microscopic models and computationally feasible macroscopic approaches. It remains to be demonstrated whether bulk parameterization of microscale characteristics (e.g., root system morphology and root conductivity) can improve process representation at the ecosystem scale. We employ the Couvreur method of microscopic uptake to yield macroscopic representation in a coupled soil-root model. Using a modified version of the PFLOTRAN model, which represents the 3-D physics of variably saturated soil, we model a one-hectare temperate forest stand under natural and synthetic climatic forcing. Our results show that as shallow soil layers dry, uptake at the tree and stand level shift to deeper soil layers, allowing the transpiration stream demanded by the atmosphere. We assess the potential capacity of the model to capture compensatory root water uptake. Further, the hydraulic plasticity of the root system is demonstrated by the quick response of uptake to rainfall pulses. These initial results indicate a promising direction for land surface models in which significant three-dimensional information from large root systems can be feasibly integrated into the forest scale simulations of root water uptake.

  4. The Mass Loss and Humification of Stumps and Roots in Masson Pine Plantations Based on Log File Records

    PubMed Central

    Zhou, Jiao; Wu, Fuzhong; Yang, Wanqin; Tan, Bo; Xu, Zhenfeng; Zhang, Jian; Duan, Fei; Liu, Hui; Justine, Meta Francis


    Stumps account for a large proportion of coarse woody debris in managed forests, but their decay dynamics are poorly understood. The loss of mass and the degree of humification of the above-ground woody debris, below-ground woody debris, bark and root system (R1, 10 mm ≥ diameter > 0 mm; R2, 25 mm ≥ diameter >10 mm; 100 mm ≥ R3 > 25 mm; R4 > 100 mm) of Masson pine (Pinus massoniana) stump systems were evaluated in southwestern China in a chronosequence of plantations cut 1–15 years prior to the study. The results indicated that above-ground woody debris decomposed more quickly than below-ground woody debris and bark, whereas the degree of humification followed the opposite trend. Compared with one-year stumps, the mass losses of 15-year stump systems were 60.4% for above-ground woody debris, 42.1% for below-ground woody debris, 47.3% for bark, 69.9% for R1, 47.3% for R2, 51.0% for R3, and 83.2% for R4. In contrast, below-ground woody debris showed a greater degree of humification compared with other components in the stump system. Among the root system, fine roots (R1, diameter ≤ 10 mm) had the largest k value (0.09), whereas the decay rate of coarser roots (R2, R3, R4; diameter > 10 mm) increased with increasing root diameter. However, coarse roots showed a larger degree of humification (0.2–0.6) than fine roots (0.3–0.4). These results suggest that below-ground woody debris and coarse roots may display a higher degree of humification, showing greater short-term contributions to overall humification when compared with the other components in the stump system. PMID:27512999

  5. Gut and Root Microbiota Commonalities

    PubMed Central

    Ramírez-Puebla, Shamayim T.; Servín-Garcidueñas, Luis E.; Jiménez-Marín, Berenice; Bolaños, Luis M.; Rosenblueth, Mónica; Martínez, Julio; Rogel, Marco Antonio; Ormeño-Orrillo, Ernesto


    Animal guts and plant roots have absorption roles for nutrient uptake and converge in harboring large, complex, and dynamic groups of microbes that participate in degradation or modification of nutrients and other substances. Gut and root bacteria regulate host gene expression, provide metabolic capabilities, essential nutrients, and protection against pathogens, and seem to share evolutionary trends. PMID:23104406

  6. The root as a drill

    PubMed Central

    Santisree, Parankusam; Nongmaithem, Sapana; Sreelakshmi, Yellamaraju; Ivanchenko, Maria; Sharma, Rameshwar


    Plant roots forage the soil for water and nutrients and overcome the soil’s physical compactness. Roots are endowed with a mechanism that allows them to penetrate and grow in dense media such as soil. However, the molecular mechanisms underlying this process are still poorly understood. The nature of the media in which roots grow adds to the difficulty to in situ analyze the mechanisms underlying root penetration. Inhibition of ethylene perception by application of 1-methyl cyclopropene (1-MCP) to tomato seedlings nearly abolished the root penetration in Soilrite. The reversal of this process by auxin indicated operation of an auxin-ethylene signaling pathway in the regulation of root penetration. The tomato pct1–2 mutant that exhibits an enhanced polar transport of auxin required higher doses of 1-MCP to inhibit root penetration, indicating a pivotal role of auxin transport in this process. In this update we provide a brief review of our current understanding of molecular processes underlying root penetration in higher plants. PMID:22415043

  7. Light-Sensing in Roots

    PubMed Central

    Rabenold, Jessica J; Liscum, Emmanuel


    Light gradients in the soil have largely been overlooked in understanding plant responses to the environment. However, roots contain photoreceptors that may receive ambient light through the soil or piped light through the vascular cylinder. In recent experiments we demonstrated linkages between phototropin-1 photoreceptor production, root growth efficiency, and drought tolerance, suggesting that root plasticity in response to light signals contributes to the ecological niche of A. thaliana. However, the availability of light cues in natural soil environments is poorly understood, raising questions about the relevance of light-mediated root growth for fitness in nature. Additionally, photoreceptor expression is characterized by pleiotropy so unique functions cannot be clearly ascribed to root vs. shoot sensory mechanisms. These considerations show that challenges exist for resolving the contribution of light-sensing by roots to plant adaptation. We suggest that blue-light sensing in roots of A. thaliana provides a model system for addressing these challenges. By calibrating blue light gradients in soils of diverse A. thaliana habitats and comparing fitness of phot1 mutant and wild-type controls when grown in presence or absence of soil light cues, it should be possible to elucidate the ecological significance of light-mediated plasticity in roots. PMID:19704750

  8. Theon's Ladder for Any Root

    ERIC Educational Resources Information Center

    Osler, Thomas J.; Wright, Marcus; Orchard, Michael


    Theon's ladder is an ancient algorithm for calculating rational approximations for the square root of 2. It features two columns of integers (called a ladder), in which the ratio of the two numbers in each row is an approximation to the square root of 2. It is remarkable for its simplicity. This algorithm can easily be generalized to find rational…

  9. Project Work on Plant Roots.

    ERIC Educational Resources Information Center

    Devonald, V. G.


    Methods of investigating plant root growth developed for research purposes can be adopted for student use. Investigations of the effect of water table level and of ethylene concentration are described, and techniques of measuring root growth are explained. (Author/ML)

  10. Nitrogen (N) Deposition Impacts Seedling Growth of Pinus massoniana via N:P Ratio Effects and the Modulation of Adaptive Responses to Low P (Phosphorus)

    PubMed Central

    Zhang, Yi; Zhou, Zhichun; Yang, Qing


    Background In forest ecosystems with phosphorus (P) deficiency, the impact of atmospheric nitrogen (N) deposition on nutritional traits related to P uptake and P use potentially determines plant growth and vegetation productivity. Methodology/Principal Findings Two N deposition simulations were combined with three soil P conditions (homogeneous P deficiency with evenly low P; heterogeneous P deficiency with low subsoil P and high topsoil P; high P) using four full-sib families of Masson pine (Pinus massoniana). Under homogeneous P deficiency, N had a low effect on growth due to higher N:P ratios, whereas N-sensitive genotypes had lower N:P ratios and greater N sensitivity. The N effect increased under higher P conditions due to increased P concentration and balanced N:P ratios. An N:P threshold of 12.0–15.0 was detected, and growth was increased by N with an N:P ratio ≤ 12.0 and increased by P with an N:P ratio ≥ 15.0. Under homogeneous P deficiency, increased P use efficiency by N deposition improved growth. Under heterogeneous P deficiency, a greater P deficiency under N deposition due to increased N:P ratios induced greater adaptive responses to low P (root acid phosphatase secretion and topsoil root proliferation) and improved P acquisition and growth. Conclusions/Significance N deposition diversely affected seedling growth across different P conditions and genotypes via N:P ratio effects and the modulation of adaptive responses to low P. The positive impact of N on growth was genotype-specific and increased by soil P addition due to balanced N:P ratios. These results indicate the significance of breeding N-sensitive tree genotypes and improving forest soil P status to compensate for increasing N deposition. PMID:24205376

  11. Nucleotide polymorphisms in a pine ortholog of the Arabidopsis degrading enzyme cellulase KORRIGAN are associated with early growth performance in Pinus pinaster.


    Cabezas, José Antonio; González-Martínez, Santiago C; Collada, Carmen; Guevara, María Angeles; Boury, Christophe; de María, Nuria; Eveno, Emmanuelle; Aranda, Ismael; Garnier-Géré, Pauline H; Brach, Jean; Alía, Ricardo; Plomion, Christophe; Cervera, María Teresa


    We have carried out a candidate-gene-based association genetic study in Pinus pinaster Aiton and evaluated the predictive performance for genetic merit gain of the most significantly associated genes and single nucleotide polymorphisms (SNPs). We used a second generation 384-SNP array enriched with candidate genes for growth and wood properties to genotype mother trees collected in 20 natural populations covering most of the European distribution of the species. Phenotypic data for total height, polycyclism, root-collar diameter and biomass were obtained from a replicated provenance-progeny trial located in two sites with contrasting environments (Atlantic vs Mediterranean climate). General linear models identified strong associations between growth traits (total height and polycyclism) and four SNPs from the korrigan candidate gene, after multiple testing corrections using false discovery rate. The combined genomic breeding value predictions assessed for the four associated korrigan SNPs by ridge regression-best linear unbiased prediction (RR-BLUP) and cross-validation accounted for up to 8 and 15% of the phenotypic variance for height and polycyclic growth, respectively, and did not improve adding SNPs from other growth-related candidate genes. For root-collar diameter and total biomass, they accounted for 1.6 and 1.1% of the phenotypic variance, respectively, but increased to 15 and 4.1% when other SNPs from lp3.1, lp3.3 and cad were included in RR-BLUP models. These results point towards a desirable integration of candidate-gene studies as a means to pre-select relevant markers, and aid genomic selection in maritime pine breeding programs.

  12. Cassava root membrane proteome reveals activities during storage root maturation.


    Naconsie, Maliwan; Lertpanyasampatha, Manassawe; Viboonjun, Unchera; Netrphan, Supatcharee; Kuwano, Masayoshi; Ogasawara, Naotake; Narangajavana, Jarunya


    Cassava (Manihot esculenta Crantz) is one of the most important crops of Thailand. Its storage roots are used as food, feed, starch production, and be the important source for biofuel and biodegradable plastic production. Despite the importance of cassava storage roots, little is known about the mechanisms involved in their formation. This present study has focused on comparison of the expression profiles of cassava root proteome at various developmental stages using two-dimensional gel electrophoresis and LC-MS/MS. Based on an anatomical study using Toluidine Blue, the secondary growth was confirmed to be essential during the development of cassava storage root. To investigate biochemical processes occurring during storage root maturation, soluble and membrane proteins were isolated from storage roots harvested from 3-, 6-, 9-, and 12-month-old cassava plants. The proteins with differential expression pattern were analysed and identified to be associated with 8 functional groups: protein folding and degradation, energy, metabolism, secondary metabolism, stress response, transport facilitation, cytoskeleton, and unclassified function. The expression profiling of membrane proteins revealed the proteins involved in protein folding and degradation, energy, and cell structure were highly expressed during early stages of development. Integration of these data along with the information available in genome and transcriptome databases is critical to expand knowledge obtained solely from the field of proteomics. Possible role of identified proteins were discussed in relation with the activities during storage root maturation in cassava.

  13. Chemotaxonomic implications of the n-alkane composition and the nonacosan-10-ol content in Picea omorika, Pinus heldreichii, and Pinus peuce.


    Nikolić, Biljana; Tešević, Vele; Bojović, Srdjan; Marin, Petar D


    The n-alkane composition and the nonacosan-10-ol content in the needle cuticular waxes of Serbian spruce (Picea omorika), Bosnian pine (Pinus heldreichii), and Macedonian pine (Pinus peuce) were compared. The amount of nonacosan-10-ol in the needle waxes of P. omorika was higher than those in P. heldreichii and P. peuce. The range of n-alkanes was also wider in P. omorika (C18 -C35 ) than in P. heldreichii and P. peuce (C18 -C33 ). The dominant n-alkanes were C29 in the needle waxes of P. omorika, C23 , C27 , and C25 in those of P. heldreichii, and C29 , C25 , C27 , and C23 in those of P. peuce. The waxes of P. omorika contained higher amounts of n-alkanes C29 , C31 , and C33 , while those of P. heldreichii and P. peuce had higher contents of n-alkanes C21 , C22 , C23 , C24 , and C26 . The principal component analysis of the contents of nine n-alkanes showed a clear separation of the Serbian spruce populations from those of the two investigated pine species, which partially overlapped. The separation of the species was due to high contents of the n-alkanes C29 and C31 (P. omorika), C19 , C20 , C21 , C22 , C23 , and C24 (P. heldreichii), and C28 (P. peuce). Cluster analysis also showed a clear separation between the P. omorika populations on one side and the P. heldreichii and P. peuce populations on the other side. The n-alkane and terpene compositions are discussed in the light of their usefulness in chemotaxonomy as well as with regard to the biogeography and phylogeny of these rare and endemic conifers.

  14. Microwave-assisted extraction and ultrasonic extraction to determine polycyclic aromatic hydrocarbons in needles and bark of Pinus pinaster Ait. and Pinus pinea L. by GC-MS.


    Ratola, Nuno; Lacorte, Sílvia; Barceló, Damià; Alves, Arminda


    Two different extraction strategies (microwave-assisted extraction (MAE) and ultrasonic extraction (USE)) were tested in the extraction of the 16 US Environmental Protection Agency (EPA) polycyclic aromatic hydrocarbons (PAHs) from pine trees. Extraction of needles and bark from two pine species common in the Iberian Peninsula (Pinus pinaster Ait. and Pinus pinea L.) was optimized using two amounts of sample (1g and 5 g) and two PAHs spiking levels (20 ng/g and 100 ng/g). In all cases, the clean-up procedure following extraction consisted in solid-phase extraction (SPE) with alumina cartridges. Quantification was done by gas chromatography (GC) with mass spectrometry (MS), using five deuterated PAH surrogate standards as internal standards. Limits of detection were globally below 0.2 ng/g. The method was robust for the matrices studied regardless of the extraction procedures. Recovery values between 70 and 130% were reached in most cases, except for high molecular weight PAHs (indeno[1,2,3-cd]pyrene, dibenzo[a,h]anthracene and benzo[ghi]perylene). A field study with naturally contaminated samples from eight sites (four in Portugal and four in Catalonia, Spain) showed that needles are more suitable biomonitors for PAHs, yielding concentrations from 2 to 17 times higher than those found in bark. The levels varied according to the sampling site, with the sum of the individual PAH concentrations between 213 and 1773 ng/g (dry weight). Phenanthrene was the most abundant PAH, followed by fluoranthene, naphthalene and pyrene.

  15. Ectomycorrhizal fungal communities associated with Masson pine (Pinus massoniana Lamb.) in Pb-Zn mine sites of central south China.


    Huang, Jian; Nara, Kazuhide; Lian, Chunlan; Zong, Kun; Peng, Kejian; Xue, Shengguo; Shen, Zhenguo


    To advance our understanding of ectomycorrhizal fungal communities in mining areas, the diversity and composition of ectomycorrhizal fungi associated with Masson pine (Pinus massoniana Lamb.) and soil chemistry were investigated in Taolin lead-zinc (Pb-Zn) mine tailings (TLT), two fragmented forest patches in a Huayuan Pb-Zn mineland (HY1 and HY2), and a non-polluted forest in Taolin in central south China. Ectomycorrhizal fungal species were identified by morphotyping and sequence analyses of the internally transcribed spacer regions of ribosomal DNA. The two study sites in the Huayuan mineland (HY1 and HY2) were significantly different in soil Pb, Zn, and cadmium (Cd) concentrations, but no significant difference was observed in ectomycorrhizal colonization, ectomycorrhizal fungal richness, diversity, or rank-abundance. In addition, the similarity of ectomycorrhizal fungal communities between HY1 and HY2 was quite high (Sørensen similarity index = 0.47). Thus, the concentration of heavy metals may not be determining factors in the structure of these communities. In the tailings, however, significantly lower ectomycorrhizal colonization and ectomycorrhizal fungal richness were observed. The amounts of Pb and Zn in the tailing sand were higher than the non-polluted forest but far lower than in HY1. Thus, these heavy metals did not account for the reduced colonization and ectomycorrhizal fungal richness in TLT. The ectomycorrhizal fungal community in TLT was dominated by four pioneer species (Rhizopogon buenoi, Tomentella ellisii, Inocybe curvipes, and Suillus granulatus), which collectively accounted for 93.2 % of root tip colonization. The immature soil conditions in tailing (low N and P, sand texture, and lack of organic matter) may only allow certain pioneer ectomycorrhizal fungal species to colonize the site. When soil samples from four sites were combined, we found that the occurrences of major ectomycorrhizal fungal taxa were not clearly related to the

  16. Nitrogen nutrition and drought hardening exert opposite effects on the stress tolerance of Pinus pinea L. seedlings.


    Villar-Salvador, Pedro; Peñuelas, Juan L; Jacobs, Douglass F


    Functional attributes determine the survival and growth of planted seedlings in reforestation projects. Nitrogen (N) and water are important resources in the cultivation of forest species, which have a strong effect on plant functional traits. We analyzed the influence of N nutrition on drought acclimation of Pinus pinea L. seedlings. Specifically, we addressed if high N fertilization reduces drought and frost tolerance of seedlings and whether drought hardening reverses the effect of high N fertilization on stress tolerance. Seedlings were grown under two N fertilization regimes (6 and 100 mg N per plant) and subjected to three drought-hardening levels (well-watered, moderate and strong hardening). Water relations, gas exchange, frost damage, N concentration and growth at the end of the drought-hardening period, and survival and growth of seedlings under controlled xeric and mesic outplanting conditions were measured. Relative to low-N plants, high-N plants were larger, had higher stomatal conductance (27%), residual transpiration (11%) and new root growth capacity and closed stomata at higher water potential. However, high N fertilization also increased frost damage (24%) and decreased plasmalemma stability to dehydration (9%). Drought hardening reversed to a great extent the reduction in stress tolerance caused by high N fertilization as it decreased frost damage, stomatal conductance and residual transpiration by 21, 31 and 24%, respectively, and increased plasmalemma stability to dehydration (8%). Drought hardening increased tissue non-structural carbohydrates and N concentration, especially in high-fertilized plants. Frost damage was positively related to the stability of plasmalemma to dehydration (r = 0.92) and both traits were negatively related to the concentration of reducing soluble sugars. No differences existed between moderate and strong drought-hardening treatments. Neither N nutrition nor drought hardening had any clear effect on seedling

  17. Uptake and distribution of nitrogen from acidic fog within a ponderosa pine (Pinus ponderosa Laws.)/litter/soil system

    SciTech Connect

    Fenn, M.E.; Leininger, T.D.


    The magnitude and importance of wet deposition of N in forests of the South Coast (Los Angeles) Air Basin have not been well characterized. We exposed 3-yr-old ponderosa pine (Pinus ponderosa Laws.) seedlings growing in native forest soil to acidic fog treatments (pH 3.1) simulating fog chemistry from a pine forest near Los Angeles, California. Fog solutions contained either {sup 15}NH{sub 4}{sup +}, {sup 15}NO{sub 3}{sup {minus}}, or unlabeled N. The fog treatments were applied in open-top chambers in six 5-hr exposures. Soil treatments within each of the fog exposures were bare soil, soil overlain with L- and F-litter, and soil covered with plastic during the fog events to prevent fogwater from contacting soil. Seedlings were harvested and samples were collected 15 wk after the fog treatments. Uptake of {sup 15}N by roots was by far the dominant pathway for plant assimilation of fog-deposited {sup 15}N. Deposition of N in fog supplied 9.4% and 8.7% of the total N in current-year crown biomass in the litter-overlay and bare-soil treatments, respectively. Total N concentrations in every plant fraction except current-year stems were significantly higher in the bare-soil treatment than in the plastic-covered soil treatment. Less than 5% of the {sup 15}N deposited directly to the seedling crowns was retained by the plants in the covered-soil treatment, whereas 57% of the {sup 15}N deposited to the seedling/litter/soil systems was incorporated into plant biomass. The litter layers retained {sup 15}NH{sub 4}{sup +} more effectively than {sup 15}NH{sub 4}{sup +} more effectively than {sup 15}NO{sub 3}. Data from this study suggest that N deposited from fog may be an important source of N for plant growth in forests of the SCAB where fog occurrence and pollution exposure coincide. 5 refs., 5 figs., 3 tabs.

  18. Effect of fire on soil microbial composition and activity in a Pinus canariensis forest and over time recovery

    NASA Astrophysics Data System (ADS)

    Ramírez Rojas, Irene; Fernández Lugo, Silvia; Arévalo Sierra, Jose Ramon; Pérez Fernández, María


    Wildfires are recurrent disturbances to forest ecosystems of Pinus canariensis, but their effects on soil microbial communities are not well characterized and have not previously been compared directly. Effects of fires on soil biotic properties are strongly dependent on the intensity of the fire, as well as on the type of soil and vegetation cover. This study aims at developing a comprehensive picture of the soil and vegetation dynamics to natural fries in an experiment comprising prescribed burning. The study was conducted at sites with similar soil, climatic, and other properties in a Canary pine forest in the Canary Islands, Spain. Soil microbial communities were assessed following four treatments: control, burnt soil the day after the fire, burnt soil three months after the fire and burnt soil six months after the. Burn treatments were conducted by the stuff from Cabildo de Canarias (Spain) on the 4th and 5th of June 2014. As a general rule, the organic carbon and the microbial biomass tend to decrease in the surface horizon after the fire, but the system responds increasing microbial activities and restoring soil variables in the subsequent months after the burning. Microbial biomass carbon significantly decreased in the burnt soils with their maximum negative effect immediately after the fire and during autumn, six months after the fire. Microbial biomass nitrogen also decreased in the burnt site immediately after the fire but increased in the fol