Science.gov

Sample records for predicting structural integrity

  1. Status of research aimed at predicting structural integrity

    SciTech Connect

    Reuter, W.G.

    1997-12-31

    Considerable research has been performed throughout the world on measuring the fracture toughness of metals. The existing capability fills the need encountered when selecting materials, thermal-mechanical treatments, welding procedures, etc., but cannot predict the fracture process of structural components containing cracks. The Idaho National Engineering and Environmental Laboratory and the Massachusetts Institute of Technology have been collaborating for a number of years on developing capabilities for using fracture toughness results to predict structural integrity. Because of the high cost of fabricating and testing structural components, these studies have been limited to predicting the fracture process in specimens containing surface cracks. This paper summarizes the present status of the experimental studies of using fracture toughness data to predict crack growth initiation in specimens (structural components) containing surface cracks. These results are limited to homogeneous base materials.

  2. SSME lifetime prediction and verification, integrating environments, structures, materials: The challenge

    NASA Technical Reports Server (NTRS)

    Ryan, R. S.; Salter, L. D.; Young, G. M., III; Munafo, P. M.

    1985-01-01

    The planned missions for the space shuttle dictated a unique and technology-extending rocket engine. The high specific impulse requirements in conjunction with a 55-mission lifetime, plus volume and weight constraints, produced unique structural design, manufacturing, and verification requirements. Operations from Earth to orbit produce severe dynamic environments, which couple with the extreme pressure and thermal environments associated with the high performance, creating large low cycle loads and high alternating stresses above endurance limit which result in high sensitivity to alternating stresses. Combining all of these effects resulted in the requirements for exotic materials, which are more susceptible to manufacturing problems, and the use of an all-welded structure. The challenge of integrating environments, dynamics, structures, and materials into a verified SSME structure is discussed. The verification program and developmental flight results are included. The first six shuttle flights had engine performance as predicted with no failures. The engine system has met the basic design challenges.

  3. Ultrasonic Sensing and Life Prediction for the DARPA Structural Integrity Prognosis System

    NASA Astrophysics Data System (ADS)

    Michaels, Jennifer E.; Michaels, Thomas E.; Cobb, Adam C.; Kacprzynski, Gregory J.

    2007-03-01

    The overall objective of the DARPA Structural Integrity Prognosis System (SIPS) program is to develop technologies to advance material damage state condition assessment with limited or no dedicated maintenance action. As a part of the sensors thrust area, an in situ ultrasonic sensing method was developed and demonstrated to detect cracks initiating from fastener holes and provide an estimate of total crack area. Crack area estimates were combined with load history data, projected future loads, and life prediction models to determine a probability density function for time-to-failure. The ultrasonic method utilizes two shear wave angle beam transducers operating in through transmission mode which are mounted on either side of the hole. The transmitted wave travels through the area of expected cracking, and the presence of cracks around the fastener holes decreases the amount of acoustic energy that is received. Furthermore, as cracks open and close during the fatigue process, the received energy is modulated, i.e., decreased when the cracks are open versus closed, and this non-linear behavior is the basis of algorithms developed to detect and size fastener holes cracks. The ultrasonic method was demonstrated as part of an integrated SIPS demonstration whereby aircraft-grade aluminum subcomponents were fatigued to failure. Results are presented from both the ultrasonic measurements and the integrated life prediction software.

  4. Structural integrity of frontostriatal connections predicts longitudinal changes in self-esteem.

    PubMed

    Chavez, Robert S; Heatherton, Todd F

    2017-06-01

    Diverse neurological and psychiatric conditions are marked by a diminished sense of positive self-regard, and reductions in self-esteem are associated with risk for these disorders. Recent evidence has shown that the connectivity of frontostriatal circuitry reflects individual differences in self-esteem. However, it remains an open question as to whether the integrity of these connections can predict self-esteem changes over larger timescales. Using diffusion magnetic resonance imaging and probabilistic tractography, we demonstrate that the integrity of white matter pathways linking the medial prefrontal cortex to the ventral striatum predicts changes in self-esteem 8 months after initial scanning in a sample of 30 young adults. Individuals with greater integrity of this pathway during the scanning session at Time 1 showed increased levels of self-esteem at follow-up, whereas individuals with lower integrity showed stifled or decreased levels of self-esteem. These results provide evidence that frontostriatal white matter integrity predicts the trajectory of self-esteem development in early adulthood, which may contribute to blunted levels of positive self-regard seen in multiple psychiatric conditions, including depression and anxiety.

  5. Integration of QUARK and I-TASSER for Ab Initio Protein Structure Prediction in CASP11.

    PubMed

    Zhang, Wenxuan; Yang, Jianyi; He, Baoji; Walker, Sara Elizabeth; Zhang, Hongjiu; Govindarajoo, Brandon; Virtanen, Jouko; Xue, Zhidong; Shen, Hong-Bin; Zhang, Yang

    2016-09-01

    We tested two pipelines developed for template-free protein structure prediction in the CASP11 experiment. First, the QUARK pipeline constructs structure models by reassembling fragments of continuously distributed lengths excised from unrelated proteins. Five free-modeling (FM) targets have the model successfully constructed by QUARK with a TM-score above 0.4, including the first model of T0837-D1, which has a TM-score = 0.736 and RMSD = 2.9 Å to the native. Detailed analysis showed that the success is partly attributed to the high-resolution contact map prediction derived from fragment-based distance-profiles, which are mainly located between regular secondary structure elements and loops/turns and help guide the orientation of secondary structure assembly. In the Zhang-Server pipeline, weakly scoring threading templates are re-ordered by the structural similarity to the ab initio folding models, which are then reassembled by I-TASSER based structure assembly simulations; 60% more domains with length up to 204 residues, compared to the QUARK pipeline, were successfully modeled by the I-TASSER pipeline with a TM-score above 0.4. The robustness of the I-TASSER pipeline can stem from the composite fragment-assembly simulations that combine structures from both ab initio folding and threading template refinements. Despite the promising cases, challenges still exist in long-range beta-strand folding, domain parsing, and the uncertainty of secondary structure prediction; the latter of which was found to affect nearly all aspects of FM structure predictions, from fragment identification, target classification, structure assembly, to final model selection. Significant efforts are needed to solve these problems before real progress on FM could be made. Proteins 2016; 84(Suppl 1):76-86. © 2015 Wiley Periodicals, Inc.

  6. Integrated prediction of protein folding and unfolding rates from only size and structural class.

    PubMed

    De Sancho, David; Muñoz, Victor

    2011-10-14

    Protein stability, folding and unfolding rates are all determined by the multidimensional folding free energy surface, which in turn is dictated by factors such as size, structure, and amino-acid sequence. Work over the last 15 years has highlighted the role of size and 3D structure in determining folding rates, resulting in many procedures for their prediction. In contrast, unfolding rates are thought to depend on sequence specifics and be much more difficult to predict. Here we introduce a minimalist physics-based model that computes one-dimensional folding free energy surfaces using the number of aminoacids (N) and the structural class (α-helical, all-β, or α-β) as only protein-specific input. In this model N sets the overall cost in conformational entropy and the net stabilization energy, whereas the structural class defines the partitioning of the stabilization energy between local and non-local interactions. To test its predictive power, we calibrated the model empirically and implemented it into an algorithm for the PREdiction of Folding and Unfolding Rates (PREFUR). We found that PREFUR predicts the absolute folding and unfolding rates of an experimental database of 52 proteins with accuracies of ±0.7 and ±1.4 orders of magnitude, respectively (relative to experimental spans of 6 and 8 orders of magnitude). Such prediction uncertainty for proteins vastly varying in size and structure is only two-fold larger than the differences in folding (±0.34) and unfolding rates (±0.7) caused by single-point mutations. Moreover, PREFUR predicts protein stability with an accuracy of ±6.3 kJ mol(-1), relative to the 5 kJ mol(-1) average perturbation induced by single-point mutations. The remarkable performance of our simplistic model demonstrates that size and structural class are the major determinants of the folding landscapes of natural proteins, whereas sequence variability only provides the final 10-20% tuning. PREFUR is thus a powerful bioinformatic tool

  7. Rigorous assessment and integration of the sequence and structure based features to predict hot spots

    PubMed Central

    2011-01-01

    effective in predicting hot spots based on sequence features. Hot spots cannot be fully predicted through simple analysis based on physicochemical characteristics, but there is reason to believe that integration of features and machine learning methods can remarkably improve the predictive performance for hot spots. PMID:21798070

  8. An Integrated Hydrologic Bayesian Multi-Model Combination Framework: Confronting Input, parameter and model structural uncertainty in Hydrologic Prediction

    SciTech Connect

    Ajami, N K; Duan, Q; Sorooshian, S

    2006-05-05

    This paper presents a new technique--Integrated Bayesian Uncertainty Estimator (IBUNE) to account for the major uncertainties of hydrologic rainfall-runoff predictions explicitly. The uncertainties from the input (forcing) data--mainly the precipitation observations and from the model parameters are reduced through a Monte Carlo Markov Chain (MCMC) scheme named Shuffled Complex Evolution Metropolis (SCEM) algorithm which has been extended to include a precipitation error model. Afterwards, the Bayesian Model Averaging (BMA) scheme is employed to further improve the prediction skill and uncertainty estimation using multiple model output. A series of case studies using three rainfall-runoff models to predict the streamflow in the Leaf River basin, Mississippi are used to examine the necessity and usefulness of this technique. The results suggests that ignoring either input forcings error or model structural uncertainty will lead to unrealistic model simulations and their associated uncertainty bounds which does not consistently capture and represent the real-world behavior of the watershed.

  9. An Integrated Bayesian Uncertainty Estimator: fusion of Input, Parameter and Model Structural Uncertainty Estimation in Hydrologic Prediction System

    NASA Astrophysics Data System (ADS)

    Ajami, N. K.; Duan, Q.; Sorooshian, S.

    2005-12-01

    To-date single conceptual hydrologic models often applied to interpret physical processes within a watershed. Nevertheless hydrologic models regardless of their sophistication and complexity are simplified representation of the complex, spatially distributed and highly nonlinear real world system. Consequently their hydrologic predictions contain considerable uncertainty from different sources including: hydrometeorological forcing inputs, boundary/initial conditions, model structure, model parameters which need to be accounted for. Thus far the effort has gone to address these sources of uncertainty explicitly, making an implicit assumption that uncertainties from different sources are additive. Nevertheless because of the nonlinear nature of the hydrologic systems, it is not feasible to account for these uncertainties independently. Here we present the Integrated Bayesian Uncertainty Estimator (IBUNE) which accounts for total uncertainties from all major sources: inputs forcing, model structure, model parameters. This algorithm explores multi-model framework to tackle model structural uncertainty while using the Bayesian rules to estimate parameter and input uncertainty within individual models. Three hydrologic models including SACramento Soil Moisture Accounting (SAC-SMA) model, Hydrologic model (HYMOD) and Simple Water Balance (SWB) model were considered within IBUNE framework for this study. The results which are presented for the Leaf River Basin, MS, indicates that IBUNE gives a better quantification of uncertainty through hydrological modeling processes, therefore provide more reliable and less bias prediction with realistic uncertainty boundaries.

  10. Predictions of structural integrity of steam generator tubes under normal operating, accident, and severe accident conditions

    SciTech Connect

    Majumdar, S.

    1996-09-01

    Available models for predicting failure of flawed and unflawed steam generator tubes under normal operating, accident, and severe accident conditions are reviewed. Tests conducted in the past, though limited, tended to show that the earlier flow-stress model for part-through-wall axial cracks overestimated the damaging influence of deep cracks. This observation is confirmed by further tests at high temperatures as well as by finite element analysis. A modified correlation for deep cracks can correct this shortcoming of the model. Recent tests have shown that lateral restraint can significantly increase the failure pressure of tubes with unsymmetrical circumferential cracks. This observation is confirmed by finite element analysis. The rate-independent flow stress models that are successful at low temperatures cannot predict the rate sensitive failure behavior of steam generator tubes at high temperatures. Therefore, a creep rupture model for predicting failure is developed and validated by tests under varying temperature and pressure loading expected during severe accidents.

  11. Predictions of structural integrity of steam generator tubes under normal operating, accident, an severe accident conditions

    SciTech Connect

    Majumdar, S.

    1997-02-01

    Available models for predicting failure of flawed and unflawed steam generator tubes under normal operating, accident, and severe accident conditions are reviewed. Tests conducted in the past, though limited, tended to show that the earlier flow-stress model for part-through-wall axial cracks overestimated the damaging influence of deep cracks. This observation was confirmed by further tests at high temperatures, as well as by finite-element analysis. A modified correlation for deep cracks can correct this shortcoming of the model. Recent tests have shown that lateral restraint can significantly increase the failure pressure of tubes with unsymmetrical circumferential cracks. This observation was confirmed by finite-element analysis. The rate-independent flow stress models that are successful at low temperatures cannot predict the rate-sensitive failure behavior of steam generator tubes at high temperatures. Therefore, a creep rupture model for predicting failure was developed and validated by tests under various temperature and pressure loadings that can occur during postulated severe accidents.

  12. Structural integrity of the contralesional hemisphere predicts cognitive impairment in ischemic stroke at three months.

    PubMed

    Dacosta-Aguayo, Rosalia; Graña, Manuel; Fernández-Andújar, Marina; López-Cancio, Elena; Cáceres, Cynthia; Bargalló, Núria; Barrios, Maite; Clemente, Immaculada; Monserrat, Pere Toran; Sas, Maite Alzamora; Dávalos, Antoni; Auer, Tibor; Mataró, Maria

    2014-01-01

    After stroke, white matter integrity can be affected both locally and distally to the primary lesion location. It has been shown that tract disruption in mirror's regions of the contralateral hemisphere is associated with degree of functional impairment. Fourteen patients suffering right hemispheric focal stroke (S) and eighteen healthy controls (HC) underwent Diffusion Weighted Imaging (DWI) and neuropsychological assessment. The stroke patient group was divided into poor (SP; n = 8) and good (SG; n = 6) cognitive recovery groups according to their cognitive improvement from the acute phase (72 hours after stroke) to the subacute phase (3 months post-stroke). Whole-brain DWI data analysis was performed by computing Diffusion Tensor Imaging (DTI) followed by Tract Based Spatial Statistics (TBSS). Assessment of effects was obtained computing the correlation of the projections on TBSS skeleton of Fractional Anisotropy (FA) and Radial Diffusivity (RD) with cognitive test results. Significant decrease of FA was found only in right brain anatomical areas for the S group when compared to the HC group. Analyzed separately, stroke patients with poor cognitive recovery showed additional significant FA decrease in several left hemisphere regions; whereas SG patients showed significant decrease only in the left genu of corpus callosum when compared to the HC. For the SG group, whole brain analysis revealed significant correlation between the performance in the Semantic Fluency test and the FA in the right hemisphere as well as between the performance in the Grooved Pegboard Test (GPT) and the Trail Making Test-part A and the FA in the left hemisphere. For the SP group, correlation analysis revealed significant correlation between the performance in the GPT and the FA in the right hemisphere.

  13. Structural Integrity of the Contralesional Hemisphere Predicts Cognitive Impairment in Ischemic Stroke at Three Months

    PubMed Central

    Dacosta-Aguayo, Rosalia; Graña, Manuel; Fernández-Andújar, Marina; López-Cancio, Elena; Cáceres, Cynthia; Bargalló, Núria; Barrios, Maite; Clemente, Immaculada; Monserrat, Pere Toran; Sas, Maite Alzamora; Dávalos, Antoni

    2014-01-01

    After stroke, white matter integrity can be affected both locally and distally to the primary lesion location. It has been shown that tract disruption in mirror’s regions of the contralateral hemisphere is associated with degree of functional impairment. Fourteen patients suffering right hemispheric focal stroke (S) and eighteen healthy controls (HC) underwent Diffusion Weighted Imaging (DWI) and neuropsychological assessment. The stroke patient group was divided into poor (SP; n = 8) and good (SG; n = 6) cognitive recovery groups according to their cognitive improvement from the acute phase (72 hours after stroke) to the subacute phase (3 months post-stroke). Whole-brain DWI data analysis was performed by computing Diffusion Tensor Imaging (DTI) followed by Tract Based Spatial Statistics (TBSS). Assessment of effects was obtained computing the correlation of the projections on TBSS skeleton of Fractional Anisotropy (FA) and Radial Diffusivity (RD) with cognitive test results. Significant decrease of FA was found only in right brain anatomical areas for the S group when compared to the HC group. Analyzed separately, stroke patients with poor cognitive recovery showed additional significant FA decrease in several left hemisphere regions; whereas SG patients showed significant decrease only in the left genu of corpus callosum when compared to the HC. For the SG group, whole brain analysis revealed significant correlation between the performance in the Semantic Fluency test and the FA in the right hemisphere as well as between the performance in the Grooved Pegboard Test (GPT) and theTrail Making Test-part A and the FA in the left hemisphere. For the SP group, correlation analysis revealed significant correlation between the performance in the GPT and the FA in the right hemisphere. PMID:24475078

  14. Crystal structure and prediction.

    PubMed

    Thakur, Tejender S; Dubey, Ritesh; Desiraju, Gautam R

    2015-04-01

    The notion of structure is central to the subject of chemistry. This review traces the development of the idea of crystal structure since the time when a crystal structure could be determined from a three-dimensional diffraction pattern and assesses the feasibility of computationally predicting an unknown crystal structure of a given molecule. Crystal structure prediction is of considerable fundamental and applied importance, and its successful execution is by no means a solved problem. The ease of crystal structure determination today has resulted in the availability of large numbers of crystal structures of higher-energy polymorphs and pseudopolymorphs. These structural libraries lead to the concept of a crystal structure landscape. A crystal structure of a compound may accordingly be taken as a data point in such a landscape.

  15. Crystal Structure and Prediction

    NASA Astrophysics Data System (ADS)

    Thakur, Tejender S.; Dubey, Ritesh; Desiraju, Gautam R.

    2015-04-01

    The notion of structure is central to the subject of chemistry. This review traces the development of the idea of crystal structure since the time when a crystal structure could be determined from a three-dimensional diffraction pattern and assesses the feasibility of computationally predicting an unknown crystal structure of a given molecule. Crystal structure prediction is of considerable fundamental and applied importance, and its successful execution is by no means a solved problem. The ease of crystal structure determination today has resulted in the availability of large numbers of crystal structures of higher-energy polymorphs and pseudopolymorphs. These structural libraries lead to the concept of a crystal structure landscape. A crystal structure of a compound may accordingly be taken as a data point in such a landscape.

  16. AIR VEHICLE INTEGRATION AND TECHNOLOGY RESEARCH (AVIATR) Task Order 0015: Predictive Capability for Hypersonic Structural Response and Life Prediction: Phase 1-Identification of Knowledge Gaps, Volume 1: Nonproprietary Version

    DTIC Science & Technology

    2010-09-01

    AFRL-RB-WP-TR-2010-3068,V1 AIR VEHICLE INTEGRATION AND TECHNOLOGY RESEARCH (AVIATR) Task Order 0015: Predictive Capability for Hypersonic ...Order 0015: Predictive Capability for Hypersonic Structural Response and Life Prediction: Phase 1-Identification of Knowledge Gaps, Volume 1...AND ADDRESS(ES) 8. PERFORMING ORGANIZATION The Boeing Company M/C 110-SK56 2600 Westminster Avenue Seal Beach , CA 90740 REPORT NUMBER 9

  17. Structural integrity of the substantia nigra and subthalamic nucleus predicts flexibility of instrumental learning in older-age individuals

    PubMed Central

    Chowdhury, Rumana; Guitart-Masip, Marc; Lambert, Christian; Dolan, Raymond J.; Düzel, Emrah

    2013-01-01

    Flexible instrumental learning is required to harness the appropriate behaviors to obtain rewards and to avoid punishments. The precise contribution of dopaminergic midbrain regions (substantia nigra/ventral tegmental area [SN/VTA]) to this form of behavioral adaptation remains unclear. Normal aging is associated with a variable loss of dopamine neurons in the SN/VTA. We therefore tested the relationship between flexible instrumental learning and midbrain structural integrity. We compared task performance on a probabilistic monetary go/no-go task, involving trial and error learning of: “go to win,” “no-go to win,” “go to avoid losing,” and “no-go to avoid losing” in 42 healthy older adults to previous behavioral data from 47 younger adults. Quantitative structural magnetization transfer images were obtained to index regional structural integrity. On average, both some younger and some older participants demonstrated a behavioral asymmetry whereby they were better at learning to act for reward (“go to win” > “no-go to win”), but better at learning not to act to avoid punishment (“no-go to avoid losing” > “go to avoid losing”). Older, but not younger, participants with greater structural integrity of the SN/VTA and the adjacent subthalamic nucleus could overcome this asymmetry. We show that interindividual variability among healthy older adults of the structural integrity within the SN/VTA and subthalamic nucleus relates to effective acquisition of competing instrumental responses. PMID:23623600

  18. Predictive Modeling of Chemical Hazard by Integrating Numerical Descriptors of Chemical Structures and Short-term Toxicity Assay Data

    PubMed Central

    Rusyn, Ivan; Sedykh, Alexander; Guyton, Kathryn Z.; Tropsha, Alexander

    2012-01-01

    Quantitative structure-activity relationship (QSAR) models are widely used for in silico prediction of in vivo toxicity of drug candidates or environmental chemicals, adding value to candidate selection in drug development or in a search for less hazardous and more sustainable alternatives for chemicals in commerce. The development of traditional QSAR models is enabled by numerical descriptors representing the inherent chemical properties that can be easily defined for any number of molecules; however, traditional QSAR models often have limited predictive power due to the lack of data and complexity of in vivo endpoints. Although it has been indeed difficult to obtain experimentally derived toxicity data on a large number of chemicals in the past, the results of quantitative in vitro screening of thousands of environmental chemicals in hundreds of experimental systems are now available and continue to accumulate. In addition, publicly accessible toxicogenomics data collected on hundreds of chemicals provide another dimension of molecular information that is potentially useful for predictive toxicity modeling. These new characteristics of molecular bioactivity arising from short-term biological assays, i.e., in vitro screening and/or in vivo toxicogenomics data can now be exploited in combination with chemical structural information to generate hybrid QSAR–like quantitative models to predict human toxicity and carcinogenicity. Using several case studies, we illustrate the benefits of a hybrid modeling approach, namely improvements in the accuracy of models, enhanced interpretation of the most predictive features, and expanded applicability domain for wider chemical space coverage. PMID:22387746

  19. An integrated degradation and structural model for predicting the service life of buried reinforced concrete structures for low- and intermediate-level radioactive waste disposal

    SciTech Connect

    Brandstetter, E.R.; Lolcama, J.L.; Reed, S.R.

    1994-03-01

    The primary focus of this study was to determine the possible rates of roof and wall failure and the times to structural collapse of the roof and walls of three vault designs at the Department of Energy`s Savannah River Site near Aiken, South Carolina. Failure was defined as a loss of ability to divert soil water around the vault. Collapse was defined as the total loss of structure integrity of the vault. Failure and eventual collapse of the three vault types results from concrete deterioration under stress, in the presence of corrosive soil water. Degradation rates for reinforced concrete were utilized, and the resultant changes in properties (such as strength, thickness, cracking and hydraulic conductivity) were evaluated. Baseline times to failure and collapse of the walls and roof components were modeled, and sensitivity analyses were conducted to provide boundaries on these estimated times. Thus, the goal of the project was to provide a bounding analysis of the time to roof and wall failure and potential collapse, rather than an actual prediction of the time to failure, and collapse.

  20. An integrated approach for non-periodic dynamic response prediction of complex structures: Numerical and experimental analysis

    NASA Astrophysics Data System (ADS)

    Rahneshin, Vahid; Chierichetti, Maria

    2016-09-01

    In this paper, a combined numerical and experimental method, called Extended Load Confluence Algorithm, is presented to accurately predict the dynamic response of non-periodic structures when little or no information about the applied loads is available. This approach, which falls into the category of Shape Sensing methods, inputs limited experimental information acquired from sensors to a mapping algorithm that predicts the response at unmeasured locations. The proposed algorithm consists of three major cores: an experimental core for data acquisition, a numerical core based on Finite Element Method for modeling the structure, and a mapping algorithm that improves the numerical model based on a modal approach in the frequency domain. The robustness and precision of the proposed algorithm are verified through numerical and experimental examples. The results of this paper demonstrate that without a precise knowledge of the loads acting on the structure, the dynamic behavior of the system can be predicted in an effective and precise manner after just a few iterations.

  1. Integrated support structure

    NASA Technical Reports Server (NTRS)

    Bruneau, Stephen D.; Campbell, John T.; Struven, Christopher A.

    1990-01-01

    This Major Qualifying Project is part of the Advanced Space Design Program at WPI. The goal is to design a support structure for a NASA GetAway Special experimental canister. The payload integration, weight, volume, and structural integrity of the canister as specified by NASA guidelines were studied. The end result is a complete set of design drawings with interface drawings and data to specify the design and leave a base on which the next group can concentrate.

  2. Integrative Approaches for Predicting in vivo Effects of Chemicals from their Structural Descriptors and the Results of Short-term Biological Assays

    PubMed Central

    Low, Yen S.; Sedykh, Alexander; Rusyn, Ivan; Tropsha, Alexander

    2017-01-01

    Cheminformatics approaches such as Quantitative Structure Activity Relationship (QSAR) modeling have been used traditionally for predicting chemical toxicity. In recent years, high throughput biological assays have been increasingly employed to elucidate mechanisms of chemical toxicity and predict toxic effects of chemicals in vivo. The data generated in such assays can be considered as biological descriptors of chemicals that can be combined with molecular descriptors and employed in QSAR modeling to improve the accuracy of toxicity prediction. In this review, we discuss several approaches for integrating chemical and biological data for predicting biological effects of chemicals in vivo and compare their performance across several data sets. We conclude that while no method consistently shows superior performance, the integrative approaches rank consistently among the best yet offer enriched interpretation of models over those built with either chemical or biological data alone. We discuss the outlook for such interdisciplinary methods and offer recommendations to further improve the accuracy and interpretability of computational models that predict chemical toxicity. PMID:24805064

  3. Integrated structural health monitoring.

    SciTech Connect

    Farrar, C. R.

    2001-01-01

    Structural health monitoring is the implementation of a damage detection strategy for aerospace, civil and mechanical engineering infrastructure. Typical damage experienced by this infrastructure might be the development of fatigue cracks, degradation of structural connections, or bearing wear in rotating machinery. The goal of the research effort reported herein is to develop a robust and cost-effective structural health monitoring solution by integrating and extending technologies from various engineering and information technology disciplines. It is the authors opinion that all structural health monitoring systems must be application specific. Therefore, a specific application, monitoring welded moment resisting steel frame connections in structures subjected to seismic excitation, is described along with the motivation for choosing this application. The structural health monitoring solution for this application will integrate structural dynamics, wireless data acquisition, local actuation, micro-electromechanical systems (MEMS) technology, and statistical pattern recognition algorithms. The proposed system is based on an assessment of the deficiencies associated with many current structural health monitoring technologies including past efforts by the authors. This paper provides an example of the integrated approach to structural health monitoring being undertaken at Los Alamos National Laboratory and summarizes progress to date on various aspects of the technology development.

  4. Integrated structural health monitoring

    NASA Astrophysics Data System (ADS)

    Farrar, Charles R.; Sohn, Hoon; Fugate, Michael L.; Czarnecki, Jerry J.

    2001-07-01

    Structural health monitoring is the implementation of a damage detection strategy for aerospace, civil and mechanical engineering infrastructure. Typical damage experienced by this infrastructure might be the development of fatigue cracks, degradation of structural connections, or bearing wear in rotating machinery. The goal of the research effort reported herein is to develop a robust and cost-effective structural health monitoring solution by integrating and extending technologies from various engineering and information technology disciplines. It is the author's opinion that all structural health monitoring systems must be application specific. Therefore, a specific application, monitoring welded moment resisting steel frame connections in structures subjected to seismic excitation, is described along with the motivation for choosing this application. The structural health monitoring solution for this application will integrate structural dynamics, wireless data acquisition, local actuation, micro-electromechanical systems (MEMS) technology, and statistical pattern recognition algorithms. The proposed system is based on an assessment of the deficiencies associated with many current structural health monitoring technologies including past efforts by the authors. This paper provides an example of the integrated approach to structural health monitoring being undertaken at Los Alamos National Laboratory and summarizes progress to date on various aspects of the technology development.

  5. Structural model integrity

    NASA Technical Reports Server (NTRS)

    Wallerstein, D. V.; Lahey, R. S.; Haggenmacher, G. W.

    1977-01-01

    Many of the practical aspects and problems of ensuring the integrity of a structural model are discussed, as well as the steps which have been taken in the NASTRAN system to assure that these checks can be routinely performed. Model integrity as used applies not only to the structural model but also to the loads applied to the model. Emphasis is also placed on the fact that when dealing with substructure analysis, all of the checking procedures discussed should be applied at the lowest level of substructure prior to any coupling.

  6. Integrating in silico prediction methods, molecular docking, and molecular dynamics simulation to predict the impact of ALK missense mutations in structural perspective.

    PubMed

    Doss, C George Priya; Chakraborty, Chiranjib; Chen, Luonan; Zhu, Hailong

    2014-01-01

    Over the past decade, advancements in next generation sequencing technology have placed personalized genomic medicine upon horizon. Understanding the likelihood of disease causing mutations in complex diseases as pathogenic or neutral remains as a major task and even impossible in the structural context because of its time consuming and expensive experiments. Among the various diseases causing mutations, single nucleotide polymorphisms (SNPs) play a vital role in defining individual's susceptibility to disease and drug response. Understanding the genotype-phenotype relationship through SNPs is the first and most important step in drug research and development. Detailed understanding of the effect of SNPs on patient drug response is a key factor in the establishment of personalized medicine. In this paper, we represent a computational pipeline in anaplastic lymphoma kinase (ALK) for SNP-centred study by the application of in silico prediction methods, molecular docking, and molecular dynamics simulation approaches. Combination of computational methods provides a way in understanding the impact of deleterious mutations in altering the protein drug targets and eventually leading to variable patient's drug response. We hope this rapid and cost effective pipeline will also serve as a bridge to connect the clinicians and in silico resources in tailoring treatments to the patients' specific genotype.

  7. AIR VEHICLES INTEGRATION AND TECHNOLOGY RESEARCH (AVIATR) Task Order 0015: Predictive Capability for Hypersonic Structural Response and Life Prediction Phase 1 - Identification of Knowledge Gaps

    DTIC Science & Technology

    2010-08-01

    rudder, all-moving horizontal tails, and body flap were “beefed up ” based on preliminary flutter assessment. The all-moving tail/ wing carry-through...external surface temperatures on the fuselage and wings of up to 640°F, and the acreage surface and structural temperatures in the engine nacelle area...edge to rotate up into the air-stream inducing a heating amplification on the panel edge as well as on the adjacent panels. In the X-33 program the

  8. Both predictability and familiarity facilitate contour integration.

    PubMed

    Sassi, Michaël; Demeyer, Maarten; Machilsen, Bart; Putzeys, Tom; Wagemans, Johan

    2014-05-30

    Research has shown that contour detection is impaired in the visual periphery for snake-shaped Gabor contours but not for circular and elliptical contours. This discrepancy in findings could be due to differences in intrinsic shape properties, including shape closure and curvature variation, as well as to differences in stimulus predictability and familiarity. In a detection task using only circular contours, the target shape is both more familiar and more predictable to the observer compared with a detection task in which a different snake-shaped contour is presented on each trial. In this study, we investigated the effects of stimulus familiarity and predictability on contour integration by manipulating and disentangling the familiarity and predictability of snakelike stimuli. We manipulated stimulus familiarity by extensively training observers with one particular snake shape. Predictability was varied by alternating trial blocks with only a single target shape and trial blocks with multiple target shapes. Our results show that both predictability and familiarity facilitated contour integration, which constitutes novel behavioral evidence for the adaptivity of the contour integration mechanism in humans. If familiarity or predictability facilitated contour integration in the periphery specifically, this could explain the discrepant findings obtained with snake contours as compared with circles or ellipses. However, we found that their facilitatory effects did not differ between central and peripheral vision and thus cannot explain that particular discrepancy in the literature.

  9. Kalman-predictive-proportional-integral-derivative (KPPID)

    SciTech Connect

    Fluerasu, A.; Sutton, M.

    2004-12-17

    With third generation synchrotron X-ray sources, it is possible to acquire detailed structural information about the system under study with time resolution orders of magnitude faster than was possible a few years ago. These advances have generated many new challenges for changing and controlling the state of the system on very short time scales, in a uniform and controlled manner. For our particular X-ray experiments on crystallization or order-disorder phase transitions in metallic alloys, we need to change the sample temperature by hundreds of degrees as fast as possible while avoiding over or under shooting. To achieve this, we designed and implemented a computer-controlled temperature tracking system which combines standard Proportional-Integral-Derivative (PID) feedback, thermal modeling and finite difference thermal calculations (feedforward), and Kalman filtering of the temperature readings in order to reduce the noise. The resulting Kalman-Predictive-Proportional-Integral-Derivative (KPPID) algorithm allows us to obtain accurate control, to minimize the response time and to avoid over/under shooting, even in systems with inherently noisy temperature readings and time delays. The KPPID temperature controller was successfully implemented at the Advanced Photon Source at Argonne National Laboratories and was used to perform coherent and time-resolved X-ray diffraction experiments.

  10. Integrated control-structure design

    NASA Technical Reports Server (NTRS)

    Hunziker, K. Scott; Kraft, Raymond H.; Bossi, Joseph A.

    1991-01-01

    A new approach for the design and control of flexible space structures is described. The approach integrates the structure and controller design processes thereby providing extra opportunities for avoiding some of the disastrous effects of control-structures interaction and for discovering new, unexpected avenues of future structural design. A control formulation based on Boyd's implementation of Youla parameterization is employed. Control design parameters are coupled with structural design variables to produce a set of integrated-design variables which are selected through optimization-based methodology. A performance index reflecting spacecraft mission goals and constraints is formulated and optimized with respect to the integrated design variables. Initial studies have been concerned with achieving mission requirements with a lighter, more flexible space structure. Details of the formulation of the integrated-design approach are presented and results are given from a study involving the integrated redesign of a flexible geostationary platform.

  11. Integrating alternative splicing detection into gene prediction

    PubMed Central

    Foissac, Sylvain; Schiex, Thomas

    2005-01-01

    Background Alternative splicing (AS) is now considered as a major actor in transcriptome/proteome diversity and it cannot be neglected in the annotation process of a new genome. Despite considerable progresses in term of accuracy in computational gene prediction, the ability to reliably predict AS variants when there is local experimental evidence of it remains an open challenge for gene finders. Results We have used a new integrative approach that allows to incorporate AS detection into ab initio gene prediction. This method relies on the analysis of genomically aligned transcript sequences (ESTs and/or cDNAs), and has been implemented in the dynamic programming algorithm of the graph-based gene finder EuGÈNE. Given a genomic sequence and a set of aligned transcripts, this new version identifies the set of transcripts carrying evidence of alternative splicing events, and provides, in addition to the classical optimal gene prediction, alternative optimal predictions (among those which are consistent with the AS events detected). This allows for multiple annotations of a single gene in a way such that each predicted variant is supported by a transcript evidence (but not necessarily with a full-length coverage). Conclusions This automatic combination of experimental data analysis and ab initio gene finding offers an ideal integration of alternatively spliced gene prediction inside a single annotation pipeline. PMID:15705189

  12. SHAPE-Directed RNA Secondary Structure Prediction

    PubMed Central

    Low, Justin T.; Weeks, Kevin M.

    2010-01-01

    The diverse functional roles of RNA are determined by its underlying structure. Accurate and comprehensive knowledge of RNA structure would inform a broader understanding of RNA biology and facilitate exploiting RNA as a biotechnological tool and therapeutic target. Determining the pattern of base pairing, or secondary structure, of RNA is a first step in these endeavors. Advances in experimental, computational, and comparative analysis approaches for analyzing secondary structure have yielded accurate structures for many small RNAs, but only a few large (>500 nts) RNAs. In addition, most current methods for determining a secondary structure require considerable effort, analytical expertise, and technical ingenuity. In this review, we outline an efficient strategy for developing accurate secondary structure models for RNAs of arbitrary length. This approach melds structural information obtained using SHAPE chemistry with structure prediction using nearest-neighbor rules and the dynamic programming algorithm implemented in the RNAstructure program. Prediction accuracies reach ≥95% for RNAs on the kilobase scale. This approach facilitates both development of new models and refinement of existing RNA structure models, which we illustrate using the Gag-Pol frameshift element in an HIV-1 M-group genome. Most promisingly, integrated experimental and computational refinement brings closer the ultimate goal of efficiently and accurately establishing the secondary structure for any RNA sequence. PMID:20554050

  13. Integrating diverse datasets improves developmental enhancer prediction.

    PubMed

    Erwin, Genevieve D; Oksenberg, Nir; Truty, Rebecca M; Kostka, Dennis; Murphy, Karl K; Ahituv, Nadav; Pollard, Katherine S; Capra, John A

    2014-06-01

    Gene-regulatory enhancers have been identified using various approaches, including evolutionary conservation, regulatory protein binding, chromatin modifications, and DNA sequence motifs. To integrate these different approaches, we developed EnhancerFinder, a two-step method for distinguishing developmental enhancers from the genomic background and then predicting their tissue specificity. EnhancerFinder uses a multiple kernel learning approach to integrate DNA sequence motifs, evolutionary patterns, and diverse functional genomics datasets from a variety of cell types. In contrast with prediction approaches that define enhancers based on histone marks or p300 sites from a single cell line, we trained EnhancerFinder on hundreds of experimentally verified human developmental enhancers from the VISTA Enhancer Browser. We comprehensively evaluated EnhancerFinder using cross validation and found that our integrative method improves the identification of enhancers over approaches that consider a single type of data, such as sequence motifs, evolutionary conservation, or the binding of enhancer-associated proteins. We find that VISTA enhancers active in embryonic heart are easier to identify than enhancers active in several other embryonic tissues, likely due to their uniquely high GC content. We applied EnhancerFinder to the entire human genome and predicted 84,301 developmental enhancers and their tissue specificity. These predictions provide specific functional annotations for large amounts of human non-coding DNA, and are significantly enriched near genes with annotated roles in their predicted tissues and lead SNPs from genome-wide association studies. We demonstrate the utility of EnhancerFinder predictions through in vivo validation of novel embryonic gene regulatory enhancers from three developmental transcription factor loci. Our genome-wide developmental enhancer predictions are freely available as a UCSC Genome Browser track, which we hope will enable

  14. Reliability and structural integrity

    NASA Technical Reports Server (NTRS)

    Davidson, J. R.

    1976-01-01

    An analytic model is developed to calculate the reliability of a structure after it is inspected for cracks. The model accounts for the growth of undiscovered cracks between inspections and their effect upon the reliability after subsequent inspections. The model is based upon a differential form of Bayes' Theorem for reliability, and upon fracture mechanics for crack growth.

  15. Structurally integrated steel solar collector

    DOEpatents

    Moore, S.W.

    1975-06-03

    Herein is disclosed a flate plate solar heat collector unit. The solar collector is integrated as a structural unit so that the collector also functions as the building roof. The functions of efficient heat collection, liquid coolant flow passages, roof structural support, and building insulation are combined into one unit.

  16. Structurally integrated steel solar collector

    DOEpatents

    Moore, Stanley W.

    1977-03-08

    Herein is disclosed a flat plate solar heat collector unit. The solar collector is integrated as a structural unit so that the collector also functions as the building roof. The functions of efficient heat collection, liquid coolant flow passages, roof structural support and building insulation are combined into one unit.

  17. Charge structure in volcanic plumes: a comparison of plume properties predicted by an integral plume model to observations of volcanic lightning during the 2010 eruption of Eyjafjallajökull, Iceland.

    PubMed

    Woodhouse, Mark J; Behnke, Sonja A

    Observations of volcanic lightning made using a lightning mapping array during the 2010 eruption of Eyjafjallajökull allow the trajectory and growth of the volcanic plume to be determined. The lightning observations are compared with predictions of an integral model of volcanic plumes that includes descriptions of the interaction with wind and the effects of moisture. We show that the trajectory predicted by the integral model closely matches the observational data and the model well describes the growth of the plume downwind of the vent. Analysis of the lightning signals reveals information on the dominant charge structure within the volcanic plume. During the Eyjafjallajökull eruption both monopole and dipole charge structures were observed in the plume. By using the integral plume model, we propose the varying charge structure is connected to the availability of condensed water and low temperatures at high altitudes in the plume, suggesting ice formation may have contributed to the generation of a dipole charge structure via thunderstorm-style ice-based charging mechanisms, though overall this charging mechanism is believed to have had only a weak influence on the production of lightning.

  18. CRHunter: integrating multifaceted information to predict catalytic residues in enzymes

    PubMed Central

    Sun, Jun; Wang, Jia; Xiong, Dan; Hu, Jian; Liu, Rong

    2016-01-01

    A variety of algorithms have been developed for catalytic residue prediction based on either feature- or template-based methodology. However, no studies have systematically compared these two strategies and further considered whether their combination could improve the prediction performance. Herein, we developed an integrative algorithm named CRHunter by simultaneously using the complementarity between feature- and template-based methodologies and that between structural and sequence information. Several novel structural features were generated by the Delaunay triangulation and Laplacian transformation of enzyme structures. Combining these features with traditional descriptors, we invented two support vector machine feature predictors based on both structural and sequence information. Furthermore, we established two template predictors using structure and profile alignments. Evaluated on datasets with different levels of homology, our feature predictors achieve relatively stable performance, whereas our template predictors yield poor results when the homological relationships become weak. Nevertheless, the hybrid algorithm CRHunter consistently achieves optimal performance among all our predictors. We also illustrate that our methodology can be applied to the predicted structures of enzymes. Compared with state-of-the-art methods, CRHunter yields comparable or better performance on various datasets. Finally, the application of this algorithm to structural genomics targets sheds light on solved protein structures with unknown functions. PMID:27665935

  19. Air Vehicle Integration and Technology Research (AVIATR). Task Order 0023: Predictive Capability for Hypersonic Structural Response and Life Prediction: Phase 2 - Detailed Design of Hypersonic Cruise Vehicle Hot-Structure

    DTIC Science & Technology

    2012-02-01

    integral stiffeners are typically selected for operational aircraft. Iso-grid and truss (or fluted ) sandwich panel configurations were thus initially...considered in Task 2 due to concerns over damage tolerance. Iso-grid and truss (or fluted ) sandwich panel configurations were thus initially...Pressure • Panel Temperature • Panel Temperature Gradient Through the Thickness • Mechanical and Thermal Factors of Safety Corrugated, or fluted

  20. Structure Prediction and Analysis of Neuraminidase Sequence Variants

    ERIC Educational Resources Information Center

    Thayer, Kelly M.

    2016-01-01

    Analyzing protein structure has become an integral aspect of understanding systems of biochemical import. The laboratory experiment endeavors to introduce protein folding to ascertain structures of proteins for which the structure is unavailable, as well as to critically evaluate the quality of the prediction obtained. The model system used is the…

  1. Global integrated drought monitoring and prediction system

    PubMed Central

    Hao, Zengchao; AghaKouchak, Amir; Nakhjiri, Navid; Farahmand, Alireza

    2014-01-01

    Drought is by far the most costly natural disaster that can lead to widespread impacts, including water and food crises. Here we present data sets available from the Global Integrated Drought Monitoring and Prediction System (GIDMaPS), which provides drought information based on multiple drought indicators. The system provides meteorological and agricultural drought information based on multiple satellite-, and model-based precipitation and soil moisture data sets. GIDMaPS includes a near real-time monitoring component and a seasonal probabilistic prediction module. The data sets include historical drought severity data from the monitoring component, and probabilistic seasonal forecasts from the prediction module. The probabilistic forecasts provide essential information for early warning, taking preventive measures, and planning mitigation strategies. GIDMaPS data sets are a significant extension to current capabilities and data sets for global drought assessment and early warning. The presented data sets would be instrumental in reducing drought impacts especially in developing countries. Our results indicate that GIDMaPS data sets reliably captured several major droughts from across the globe. PMID:25977759

  2. Global integrated drought monitoring and prediction system.

    PubMed

    Hao, Zengchao; AghaKouchak, Amir; Nakhjiri, Navid; Farahmand, Alireza

    2014-01-01

    Drought is by far the most costly natural disaster that can lead to widespread impacts, including water and food crises. Here we present data sets available from the Global Integrated Drought Monitoring and Prediction System (GIDMaPS), which provides drought information based on multiple drought indicators. The system provides meteorological and agricultural drought information based on multiple satellite-, and model-based precipitation and soil moisture data sets. GIDMaPS includes a near real-time monitoring component and a seasonal probabilistic prediction module. The data sets include historical drought severity data from the monitoring component, and probabilistic seasonal forecasts from the prediction module. The probabilistic forecasts provide essential information for early warning, taking preventive measures, and planning mitigation strategies. GIDMaPS data sets are a significant extension to current capabilities and data sets for global drought assessment and early warning. The presented data sets would be instrumental in reducing drought impacts especially in developing countries. Our results indicate that GIDMaPS data sets reliably captured several major droughts from across the globe.

  3. Toward structure prediction of cyclic peptides.

    PubMed

    Yu, Hongtao; Lin, Yu-Shan

    2015-02-14

    Cyclic peptides are a promising class of molecules that can be used to target specific protein-protein interactions. A computational method to accurately predict their structures would substantially advance the development of cyclic peptides as modulators of protein-protein interactions. Here, we develop a computational method that integrates bias-exchange metadynamics simulations, a Boltzmann reweighting scheme, dihedral principal component analysis and a modified density peak-based cluster analysis to provide a converged structural description for cyclic peptides. Using this method, we evaluate the performance of a number of popular protein force fields on a model cyclic peptide. All the tested force fields seem to over-stabilize the α-helix and PPII/β regions in the Ramachandran plot, commonly populated by linear peptides and proteins. Our findings suggest that re-parameterization of a force field that well describes the full Ramachandran plot is necessary to accurately model cyclic peptides.

  4. Nanocomposites for Enhanced Structural Integrity

    DTIC Science & Technology

    2007-09-11

    to develop the science base necessary for full utilization of nanoreinforcements into polymers and fiber composites to improve mechanical , thermal and...prepreg plies were also studied to a limited extent. The properly oxidated GNPs were found to improve not only mechanical properties but also thermal...102 Nanocomposites for Enhanced Structural Integrity AFOSR bn0)2-1-0414 H. Thomas Hahn Mechanical & Aerospace Engineering Department University of

  5. Practical lessons from protein structure prediction

    PubMed Central

    Ginalski, Krzysztof; Grishin, Nick V.; Godzik, Adam; Rychlewski, Leszek

    2005-01-01

    Despite recent efforts to develop automated protein structure determination protocols, structural genomics projects are slow in generating fold assignments for complete proteomes, and spatial structures remain unknown for many protein families. Alternative cheap and fast methods to assign folds using prediction algorithms continue to provide valuable structural information for many proteins. The development of high-quality prediction methods has been boosted in the last years by objective community-wide assessment experiments. This paper gives an overview of the currently available practical approaches to protein structure prediction capable of generating accurate fold assignment. Recent advances in assessment of the prediction quality are also discussed. PMID:15805122

  6. Integrated Computational Solution for Predicting Skin Sensitization Potential of Molecules

    PubMed Central

    Desai, Aarti; Singh, Vivek K.; Jere, Abhay

    2016-01-01

    Introduction Skin sensitization forms a major toxicological endpoint for dermatology and cosmetic products. Recent ban on animal testing for cosmetics demands for alternative methods. We developed an integrated computational solution (SkinSense) that offers a robust solution and addresses the limitations of existing computational tools i.e. high false positive rate and/or limited coverage. Results The key components of our solution include: QSAR models selected from a combinatorial set, similarity information and literature-derived sub-structure patterns of known skin protein reactive groups. Its prediction performance on a challenge set of molecules showed accuracy = 75.32%, CCR = 74.36%, sensitivity = 70.00% and specificity = 78.72%, which is better than several existing tools including VEGA (accuracy = 45.00% and CCR = 54.17% with ‘High’ reliability scoring), DEREK (accuracy = 72.73% and CCR = 71.44%) and TOPKAT (accuracy = 60.00% and CCR = 61.67%). Although, TIMES-SS showed higher predictive power (accuracy = 90.00% and CCR = 92.86%), the coverage was very low (only 10 out of 77 molecules were predicted reliably). Conclusions Owing to improved prediction performance and coverage, our solution can serve as a useful expert system towards Integrated Approaches to Testing and Assessment for skin sensitization. It would be invaluable to cosmetic/ dermatology industry for pre-screening their molecules, and reducing time, cost and animal testing. PMID:27271321

  7. Integrated Propulsion/Vehicle System Structurally Optimized

    NASA Technical Reports Server (NTRS)

    Hunter, James E.; McCurdy, David R.

    2003-01-01

    Ongoing research and testing are essential in the development of air-breathing hypersonic propulsion technology, and this year some positive advancement was made at the NASA Glenn Research Center. Recent work performed for GTX, a rocket-based combined-cycle, single-stage-to-orbit concept, included structural assessments of both the engine and flight vehicle. In the development of air-breathing engine technology, it is impractical to design and optimize components apart from the fully integrated system because tradeoffs must be made between performance and structural capability. Efforts were made to control the flight trajectory, for example, to minimize the aerodynamic heating effects. Structural optimization was applied to evaluate concept feasibility and was instrumental in the determination of the gross liftoff weight of the integrated system. Achieving low Earth orbit with even a small payload requires an aggressive approach to weight minimization through the use of lightweight, oxidation-resistant composite materials. Assessing the integrated system involved investigating the flight trajectory to determine where the critical load events occur in flight and then generating the corresponding environment at each of these events. Structural evaluation requires the mapping of the critical flight loads to finite element models, including the combined effects of aerodynamic, inertial, combustion, and other loads. NASA s APAS code was used to generate aerodynamic pressure and temperature profiles at each critical event. The radiation equilibrium surface temperatures from APAS were used to predict temperatures through the thickness. Heat transfer solutions using NASA's MINIVER code and the SINDA code (Cullimore & Ring Technologies, Littleton, CO) were calculated at selective points external to the integrated vehicle system and then extrapolated over the entire exposed surface. FORTRAN codes were written to expedite the finite element mapping of the aerodynamic heating

  8. Assuring structural integrity in Army systems

    NASA Technical Reports Server (NTRS)

    1985-01-01

    The object of this study was to recommend possible improvements in the manner in which structural integrity of Army systems is assured. The elements of a structural integrity program are described, and relevant practices used in various industries and government organizations are reviewed. Some case histories of Army weapon systems are examined. The mandatory imposition of a structural integrity program patterned after the Air Force Aircraft Structural Integrity Program is recommended and the benefits of such an action are identified.

  9. Data-directed RNA secondary structure prediction using probabilistic modeling.

    PubMed

    Deng, Fei; Ledda, Mirko; Vaziri, Sana; Aviran, Sharon

    2016-08-01

    Structure dictates the function of many RNAs, but secondary RNA structure analysis is either labor intensive and costly or relies on computational predictions that are often inaccurate. These limitations are alleviated by integration of structure probing data into prediction algorithms. However, existing algorithms are optimized for a specific type of probing data. Recently, new chemistries combined with advances in sequencing have facilitated structure probing at unprecedented scale and sensitivity. These novel technologies and anticipated wealth of data highlight a need for algorithms that readily accommodate more complex and diverse input sources. We implemented and investigated a recently outlined probabilistic framework for RNA secondary structure prediction and extended it to accommodate further refinement of structural information. This framework utilizes direct likelihood-based calculations of pseudo-energy terms per considered structural context and can readily accommodate diverse data types and complex data dependencies. We use real data in conjunction with simulations to evaluate performances of several implementations and to show that proper integration of structural contexts can lead to improvements. Our tests also reveal discrepancies between real data and simulations, which we show can be alleviated by refined modeling. We then propose statistical preprocessing approaches to standardize data interpretation and integration into such a generic framework. We further systematically quantify the information content of data subsets, demonstrating that high reactivities are major drivers of SHAPE-directed predictions and that better understanding of less informative reactivities is key to further improvements. Finally, we provide evidence for the adaptive capability of our framework using mock probe simulations.

  10. Predicting Protein Structure Using Parallel Genetic Algorithms.

    DTIC Science & Technology

    1994-12-01

    By " Predicting rotein Structure D istribticfiar.. ................ Using Parallel Genetic Algorithms ,Avaiu " ’ •"... Dist THESIS I IGeorge H...iiLite-d Approved for public release; distribution unlimited AFIT/ GCS /ENG/94D-03 Predicting Protein Structure Using Parallel Genetic Algorithms ...1-1 1.2 Genetic Algorithms ......... ............................ 1-3 1.3 The Protein Folding Problem

  11. OPTIMIZATION BIAS IN ENERGY-BASED STRUCTURE PREDICTION.

    PubMed

    Petrella, Robert J

    2013-12-01

    Physics-based computational approaches to predicting the structure of macromolecules such as proteins are gaining increased use, but there are remaining challenges. In the current work, it is demonstrated that in energy-based prediction methods, the degree of optimization of the sampled structures can influence the prediction results. In particular, discrepancies in the degree of local sampling can bias the predictions in favor of the oversampled structures by shifting the local probability distributions of the minimum sampled energies. In simple systems, it is shown that the magnitude of the errors can be calculated from the energy surface, and for certain model systems, derived analytically. Further, it is shown that for energy wells whose forms differ only by a randomly assigned energy shift, the optimal accuracy of prediction is achieved when the sampling around each structure is equal. Energy correction terms can be used in cases of unequal sampling to reproduce the total probabilities that would occur under equal sampling, but optimal corrections only partially restore the prediction accuracy lost to unequal sampling. For multiwell systems, the determination of the correction terms is a multibody problem; it is shown that the involved cross-correlation multiple integrals can be reduced to simpler integrals. The possible implications of the current analysis for macromolecular structure prediction are discussed.

  12. Collective prediction based on community structure

    NASA Astrophysics Data System (ADS)

    Jiang, Yasong; Li, Taisong; Zhang, Yan; Yan, Yonghong

    2017-01-01

    Collective prediction algorithms have been used to improve performances when network structures are involved in prediction tasks. The training dataset of such tasks often contain information of content, links and labels, while the testing dataset have only content and link information. Conventional collective prediction algorithms conduct predictions based on the content of a node and the information of its direct neighbors with a base classifier. However, the information of some direct neighbor nodes may be not consistent with the target one. In addition, the information of indirect neighbors can be helpful when that of direct neighbors is scant. In this paper, instead of using information of direct neighbors, we propose to apply community structures in networks to prediction tasks. A community detection method is aggregated into the collective prediction process to improve prediction performance. Experimental results show that the proposed algorithm outperforms a number of standard prediction algorithms specially under conditions that labeled training dataset are limited.

  13. Protein Structure Prediction with Visuospatial Analogy

    NASA Astrophysics Data System (ADS)

    Davies, Jim; Glasgow, Janice; Kuo, Tony

    We show that visuospatial representations and reasoning techniques can be used as a similarity metric for analogical protein structure prediction. Our system retrieves pairs of α-helices based on contact map similarity, then transfers and adapts the structure information to an unknown helix pair, showing that similar protein contact maps predict similar 3D protein structure. The success of this method provides support for the notion that changing representations can enable similarity metrics in analogy.

  14. Computational Prediction of RNA Tertiary Structure

    NASA Astrophysics Data System (ADS)

    Zhao, Yunjie; Gong, Zhou; Chen, Changjun; Xiao, Yi

    2012-02-01

    RNAs have been found to be involved in the biological processes. The large RNA usually consists of two basic elements: RNA hairpins and duplex. Due to the experimental determination difficulties, the few RNA tertiary structures limit our understanding of the specific regulation mechanisms and functions. Therefore, RNA tertiary structure prediction is very important for understanding RNA biological functions. Since RNA often folds hierarchically, one of the possible RNA structure prediction approaches is through the hierarchical steps. Here, we focus on the prediction method of RNA tertiary hairpin and duplex structures in which assembles the small tertiary structure fragments from well-defined RNA structural motifs. In a benchmark test with known experiment structures, more than half of the cases agree with the experimental structure better than 3 å RMSD over all the heavy atoms. The prediction results also reproduce the native like complementary base pairs of the secondary structures. Most importantly, the method performs the atomic accuracy of tertiary structures by about several minutes. We expect that the method will be a useful resource for RNA tertiary structure prediction and helpful to the biological research community.

  15. Energy-directed RNA structure prediction.

    PubMed

    Hofacker, Ivo L

    2014-01-01

    In this chapter we present the classic dynamic programming algorithms for RNA structure prediction by energy minimization, as well as variations of this approach that allow to compute suboptimal foldings, or even the partition function over all possible secondary structures. The latter are essential in order to deal with the inaccuracy of minimum free energy (MFE) structure prediction, and can be used, for example, to derive reliability measures that assign a confidence value to all or part of a predicted structure. In addition, we discuss recently proposed alternatives to the MFE criterion such as the use of maximum expected accuracy (MEA) or centroid structures. The dynamic programming algorithms implicitly assume that the RNA molecule is in thermodynamic equilibrium. However, especially for long RNAs, this need not be the case. In the last section we therefore discuss approaches for predicting RNA folding kinetics and co-transcriptional folding.

  16. Predicting pseudoknotted structures across two RNA sequences

    PubMed Central

    Sperschneider, Jana; Datta, Amitava; Wise, Michael J.

    2012-01-01

    Motivation: Laboratory RNA structure determination is demanding and costly and thus, computational structure prediction is an important task. Single sequence methods for RNA secondary structure prediction are limited by the accuracy of the underlying folding model, if a structure is supported by a family of evolutionarily related sequences, one can be more confident that the prediction is accurate. RNA pseudoknots are functional elements, which have highly conserved structures. However, few comparative structure prediction methods can handle pseudoknots due to the computational complexity. Results: A comparative pseudoknot prediction method called DotKnot-PW is introduced based on structural comparison of secondary structure elements and H-type pseudoknot candidates. DotKnot-PW outperforms other methods from the literature on a hand-curated test set of RNA structures with experimental support. Availability: DotKnot-PW and the RNA structure test set are available at the web site http://dotknot.csse.uwa.edu.au/pw. Contact: janaspe@csse.uwa.edu.au Supplementary information: Supplementary data are available at Bioinformatics online. PMID:23044552

  17. Damage Tolerance of Integral Structure in Rotorcraft

    NASA Technical Reports Server (NTRS)

    Forth, Scott C.; Urban, Michael R.

    2003-01-01

    The rotorcraft industry has rapidly implemented integral structures into aircraft to benefit from the weight and cost advantages over traditionally riveted structure. The cost to manufacture an integral structure, where the entire component is machined from a single plate of material, is about one-fifth that of a riveted structure. Furthermore, the integral structure can weigh only one-half that of a riveted structure through optimal design of stiffening structure and part reduction. Finally, inspection and repair of damage in the field can be less costly than riveted structure. There are no rivet heads to inspect under, reducing inspection time, and damage can be removed or patched readily without altering the primary structure, reducing replacement or repair costs. In this paper, the authors will investigate the damage tolerance implications of fielding an integral structure manufactured from thick plate aluminum.

  18. SCRATCH: a protein structure and structural feature prediction server

    PubMed Central

    Cheng, J.; Randall, A. Z.; Sweredoski, M. J.; Baldi, P.

    2005-01-01

    SCRATCH is a server for predicting protein tertiary structure and structural features. The SCRATCH software suite includes predictors for secondary structure, relative solvent accessibility, disordered regions, domains, disulfide bridges, single mutation stability, residue contacts versus average, individual residue contacts and tertiary structure. The user simply provides an amino acid sequence and selects the desired predictions, then submits to the server. Results are emailed to the user. The server is available at . PMID:15980571

  19. Integrated method for combustion stability prediction

    NASA Astrophysics Data System (ADS)

    Yu, Y. C.; O'Hara, L.; Smith, R. J.; Anderson, W. E.; Merkle, C. L.

    2011-10-01

    Major obstacles in overcoming combustion instability include the absence of a mechanistic and a priori prediction capability, and the difficulty in studying instability in the laboratory due to the perceived need for testing at the full-scale pressure and geometry to ensure that important processes are maintained. A hierarchal approach toward combustion instability is described that comprises experiment, analysis, and highfidelity computation to develop combustion response submodels that can be used in engineering-level design analysis. The paper provides an illustrative example of how these elements are used to develop a prediction for growth rates in model rocket combustors that generate spontaneous longitudinal combustion instabilities.

  20. Predicting crystal structures of organic compounds.

    PubMed

    Price, Sarah L

    2014-04-07

    Currently, organic crystal structure prediction (CSP) methods are based on searching for the most thermodynamically stable crystal structure, making various approximations in evaluating the crystal energy. The most stable (global minimum) structure provides a prediction of an experimental crystal structure. However, depending on the specific molecule, there may be other structures which are very close in energy. In this case, the other structures on the crystal energy landscape may be polymorphs, components of static or dynamic disorder in observed structures, or there may be no route to nucleating and growing these structures. A major reason for performing CSP studies is as a complement to solid form screening to see which alternative packings to the known polymorphs are thermodynamically feasible.

  1. Predicting RNA structure: advances and limitations.

    PubMed

    Hofacker, Ivo L; Lorenz, Ronny

    2014-01-01

    RNA secondary structures can be predicted using efficient algorithms. A widely used software package implementing a large number of computational methods is the ViennaRNA Package. This chapter describes how to use programs from the ViennaRNA Package to perform common tasks such as prediction of minimum free-energy structures, suboptimal structures, or base pairing probabilities, and generating secondary structure plots with reliability annotation. Moreover, we present recent methods to assess the folding kinetics of an RNA via 2D projections of the energy landscape, identification of local minima and energy barriers, or simulation of RNA folding as a Markov process.

  2. GAPIT: genome association and prediction integrated tool

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Advances in high throughput sequencing have improved the detection of genes underlying important traits as well as the prediction accuracy of disease risk and breeding value of crop or livestock. Software programs developed to perform statistical genetic analysis that support these activities should...

  3. Enhanced multi-view prediction structure

    NASA Astrophysics Data System (ADS)

    Liu, Da; Li, Yi; Xiong, Yazhou; Wang, Li; Li, Chunyan; Yin, Fang

    2016-11-01

    In this paper, firstly an extended DFMC Structure is proposed, then HQF jump period in extended DFMC is presented. Considering temporal-view and interview prediction structure, HQF location is determined. From the HQF, an enhance LQF is proposed. Then considering the HQF and enhance LQF, improved interview prediction is proposed. Finally bit allocation in the proposed multi-view is proposed. Experimental results show that the proposed method can achieve better performance than the previous schemes.

  4. Impact of active controls technology on structural integrity

    NASA Technical Reports Server (NTRS)

    Noll, Thomas; Austin, Edward; Donley, Shawn; Graham, George; Harris, Terry

    1991-01-01

    This paper summarizes the findings of The Technical Cooperation Program to assess the impact of active controls technology on the structural integrity of aeronautical vehicles and to evaluate the present state-of-the-art for predicting the loads caused by a flight-control system modification and the resulting change in the fatigue life of the flight vehicle. The potential for active controls to adversely affect structural integrity is described, and load predictions obtained using two state-of-the-art analytical methods are given.

  5. Assimilating Thor: How Airmen Integrate Weather Prediction

    DTIC Science & Technology

    2010-06-01

    fluid dynamics to the manic ‗fluid‘ of atmospheric gases demanded computational speeds an order of magnitude greater than the best calculators...Surgeon General Doctor Joseph Lovell, building on earlier studies showing the possible influence of weather and climate on illness and disease...in the Dardanelles campaign, whose predictions in early October of ―three months of good weather ahead‖ not only left troops ill -prepared for a hot

  6. MUFOLD: A new solution for protein 3D structure prediction.

    PubMed

    Zhang, Jingfen; Wang, Qingguo; Barz, Bogdan; He, Zhiquan; Kosztin, Ioan; Shang, Yi; Xu, Dong

    2010-04-01

    There have been steady improvements in protein structure prediction during the past 2 decades. However, current methods are still far from consistently predicting structural models accurately with computing power accessible to common users. Toward achieving more accurate and efficient structure prediction, we developed a number of novel methods and integrated them into a software package, MUFOLD. First, a systematic protocol was developed to identify useful templates and fragments from Protein Data Bank for a given target protein. Then, an efficient process was applied for iterative coarse-grain model generation and evaluation at the Calpha or backbone level. In this process, we construct models using interresidue spatial restraints derived from alignments by multidimensional scaling, evaluate and select models through clustering and static scoring functions, and iteratively improve the selected models by integrating spatial restraints and previous models. Finally, the full-atom models were evaluated using molecular dynamics simulations based on structural changes under simulated heating. We have continuously improved the performance of MUFOLD by using a benchmark of 200 proteins from the Astral database, where no template with >25% sequence identity to any target protein is included. The average root-mean-square deviation of the best models from the native structures is 4.28 A, which shows significant and systematic improvement over our previous methods. The computing time of MUFOLD is much shorter than many other tools, such as Rosetta. MUFOLD demonstrated some success in the 2008 community-wide experiment for protein structure prediction CASP8.

  7. Predicting complex mineral structures using genetic algorithms.

    PubMed

    Mohn, Chris E; Kob, Walter

    2015-10-28

    We show that symmetry-adapted genetic algorithms are capable of finding the ground state of a range of complex crystalline phases including layered- and incommensurate super-structures. This opens the way for the atomistic prediction of complex crystal structures of functional materials and mineral phases.

  8. Characteristics and Prediction of RNA Structure

    PubMed Central

    Zhu, Daming; Zhang, Caiming; Han, Huijian; Crandall, Keith A.

    2014-01-01

    RNA secondary structures with pseudoknots are often predicted by minimizing free energy, which is NP-hard. Most RNAs fold during transcription from DNA into RNA through a hierarchical pathway wherein secondary structures form prior to tertiary structures. Real RNA secondary structures often have local instead of global optimization because of kinetic reasons. The performance of RNA structure prediction may be improved by considering dynamic and hierarchical folding mechanisms. This study is a novel report on RNA folding that accords with the golden mean characteristic based on the statistical analysis of the real RNA secondary structures of all 480 sequences from RNA STRAND, which are validated by NMR or X-ray. The length ratios of domains in these sequences are approximately 0.382L, 0.5L, 0.618L, and L, where L is the sequence length. These points are just the important golden sections of sequence. With this characteristic, an algorithm is designed to predict RNA hierarchical structures and simulate RNA folding by dynamically folding RNA structures according to the above golden section points. The sensitivity and number of predicted pseudoknots of our algorithm are better than those of the Mfold, HotKnots, McQfold, ProbKnot, and Lhw-Zhu algorithms. Experimental results reflect the folding rules of RNA from a new angle that is close to natural folding. PMID:25110687

  9. Structural Integrity in Measures of Self Concept.

    ERIC Educational Resources Information Center

    Stenner, A. Jackson; Katzenmeyer, W.G.

    Structural integrity of a measure is defined in terms of its replicability, constancy, invariance, and stability. Work completed in the development and validation of the Self Observation Scales (SOS) Primary Level (Stenner and Katzenmeyer, 1973) serves to illustrate one method of establishing structural integrity. The name of each scale of the SOS…

  10. Predicting structure in nonsymmetric sparse matrix factorizations

    SciTech Connect

    Gilbert, J.R. ); Ng, E.G. )

    1992-10-01

    Many computations on sparse matrices have a phase that predicts the nonzero structure of the output, followed by a phase that actually performs the numerical computation. We study structure prediction for computations that involve nonsymmetric row and column permutations and nonsymmetric or non-square matrices. Our tools are bipartite graphs, matchings, and alternating paths. Our main new result concerns LU factorization with partial pivoting. We show that if a square matrix A has the strong Hall property (i.e., is fully indecomposable) then an upper bound due to George and Ng on the nonzero structure of L + U is as tight as possible. To show this, we prove a crucial result about alternating paths in strong Hall graphs. The alternating-paths theorem seems to be of independent interest: it can also be used to prove related results about structure prediction for QR factorization that are due to Coleman, Edenbrandt, Gilbert, Hare, Johnson, Olesky, Pothen, and van den Driessche.

  11. Improved Predictions of Secondary Structures for RNA

    NASA Astrophysics Data System (ADS)

    Jaeger, John A.; Turner, Douglas H.; Zuker, Michael

    1989-10-01

    The accuracy of computer predictions of RNA secondary structure from sequence data and free energy parameters has been increased to roughly 70%. Performance is judged by comparison with structures known from phylogenetic analysis. The algorithm also generates suboptimal structures. On average, the best structure within 10% of the lowest free energy contains roughly 90% of phylogenetically known helixes. The algorithm does not include tertiary interactions or pseudoknots and employs a crude model for single-stranded regions. The only favorable interactions are base pairing and stacking of terminal unpaired nucleotides at the ends of helixes. The excellent performance is consistent with these interactions being the primary interactions determining RNA secondary structure.

  12. Predicting ramps by integrating different sorts of information

    NASA Astrophysics Data System (ADS)

    Hirata, Yoshito; Aihara, Kazuyuki

    2016-05-01

    Although predicting sudden rapid changes of renewable energy outputs is useful for maintaining the stability of power grids with many renewable energy resources, the prediction is difficult so far. Here we list causes for the uncertainty for our prediction, quantify them, and forecast whether such sudden rapid changes are likely to happen or not by integrating their quantifications with a method of machine learning. We test the proposed forecast using a toy model and real datasets of solar irradiance and wind speed.

  13. Particle-swarm structure prediction on clusters

    NASA Astrophysics Data System (ADS)

    Lv, Jian; Wang, Yanchao; Zhu, Li; Ma, Yanming

    2012-08-01

    We have developed an efficient method for cluster structure prediction based on the generalization of particle swarm optimization (PSO). A local version of PSO algorithm was implemented to utilize a fine exploration of potential energy surface for a given non-periodic system. We have specifically devised a technique of so-called bond characterization matrix (BCM) to allow the proper measure on the structural similarity. The BCM technique was then employed to eliminate similar structures and define the desirable local search spaces. We find that the introduction of point group symmetries into generation of cluster structures enables structural diversity and apparently avoids the generation of liquid-like (or disordered) clusters for large systems, thus considerably improving the structural search efficiency. We have incorporated Metropolis criterion into our method to further enhance the structural evolution towards low-energy regimes of potential energy surfaces. Our method has been extensively benchmarked on Lennard-Jones clusters with different sizes up to 150 atoms and applied into prediction of new structures of medium-sized Lin (n = 20, 40, 58) clusters. High search efficiency was achieved, demonstrating the reliability of the current methodology and its promise as a major method on cluster structure prediction.

  14. Predicting polymeric crystal structures by evolutionary algorithms

    NASA Astrophysics Data System (ADS)

    Zhu, Qiang; Sharma, Vinit; Oganov, Artem R.; Ramprasad, Ramamurthy

    2014-10-01

    The recently developed evolutionary algorithm USPEX proved to be a tool that enables accurate and reliable prediction of structures. Here we extend this method to predict the crystal structure of polymers by constrained evolutionary search, where each monomeric unit is treated as a building block with fixed connectivity. This greatly reduces the search space and allows the initial structure generation with different sequences and packings of these blocks. The new constrained evolutionary algorithm is successfully tested and validated on a diverse range of experimentally known polymers, namely, polyethylene, polyacetylene, poly(glycolic acid), poly(vinyl chloride), poly(oxymethylene), poly(phenylene oxide), and poly (p-phenylene sulfide). By fixing the orientation of polymeric chains, this method can be further extended to predict the structures of complex linear polymers, such as all polymorphs of poly(vinylidene fluoride), nylon-6 and cellulose. The excellent agreement between predicted crystal structures and experimentally known structures assures a major role of this approach in the efficient design of the future polymeric materials.

  15. Reduced ceria nanofilms from structure prediction.

    PubMed

    Kozlov, Sergey M; Demiroglu, Ilker; Neyman, Konstantin M; Bromley, Stefan T

    2015-03-14

    Experimentally, Ce2O3 films are used to study cerium oxide in its fully or partially reduced state, as present in many applications. We have explored the space of low energy Ce2O3 nanofilms using structure prediction and density functional calculations, yielding more than 30 distinct nanofilm structures. First, our results help to rationalize the roles of thermodynamics and kinetics in the preparation of reduced ceria nanofilms with different bulk crystalline structures (e.g. A-type or bixbyite) depending on the support used. Second, we predict a novel, as yet experimentally unresolved, nanofilm which has a structure that does not correspond to any previously reported bulk A2B3 phase and which has an energetic stability between that of A-type and bixbyite. To assist identification and fabrication of this new Ce2O3 nanofilm we calculate some observable properties and propose supports for its epitaxial growth.

  16. UK Environmental Prediction - integration and evaluation at the convective scale

    NASA Astrophysics Data System (ADS)

    Fallmann, Joachim; Lewis, Huw; Castillo, Juan Manuel; Pearson, David; Harris, Chris; Saulter, Andy; Bricheno, Lucy; Blyth, Eleanor

    2016-04-01

    It has long been understood that accurate prediction and warning of the impacts of severe weather requires an integrated approach to forecasting. For example, high impact weather is typically manifested through various interactions and feedbacks between different components of the Earth System. Damaging high winds can lead to significant damage from the large waves and storm surge along coastlines. The impact of intense rainfall can be translated through saturated soils and land surface processes, high river flows and flooding inland. The substantial impacts on individuals, businesses and infrastructure of such events indicate a pressing need to understand better the value that might be delivered through more integrated environmental prediction. To address this need, the Met Office, NERC Centre for Ecology & Hydrology and NERC National Oceanography Centre have begun to develop the foundations of a coupled high resolution probabilistic forecast system for the UK at km-scale. This links together existing model components of the atmosphere, coastal ocean, land surface and hydrology. Our initial focus has been on a 2-year Prototype project to demonstrate the UK coupled prediction concept in research mode. This presentation will provide an update on UK environmental prediction activities. We will present the results from the initial implementation of an atmosphere-land-ocean coupled system and discuss progress and initial results from further development to integrate wave interactions. We will discuss future directions and opportunities for collaboration in environmental prediction, and the challenges to realise the potential of integrated regional coupled forecasting for improving predictions and applications.

  17. Ko Displacement Theory for Structural Shape Predictions

    NASA Technical Reports Server (NTRS)

    Ko, William L.

    2010-01-01

    The development of the Ko displacement theory for predictions of structure deformed shapes was motivated in 2003 by the Helios flying wing, which had a 247-ft (75-m) wing span with wingtip deflections reaching 40 ft (12 m). The Helios flying wing failed in midair in June 2003, creating the need to develop new technology to predict in-flight deformed shapes of unmanned aircraft wings for visual display before the ground-based pilots. Any types of strain sensors installed on a structure can only sense the surface strains, but are incapable to sense the overall deformed shapes of structures. After the invention of the Ko displacement theory, predictions of structure deformed shapes could be achieved by feeding the measured surface strains into the Ko displacement transfer functions for the calculations of out-of-plane deflections and cross sectional rotations at multiple locations for mapping out overall deformed shapes of the structures. The new Ko displacement theory combined with a strain-sensing system thus created a revolutionary new structure- shape-sensing technology.

  18. Plated lamination structures for integrated magnetic devices

    SciTech Connect

    Webb, Bucknell C.

    2014-06-17

    Semiconductor integrated magnetic devices such as inductors, transformers, etc., having laminated magnetic-insulator stack structures are provided, wherein the laminated magnetic-insulator stack structures are formed using electroplating techniques. For example, an integrated laminated magnetic device includes a multilayer stack structure having alternating magnetic and insulating layers formed on a substrate, wherein each magnetic layer in the multilayer stack structure is separated from another magnetic layer in the multilayer stack structure by an insulating layer, and a local shorting structure to electrically connect each magnetic layer in the multilayer stack structure to an underlying magnetic layer in the multilayer stack structure to facilitate electroplating of the magnetic layers using an underlying conductive layer (magnetic or seed layer) in the stack as an electrical cathode/anode for each electroplated magnetic layer in the stack structure.

  19. Cascaded multiple classifiers for secondary structure prediction.

    PubMed Central

    Ouali, M.; King, R. D.

    2000-01-01

    We describe a new classifier for protein secondary structure prediction that is formed by cascading together different types of classifiers using neural networks and linear discrimination. The new classifier achieves an accuracy of 76.7% (assessed by a rigorous full Jack-knife procedure) on a new nonredundant dataset of 496 nonhomologous sequences (obtained from G.J. Barton and J.A. Cuff). This database was especially designed to train and test protein secondary structure prediction methods, and it uses a more stringent definition of homologous sequence than in previous studies. We show that it is possible to design classifiers that can highly discriminate the three classes (H, E, C) with an accuracy of up to 78% for beta-strands, using only a local window and resampling techniques. This indicates that the importance of long-range interactions for the prediction of beta-strands has been probably previously overestimated. PMID:10892809

  20. Structure-Based Predictions of Activity Cliffs

    PubMed Central

    Husby, Jarmila; Bottegoni, Giovanni; Kufareva, Irina; Abagyan, Ruben; Cavalli, Andrea

    2015-01-01

    In drug discovery, it is generally accepted that neighboring molecules in a given descriptors' space display similar activities. However, even in regions that provide strong predictability, structurally similar molecules can occasionally display large differences in potency. In QSAR jargon, these discontinuities in the activity landscape are known as ‘activity cliffs’. In this study, we assessed the reliability of ligand docking and virtual ligand screening schemes in predicting activity cliffs. We performed our calculations on a diverse, independently collected database of cliff-forming co-crystals. Starting from ideal situations, which allowed us to establish our baseline, we progressively moved toward simulating more realistic scenarios. Ensemble- and template-docking achieved a significant level of accuracy, suggesting that, despite the well-known limitations of empirical scoring schemes, activity cliffs can be accurately predicted by advanced structure-based methods. PMID:25918827

  1. Predicting continuous local structure and the effect of its substitution for secondary structure in fragment-free protein structure prediction.

    PubMed

    Faraggi, Eshel; Yang, Yuedong; Zhang, Shesheng; Zhou, Yaoqi

    2009-11-11

    Local structures predicted from protein sequences are used extensively in every aspect of modeling and prediction of protein structure and function. For more than 50 years, they have been predicted at a low-resolution coarse-grained level (e.g., three-state secondary structure). Here, we combine a two-state classifier with real-value predictor to predict local structure in continuous representation by backbone torsion angles. The accuracy of the angles predicted by this approach is close to that derived from NMR chemical shifts. Their substitution for predicted secondary structure as restraints for ab initio structure prediction doubles the success rate. This result demonstrates the potential of predicted local structure for fragment-free tertiary-structure prediction. It further implies potentially significant benefits from using predicted real-valued torsion angles as a replacement for or supplement to the secondary-structure prediction tools used almost exclusively in many computational methods ranging from sequence alignment to function prediction.

  2. UK Environmental Prediction - integration and evaluation at the convective scale

    NASA Astrophysics Data System (ADS)

    Fallmann, Joachim; Lewis, Huw; Castillo, Juan Manuel; Pearson, David; Harris, Chris; Saulter, Andy; Bricheno, Lucy; Blyth, Eleanor

    2016-04-01

    Traditionally, the simulation of regional ocean, wave and atmosphere components of the Earth System have been considered separately, with some information on other components provided by means of boundary or forcing conditions. More recently, the potential value of a more integrated approach, as required for global climate and Earth System prediction, for regional short-term applications has begun to gain increasing research effort. In the UK, this activity is motivated by an understanding that accurate prediction and warning of the impacts of severe weather requires an integrated approach to forecasting. The substantial impacts on individuals, businesses and infrastructure of such events indicate a pressing need to understand better the value that might be delivered through more integrated environmental prediction. To address this need, the Met Office, NERC Centre for Ecology & Hydrology and NERC National Oceanography Centre have begun to develop the foundations of a coupled high resolution probabilistic forecast system for the UK at km-scale. This links together existing model components of the atmosphere, coastal ocean, land surface and hydrology. Our initial focus has been on a 2-year Prototype project to demonstrate the UK coupled prediction concept in research mode. This presentation will provide an update on UK environmental prediction activities. We will present the results from the initial implementation of an atmosphere-land-ocean coupled system, including a new eddy-permitting resolution ocean component, and discuss progress and initial results from further development to integrate wave interactions in this relatively high resolution system. We will discuss future directions and opportunities for collaboration in environmental prediction, and the challenges to realise the potential of integrated regional coupled forecasting for improving predictions and applications.

  3. PROSNET: INTEGRATING HOMOLOGY WITH MOLECULAR NETWORKS FOR PROTEIN FUNCTION PREDICTION

    PubMed Central

    Wang, Sheng; Qu, Meng

    2016-01-01

    Automated annotation of protein function has become a critical task in the post-genomic era. Network-based approaches and homology-based approaches have been widely used and recently tested in large-scale community-wide assessment experiments. It is natural to integrate network data with homology information to further improve the predictive performance. However, integrating these two heterogeneous, high-dimensional and noisy datasets is non-trivial. In this work, we introduce a novel protein function prediction algorithm ProSNet. An integrated heterogeneous network is first built to include molecular networks of multiple species and link together homologous proteins across multiple species. Based on this integrated network, a dimensionality reduction algorithm is introduced to obtain compact low-dimensional vectors to encode proteins in the network. Finally, we develop machine learning classification algorithms that take the vectors as input and make predictions by transferring annotations both within each species and across different species. Extensive experiments on five major species demonstrate that our integration of homology with molecular networks substantially improves the predictive performance over existing approaches. PMID:27896959

  4. Test Structures For Bumpy Integrated Circuits

    NASA Technical Reports Server (NTRS)

    Buehler, Martin G.; Sayah, Hoshyar R.

    1989-01-01

    Cross-bridge resistors added to comb and serpentine patterns. Improved combination of test structures built into integrated circuit used to evaluate design rules, fabrication processes, and quality of interconnections. Consist of meshing serpentines and combs, and cross bridge. Structures used to make electrical measurements revealing defects in design or fabrication. Combination of test structures includes three comb arrays, two serpentine arrays, and cross bridge. Made of aluminum or polycrystalline silicon, depending on material in integrated-circuit layers evaluated. Aluminum combs and serpentine arrays deposited over steps made by polycrystalline silicon and diffusion layers, while polycrystalline silicon versions of these structures used to cross over steps made by thick oxide layer.

  5. Gene structure prediction by linguistic methods

    SciTech Connect

    Dong, S.; Searls, D.B.

    1994-10-01

    The higher-order structure of genes and other features of biological sequences can be described by means of formal grammars. These grammars can then be used by general-purpose parsers to detect and to assemble such structures by means of syntactic pattern recognition. We describe a grammar and parser for eukaryotic protein-encoding genes, which by some measures is as effective as current connectionist and combinatorial algorithms in predicting gene structures for sequence database entries. Parameters of the grammar rules are optimized for several different species, and mixing experiments are performed to determine the degree of species specificity and the relative importance of compositional, signal-based, and syntactic components in gene prediction. 24 refs., 5 figs., 3 tabs.

  6. Integrated flow field (IFF) structure

    NASA Technical Reports Server (NTRS)

    Pien, Shyhing M. (Inventor); Warshay, Marvin (Inventor)

    2012-01-01

    The present disclosure relates in part to a flow field structure comprising a hydrophilic part and a hydrophobic part communicably attached to each other via a connecting interface. The present disclosure further relates to electrochemical cells comprising the aforementioned flow fields.

  7. RNA Structure: Advances and Assessment of 3D Structure Prediction.

    PubMed

    Miao, Zhichao; Westhof, Eric

    2017-03-30

    Biological functions of RNA molecules are dependent upon sustained specific three-dimensional (3D) structures of RNA, with or without the help of proteins. Understanding of RNA structure is frequently based on 2D structures, which describe only the Watson-Crick (WC) base pairs. Here, we hierarchically review the structural elements of RNA and how they contribute to RNA 3D structure. We focus our analysis on the non-WC base pairs and on RNA modules. Several computer programs have now been designed to predict RNA modules. We describe the RNA-Puzzles initiative, which is a community-wide, blind assessment of RNA 3D structure prediction programs to determine the capabilities and bottlenecks of current predictions. The assessment metrics used in RNA-Puzzles are briefly described. The detection of RNA 3D modules from sequence data and their automatic implementation belong to the current challenges in RNA 3D structure prediction. Expected final online publication date for the Annual Review of Biophysics Volume 46 is May 20, 2017. Please see http://www.annualreviews.org/page/journal/pubdates for revised estimates.

  8. Predicting structured metadata from unstructured metadata

    PubMed Central

    Posch, Lisa; Panahiazar, Maryam; Dumontier, Michel; Gevaert, Olivier

    2016-01-01

    Enormous amounts of biomedical data have been and are being produced by investigators all over the world. However, one crucial and limiting factor in data reuse is accurate, structured and complete description of the data or data about the data—defined as metadata. We propose a framework to predict structured metadata terms from unstructured metadata for improving quality and quantity of metadata, using the Gene Expression Omnibus (GEO) microarray database. Our framework consists of classifiers trained using term frequency-inverse document frequency (TF-IDF) features and a second approach based on topics modeled using a Latent Dirichlet Allocation model (LDA) to reduce the dimensionality of the unstructured data. Our results on the GEO database show that structured metadata terms can be the most accurately predicted using the TF-IDF approach followed by LDA both outperforming the majority vote baseline. While some accuracy is lost by the dimensionality reduction of LDA, the difference is small for elements with few possible values, and there is a large improvement over the majority classifier baseline. Overall this is a promising approach for metadata prediction that is likely to be applicable to other datasets and has implications for researchers interested in biomedical metadata curation and metadata prediction. Database URL: http://www.yeastgenome.org/

  9. Fracture Testing of Integral Stiffened Structure

    NASA Technical Reports Server (NTRS)

    Newman, John A.; Smith, Stephen W.; Piascik, Robert S.; Dawicke, David S.; Johnston, William M.; Willard, Scott A.

    2008-01-01

    Laboratory testing was conducted to evaluate safety concerns for integrally-stiffened tanks that were found to have developed cracks during pressurization testing. Cracks occurred at fastener holes where additional stiffeners were attached to the integrally-stiffened tank structure. Tests were conducted to obtain material properties and to reproduce the crack morphologies that were observed in service to help determine if the tanks are safe for operation. Reproducing the cracking modes observed during pressurization testing required a complex loading state involving both a tensile load in the integrally-stiffened structure and a pin-load at a fastener hole.

  10. Integrable structures in quantum field theory

    NASA Astrophysics Data System (ADS)

    Negro, Stefano

    2016-08-01

    This review was born as notes for a lecture given at the Young Researchers Integrability School (YRIS) school on integrability in Durham, in the summer of 2015. It deals with a beautiful method, developed in the mid-nineties by Bazhanov, Lukyanov and Zamolodchikov and, as such, called BLZ. This method can be interpreted as a field theory version of the quantum inverse scattering, also known as the algebraic Bethe ansatz. Starting with the case of conformal field theories (CFTs) we show how to build the field theory analogues of commuting transfer T matrices and Baxter Q-operators of integrable lattice models. These objects contain the complete information of the integrable structure of the theory, viz. the integrals of motion, and can be used, as we will show, to derive the thermodynamic Bethe ansatz and nonlinear integral equations. This same method can be easily extended to the description of integrable structures of certain particular massive deformations of CFTs; these, in turn, can be described as quantum group reductions of the quantum sine-Gordon model and it is an easy step to include this last theory in the framework of BLZ approach. Finally we show an interesting and surprising connection of the BLZ structures with classical objects emerging from the study of classical integrable models via the inverse scattering transform method. This connection goes under the name of ODE/IM correspondence and we will present it for the specific case of quantum sine-Gordon model only.

  11. An Integrated Software Package to Enable Predictive Simulation Capabilities

    SciTech Connect

    Chen, Yousu; Fitzhenry, Erin B.; Jin, Shuangshuang; Palmer, Bruce J.; Sharma, Poorva; Huang, Zhenyu

    2016-08-11

    The power grid is increasing in complexity due to the deployment of smart grid technologies. Such technologies vastly increase the size and complexity of power grid systems for simulation and modeling. This increasing complexity necessitates not only the use of high-performance-computing (HPC) techniques, but a smooth, well-integrated interplay between HPC applications. This paper presents a new integrated software package that integrates HPC applications and a web-based visualization tool based on a middleware framework. This framework can support the data communication between different applications. Case studies with a large power system demonstrate the predictive capability brought by the integrated software package, as well as the better situational awareness provided by the web-based visualization tool in a live mode. Test results validate the effectiveness and usability of the integrated software package.

  12. Frontoparietal white matter integrity predicts haptic performance in chronic stroke.

    PubMed

    Borstad, Alexandra L; Choi, Seongjin; Schmalbrock, Petra; Nichols-Larsen, Deborah S

    2016-01-01

    Frontoparietal white matter supports information transfer between brain areas involved in complex haptic tasks such as somatosensory discrimination. The purpose of this study was to gain an understanding of the relationship between microstructural integrity of frontoparietal network white matter and haptic performance in persons with chronic stroke and to compare frontoparietal network integrity in participants with stroke and age matched control participants. Nineteen individuals with stroke and 16 controls participated. Haptic performance was quantified using the Hand Active Sensation Test (HASTe), an 18-item match-to-sample test of weight and texture discrimination. Three tesla MRI was used to obtain diffusion-weighted and high-resolution anatomical images of the whole brain. Probabilistic tractography was used to define 10 frontoparietal tracts total; Four intrahemispheric tracts measured bilaterally 1) thalamus to primary somatosensory cortex (T-S1), 2) thalamus to primary motor cortex (T-M1), 3) primary to secondary somatosensory cortex (S1 to SII) and 4) primary somatosensory cortex to middle frontal gyrus (S1 to MFG) and, 2 interhemispheric tracts; S1-S1 and precuneus interhemispheric. A control tract outside the network, the cuneus interhemispheric tract, was also examined. The diffusion metrics fractional anisotropy (FA), mean diffusivity (MD), axial (AD) and radial diffusivity (RD) were quantified for each tract. Diminished FA and elevated MD values are associated with poorer white matter integrity in chronic stroke. Nine of 10 tracts quantified in the frontoparietal network had diminished structural integrity poststroke compared to the controls. The precuneus interhemispheric tract was not significantly different between groups. Principle component analysis across all frontoparietal white matter tract MD values indicated a single factor explained 47% and 57% of the variance in tract mean diffusivity in stroke and control groups respectively. Age

  13. Enhancing interacting residue prediction with integrated contact matrix prediction in protein-protein interaction.

    PubMed

    Du, Tianchuan; Liao, Li; Wu, Cathy H

    2016-12-01

    Identifying the residues in a protein that are involved in protein-protein interaction and identifying the contact matrix for a pair of interacting proteins are two computational tasks at different levels of an in-depth analysis of protein-protein interaction. Various methods for solving these two problems have been reported in the literature. However, the interacting residue prediction and contact matrix prediction were handled by and large independently in those existing methods, though intuitively good prediction of interacting residues will help with predicting the contact matrix. In this work, we developed a novel protein interacting residue prediction system, contact matrix-interaction profile hidden Markov model (CM-ipHMM), with the integration of contact matrix prediction and the ipHMM interaction residue prediction. We propose to leverage what is learned from the contact matrix prediction and utilize the predicted contact matrix as "feedback" to enhance the interaction residue prediction. The CM-ipHMM model showed significant improvement over the previous method that uses the ipHMM for predicting interaction residues only. It indicates that the downstream contact matrix prediction could help the interaction site prediction.

  14. Structurally Integrated Antenna Concepts for HALE UAVs

    NASA Technical Reports Server (NTRS)

    Cravey, Robin L.; Vedeler, Erik; Goins, Larry; Young, W. Robert; Lawrence, Roland W.

    2006-01-01

    This technical memorandum describes work done in support of the Multifunctional Structures and Materials Team under the Vehicle Systems Program's ITAS (Integrated Tailored Aero Structures) Project during FY 2005. The Electromagnetics and Sensors Branch (ESB) developed three ultra lightweight antenna concepts compatible with HALE UAVs (High Altitude Long Endurance Unmanned Aerial Vehicles). ESB also developed antenna elements that minimize the interaction between elements and the vehicle to minimize the impact of wing flexure on the EM (electromagnetic) performance of the integrated array. In addition, computer models were developed to perform phase correction for antenna arrays whose elements are moving relative to each other due to wing deformations expected in HALE vehicle concepts. Development of lightweight, conformal or structurally integrated antenna elements and compensating for the impact of a lightweight, flexible structure on a large antenna array are important steps in the realization of HALE UAVs for microwave applications such as passive remote sensing and communications.

  15. Reduced ceria nanofilms from structure prediction

    NASA Astrophysics Data System (ADS)

    Kozlov, Sergey M.; Demiroglu, Ilker; Neyman, Konstantin M.; Bromley, Stefan T.

    2015-02-01

    Experimentally, Ce2O3 films are used to study cerium oxide in its fully or partially reduced state, as present in many applications. We have explored the space of low energy Ce2O3 nanofilms using structure prediction and density functional calculations, yielding more than 30 distinct nanofilm structures. First, our results help to rationalize the roles of thermodynamics and kinetics in the preparation of reduced ceria nanofilms with different bulk crystalline structures (e.g. A-type or bixbyite) depending on the support used. Second, we predict a novel, as yet experimentally unresolved, nanofilm which has a structure that does not correspond to any previously reported bulk A2B3 phase and which has an energetic stability between that of A-type and bixbyite. To assist identification and fabrication of this new Ce2O3 nanofilm we calculate some observable properties and propose supports for its epitaxial growth.Experimentally, Ce2O3 films are used to study cerium oxide in its fully or partially reduced state, as present in many applications. We have explored the space of low energy Ce2O3 nanofilms using structure prediction and density functional calculations, yielding more than 30 distinct nanofilm structures. First, our results help to rationalize the roles of thermodynamics and kinetics in the preparation of reduced ceria nanofilms with different bulk crystalline structures (e.g. A-type or bixbyite) depending on the support used. Second, we predict a novel, as yet experimentally unresolved, nanofilm which has a structure that does not correspond to any previously reported bulk A2B3 phase and which has an energetic stability between that of A-type and bixbyite. To assist identification and fabrication of this new Ce2O3 nanofilm we calculate some observable properties and propose supports for its epitaxial growth. Electronic supplementary information (ESI) available: Graph of IP versus DFT relative energies for nanofilms, GGA + U calculated lattice parameters and

  16. Testing Predictive Models of Technology Integration in Mexico and the United States

    ERIC Educational Resources Information Center

    Velazquez, Cesareo Morales

    2008-01-01

    Data from Mexico City, Mexico (N = 978) and from Texas, USA (N = 932) were used to test the predictive validity of the teacher professional development component of the Will, Skill, Tool Model of Technology Integration in a cross-cultural context. Structural equation modeling (SEM) was used to test the model. Analyses of these data yielded…

  17. Multithreaded parsing for predicting RNA secondary structures.

    PubMed

    Al-Mulhem, Muhammed S

    2010-01-01

    Many computational approaches have been developed for modelling and analysing the RNA secondary structure. These approaches are based on diverse methods such as grammars, dynamic programming, matching and evolutionary algorithms. This paper proposes a new parsing algorithm for the prediction of RNA secondary structures. The proposed algorithm is based on the shift-reduce LR parsing algorithm for programming languages. It has two main contributions: it extends the LR parsing algorithm by using a Stochastic Context-Free Grammar (SCFG) instead of Context-Free Grammar (CFG) for parsing RNA secondary structures; it extends the LR parsing algorithm by using a multithreaded approach to handle the LR parsing conflicts resulting from the use of ambiguous grammars.

  18. Development of Improved Surface Integral Methods for Jet Aeroacoustic Predictions

    NASA Technical Reports Server (NTRS)

    Pilon, Anthony R.; Lyrintzis, Anastasios S.

    1997-01-01

    The accurate prediction of aerodynamically generated noise has become an important goal over the past decade. Aeroacoustics must now be an integral part of the aircraft design process. The direct calculation of aerodynamically generated noise with CFD-like algorithms is plausible. However, large computer time and memory requirements often make these predictions impractical. It is therefore necessary to separate the aeroacoustics problem into two parts, one in which aerodynamic sound sources are determined, and another in which the propagating sound is calculated. This idea is applied in acoustic analogy methods. However, in the acoustic analogy, the determination of far-field sound requires the solution of a volume integral. This volume integration again leads to impractical computer requirements. An alternative to the volume integrations can be found in the Kirchhoff method. In this method, Green's theorem for the linear wave equation is used to determine sound propagation based on quantities on a surface surrounding the source region. The change from volume to surface integrals represents a tremendous savings in the computer resources required for an accurate prediction. This work is concerned with the development of enhancements of the Kirchhoff method for use in a wide variety of aeroacoustics problems. This enhanced method, the modified Kirchhoff method, is shown to be a Green's function solution of Lighthill's equation. It is also shown rigorously to be identical to the methods of Ffowcs Williams and Hawkings. This allows for development of versatile computer codes which can easily alternate between the different Kirchhoff and Ffowcs Williams-Hawkings formulations, using the most appropriate method for the problem at hand. The modified Kirchhoff method is developed primarily for use in jet aeroacoustics predictions. Applications of the method are shown for two dimensional and three dimensional jet flows. Additionally, the enhancements are generalized so that

  19. Posterror slowing predicts rule-based but not information-integration category learning.

    PubMed

    Tam, Helen; Maddox, W Todd; Huang-Pollock, Cynthia L

    2013-12-01

    We examined whether error monitoring, operationalized as the degree to which individuals slow down after committing an error (i.e., posterror slowing), is differentially important in the learning of rule-based versus information-integration category structures. Rule-based categories are most efficiently solved through the application of an explicit verbal strategy (e.g., "sort by color"). In contrast, information-integration categories are believed to be learned in a trial-by-trial, associative manner. Our results indicated that posterror slowing predicts enhanced rule-based but not information-integration category learning. Implications for multiple category-learning systems are discussed.

  20. Integrate modelling of smart structures for astronomy: design future technologies

    NASA Astrophysics Data System (ADS)

    Riva, M.; Moschetti, M.

    2016-07-01

    The astronomical instrumentation needs high level of image quality and stability. The quality of images processed by an optical instrument can be referred to the size of the spot and/or the point spread function (p.s.f.), while the stability is related to the displacement of the spot centroid during the observations. The importance of new design procedures for astronomical instruments through the direct design of the materials taking into account their functionalities integrating different approaches (FEM + raytracing) is then enhanced by the new upcoming requirement. Different functional materials can be joined together exploiting each peculiar property in order to realize an integrated structure better known as Smart Structure. They are capable of sensing and reacting to their environment in a predictable and desired manner, through the integration of various elements, such as sensors, actuators, power sources, signal processors, and communications network. The Paper describes possible application related to two main functional materials: piezoelectric materials and Shape Memory Alloys.

  1. Predicting protein structures with a multiplayer online game.

    PubMed

    Cooper, Seth; Khatib, Firas; Treuille, Adrien; Barbero, Janos; Lee, Jeehyung; Beenen, Michael; Leaver-Fay, Andrew; Baker, David; Popović, Zoran; Players, Foldit

    2010-08-05

    People exert large amounts of problem-solving effort playing computer games. Simple image- and text-recognition tasks have been successfully 'crowd-sourced' through games, but it is not clear if more complex scientific problems can be solved with human-directed computing. Protein structure prediction is one such problem: locating the biologically relevant native conformation of a protein is a formidable computational challenge given the very large size of the search space. Here we describe Foldit, a multiplayer online game that engages non-scientists in solving hard prediction problems. Foldit players interact with protein structures using direct manipulation tools and user-friendly versions of algorithms from the Rosetta structure prediction methodology, while they compete and collaborate to optimize the computed energy. We show that top-ranked Foldit players excel at solving challenging structure refinement problems in which substantial backbone rearrangements are necessary to achieve the burial of hydrophobic residues. Players working collaboratively develop a rich assortment of new strategies and algorithms; unlike computational approaches, they explore not only the conformational space but also the space of possible search strategies. The integration of human visual problem-solving and strategy development capabilities with traditional computational algorithms through interactive multiplayer games is a powerful new approach to solving computationally-limited scientific problems.

  2. Predicting Protein Function via Semantic Integration of Multiple Networks.

    PubMed

    Yu, Guoxian; Fu, Guangyuan; Wang, Jun; Zhu, Hailong

    2016-01-01

    Determining the biological functions of proteins is one of the key challenges in the post-genomic era. The rapidly accumulated large volumes of proteomic and genomic data drives to develop computational models for automatically predicting protein function in large scale. Recent approaches focus on integrating multiple heterogeneous data sources and they often get better results than methods that use single data source alone. In this paper, we investigate how to integrate multiple biological data sources with the biological knowledge, i.e., Gene Ontology (GO), for protein function prediction. We propose a method, called SimNet, to Semantically integrate multiple functional association Networks derived from heterogenous data sources. SimNet firstly utilizes GO annotations of proteins to capture the semantic similarity between proteins and introduces a semantic kernel based on the similarity. Next, SimNet constructs a composite network, obtained as a weighted summation of individual networks, and aligns the network with the kernel to get the weights assigned to individual networks. Then, it applies a network-based classifier on the composite network to predict protein function. Experiment results on heterogenous proteomic data sources of Yeast, Human, Mouse, and Fly show that, SimNet not only achieves better (or comparable) results than other related competitive approaches, but also takes much less time. The Matlab codes of SimNet are available at https://sites.google.com/site/guoxian85/simnet.

  3. Predicting road accidents: Structural time series approach

    NASA Astrophysics Data System (ADS)

    Junus, Noor Wahida Md; Ismail, Mohd Tahir

    2014-07-01

    In this paper, the model for occurrence of road accidents in Malaysia between the years of 1970 to 2010 was developed and throughout this model the number of road accidents have been predicted by using the structural time series approach. The models are developed by using stepwise method and the residual of each step has been analyzed. The accuracy of the model is analyzed by using the mean absolute percentage error (MAPE) and the best model is chosen based on the smallest Akaike information criterion (AIC) value. A structural time series approach found that local linear trend model is the best model to represent the road accidents. This model allows level and slope component to be varied over time. In addition, this approach also provides useful information on improving the conventional time series method.

  4. Integrated Management of Structural Pests in Schools.

    ERIC Educational Resources Information Center

    Illinois State Dept. of Public Health, Springfield.

    The state of Illinois is encouraging schools to better inspect and evaluate the causes of their pest infestation problems through use of the Integrated Pest Management (IPM) guidelines developed by the Illinois Department of Public Health. This guide reviews the philosophy and organization of an IPM program for structural pests in schools,…

  5. Initial Integration of Noise Prediction Tools for Acoustic Scattering Effects

    NASA Technical Reports Server (NTRS)

    Nark, Douglas M.; Burley, Casey L.; Tinetti, Ana; Rawls, John W.

    2008-01-01

    This effort provides an initial glimpse at NASA capabilities available in predicting the scattering of fan noise from a non-conventional aircraft configuration. The Aircraft NOise Prediction Program, Fast Scattering Code, and the Rotorcraft Noise Model were coupled to provide increased fidelity models of scattering effects on engine fan noise sources. The integration of these codes led to the identification of several keys issues entailed in applying such multi-fidelity approaches. In particular, for prediction at noise certification points, the inclusion of distributed sources leads to complications with the source semi-sphere approach. Computational resource requirements limit the use of the higher fidelity scattering code to predict radiated sound pressure levels for full scale configurations at relevant frequencies. And, the ability to more accurately represent complex shielding surfaces in current lower fidelity models is necessary for general application to scattering predictions. This initial step in determining the potential benefits/costs of these new methods over the existing capabilities illustrates a number of the issues that must be addressed in the development of next generation aircraft system noise prediction tools.

  6. Structural network efficiency predicts conversion to dementia

    PubMed Central

    Tuladhar, Anil M.; van Uden, Ingeborg W.M.; Rutten-Jacobs, Loes C.A.; Lawrence, Andrew; van der Holst, Helena; van Norden, Anouk; de Laat, Karlijn; van Dijk, Ewoud; Claassen, Jurgen A.H.R.; Kessels, Roy P.C.; Markus, Hugh S.; Norris, David G.

    2016-01-01

    Objective: To examine whether structural network connectivity at baseline predicts incident all-cause dementia in a prospective hospital-based cohort of elderly participants with MRI evidence of small vessel disease (SVD). Methods: A total of 436 participants from the Radboud University Nijmegen Diffusion Tensor and Magnetic Resonance Cohort (RUN DMC), a prospective hospital-based cohort of elderly without dementia with cerebral SVD, were included in 2006. During follow-up (2011–2012), dementia was diagnosed. The structural network was constructed from baseline diffusion tensor imaging followed by deterministic tractography and measures of efficiency using graph theory were calculated. Cox proportional regression analyses were conducted. Results: During 5 years of follow-up, 32 patients developed dementia. MRI markers for SVD were strongly associated with network measures. Patients with dementia showed lower total network strength and global and local efficiency at baseline as compared with the group without dementia. Lower global network efficiency was independently associated with increased risk of incident all-cause dementia (hazard ratio 0.63, 95% confidence interval 0.42–0.96, p = 0.032); in contrast, individual SVD markers including lacunes, white matter hyperintensities volume, and atrophy were not independently associated. Conclusions: These results support a role of network disruption playing a pivotal role in the genesis of dementia in SVD, and suggest network analysis of the connectivity of white matter has potential as a predictive marker in the disease. PMID:26888983

  7. Quantifying the structural integrity of nanorod arrays.

    PubMed

    Thöle, Florian; Xue, Longjian; HEß, Claudia; Hillebrand, Reinald; Gorb, Stanislav N; Steinhart, Martin

    2017-02-01

    Arrays of aligned nanorods oriented perpendicular to a support, which are accessible by top-down lithography or by means of shape-defining hard templates, have received increasing interest as sensor components, components for nanophotonics and nanoelectronics, substrates for tissue engineering, surfaces having specific adhesive or antiadhesive properties and as surfaces with customized wettability. Agglomeration of the nanorods deteriorates the performance of components based on nanorod arrays. A comprehensive body of literature deals with mechanical failure mechanisms of nanorods and design criteria for mechanically stable nanorod arrays. However, the structural integrity of nanorod arrays is commonly evaluated only visually and qualitatively. We use real-space analysis of microscopic images to quantify the fraction of condensed nanorods in nanorod arrays. We suggest the number of array elements apparent in the micrographs divided by the number of array elements a defect-free array would contain in the same area, referred to as integrity fraction, as a measure of structural array integrity. Reproducible procedures to determine the imaged number of array elements are introduced. Thus, quantitative comparisons of different nanorod arrays, or of one nanorod array at different stages of its use, are possible. Structural integrities of identical nanorod arrays differing only in the length of the nanorods are exemplarily analysed.

  8. Predicted and experimental structures of integrins and beta-propellers.

    PubMed

    Springer, Timothy A

    2002-12-01

    Integrins and other cell surface receptors have been fertile grounds for structure prediction experiments. Recently determined structures show remarkable successes, especially with beta-propeller domain predictions, and also reveal how ligand binding by integrins is conformationally regulated.

  9. The structure of integral dimensions: contrasting topological and Cartesian representations.

    PubMed

    Jones, Matt; Goldstone, Robert L

    2013-02-01

    Diverse evidence shows that perceptually integral dimensions, such as those composing color, are represented holistically. However, the nature of these holistic representations is poorly understood. Extant theories, such as those founded on multidimensional scaling or general recognition theory, model integral stimulus spaces using a Cartesian coordinate system, just as with spaces defined by separable dimensions. This approach entails a rich geometrical structure that has never been questioned but may not be psychologically meaningful for integral dimensions. In particular, Cartesian models carry a notion of orthogonality of component dimensions, such that if 1 dimension is diagnostic for a classification or discrimination task, another can be selected as uniquely irrelevant. This article advances an alternative model in which integral dimensions are characterized as topological spaces. The Cartesian and topological models are tested in a series of experiments using the perceptual-learning phenomenon of dimension differentiation, whereby discrimination training with integral-dimension stimuli can induce an analytic representation of those stimuli. Under the present task design, the 2 models make contrasting predictions regarding the analytic representation that will be learned. Results consistently support the Cartesian model. These findings indicate that perceptual representations of integral dimensions are surprisingly structured, despite their holistic, unanalyzed nature.

  10. Departure Queue Prediction for Strategic and Tactical Surface Scheduler Integration

    NASA Technical Reports Server (NTRS)

    Zelinski, Shannon; Windhorst, Robert

    2016-01-01

    A departure metering concept to be demonstrated at Charlotte Douglas International Airport (CLT) will integrate strategic and tactical surface scheduling components to enable the respective collaborative decision making and improved efficiency benefits these two methods of scheduling provide. This study analyzes the effect of tactical scheduling on strategic scheduler predictability. Strategic queue predictions and target gate pushback times to achieve a desired queue length are compared between fast time simulations of CLT surface operations with and without tactical scheduling. The use of variable departure rates as a strategic scheduler input was shown to substantially improve queue predictions over static departure rates. With target queue length calibration, the strategic scheduler can be tuned to produce average delays within one minute of the tactical scheduler. However, root mean square differences between strategic and tactical delays were between 12 and 15 minutes due to the different methods the strategic and tactical schedulers use to predict takeoff times and generate gate pushback clearances. This demonstrates how difficult it is for the strategic scheduler to predict tactical scheduler assigned gate delays on an individual flight basis as the tactical scheduler adjusts departure sequence to accommodate arrival interactions. Strategic/tactical scheduler compatibility may be improved by providing more arrival information to the strategic scheduler and stabilizing tactical scheduler changes to runway sequence in response to arrivals.

  11. Evaluation, analysis and prediction of geologic structures

    NASA Astrophysics Data System (ADS)

    Woodward, Nicholas B.

    2012-08-01

    Balanced cross-sections claim to be better because they apply a rigorous set of rules to develop the conceptual model of the structures present in an area. Balanced cross-sections can be further improved and become more useful to understanding real physical problems by collection of additional data such as seismic reflection surveys, collection of additional stratigraphic data, or collection of rock fabric information. The additional information validates the initial model and provides details on deformation conditions and on local rock responses to the deformation. Although individual cross-sections are two dimensional, the objective of evaluation and analysis of deformed regions should be three dimensional whenever possible to recognize the challenges of the real world. Subsurface system analysis derived from the hydrologic community emphasizes conceptual model development through model verification, validation, uncertainty quantification, benchmarking and meta-analysis. Their approach includes many steps informally used by the structural geology community but in a much more explicit way. Newer geological applications of structural geology would benefit from this more rigorous approach for designing and doing performance predictions as technological needs become more socially sensitive such as for carbon storage sites, new areas of energy exploration in higher population density areas, or for nuclear waste storage facilities.

  12. Disturbance metrics predict a wetland Vegetation Index of Biotic Integrity

    USGS Publications Warehouse

    Stapanian, Martin A.; Mack, John; Adams, Jean V.; Gara, Brian; Micacchion, Mick

    2013-01-01

    Indices of biological integrity of wetlands based on vascular plants (VIBIs) have been developed in many areas in the USA. Knowledge of the best predictors of VIBIs would enable management agencies to make better decisions regarding mitigation site selection and performance monitoring criteria. We use a novel statistical technique to develop predictive models for an established index of wetland vegetation integrity (Ohio VIBI), using as independent variables 20 indices and metrics of habitat quality, wetland disturbance, and buffer area land use from 149 wetlands in Ohio, USA. For emergent and forest wetlands, predictive models explained 61% and 54% of the variability, respectively, in Ohio VIBI scores. In both cases the most important predictor of Ohio VIBI score was a metric that assessed habitat alteration and development in the wetland. Of secondary importance as a predictor was a metric that assessed microtopography, interspersion, and quality of vegetation communities in the wetland. Metrics and indices assessing disturbance and land use of the buffer area were generally poor predictors of Ohio VIBI scores. Our results suggest that vegetation integrity of emergent and forest wetlands could be most directly enhanced by minimizing substrate and habitat disturbance within the wetland. Such efforts could include reducing or eliminating any practices that disturb the soil profile, such as nutrient enrichment from adjacent farm land, mowing, grazing, or cutting or removing woody plants.

  13. Boundary-Layer Receptivity and Integrated Transition Prediction

    NASA Technical Reports Server (NTRS)

    Chang, Chau-Lyan; Choudhari, Meelan

    2005-01-01

    The adjoint parabold stability equations (PSE) formulation is used to calculate the boundary layer receptivity to localized surface roughness and suction for compressible boundary layers. Receptivity efficiency functions predicted by the adjoint PSE approach agree well with results based on other nonparallel methods including linearized Navier-Stokes equations for both Tollmien-Schlichting waves and crossflow instability in swept wing boundary layers. The receptivity efficiency function can be regarded as the Green's function to the disturbance amplitude evolution in a nonparallel (growing) boundary layer. Given the Fourier transformed geometry factor distribution along the chordwise direction, the linear disturbance amplitude evolution for a finite size, distributed nonuniformity can be computed by evaluating the integral effects of both disturbance generation and linear amplification. The synergistic approach via the linear adjoint PSE for receptivity and nonlinear PSE for disturbance evolution downstream of the leading edge forms the basis for an integrated transition prediction tool. Eventually, such physics-based, high fidelity prediction methods could simulate the transition process from the disturbance generation through the nonlinear breakdown in a holistic manner.

  14. Blind protein structure prediction using accelerated free-energy simulations

    PubMed Central

    Perez, Alberto; Morrone, Joseph A.; Brini, Emiliano; MacCallum, Justin L.; Dill, Ken A.

    2016-01-01

    We report a key proof of principle of a new acceleration method [Modeling Employing Limited Data (MELD)] for predicting protein structures by molecular dynamics simulation. It shows that such Boltzmann-satisfying techniques are now sufficiently fast and accurate to predict native protein structures in a limited test within the Critical Assessment of Structure Prediction (CASP) community-wide blind competition. PMID:27847872

  15. Optimizing nondecomposable loss functions in structured prediction.

    PubMed

    Ranjbar, Mani; Lan, Tian; Wang, Yang; Robinovitch, Steven N; Li, Ze-Nian; Mori, Greg

    2013-04-01

    We develop an algorithm for structured prediction with nondecomposable performance measures. The algorithm learns parameters of Markov Random Fields (MRFs) and can be applied to multivariate performance measures. Examples include performance measures such as Fβ score (natural language processing), intersection over union (object category segmentation), Precision/Recall at k (search engines), and ROC area (binary classifiers). We attack this optimization problem by approximating the loss function with a piecewise linear function. The loss augmented inference forms a Quadratic Program (QP), which we solve using LP relaxation. We apply this approach to two tasks: object class-specific segmentation and human action retrieval from videos. We show significant improvement over baseline approaches that either use simple loss functions or simple scoring functions on the PASCAL VOC and H3D Segmentation datasets, and a nursing home action recognition dataset.

  16. Predicting missing links via structural similarity

    NASA Astrophysics Data System (ADS)

    Lyu, Guo-Dong; Fan, Chang-Jun; Yu, Lian-Fei; Xiu, Bao-Xin; Zhang, Wei-Ming

    2015-04-01

    Predicting missing links in networks plays a significant role in modern science. On the basis of structural similarity, our paper proposes a new node-similarity-based measure called biased resource allocation (BRA), which is motivated by the resource allocation (RA) measure. Comparisons between BRA and nine well-known node-similarity-based measures on five real networks indicate that BRA performs no worse than RA, which was the best node-similarity-based index in previous researches. Afterwards, based on localPath (LP) and Katz measure, we propose another two improved measures, named Im-LocalPath and Im-Katz respectively. Numerical results show that the prediction accuracy of both Im-LP and Im-Katz measure improve compared with the original LP and Katz measure. Finally, a new path-similarity-based measure and its improved measure, called LYU and Im-LYU measure, are proposed and especially, Im-LYU measure is shown to perform more remarkably than other mentioned measures.

  17. Integrated structural-aerodynamic design optimization

    NASA Technical Reports Server (NTRS)

    Haftka, R. T.; Kao, P. J.; Grossman, B.; Polen, D.; Sobieszczanski-Sobieski, J.

    1988-01-01

    This paper focuses on the processes of simultaneous aerodynamic and structural wing design as a prototype for design integration, with emphasis on the major difficulty associated with multidisciplinary design optimization processes, their enormous computational costs. Methods are presented for reducing this computational burden through the development of efficient methods for cross-sensitivity calculations and the implementation of approximate optimization procedures. Utilizing a modular sensitivity analysis approach, it is shown that the sensitivities can be computed without the expensive calculation of the derivatives of the aerodynamic influence coefficient matrix, and the derivatives of the structural flexibility matrix. The same process is used to efficiently evaluate the sensitivities of the wing divergence constraint, which should be particularly useful, not only in problems of complete integrated aircraft design, but also in aeroelastic tailoring applications.

  18. Structural Integrity of a Wind Tunnel Balance

    NASA Technical Reports Server (NTRS)

    Karkehabadi, R.; Rhew, R. D.

    2004-01-01

    The National Aeronautics and Space Administration (NASA) Langley Research Center (LaRC) has been designing strain-gage balances for utilization in wind tunnels since its inception. The utilization of balances span over a wide variety of aerodynamic tests. A force balance is an inherently critically stressed component due to the requirements of measurement sensitivity. Research and analyses are done in order to investigate the structural integrity of the balances as well as developing an understanding of their performance in order to enhance their capability. Maximum loading occurs when all 6 components of the loads are applied simultaneously with their maximum value allowed (limit load). This circumstance normally does not occur in the wind tunnel. However, if it occurs, is the balance capable of handling the loads with an acceptable factor of safety? LaRC Balance 1621 was modeled and meshed in PATRAN for analysis in NASTRAN. For a complete analysis, it is necessary to consider all the load cases as well as use dense mesh near all the edges. Because of computer limitations, it is not possible to have one model with the dense mesh near all edges. In the present study, a dense mesh is limited to the surface corners where the cage and axial sections meet. Four different load combinations are used for the current analysis. Linear analysis is performed for each load case. In the case where the stress value is above linear elastic region, it is necessary to perform nonlinear analysis. It is also important to investigate the variables limiting the structural integrity of the balances. In order to investigate the possibility of modifying the existing balances to enhance the structural integrity, some modifications are done on this balance. The structural integrity of the balance after modification is investigated.

  19. Integrating Multiple Evidence Sources to Predict Adverse Drug Reactions Based on a Systems Pharmacology Model

    PubMed Central

    Cao, D-S; Xiao, N; Li, Y-J; Zeng, W-B; Liang, Y-Z; Lu, A-P; Xu, Q-S; Chen, AF

    2015-01-01

    Identifying potential adverse drug reactions (ADRs) is critically important for drug discovery and public health. Here we developed a multiple evidence fusion (MEF) method for the large-scale prediction of drug ADRs that can handle both approved drugs and novel molecules. MEF is based on the similarity reference by collaborative filtering, and integrates multiple similarity measures from various data types, taking advantage of the complementarity in the data. We used MEF to integrate drug-related and ADR-related data from multiple levels, including the network structural data formed by known drug–ADR relationships for predicting likely unknown ADRs. On cross-validation, it obtains high sensitivity and specificity, substantially outperforming existing methods that utilize single or a few data types. We validated our prediction by their overlap with drug–ADR associations that are known in databases. The proposed computational method could be used for complementary hypothesis generation and rapid analysis of potential drug–ADR interactions. PMID:26451329

  20. Structure prediction of magnetosome-associated proteins

    PubMed Central

    Nudelman, Hila; Zarivach, Raz

    2014-01-01

    Magnetotactic bacteria (MTB) are Gram-negative bacteria that can navigate along geomagnetic fields. This ability is a result of a unique intracellular organelle, the magnetosome. These organelles are composed of membrane-enclosed magnetite (Fe3O4) or greigite (Fe3S4) crystals ordered into chains along the cell. Magnetosome formation, assembly, and magnetic nano-crystal biomineralization are controlled by magnetosome-associated proteins (MAPs). Most MAP-encoding genes are located in a conserved genomic region – the magnetosome island (MAI). The MAI appears to be conserved in all MTB that were analyzed so far, although the MAI size and organization differs between species. It was shown that MAI deletion leads to a non-magnetic phenotype, further highlighting its important role in magnetosome formation. Today, about 28 proteins are known to be involved in magnetosome formation, but the structures and functions of most MAPs are unknown. To reveal the structure–function relationship of MAPs we used bioinformatics tools in order to build homology models as a way to understand their possible role in magnetosome formation. Here we present a predicted 3D structural models’ overview for all known Magnetospirillum gryphiswaldense strain MSR-1 MAPs. PMID:24523717

  1. Crystal structure prediction of rigid molecules.

    PubMed

    Elking, Dennis M; Fusti-Molnar, Laszlo; Nichols, Anthony

    2016-08-01

    A non-polarizable force field based on atomic multipoles fit to reproduce experimental crystal properties and ab initio gas-phase dimers is described. The Ewald method is used to calculate both long-range electrostatic and 1/r(6) dispersion energies of crystals. The dispersion energy of a crystal calculated by a cutoff method is shown to converge slowly to the exact Ewald result. A method for constraining space-group symmetry during unit-cell optimization is derived. Results for locally optimizing 4427 unit cells including volume, cell parameters, unit-cell r.m.s.d. and CPU timings are given for both flexible and rigid molecule optimization. An algorithm for randomly generating rigid molecule crystals is described. Using the correct experimentally determined space group, the average and maximum number of random crystals needed to find the correct experimental structure is given for 2440 rigid single component crystals. The force field energy rank of the correct experimental structure is presented for the same set of 2440 rigid single component crystals assuming the correct space group. A complete crystal prediction is performed for two rigid molecules by searching over the 32 most probable space groups.

  2. Air Vehicles Technology Integration Program (AVTIP). Delivery Order 0020: Prediction of Manufacturing Tolerances for Laminar Flow

    DTIC Science & Technology

    2005-06-01

    AFRL-VA-WP-TR-2005-3060 AIR VEHICLES TECHNOLOGY INTEGRATION PROGRAM (AVTIP) Delivery Order 0020 : Prediction Of... Technology Integration Program (AVTIP) 5b. GRANT NUMBER Delivery Order 0020 : Prediction Of Manufacturing Tolerances For Laminar Flow 5c. PROGRAM

  3. Integrated support structure for GASCAN 2

    NASA Technical Reports Server (NTRS)

    1990-01-01

    The focus of the Worcester Polytechnic Institute (WPI) Advanced Space Design Program was the preliminary design of the Integrated Support Structure for GASCAN II, a Get Away Special canister donated by the MITRE Corporation. Two teams of three students each worked on the support structure. There was a structural design team and a thermal design team. The structure will carry three experiments also undergoing preliminary design this year, the mu-gravity Ignition Experiment, the Rotational Flow in Low Gravity Experiment, and the Ionospheric Properties and Propagation Experiment. The structural design team was responsible for the layout of the GASCAN and the preliminary design of the structure itself. They produced the physical interface specifications defining the baseline weights and volumes for the equipment and produced layout drawings of the system. The team produced static and modal finite element analysis of the structure using ANSYS. The thermal design team was responsible for the power and timing requirements of the payload and for the identification and preliminary analysis of potential thermal problems. The team produced the power, timing, and energy interface specifications and assisted in the development of the specification of the battery pack. The thermal parameters of each experiment were cataloged and the experiments were subjected to worst case heat transfer scenarios.

  4. Crystal Structure Prediction for Cyclotrimethylene Trinitramine (RDX) from First Principles

    DTIC Science & Technology

    2009-04-01

    REPORT Crystal structure prediction for cyclotrimethylene trinitramine (RDX) from ?rst principles 14. ABSTRACT 16. SECURITY CLASSIFICATION OF: Crystal... structure prediction and molecular dynamics methods were applied to the cyclotrimethylene trinitramine (RDX) crystal to explore the stability rankings...500 high-density structures resulting from molecular packing were minimized and the 14 lowest-energy structures were subjected to isothermal

  5. Integrated uncertainty assessment of flow predictions in a Swiss catchment

    NASA Astrophysics Data System (ADS)

    Honti, M.; Stamm, C.; Reichert, P.

    2012-04-01

    Despite the vivid scientific debate on the suitability of RCM predictions for hydrological forecasting, impact studies relying on climatic input data and hydrological models are still the exclusive methods to provide some insight into the expected evolution of streams in the close future. While the climatic uncertainty is usually considered being dominant in such studies, more and more sophisticated uncertainty assessment methods reveal that the uncertainty of our hydrological models has been systematically underestimated by inappropriate assessment methods and that our predictive power for the present conditions can be as weak as it was considered for the future. The integrated treatment of various uncertainty sources allows us to quantify the overall predictive uncertainty for such studies and to decide if the anticipated impacts are relevant compared to the existing uncertainty. The Mönchaltorfer Aa catchment (46 km2) in Switzerland was modelled as a case study. A conceptual rainfall-runoff model was calibrated on measured discharge data with Bayesian parameter inference assuming a statistical error process that can account for various uncertainty sources. Climatic input data were produced by statistical downscaling from the outputs of 10 ENSEMBLES GCM-RCM model chains for the A1B emission scenario with the time horizon of 2050. Hourly rainfall data were produced with the Neyman-Scott rectangular pulses model (Rodriguez-Iturbe et al. 1987) while other weather parameters were generated on daily scale with the UKCP09 weather generator (Murphy et al. 2009). Expected landuse changes were assessed by creating divergent regional storylines from countrywide socio-economic scenarios. Despite the good performance of the hydrological model (Nash-Sutcliffe =0.8), its total predictive uncertainty was significant even for the present conditions. Due to the significant contribution of input uncertainty, individual flood peaks could be predicted with poor confidence. However

  6. Structural integrity of future aging airplanes

    NASA Technical Reports Server (NTRS)

    Mcguire, Jack F.; Goranson, Ulf G.

    1992-01-01

    A multitude of design considerations is involved in ensuring the structural integrity of Boeing jet transports that have common design concepts validated by extensive analyses, tests, and three decades of service. As airplanes approach their design service objectives, the incidences of fatigue and corrosion may become widespread. Continuing airworthiness of the aging jet fleet requires diligent performance from the manufacturer, the airlines, and airworthiness authorities. Aging fleet support includes timely development of supplemental structural inspection documents applicable to selected older airplanes, teardown inspections of high-time airframes retired from service, fatigue testing of older airframes, and structural surveys of more than 130 airplanes operated throughout the world. Lessons learned from these activities are incorporated in service bulletin recommendations, production line modifications, and design manual updates. An overview of traditional Boeing fleet support activities and the anticipated benefits for future generations of commercial airplanes based on the continuous design improvement process are presented.

  7. An integrated uncertainty and ensemble-based data assimilation approach for improved operational streamflow predictions

    NASA Astrophysics Data System (ADS)

    He, M.; Hogue, T. S.; Margulis, S. A.; Franz, K. J.

    2012-03-01

    The current study proposes an integrated uncertainty and ensemble-based data assimilation framework (ICEA) and evaluates its viability in providing operational streamflow predictions via assimilating snow water equivalent (SWE) data. This step-wise framework applies a parameter uncertainty analysis algorithm (ISURF) to identify the uncertainty structure of sensitive model parameters, which is subsequently formulated into an Ensemble Kalman Filter (EnKF) to generate updated snow states for streamflow prediction. The framework is coupled to the US National Weather Service (NWS) snow and rainfall-runoff models. Its applicability is demonstrated for an operational basin of a western River Forecast Center (RFC) of the NWS. Performance of the framework is evaluated against existing operational baseline (RFC predictions), the stand-alone ISURF and the stand-alone EnKF. Results indicate that the ensemble-mean prediction of ICEA considerably outperforms predictions from the other three scenarios investigated, particularly in the context of predicting high flows (top 5th percentile). The ICEA streamflow ensemble predictions capture the variability of the observed streamflow well, however the ensemble is not wide enough to consistently contain the range of streamflow observations in the study basin. Our findings indicate that the ICEA has the potential to supplement the current operational (deterministic) forecasting method in terms of providing improved single-valued (e.g., ensemble mean) streamflow predictions as well as meaningful ensemble predictions.

  8. An integrated uncertainty and ensemble-based data assimilation approach for improved operational streamflow predictions

    NASA Astrophysics Data System (ADS)

    He, M.; Hogue, T. S.; Margulis, S. A.; Franz, K. J.

    2011-08-01

    The current study proposes an integrated uncertainty and ensemble-based data assimilation framework (ICEA) and evaluates its viability in providing operational streamflow predictions via assimilating snow water equivalent (SWE) data. This step-wise framework applies a parameter uncertainty analysis algorithm (ISURF) to identify the uncertainty structure of sensitive model parameters, which is subsequently formulated into an Ensemble Kalman Filter (EnKF) to generate updated snow states for streamflow prediction. The framework is coupled to the US National Weather Service (NWS) snow and rainfall-runoff models. Its applicability is demonstrated for an operational basin of a western River Forecast Center (RFC) of the NWS. Performance of the framework is evaluated against existing operational baseline (RFC predictions), the stand-alone ISURF, and the stand-alone EnKF. Results indicate that the ensemble-mean prediction of ICEA considerably outperforms predictions from the other three scenarios investigated, particularly in the context of predicting high flows (top 5th percentile). The ICEA streamflow ensemble predictions capture the variability of the observed streamflow well, however the ensemble is not wide enough to consistently contain the range of streamflow observations in the study basin. Our findings indicate that the ICEA has the potential to supplement the current operational (deterministic) forecasting method in terms of providing improved single-valued (e.g., ensemble mean) streamflow predictions as well as meaningful ensemble predictions.

  9. Integrated design of structures, controls, and materials

    NASA Technical Reports Server (NTRS)

    Blankenship, G. L.

    1994-01-01

    In this talk we shall discuss algorithms and CAD tools for the design and analysis of structures for high performance applications using advanced composite materials. An extensive mathematical theory for optimal structural (e.g., shape) design was developed over the past thirty years. Aspects of this theory have been used in the design of components for hypersonic vehicles and thermal diffusion systems based on homogeneous materials. Enhancement of the design methods to include optimization of the microstructure of the component is a significant innovation which can lead to major enhancements in component performance. Our work is focused on the adaptation of existing theories of optimal structural design (e.g., optimal shape design) to treat the design of structures using advanced composite materials (e.g., fiber reinforced, resin matrix materials). In this talk we shall discuss models and algorithms for the design of simple structures from composite materials, focussing on a problem in thermal management. We shall also discuss methods for the integration of active structural controls into the design process.

  10. Integrated Aeromechanics with Three-Dimensional Solid-Multibody Structures

    NASA Technical Reports Server (NTRS)

    Datta, Anubhav; Johnson, Wayne

    2014-01-01

    A full three-dimensional finite element-multibody structural dynamic solver is coupled to a three-dimensional Reynolds-averaged Navier-Stokes solver for the prediction of integrated aeromechanical stresses and strains on a rotor blade in forward flight. The objective is to lay the foundations of all major pieces of an integrated three-dimensional rotor dynamic analysis - from model construction to aeromechanical solution to stress/strain calculation. The primary focus is on the aeromechanical solution. Two types of three-dimensional CFD/CSD interfaces are constructed for this purpose with an emphasis on resolving errors from geometry mis-match so that initial-stage approximate structural geometries can also be effectively analyzed. A three-dimensional structural model is constructed as an approximation to a UH-60A-like fully articulated rotor. The aerodynamic model is identical to the UH-60A rotor. For preliminary validation measurements from a UH-60A high speed flight is used where CFD coupling is essential to capture the advancing side tip transonic effects. The key conclusion is that an integrated aeromechanical analysis is indeed possible with three-dimensional structural dynamics but requires a careful description of its geometry and discretization of its parts.

  11. Self assembled structures for 3D integration

    NASA Astrophysics Data System (ADS)

    Rao, Madhav

    Three dimensional (3D) micro-scale structures attached to a silicon substrate have various applications in microelectronics. However, formation of 3D structures using conventional micro-fabrication techniques are not efficient and require precise control of processing parameters. Self assembly is a method for creating 3D structures that takes advantage of surface area minimization phenomena. Solder based self assembly (SBSA), the subject of this dissertation, uses solder as a facilitator in the formation of 3D structures from 2D patterns. Etching a sacrificial layer underneath a portion of the 2D pattern allows the solder reflow step to pull those areas out of the substrate plane resulting in a folded 3D structure. Initial studies using the SBSA method demonstrated low yields in the formation of five different polyhedra. The failures in folding were primarily attributed to nonuniform solder deposition on the underlying metal pads. The dip soldering method was analyzed and subsequently refined. A modified dip soldering process provided improved yield among the polyhedra. Solder bridging referred as joining of solder deposited on different metal patterns in an entity influenced the folding mechanism. In general, design parameters such as small gap-spacings and thick metal pads were found to favor solder bridging for all patterns studied. Two types of soldering: face and edge soldering were analyzed. Face soldering refers to the application of solder on the entire metal face. Edge soldering indicates application of solder only on the edges of the metal face. Mechanical grinding showed that face soldered SBSA structures were void free and robust in nature. In addition, the face soldered 3D structures provide a consistent heat resistant solder standoff height that serve as attachments in the integration of dissimilar electronic technologies. Face soldered 3D structures were developed on the underlying conducting channel to determine the thermo-electric reliability of

  12. Atomic vapor spectroscopy in integrated photonic structures

    SciTech Connect

    Ritter, Ralf; Kübler, Harald; Pfau, Tilman; Löw, Robert; Gruhler, Nico; Pernice, Wolfram

    2015-07-27

    We investigate an integrated optical chip immersed in atomic vapor providing several waveguide geometries for spectroscopy applications. The narrow-band transmission through a silicon nitride waveguide and interferometer is altered when the guided light is coupled to a vapor of rubidium atoms via the evanescent tail of the waveguide mode. We use grating couplers to couple between the waveguide mode and the radiating wave, which allow for addressing arbitrary coupling positions on the chip surface. The evanescent atom-light interaction can be numerically simulated and shows excellent agreement with our experimental data. This work demonstrates a next step towards miniaturization and integration of alkali atom spectroscopy and provides a platform for further fundamental studies of complex waveguide structures.

  13. iStable: off-the-shelf predictor integration for predicting protein stability changes

    PubMed Central

    2013-01-01

    Background Mutation of a single amino acid residue can cause changes in a protein, which could then lead to a loss of protein function. Predicting the protein stability changes can provide several possible candidates for the novel protein designing. Although many prediction tools are available, the conflicting prediction results from different tools could cause confusion to users. Results We proposed an integrated predictor, iStable, with grid computing architecture constructed by using sequence information and prediction results from different element predictors. In the learning model, several machine learning methods were evaluated and adopted the support vector machine as an integrator, while not just choosing the majority answer given by element predictors. Furthermore, the role of the sequence information played was analyzed in our model, and an 11-window size was determined. On the other hand, iStable is available with two different input types: structural and sequential. After training and cross-validation, iStable has better performance than all of the element predictors on several datasets. Under different classifications and conditions for validation, this study has also shown better overall performance in different types of secondary structures, relative solvent accessibility circumstances, protein memberships in different superfamilies, and experimental conditions. Conclusions The trained and validated version of iStable provides an accurate approach for prediction of protein stability changes. iStable is freely available online at: http://predictor.nchu.edu.tw/iStable. PMID:23369171

  14. High Cycle Fatigue Prediction for Mistuned Bladed Disks with Fully Coupled Fluid-Structural Interaction

    DTIC Science & Technology

    2006-06-01

    vibration and flutter boundary of 2D NACA 64A010 transonic airfoil, 3D plate wing structural response. The predicted results agree well with benchmark...CFD code coupled with a structural integrator based on the convolution integral to obtain the flutter boundary for a NACA 64A010 airfoil[10]. Alonso and...validation case of the scheme for moving grid system, the forced pitching NACA 64A010 airfoil is calculated. For this transonic airfoil, the Reynolds

  15. Challenges for the aircraft structural integrity program

    NASA Technical Reports Server (NTRS)

    Lincoln, John W.

    1994-01-01

    Thirty-six years ago the United States Air Force established the USAF Aircraft Structural Integrity Program (ASIP) because flight safety had been degraded by fatigue failures of operational aircraft. This initial program evolved, but has been stable since the issuance of MIL-STD-1530A in 1975. Today, the program faces new challenges because of a need to maintain aircraft longer in an environment of reduced funding levels. Also, there is increased pressure to reduce cost of the acquisition of new aircraft. It is the purpose of this paper to discuss the challenges for the ASIP and identify the changes in the program that will meet these challenges in the future.

  16. Dynamic kirigami structures for integrated solar tracking.

    PubMed

    Lamoureux, Aaron; Lee, Kyusang; Shlian, Matthew; Forrest, Stephen R; Shtein, Max

    2015-09-08

    Optical tracking is often combined with conventional flat panel solar cells to maximize electrical power generation over the course of a day. However, conventional trackers are complex and often require costly and cumbersome structural components to support system weight. Here we use kirigami (the art of paper cutting) to realize novel solar cells where tracking is integral to the structure at the substrate level. Specifically, an elegant cut pattern is made in thin-film gallium arsenide solar cells, which are then stretched to produce an array of tilted surface elements which can be controlled to within ±1°. We analyze the combined optical and mechanical properties of the tracking system, and demonstrate a mechanically robust system with optical tracking efficiencies matching conventional trackers. This design suggests a pathway towards enabling new applications for solar tracking, as well as inspiring a broader range of optoelectronic and mechanical devices.

  17. Dynamic kirigami structures for integrated solar tracking

    PubMed Central

    Lamoureux, Aaron; Lee, Kyusang; Shlian, Matthew; Forrest, Stephen R.; Shtein, Max

    2015-01-01

    Optical tracking is often combined with conventional flat panel solar cells to maximize electrical power generation over the course of a day. However, conventional trackers are complex and often require costly and cumbersome structural components to support system weight. Here we use kirigami (the art of paper cutting) to realize novel solar cells where tracking is integral to the structure at the substrate level. Specifically, an elegant cut pattern is made in thin-film gallium arsenide solar cells, which are then stretched to produce an array of tilted surface elements which can be controlled to within ±1°. We analyze the combined optical and mechanical properties of the tracking system, and demonstrate a mechanically robust system with optical tracking efficiencies matching conventional trackers. This design suggests a pathway towards enabling new applications for solar tracking, as well as inspiring a broader range of optoelectronic and mechanical devices. PMID:26348820

  18. Dynamic kirigami structures for integrated solar tracking

    NASA Astrophysics Data System (ADS)

    Lamoureux, Aaron; Lee, Kyusang; Shlian, Matthew; Forrest, Stephen R.; Shtein, Max

    2015-09-01

    Optical tracking is often combined with conventional flat panel solar cells to maximize electrical power generation over the course of a day. However, conventional trackers are complex and often require costly and cumbersome structural components to support system weight. Here we use kirigami (the art of paper cutting) to realize novel solar cells where tracking is integral to the structure at the substrate level. Specifically, an elegant cut pattern is made in thin-film gallium arsenide solar cells, which are then stretched to produce an array of tilted surface elements which can be controlled to within +/-1°. We analyze the combined optical and mechanical properties of the tracking system, and demonstrate a mechanically robust system with optical tracking efficiencies matching conventional trackers. This design suggests a pathway towards enabling new applications for solar tracking, as well as inspiring a broader range of optoelectronic and mechanical devices.

  19. Information theory provides a comprehensive framework for the evaluation of protein structure predictions

    PubMed Central

    Swanson, Rosemarie; Vannucci, Marina; Tsai, Jerry W.

    2008-01-01

    Protein structure prediction has a number of important ad hoc similarity measures for evaluating predictions, but would benefit from a measure that is able to provide a common framework for a broad range of comparisons. Here we show that a mutual information-like measure can provide a comprehensive framework for evaluating protein structure prediction of all types. We discuss the concept of information, its application to secondary structure, and the obstacle to applying it to 3D structure. Based on insights from the secondary structure case, we present an approach to work around the 3D difficulties, and develop a method to measure the mutual information provided by a 3D structure prediction. We integrate the evaluation of all types of protein structure prediction into a single frame work, and compare the amount of information provided by various prediction methods, including secondary structure prediction. Within this broadened framework, the idea that structure is better preserved than sequence during evolution is evaluated quantitatively for the globin family. A nearly perfect sequence match in the globin family corresponds to about 300 bits of information, whereas a nearly perfect structural match for the same two proteins corresponds to about 2500 bits of information, where bits of information describes the probability of obtaining a match of similar closeness by chance. Mutual information provides both a theoretical basis for evaluating structure similarity and an explanatory surround for existing similarity measures. PMID:18704942

  20. Developing a comprehensive training curriculum for integrated predictive maintenance

    NASA Astrophysics Data System (ADS)

    Wurzbach, Richard N.

    2002-03-01

    On-line equipment condition monitoring is a critical component of the world-class production and safety histories of many successful nuclear plant operators. From addressing availability and operability concerns of nuclear safety-related equipment to increasing profitability through support system reliability and reduced maintenance costs, Predictive Maintenance programs have increasingly become a vital contribution to the maintenance and operation decisions of nuclear facilities. In recent years, significant advancements have been made in the quality and portability of many of the instruments being used, and software improvements have been made as well. However, the single most influential component of the success of these programs is the impact of a trained and experienced team of personnel putting this technology to work. Changes in the nature of the power generation industry brought on by competition, mergers, and acquisitions, has taken the historically stable personnel environment of power generation and created a very dynamic situation. As a result, many facilities have seen a significant turnover in personnel in key positions, including predictive maintenance personnel. It has become the challenge for many nuclear operators to maintain the consistent contribution of quality data and information from predictive maintenance that has become important in the overall equipment decision process. These challenges can be met through the implementation of quality training to predictive maintenance personnel and regular updating and re-certification of key technology holders. The use of data management tools and services aid in the sharing of information across sites within an operating company, and with experts who can contribute value-added data management and analysis. The overall effectiveness of predictive maintenance programs can be improved through the incorporation of newly developed comprehensive technology training courses. These courses address the use of

  1. Statistical energy analysis response prediction methods for structural systems

    NASA Technical Reports Server (NTRS)

    Davis, R. F.

    1979-01-01

    The results of an effort to document methods for accomplishing response predictions for commonly encountered aerospace structural configurations is presented. Application of these methods to specified aerospace structure to provide sample analyses is included. An applications manual, with the structural analyses appended as example problems is given. Comparisons of the response predictions with measured data are provided for three of the example problems.

  2. RNA-SSPT: RNA Secondary Structure Prediction Tools

    PubMed Central

    Ahmad, Freed; Mahboob, Shahid; Gulzar, Tahsin; din, Salah U; Hanif, Tanzeela; Ahmad, Hifza; Afzal, Muhammad

    2013-01-01

    The prediction of RNA structure is useful for understanding evolution for both in silico and in vitro studies. Physical methods like NMR studies to predict RNA secondary structure are expensive and difficult. Computational RNA secondary structure prediction is easier. Comparative sequence analysis provides the best solution. But secondary structure prediction of a single RNA sequence is challenging. RNA-SSPT is a tool that computationally predicts secondary structure of a single RNA sequence. Most of the RNA secondary structure prediction tools do not allow pseudoknots in the structure or are unable to locate them. Nussinov dynamic programming algorithm has been implemented in RNA-SSPT. The current studies shows only energetically most favorable secondary structure is required and the algorithm modification is also available that produces base pairs to lower the total free energy of the secondary structure. For visualization of RNA secondary structure, NAVIEW in C language is used and modified in C# for tool requirement. RNA-SSPT is built in C# using Dot Net 2.0 in Microsoft Visual Studio 2005 Professional edition. The accuracy of RNA-SSPT is tested in terms of Sensitivity and Positive Predicted Value. It is a tool which serves both secondary structure prediction and secondary structure visualization purposes. PMID:24250115

  3. Reactor pressure vessel structural integrity research

    SciTech Connect

    Pennell, W.E.; Corwin, W.R.

    1995-04-01

    Development continues on the technology used to assess the safety of irradiation-embrittled nuclear reactor pressure vessels (RPVs) containing flaws. Fracture mechanics tests on RPV steel, coupled with detailed elastic-plastic finite-element analyses of the crack-tip stress fields, have shown that (1) constraint relaxation at the crack tip of shallows surface flaws results in increased data scatter but no increase in the lower-bound fracture toughness, (2) the nil ductility temperature (NDT) performs better than the reference temperature for nil ductility transition (RT{sub NDT}) as a normalizing parameter for shallow-flaw fracture toughness data, (3) biaxial loading can reduce the shallow-flaw fracture toughness, (4) stress-based dual-parameter fracture toughness correlations cannot predict the effect of biaxial loading on a shallow-flaw fracture toughness because in-plane stresses at the crack tip are not influenced by biaxial loading, and (5) an implicit strain-based dual-parameter fracture toughness correlation can predict the effect of biaxial loading on shallow-flaw fracture toughness. Experimental irradiation investigations have shown that (1) the irradiation-induced shift in Charpy V-notch vs temperature behavior may not be adequate to conservatively assess fracture toughness shifts due to embrittlement, and (2) the wide global variations of initial chemistry and fracture properties of a nominally uniform material within a pressure vessel may confound accurate integrity assessments that require baseline properties.

  4. Structural integrity of engineering composite materials: a cracking good yarn.

    PubMed

    Beaumont, Peter W R; Soutis, Costas

    2016-07-13

    Predicting precisely where a crack will develop in a material under stress and exactly when in time catastrophic fracture of the component will occur is one the oldest unsolved mysteries in the design and building of large-scale engineering structures. Where human life depends upon engineering ingenuity, the burden of testing to prove a 'fracture safe design' is immense. Fitness considerations for long-life implementation of large composite structures include understanding phenomena such as impact, fatigue, creep and stress corrosion cracking that affect reliability, life expectancy and durability of structure. Structural integrity analysis treats the design, the materials used, and figures out how best components and parts can be joined, and takes service duty into account. However, there are conflicting aims in the complete design process of designing simultaneously for high efficiency and safety assurance throughout an economically viable lifetime with an acceptable level of risk. This article is part of the themed issue 'Multiscale modelling of the structural integrity of composite materials'.

  5. Structural integrity of engineering composite materials: a cracking good yarn

    PubMed Central

    Beaumont, Peter W. R.

    2016-01-01

    Predicting precisely where a crack will develop in a material under stress and exactly when in time catastrophic fracture of the component will occur is one the oldest unsolved mysteries in the design and building of large-scale engineering structures. Where human life depends upon engineering ingenuity, the burden of testing to prove a ‘fracture safe design’ is immense. Fitness considerations for long-life implementation of large composite structures include understanding phenomena such as impact, fatigue, creep and stress corrosion cracking that affect reliability, life expectancy and durability of structure. Structural integrity analysis treats the design, the materials used, and figures out how best components and parts can be joined, and takes service duty into account. However, there are conflicting aims in the complete design process of designing simultaneously for high efficiency and safety assurance throughout an economically viable lifetime with an acceptable level of risk. This article is part of the themed issue ‘Multiscale modelling of the structural integrity of composite materials’. PMID:27242293

  6. A Predictive Structural Model of the Primate Connectome

    PubMed Central

    Beul, Sarah F.; Barbas, Helen; Hilgetag, Claus C.

    2017-01-01

    Anatomical connectivity imposes strong constraints on brain function, but there is no general agreement about principles that govern its organization. Based on extensive quantitative data, we tested the power of three factors to predict connections of the primate cerebral cortex: architectonic similarity (structural model), spatial proximity (distance model) and thickness similarity (thickness model). Architectonic similarity showed the strongest and most consistent influence on connection features. This parameter was strongly associated with the presence or absence of inter-areal connections and when integrated with spatial distance, the factor allowed predicting the existence of projections with very high accuracy. Moreover, architectonic similarity was strongly related to the laminar pattern of projection origins, and the absolute number of cortical connections of an area. By contrast, cortical thickness similarity and distance were not systematically related to connection features. These findings suggest that cortical architecture provides a general organizing principle for connections in the primate brain, providing further support for the well-corroborated structural model. PMID:28256558

  7. I-TASSER: a unified platform for automated protein structure and function prediction.

    PubMed

    Roy, Ambrish; Kucukural, Alper; Zhang, Yang

    2010-04-01

    The iterative threading assembly refinement (I-TASSER) server is an integrated platform for automated protein structure and function prediction based on the sequence-to-structure-to-function paradigm. Starting from an amino acid sequence, I-TASSER first generates three-dimensional (3D) atomic models from multiple threading alignments and iterative structural assembly simulations. The function of the protein is then inferred by structurally matching the 3D models with other known proteins. The output from a typical server run contains full-length secondary and tertiary structure predictions, and functional annotations on ligand-binding sites, Enzyme Commission numbers and Gene Ontology terms. An estimate of accuracy of the predictions is provided based on the confidence score of the modeling. This protocol provides new insights and guidelines for designing of online server systems for the state-of-the-art protein structure and function predictions. The server is available at http://zhanglab.ccmb.med.umich.edu/I-TASSER.

  8. Integrated hydro-bacterial modelling for predicting bathing water quality

    NASA Astrophysics Data System (ADS)

    Huang, Guoxian; Falconer, Roger A.; Lin, Binliang

    2017-03-01

    In recent years health risks associated with the non-compliance of bathing water quality have received increasing worldwide attention. However, it is particularly challenging to establish the source of any non-compliance, due to the complex nature of the source of faecal indicator organisms, and the fate and delivery processes and scarcity of field measured data in many catchments and estuaries. In the current study an integrated hydro-bacterial model, linking a catchment, 1-D model and 2-D model were integrated to simulate the adsorption-desorption processes of faecal bacteria to and from sediment particles in river, estuarine and coastal waters, respectively. The model was then validated using hydrodynamic, sediment and faecal bacteria concentration data, measured in 2012, in the Ribble river and estuary, and along the Fylde coast, UK. Particular emphasis has been placed on the mechanism of faecal bacteria transport and decay through the deposition and resuspension of suspended sediments. The results showed that by coupling the E.coli concentration with the sediment transport processes, the accuracy of the predicted E.coli levels was improved. A series of scenario runs were then carried out to investigate the impacts of different management scenarios on the E.coli concentration levels in the coastal bathing water sites around Liverpool Bay, UK. The model results show that the level of compliance with the new EU bathing water standards can be improved significantly by extending outfalls and/or reducing urban sources by typically 50%.

  9. Cluster and Integral In-Orbit Solar Array Performance Prediction

    NASA Astrophysics Data System (ADS)

    d'Accolti, Gianfelice; Gonzalez, Jose Ramon; Taylor, Stephen; Escoubet, Philippe; Volpp, Juergen; Southworth, Richard; Bordoni, Emanuela

    2014-08-01

    Solar array in-orbit performance prediction is a key point to allow the extension of a mission, especially when margins of few watts are of paramount importance to keep working instruments relevant to its continuation. This is the case of the four Cluster satellites whose mission survival was depending on 10 to 15 Watts, a quantity normally neglected or absorbed in the simulation error. This verification was carried out after the first 12 years in orbit, with the aim of requesting a mission extension up to 2017. In order to verify if the solar array could deliver the requested power to satisfy the mission needs, ESA's Solar Generator Section reviewed its performance at a very detailed level. The approach followed produced four cases with different levels of probability. With this method, the data retrieved from the telemetry have been fitted with a very high degree of accuracy. The approach followed for Integral is slightly different. In this case the orbit is quite different, very eccentric and with a low perigee that crosses the trapped particle belts at some periods during the orbital evolution. The main implication of this fact lies in the higher doses of radiation and in the difficulty of making a reliable prediction. This situation has been overcome by assuming safety margins for the radiation dose to ensure the operation of solar array under the mission request.

  10. Model Predictive Control of Integrated Gasification Combined Cycle Power Plants

    SciTech Connect

    B. Wayne Bequette; Priyadarshi Mahapatra

    2010-08-31

    The primary project objectives were to understand how the process design of an integrated gasification combined cycle (IGCC) power plant affects the dynamic operability and controllability of the process. Steady-state and dynamic simulation models were developed to predict the process behavior during typical transients that occur in plant operation. Advanced control strategies were developed to improve the ability of the process to follow changes in the power load demand, and to improve performance during transitions between power levels. Another objective of the proposed work was to educate graduate and undergraduate students in the application of process systems and control to coal technology. Educational materials were developed for use in engineering courses to further broaden this exposure to many students. ASPENTECH software was used to perform steady-state and dynamic simulations of an IGCC power plant. Linear systems analysis techniques were used to assess the steady-state and dynamic operability of the power plant under various plant operating conditions. Model predictive control (MPC) strategies were developed to improve the dynamic operation of the power plants. MATLAB and SIMULINK software were used for systems analysis and control system design, and the SIMULINK functionality in ASPEN DYNAMICS was used to test the control strategies on the simulated process. Project funds were used to support a Ph.D. student to receive education and training in coal technology and the application of modeling and simulation techniques.

  11. A comprehensive comparison of comparative RNA structure prediction approaches

    PubMed Central

    Gardner, Paul P; Giegerich, Robert

    2004-01-01

    Background An increasing number of researchers have released novel RNA structure analysis and prediction algorithms for comparative approaches to structure prediction. Yet, independent benchmarking of these algorithms is rarely performed as is now common practice for protein-folding, gene-finding and multiple-sequence-alignment algorithms. Results Here we evaluate a number of RNA folding algorithms using reliable RNA data-sets and compare their relative performance. Conclusions We conclude that comparative data can enhance structure prediction but structure-prediction-algorithms vary widely in terms of both sensitivity and selectivity across different lengths and homologies. Furthermore, we outline some directions for future research. PMID:15458580

  12. PROSPER: An Integrated Feature-Based Tool for Predicting Protease Substrate Cleavage Sites

    PubMed Central

    Perry, Andrew J.; Akutsu, Tatsuya; Webb, Geoffrey I.; Whisstock, James C.; Pike, Robert N.

    2012-01-01

    The ability to catalytically cleave protein substrates after synthesis is fundamental for all forms of life. Accordingly, site-specific proteolysis is one of the most important post-translational modifications. The key to understanding the physiological role of a protease is to identify its natural substrate(s). Knowledge of the substrate specificity of a protease can dramatically improve our ability to predict its target protein substrates, but this information must be utilized in an effective manner in order to efficiently identify protein substrates by in silico approaches. To address this problem, we present PROSPER, an integrated feature-based server for in silico identification of protease substrates and their cleavage sites for twenty-four different proteases. PROSPER utilizes established specificity information for these proteases (derived from the MEROPS database) with a machine learning approach to predict protease cleavage sites by using different, but complementary sequence and structure characteristics. Features used by PROSPER include local amino acid sequence profile, predicted secondary structure, solvent accessibility and predicted native disorder. Thus, for proteases with known amino acid specificity, PROSPER provides a convenient, pre-prepared tool for use in identifying protein substrates for the enzymes. Systematic prediction analysis for the twenty-four proteases thus far included in the database revealed that the features we have included in the tool strongly improve performance in terms of cleavage site prediction, as evidenced by their contribution to performance improvement in terms of identifying known cleavage sites in substrates for these enzymes. In comparison with two state-of-the-art prediction tools, PoPS and SitePrediction, PROSPER achieves greater accuracy and coverage. To our knowledge, PROSPER is the first comprehensive server capable of predicting cleavage sites of multiple proteases within a single substrate sequence using

  13. Energy-Efficient Integration of Continuous Context Sensing and Prediction into Smartwatches.

    PubMed

    Rawassizadeh, Reza; Tomitsch, Martin; Nourizadeh, Manouchehr; Momeni, Elaheh; Peery, Aaron; Ulanova, Liudmila; Pazzani, Michael

    2015-09-08

    As the availability and use of wearables increases, they are becoming a promising platform for context sensing and context analysis. Smartwatches are a particularly interesting platform for this purpose, as they offer salient advantages, such as their proximity to the human body. However, they also have limitations associated with their small form factor, such as processing power and battery life, which makes it difficult to simply transfer smartphone-based context sensing and prediction models to smartwatches. In this paper, we introduce an energy-efficient, generic, integrated framework for continuous context sensing and prediction on smartwatches. Our work extends previous approaches for context sensing and prediction on wrist-mounted wearables that perform predictive analytics outside the device. We offer a generic sensing module and a novel energy-efficient, on-device prediction module that is based on a semantic abstraction approach to convert sensor data into meaningful information objects, similar to human perception of a behavior. Through six evaluations, we analyze the energy efficiency of our framework modules, identify the optimal file structure for data access and demonstrate an increase in accuracy of prediction through our semantic abstraction method. The proposed framework is hardware independent and can serve as a reference model for implementing context sensing and prediction on small wearable devices beyond smartwatches, such as body-mounted cameras.

  14. Energy-Efficient Integration of Continuous Context Sensing and Prediction into Smartwatches

    PubMed Central

    Rawassizadeh, Reza; Tomitsch, Martin; Nourizadeh, Manouchehr; Momeni, Elaheh; Peery, Aaron; Ulanova, Liudmila; Pazzani, Michael

    2015-01-01

    As the availability and use of wearables increases, they are becoming a promising platform for context sensing and context analysis. Smartwatches are a particularly interesting platform for this purpose, as they offer salient advantages, such as their proximity to the human body. However, they also have limitations associated with their small form factor, such as processing power and battery life, which makes it difficult to simply transfer smartphone-based context sensing and prediction models to smartwatches. In this paper, we introduce an energy-efficient, generic, integrated framework for continuous context sensing and prediction on smartwatches. Our work extends previous approaches for context sensing and prediction on wrist-mounted wearables that perform predictive analytics outside the device. We offer a generic sensing module and a novel energy-efficient, on-device prediction module that is based on a semantic abstraction approach to convert sensor data into meaningful information objects, similar to human perception of a behavior. Through six evaluations, we analyze the energy efficiency of our framework modules, identify the optimal file structure for data access and demonstrate an increase in accuracy of prediction through our semantic abstraction method. The proposed framework is hardware independent and can serve as a reference model for implementing context sensing and prediction on small wearable devices beyond smartwatches, such as body-mounted cameras. PMID:26370997

  15. Integrated in silico approaches for the prediction of Ames test mutagenicity

    NASA Astrophysics Data System (ADS)

    Modi, Sandeep; Li, Jin; Malcomber, Sophie; Moore, Claire; Scott, Andrew; White, Andrew; Carmichael, Paul

    2012-09-01

    The bacterial reverse mutation assay (Ames test) is a biological assay used to assess the mutagenic potential of chemical compounds. In this paper approaches for the development of an in silico mutagenicity screening tool are described. Three individual in silico models, which cover both structure activity relationship methods (SARs) and quantitative structure activity relationship methods (QSARs), were built using three different modelling techniques: (1) an in-house alert model: which uses SAR approach where alerts are generated based on experts judgements; (2) a kNN approach (k-Nearest Neighbours), which is a QSAR model where a prediction is given based on outcomes of its k chemical neighbours; (3) a naive Bayesian model (NB), which is another QSAR model, where a prediction is derived using a Bayesian formula through preselected identified informative chemical features (e.g., physico-chemical, structural descriptors). These in silico models, were compared against two well-known alert models (DEREK and ToxTree) and also against three different consensus approaches (Categorical Bayesian Integration Approach (CBI), Partial Least Squares Discriminate Analysis (PLS-DA) and simple majority vote approach). By applying these integration methods on the validation sets it was shown that both integration models (PLS-DA and CBI) achieved better performance than any of the individual models or consensus obtained by simple majority rule. In conclusion, the recommendation of this paper is that when obtaining consensus predictions for Ames mutagenicity, approaches like PLS-DA or CBI should be the first choice for the integration as compared to a simple majority vote approach.

  16. Integrated Force Method for Indeterminate Structures

    NASA Technical Reports Server (NTRS)

    Hopkins, Dale A.; Halford, Gary R.; Patnaik, Surya N.

    2008-01-01

    Two methods of solving indeterminate structural-mechanics problems have been developed as products of research on the theory of strain compatibility. In these methods, stresses are considered to be the primary unknowns (in contrast to strains and displacements being considered as the primary unknowns in some prior methods). One of these methods, denoted the integrated force method (IFM), makes it possible to compute stresses, strains, and displacements with high fidelity by use of modest finite-element models that entail relatively small amounts of computation. The other method, denoted the completed Beltrami Mitchell formulation (CBMF), enables direct determination of stresses in an elastic continuum with general boundary conditions, without the need to first calculate displacements as in traditional methods. The equilibrium equation, the compatibility condition, and the material law are the three fundamental concepts of the theory of structures. For almost 150 years, it has been commonly supposed that the theory is complete. However, until now, the understanding of the compatibility condition remained incomplete, and the compatibility condition was confused with the continuity condition. Furthermore, the compatibility condition as applied to structures in its previous incomplete form was inconsistent with the strain formulation in elasticity.

  17. Enhanced Composites Integrity Through Structural Health Monitoring

    NASA Astrophysics Data System (ADS)

    Giurgiutiu, Victor; Soutis, Constantinos

    2012-10-01

    This paper discusses the topic of how the integrity of safety-critical structural composites can be enhanced by the use of structural health monitoring (SHM) techniques. The paper starts with a presentation of how the certification of flight-critical composite structures can be achieved within the framework of civil aviation safety authority requirements. Typical composites damage mechanisms, which make this process substantially different from that for metallic materials are discussed. The opportunities presented by the use of SHM techniques in future civil aircraft developments are explained. The paper then focuses on active SHM with piezoelectric wafer active sensors (PWAS). After reviewing the PWAS-based SHM options, the paper follows with a discussion of the specifics of guided wave propagation in composites and PWAS-tuning effects. The paper presents a number of experimental results for damage detection in simple flat unidirectional and quasi-isotropic composite specimens. Calibrated through holes of increasing diameter and impact damage of various energies and velocities are considered. The paper ends with conclusions and suggestions for further work.

  18. On the significance of an RNA tertiary structure prediction

    PubMed Central

    Hajdin, Christine E.; Ding, Feng; Dokholyan, Nikolay V.; Weeks, Kevin M.

    2010-01-01

    Tertiary structure prediction is important for understanding structure–function relationships for RNAs whose structures are unknown and for characterizing RNA states recalcitrant to direct analysis. However, it is unknown what root-mean-square deviation (RMSD) corresponds to a statistically significant RNA tertiary structure prediction. We use discrete molecular dynamics to generate RNA-like folds for structures up to 161 nucleotides (nt) that have complex tertiary interactions and then determine the RMSD distribution between these decoys. These distributions are Gaussian-like. The mean RMSD increases with RNA length and is smaller if secondary structure constraints are imposed while generating decoys. The compactness of RNA molecules with true tertiary folds is intermediate between closely packed spheres and a freely jointed chain. We use this scaling relationship to define an expression relating RMSD with the confidence that a structure prediction is better than that expected by chance. This is the prediction significance, and corresponds to a P-value. For a 100-nt RNA, the RMSD of predicted structures should be within 25 Å of the accepted structure to reach the P ≤ 0.01 level if the secondary structure is predicted de novo and within 14 Å if secondary structure information is used as a constraint. This significance approach should be useful for evaluating diverse RNA structure prediction and molecular modeling algorithms. PMID:20498460

  19. Predicting crystal structure by merging data mining with quantum mechanics.

    PubMed

    Fischer, Christopher C; Tibbetts, Kevin J; Morgan, Dane; Ceder, Gerbrand

    2006-08-01

    Modern methods of quantum mechanics have proved to be effective tools to understand and even predict materials properties. An essential element of the materials design process, relevant to both new materials and the optimization of existing ones, is knowing which crystal structures will form in an alloy system. Crystal structure can only be predicted effectively with quantum mechanics if an algorithm to direct the search through the large space of possible structures is found. We present a new approach to the prediction of structure that rigorously mines correlations embodied within experimental data and uses them to direct quantum mechanical techniques efficiently towards the stable crystal structure of materials.

  20. Attachment theory and theory of planned behavior: an integrative model predicting underage drinking.

    PubMed

    Lac, Andrew; Crano, William D; Berger, Dale E; Alvaro, Eusebio M

    2013-08-01

    Research indicates that peer and maternal bonds play important but sometimes contrasting roles in the outcomes of children. Less is known about attachment bonds to these 2 reference groups in young adults. Using a sample of 351 participants (18 to 20 years of age), the research integrated two theoretical traditions: attachment theory and theory of planned behavior (TPB). The predictive contribution of both theories was examined in the context of underage adult alcohol use. Using full structural equation modeling, results substantiated the hypotheses that secure peer attachment positively predicted norms and behavioral control toward alcohol, but secure maternal attachment inversely predicted attitudes and behavioral control toward alcohol. Alcohol attitudes, norms, and behavioral control each uniquely explained alcohol intentions, which anticipated an increase in alcohol behavior 1 month later. The hypothesized processes were statistically corroborated by tests of indirect and total effects. These findings support recommendations for programs designed to curtail risky levels of underage drinking using the tenets of attachment theory and TPB.

  1. Structural integrity of nuclear reactor pressure vessels

    NASA Astrophysics Data System (ADS)

    Knott, John F.

    2013-09-01

    The paper starts from concerns expressed by Sir Alan Cottrell, in the early 1970s, related to the safety of the pressurized water reactor (PWR) proposed at that time for the next phase of electrical power generation. It proceeds to describe the design and operation of nuclear generation plant and gives details of the manufacture of PWR reactor pressure vessels (RPVs). Attention is paid to stress-relief cracking and under-clad cracking, experienced with early RPVs, explaining the mechanisms for these forms of cracking and the means taken to avoid them. Particular note is made of the contribution of non-destructive inspection to structural integrity. Factors affecting brittle fracture in RPV steels are described: in particular, effects of neutron irradiation. The use of fracture mechanics to assess defect tolerance is explained, together with the failure assessment diagram embodied in the R6 procedure. There is discussion of the Master Curve and how it incorporates effects of irradiation on fracture toughness. Dangers associated with extrapolation of data to low probabilities are illustrated. The treatment of fatigue-crack growth is described, in the context of transients that may be experienced in the operation of PWR plant. Detailed attention is paid to the thermal shock associated with a large loss-of-coolant accident. The final section reviews the arguments advanced to justify 'Incredibility of Failure' and how these are incorporated in assessments of the integrity of existing plant and proposed 'new build' PWR pressure vessels.

  2. Integrated structural repair of a producing FPSO

    SciTech Connect

    Johnson, P.R.; Smith, T.A.

    1997-07-01

    The state of the art in FPSO design is advancing rapidly. The long-term reliability of FPSO systems has improved as maintenance issues, have received greater emphasis in both new-builds and conversions. Despite this new emphasis, problems will still arise and repairs will still be required. Ultimately, the ability of any FPSO to stay on location and on production will depend on the scope of repairs which can be economically performed in-situ. In 1994 and 1995, Marathon Petroleum Indonesia Limited (MPIL) performed an in-situ repair on the FPSO Kakap Natuna. The scope and complexity of this work suggests there are few, if any, limits on in-situ structural repairs which can be successfully performed on a producing FPSO. The use of an integrated execution strategy for the repairs greatly reduced their cost.

  3. Integral Airframe Structures (IAS): Validated Feasibility Study of Integrally Stiffened Metallic Fuselage Panels for Reducing Manufacturing Costs

    NASA Technical Reports Server (NTRS)

    Munroe, J.; Wilkins, K.; Gruber, M.; Domack, Marcia S. (Technical Monitor)

    2000-01-01

    The Integral Airframe Structures (IAS) program investigated the feasibility of using "integrally stiffened" construction for commercial transport fuselage structure. The objective of the program was to demonstrate structural performance and weight equal to current "built-up" structure with lower manufacturing cost. Testing evaluated mechanical properties, structural details, joint performance, repair, static compression, and two-bay crack residual strength panels. Alloys evaluated included 7050-T7451 plate, 7050-T74511 extrusion, 6013-T6511x extrusion, and 7475-T7351 plate. Structural performance was evaluated with a large 7475-T7351 pressure test that included the arrest of a two-bay longitudinal crack, and a measure of residual strength for a two-bay crack centered on a broken frame. Analysis predictions for the two-bay longitudinal crack panel correlated well with the test results. Analysis activity conducted by the IAS team strongly indicates that current analysis tools predict integral structural behavior as accurately as built-up structure. The cost study results indicated that, compared to built-up fabrication methods, high-speed machining structure from aluminum plate would yield a recurring cost savings of 61%. Part count dropped from 78 individual parts on a baseline panel to just 7 parts for machined IAS structure.

  4. Critical Features of Fragment Libraries for Protein Structure Prediction.

    PubMed

    Trevizani, Raphael; Custódio, Fábio Lima; Dos Santos, Karina Baptista; Dardenne, Laurent Emmanuel

    2017-01-01

    The use of fragment libraries is a popular approach among protein structure prediction methods and has proven to substantially improve the quality of predicted structures. However, some vital aspects of a fragment library that influence the accuracy of modeling a native structure remain to be determined. This study investigates some of these features. Particularly, we analyze the effect of using secondary structure prediction guiding fragments selection, different fragments sizes and the effect of structural clustering of fragments within libraries. To have a clearer view of how these factors affect protein structure prediction, we isolated the process of model building by fragment assembly from some common limitations associated with prediction methods, e.g., imprecise energy functions and optimization algorithms, by employing an exact structure-based objective function under a greedy algorithm. Our results indicate that shorter fragments reproduce the native structure more accurately than the longer. Libraries composed of multiple fragment lengths generate even better structures, where longer fragments show to be more useful at the beginning of the simulations. The use of many different fragment sizes shows little improvement when compared to predictions carried out with libraries that comprise only three different fragment sizes. Models obtained from libraries built using only sequence similarity are, on average, better than those built with a secondary structure prediction bias. However, we found that the use of secondary structure prediction allows greater reduction of the search space, which is invaluable for prediction methods. The results of this study can be critical guidelines for the use of fragment libraries in protein structure prediction.

  5. Critical Features of Fragment Libraries for Protein Structure Prediction

    PubMed Central

    dos Santos, Karina Baptista

    2017-01-01

    The use of fragment libraries is a popular approach among protein structure prediction methods and has proven to substantially improve the quality of predicted structures. However, some vital aspects of a fragment library that influence the accuracy of modeling a native structure remain to be determined. This study investigates some of these features. Particularly, we analyze the effect of using secondary structure prediction guiding fragments selection, different fragments sizes and the effect of structural clustering of fragments within libraries. To have a clearer view of how these factors affect protein structure prediction, we isolated the process of model building by fragment assembly from some common limitations associated with prediction methods, e.g., imprecise energy functions and optimization algorithms, by employing an exact structure-based objective function under a greedy algorithm. Our results indicate that shorter fragments reproduce the native structure more accurately than the longer. Libraries composed of multiple fragment lengths generate even better structures, where longer fragments show to be more useful at the beginning of the simulations. The use of many different fragment sizes shows little improvement when compared to predictions carried out with libraries that comprise only three different fragment sizes. Models obtained from libraries built using only sequence similarity are, on average, better than those built with a secondary structure prediction bias. However, we found that the use of secondary structure prediction allows greater reduction of the search space, which is invaluable for prediction methods. The results of this study can be critical guidelines for the use of fragment libraries in protein structure prediction. PMID:28085928

  6. Structural integrated sensor and actuator systems for active flow control

    NASA Astrophysics Data System (ADS)

    Behr, Christian; Schwerter, Martin; Leester-Schädel, Monika; Wierach, Peter; Dietzel, Andreas; Sinapius, Michael

    2016-04-01

    An adaptive flow separation control system is designed and implemented as an essential part of a novel high-lift device for future aircraft. The system consists of MEMS pressure sensors to determine the flow conditions and adaptive lips to regulate the mass flow and the velocity of a wall near stream over the internally blown Coanda flap. By the oscillating lip the mass flow in the blowing slot changes dynamically, consequently the momentum exchange of the boundary layer over a high lift flap required mass flow can be reduced. These new compact and highly integrated systems provide a real-time monitoring and manipulation of the flow conditions. In this context the integration of pressure sensors into flow sensing airfoils of composite material is investigated. Mechanical and electrical properties of the integrated sensors are investigated under mechanical loads during tensile tests. The sensors contain a reference pressure chamber isolated to the ambient by a deformable membrane with integrated piezoresistors connected as a Wheatstone bridge, which outputs voltage signals depending on the ambient pressure. The composite material in which the sensors are embedded consists of 22 individual layers of unidirectional glass fiber reinforced plastic (GFRP) prepreg. The results of the experiments are used for adapting the design of the sensors and the layout of the laminate to ensure an optimized flux of force in highly loaded structures primarily for future aeronautical applications. It can be shown that the pressure sensor withstands the embedding process into fiber composites with full functional capability and predictable behavior under stress.

  7. Integrative neuroscience approach to predict ADHD stimulant response.

    PubMed

    Hermens, Daniel F; Rowe, Donald L; Gordon, Evian; Williams, Leanne M

    2006-05-01

    Despite high rates of prescription, little is known about the long-term consequences of stimulant medication therapy for attention-deficit hyperactivity disorder (ADHD) sufferers. Historically, the clinical use of stimulants for ADHD has been based on trial and error before optimal therapy is reached. Concurrently, scientific research on the mechanism of action of stimulants has influenced neurobiological models of ADHD, but has not always informed their prescription. Whilst the two main stimulant types (methylphenidate and dexamphetamine) have numerous similarities, they also differ (slightly) in mechanism and possibly individual response. A further issue relates to differences in cost and availability compounded by the expectation for stimulants to be effective in ameliorating a broad spectrum of ADHD-related symptoms. Thus, there is an increasing need for treating clinicians to prescribe not only the most effective drug, but also the most appropriate dose with the associated release mechanism and schedule for each ADHD patient presented. In this regard, the field is witnessing an emergence of the personalized medicine approach to ADHD, in which treatment decisions are tailored to each individual. This shift requires a new approach to research into treatment response prediction. Given the heterogeneity of ADHD, a profile of information may be required to capture the most sensitive predictors of treatment response in individuals. These profiles will also benefit from the integration of data from clinical rating scales with more direct measures of cognition and brain function. In conclusion, there is a need to establish a more robust normative framework as the baseline for treatment, as well as diagnostic decisions, and as discussed, the growth of integrated neuroscience databases will be important in this regard.

  8. Hippocampal structure predicts cortical indices of reactivation of related items.

    PubMed

    Walker, John A; Low, Kathy A; Fletcher, Mark A; Cohen, Neal J; Gratton, Gabriele; Fabiani, Monica

    2017-01-27

    One of the key components of relational memory is the ability to bind together the constituent elements of a memory experience, and this ability is thought to be supported by the hippocampus. Previously we had shown that these relational bindings can be used to reactivate the cortical processors of an absent item in the presence of a relationally bound associate (Walker et al., 2014). Specifically, we recorded the event-related optical signal (EROS) when presenting the scene of a face-scene pair during a preview period immediately preceding a test display, and demonstrated reactivation of a face-processing cortical area (the superior temporal sulcus, STS) for scenes that had been previously paired with faces, relative to scenes that had not. Here we combined the EROS measures during the same preview paradigm with anatomical estimates of hippocampal integrity (structural MRI measures of hippocampal volume and diffusion tensor imaging measures of mean fractional anisotropy and diffusivity) to provide evidence that the hippocampus is mediating this reactivation phenomenon. The study was run in a sample of older adults aged 55-87, taking advantage of the high amount of hippocampal variability present in aging. We replicated the functional reactivation of STS during the preview period, specific to scenes previously paired with faces. Crucially, we also found that this phenomenon is correlated with structural hippocampus integrity. Both STS reactivation and hippocampal structure predicted subsequent recognition performance. These data support the theory that relational memory is sustained by an interaction between hippocampal and cortical sensory processing regions, and that these functions may be at the basis of episodic memory changes in normal aging.

  9. Integrated numerical prediction of atomization process of liquid hydrogen jet

    NASA Astrophysics Data System (ADS)

    Ishimoto, Jun; Ohira, Katsuhide; Okabayashi, Kazuki; Chitose, Keiko

    2008-05-01

    The 3-D structure of the liquid atomization behavior of an LH jet flow through a pinhole nozzle is numerically investigated and visualized by a new type of integrated simulation technique. The present computational fluid dynamics (CFD) analysis focuses on the thermodynamic effect on the consecutive breakup of a cryogenic liquid column, the formation of a liquid film, and the generation of droplets in the outlet section of the pinhole nozzle. Utilizing the governing equations for a high-speed turbulent cryogenic jet flow through a pinhole nozzle based on the thermal nonequilibrium LES-VOF model in conjunction with the CSF model, an integrated parallel computation is performed to clarify the detailed atomization process of a high-speed LH2 jet flow through a pinhole nozzle and to acquire data, which is difficult to confirm by experiment, such as atomization length, liquid core shape, droplet-size distribution, spray angle, droplet velocity profiles, and thermal field surrounding the atomizing jet flow. According to the present computation, the cryogenic atomization rate and the LH2 droplets-gas two-phase flow characteristics are found to be controlled by the turbulence perturbation upstream of the pinhole nozzle, hydrodynamic instabilities at the gas-liquid interface and shear stress between the liquid core and the periphery of the LH2 jet. Furthermore, calculation of the effect of cryogenic atomization on the jet thermal field shows that such atomization extensively enhances the thermal diffusion surrounding the LH2 jet flow.

  10. Protein Structure Prediction Using String Kernels

    DTIC Science & Technology

    2006-03-03

    Prediction using String Kernels 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER 5e. TASK NUMBER...consists of 4352 sequences from SCOP version 1.53 extracted from the Astral database, grouped into families and superfamilies. The dataset is processed

  11. Predicting Career Advancement with Structural Equation Modelling

    ERIC Educational Resources Information Center

    Heimler, Ronald; Rosenberg, Stuart; Morote, Elsa-Sofia

    2012-01-01

    Purpose: The purpose of this paper is to use the authors' prior findings concerning basic employability skills in order to determine which skills best predict career advancement potential. Design/methodology/approach: Utilizing survey responses of human resource managers, the employability skills showing the largest relationships to career…

  12. Precision Imaging: more descriptive, predictive and integrative imaging.

    PubMed

    Frangi, Alejandro F; Taylor, Zeike A; Gooya, Ali

    2016-10-01

    Medical image analysis has grown into a matured field challenged by progress made across all medical imaging technologies and more recent breakthroughs in biological imaging. The cross-fertilisation between medical image analysis, biomedical imaging physics and technology, and domain knowledge from medicine and biology has spurred a truly interdisciplinary effort that stretched outside the original boundaries of the disciplines that gave birth to this field and created stimulating and enriching synergies. Consideration on how the field has evolved and the experience of the work carried out over the last 15 years in our centre, has led us to envision a future emphasis of medical imaging in Precision Imaging. Precision Imaging is not a new discipline but rather a distinct emphasis in medical imaging borne at the cross-roads between, and unifying the efforts behind mechanistic and phenomenological model-based imaging. It captures three main directions in the effort to deal with the information deluge in imaging sciences, and thus achieve wisdom from data, information, and knowledge. Precision Imaging is finally characterised by being descriptive, predictive and integrative about the imaged object. This paper provides a brief and personal perspective on how the field has evolved, summarises and formalises our vision of Precision Imaging for Precision Medicine, and highlights some connections with past research and current trends in the field.

  13. A Software Pipeline for Protein Structure Prediction

    DTIC Science & Technology

    2006-11-01

    programs, such as GenTHREADER (Jones 1999), FUGUE (Shi, Blundell et al. 2001), and 3D- PSSM (Kelley, MacCallum et al. 2000), use hybrid approaches...annotation using structural profiles in the program 3D- PSSM , J Mol Biol, 299, 499- 520. Kim, D., D. Xu, et al., 2003: PROSPECT II: protein structure

  14. Prediction of Protein Structure Using Surface Accessibility Data

    PubMed Central

    Hartlmüller, Christoph; Göbl, Christoph

    2016-01-01

    Abstract An approach to the de novo structure prediction of proteins is described that relies on surface accessibility data from NMR paramagnetic relaxation enhancements by a soluble paramagnetic compound (sPRE). This method exploits the distance‐to‐surface information encoded in the sPRE data in the chemical shift‐based CS‐Rosetta de novo structure prediction framework to generate reliable structural models. For several proteins, it is demonstrated that surface accessibility data is an excellent measure of the correct protein fold in the early stages of the computational folding algorithm and significantly improves accuracy and convergence of the standard Rosetta structure prediction approach. PMID:27560616

  15. Reliability of toxicological determination for predicting ecological integrity in freshwater systems

    SciTech Connect

    Birge, W.J.; Kercher, M.; Zuiderveen, J.

    1994-12-31

    Over an 8-year period, on-site biomonitoring studies were conducted on four freshwater systems that varied in order, gradient, substrate composition and community structure. One objective was to evaluate the reliability of toxicological findings for predicting ecological integrity. Impact from one or more point-source discharges varied among the different systems from slight to severe in effluent receiving areas and decreased incrementally with distance downstream. Studies were performed at 8 or more stations selected for comparable conditions, including upstream reference and downstream recovery areas. On-site toxicological evaluations were performed with 7-day tests using Ceriodaphnia dubia and fathead minnow embryo-larval tests. Test water was changed daily with fresh collections. Ecological conditions were analyzed using the Rapid Bioassessment Protocol III, Brillouin and Shannon-Weaver indices, cluster analysis and traditional methods (e.q., species richness, diversity, functional groups). In streams with heavy to extreme impact near the effluent outfall, fathead minnow toxicity data correlated significantly with ecological parameters, giving good predictability of ecological integrity. However, in other systems, toxicological endpoints were marginal to unreliable in predicting slight to moderate ecological impact or initial stages of recovery. Attrition of macroinvertebrate species by 20 to 30% resulted without observing consistent trends in toxicity. Neither biodiversity nor abundance of aquatic life could be predicted with confidence when the pattern of ecological impact was not decisive.

  16. Fatigue Prediction for Composite Materials and Structures

    DTIC Science & Technology

    2005-10-01

    Eugenio OÑATE CIMNE (International Center for Numerical Methods in Engineering) Building C-1, Campus Nord UPC -C/ Gran Capitán s/n 08034 Barcelona...SPAIN * salomon@cimne.upc.edu ABSTRACT The objective of this paper is to present a new computational methodology for predicting the durability of... methodology is validated using experimental data from tests on CFRR composite material samples. 1.0 INTRODUCTION Fatigue is defined as "the process

  17. Neural network definitions of highly predictable protein secondary structure classes

    SciTech Connect

    Lapedes, A. |; Steeg, E.; Farber, R.

    1994-02-01

    We use two co-evolving neural networks to determine new classes of protein secondary structure which are significantly more predictable from local amino sequence than the conventional secondary structure classification. Accurate prediction of the conventional secondary structure classes: alpha helix, beta strand, and coil, from primary sequence has long been an important problem in computational molecular biology. Neural networks have been a popular method to attempt to predict these conventional secondary structure classes. Accuracy has been disappointingly low. The algorithm presented here uses neural networks to similtaneously examine both sequence and structure data, and to evolve new classes of secondary structure that can be predicted from sequence with significantly higher accuracy than the conventional classes. These new classes have both similarities to, and differences with the conventional alpha helix, beta strand and coil.

  18. Protein structure prediction from sequence variation

    PubMed Central

    Marks, Debora S; Hopf, Thomas A; Sander, Chris

    2015-01-01

    Genomic sequences contain rich evolutionary information about functional constraints on macromolecules such as proteins. This information can be efficiently mined to detect evolutionary couplings between residues in proteins and address the long-standing challenge to compute protein three-dimensional structures from amino acid sequences. Substantial progress has recently been made on this problem owing to the explosive growth in available sequences and the application of global statistical methods. In addition to three-dimensional structure, the improved understanding of covariation may help identify functional residues involved in ligand binding, protein-complex formation and conformational changes. We expect computation of covariation patterns to complement experimental structural biology in elucidating the full spectrum of protein structures, their functional interactions and evolutionary dynamics. PMID:23138306

  19. Lifetime Reliability Prediction of Ceramic Structures Under Transient Thermomechanical Loads

    NASA Technical Reports Server (NTRS)

    Nemeth, Noel N.; Jadaan, Osama J.; Gyekenyesi, John P.

    2005-01-01

    An analytical methodology is developed to predict the probability of survival (reliability) of ceramic components subjected to harsh thermomechanical loads that can vary with time (transient reliability analysis). This capability enables more accurate prediction of ceramic component integrity against fracture in situations such as turbine startup and shutdown, operational vibrations, atmospheric reentry, or other rapid heating or cooling situations (thermal shock). The transient reliability analysis methodology developed herein incorporates the following features: fast-fracture transient analysis (reliability analysis without slow crack growth, SCG); transient analysis with SCG (reliability analysis with time-dependent damage due to SCG); a computationally efficient algorithm to compute the reliability for components subjected to repeated transient loading (block loading); cyclic fatigue modeling using a combined SCG and Walker fatigue law; proof testing for transient loads; and Weibull and fatigue parameters that are allowed to vary with temperature or time. Component-to-component variation in strength (stochastic strength response) is accounted for with the Weibull distribution, and either the principle of independent action or the Batdorf theory is used to predict the effect of multiaxial stresses on reliability. The reliability analysis can be performed either as a function of the component surface (for surface-distributed flaws) or component volume (for volume-distributed flaws). The transient reliability analysis capability has been added to the NASA CARES/ Life (Ceramic Analysis and Reliability Evaluation of Structures/Life) code. CARES/Life was also updated to interface with commercially available finite element analysis software, such as ANSYS, when used to model the effects of transient load histories. Examples are provided to demonstrate the features of the methodology as implemented in the CARES/Life program.

  20. Cancer Pharmacogenomics: Integrating Discoveries in Basic, Clinical and Population Sciences to Advance Predictive Cancer Care

    Cancer.gov

    Cancer Pharmacogenomics: Integrating Discoveries in Basic, Clinical and Population Sciences to Advance Predictive Cancer Care, a 2010 workshop sponsored by the Epidemiology and Genomics Research Program.

  1. Characterization and Prediction of Protein Flexibility Based on Structural Alphabets

    PubMed Central

    Liu, Bin

    2016-01-01

    Motivation. To assist efforts in determining and exploring the functional properties of proteins, it is desirable to characterize and predict protein flexibilities. Results. In this study, the conformational entropy is used as an indicator of the protein flexibility. We first explore whether the conformational change can capture the protein flexibility. The well-defined decoy structures are converted into one-dimensional series of letters from a structural alphabet. Four different structure alphabets, including the secondary structure in 3-class and 8-class, the PB structure alphabet (16-letter), and the DW structure alphabet (28-letter), are investigated. The conformational entropy is then calculated from the structure alphabet letters. Some of the proteins show high correlation between the conformation entropy and the protein flexibility. We then predict the protein flexibility from basic amino acid sequence. The local structures are predicted by the dual-layer model and the conformational entropy of the predicted class distribution is then calculated. The results show that the conformational entropy is a good indicator of the protein flexibility, but false positives remain a problem. The DW structure alphabet performs the best, which means that more subtle local structures can be captured by large number of structure alphabet letters. Overall this study provides a simple and efficient method for the characterization and prediction of the protein flexibility. PMID:27660756

  2. Crack Turning in Integrally Stiffened Aircraft Structures

    NASA Technical Reports Server (NTRS)

    Pettit, Richard Glen

    2000-01-01

    Current emphasis in the aircraft industry toward reducing manufacturing cost has created a renewed interest in integrally stiffened structures. Crack turning has been identified as an approach to improve the damage tolerance and fail-safety of this class of structures. A desired behavior is for skin cracks to turn before reaching a stiffener, instead of growing straight through. A crack in a pressurized fuselage encounters high T-stress as it nears the stiffener--a condition favorable to crack turning. Also, the tear resistance of aluminum alloys typically varies with crack orientation, a form of anisotropy that can influence the crack path. The present work addresses these issues with a study of crack turning in two-dimensions, including the effects of both T-stress and fracture anisotropy. Both effects are shown to have relation to the process zone size, an interaction that is central to this study. Following an introduction to the problem, the T-stress effect is studied for a slightly curved semi-infinite crack with a cohesive process zone, yielding a closed form expression for the future crack path in an infinite medium. For a given initial crack tip curvature and tensile T-stress, the crack path instability is found to increase with process zone size. Fracture orthotropy is treated using a simple function to interpolate between the two principal fracture resistance values in two-dimensions. An extension to three-dimensions interpolates between the six principal values of fracture resistance. Also discussed is the transition between mode I and mode II fracture in metals. For isotropic materials, there is evidence that the crack seeks out a direction of either local symmetry (pure mode I) or local asymmetry (pure mode II) growth. For orthotropic materials the favored states are not pure modal, and have mode mixity that is a function of crack orientation.

  3. Integrating remotely sensed fires for predicting deforestation for REDD.

    PubMed

    Armenteras, Dolors; Gibbes, Cerian; Anaya, Jesús A; Dávalos, Liliana M

    2017-02-16

    Fire is an important tool in tropical forest management, as it alters forest composition, structure, and the carbon budget. The United Nations program on Reducing Emissions from Deforestation and Forest Degradation (REDD+) aims to sustainably manage forests, as well as conserve and enhance their carbon stocks. Despite the crucial role of fire management, decision-making on REDD+ interventions fails to systematically include fires. Here, we address this critical knowledge gap in two ways. First, we review REDD+ projects and programs to assess the inclusion of fires in monitoring, reporting and verification (MRV) systems. Second, we model the relationship between fire and forest for a pilot site in Colombia using near-real-time (NRT) fire monitoring data derived from the Moderate Resolution Imaging Spectroradiometer (MODIS). The literature review revealed fire remains to be incorporated as a key component of MRV systems. Spatially-explicit modeling of land use change showed the probability of deforestation declined sharply with increasing distance to the nearest fire the preceding year (multi-year model area under the curve [AUC] 0.82). Deforestation predictions based on the model performed better than the official REDD early-warning system. The model AUC for 2013 and 2014 was 0.81 compared to 0.52 for the early warning system in 2013 and 0.68 in 2014. This demonstrates NRT fire monitoring is a powerful tool to predict sites of forest deforestation. Applying new, publicly available, and open-access NRT fire data should be an essential element of early-warning systems to detect and prevent deforestation. Our results provide tools for improving both the current MRV systems, and the deforestation early-warning system in Colombia. This article is protected by copyright. All rights reserved.

  4. Structural Prediction and Experimental Verification of Three New Ferroelectric Materials

    NASA Astrophysics Data System (ADS)

    Arbogast, D. J.; Foster, M. C.; Nielson, R. M.; Photinos, P. J.; Abrahams, S. C.

    1999-05-01

    Aminoguanidinium hexafluorozirconate, potassium niobyl silicate and fresnoite are typical members of a growing group of materials predicted to be new ferroelectrics by the application of structural criteria. Following prediction, undergraduate chemistry majors prepare and physics majors measure the dielectric properties of each. Experimental results will be presented for the three title materials in verification of their predicted property. In addition to the structural criteria on which the predictions depend, the circuits built locally and other instrumentation used for measuring ac and dc hysteresis, the thermal and frequency dependence of the dielectric permittivity, the thermal dependence of the spontaneous polarization and also the pyroelectric coefficient will be presented.

  5. Protein function prediction by massive integration of evolutionary analyses and multiple data sources

    PubMed Central

    2013-01-01

    Background Accurate protein function annotation is a severe bottleneck when utilizing the deluge of high-throughput, next generation sequencing data. Keeping database annotations up-to-date has become a major scientific challenge that requires the development of reliable automatic predictors of protein function. The CAFA experiment provided a unique opportunity to undertake comprehensive 'blind testing' of many diverse approaches for automated function prediction. We report on the methodology we used for this challenge and on the lessons we learnt. Methods Our method integrates into a single framework a wide variety of biological information sources, encompassing sequence, gene expression and protein-protein interaction data, as well as annotations in UniProt entries. The methodology transfers functional categories based on the results from complementary homology-based and feature-based analyses. We generated the final molecular function and biological process assignments by combining the initial predictions in a probabilistic manner, which takes into account the Gene Ontology hierarchical structure. Results We propose a novel scoring function called COmbined Graph-Information Content similarity (COGIC) score for the comparison of predicted functional categories and benchmark data. We demonstrate that our integrative approach provides increased scope and accuracy over both the component methods and the naïve predictors. In line with previous studies, we find that molecular function predictions are more accurate than biological process assignments. Conclusions Overall, the results indicate that there is considerable room for improvement in the field. It still remains for the community to invest a great deal of effort to make automated function prediction a useful and routine component in the toolbox of life scientists. As already witnessed in other areas, community-wide blind testing experiments will be pivotal in establishing standards for the evaluation of

  6. Assessment of structural integrity of wooden poles

    NASA Astrophysics Data System (ADS)

    Craighead, Ian A.; Thackery, Steve; Redstall, Martin; Thomas, Matthew R.

    2000-05-01

    Despite recent advances in the development of new materials, wood continues to be used globally for the support of overhead cable networks used by telecommunications and electrical utility companies. As a natural material, wood is subject to decay and will eventually fail, causing disruption to services and danger to public and company personnel. Internal decay, due to basidomycetes fungi or attack by termites, can progress rapidly and is often difficult to detect by casual inspection. The traditional method of testing poles for decay involves hitting them with a hammer and listening to the sound that results. However, evidence suggests that a large number of poles are replaced unnecessarily and a significant number of poles continue to fail unexpectedly in service. Therefore, a more accurate method of assessing the structural integrity of wooden poles is required. Over the last 25 years there have been a number of attempts at improving decay detection. Techniques such as ultrasound, drilling X rays etc. have been developed but have generally failed to improve upon the practicality and accuracy of the traditional testing method. The paper describes the use of signal processing techniques to analyze the acoustic response of the pole and thereby determine the presence of decay. Development of a prototype meter is described and the results of initial tests on several hundred poles are presented.

  7. Structural integration in hypoxia-inducible factors

    SciTech Connect

    Wu, Dalei; Potluri, Nalini; Lu, Jingping; Kim, Youngchang; Rastinejad, Fraydoon

    2015-08-20

    The hypoxia-inducible factors (HIFs) coordinate cellular adaptations to low oxygen stress by regulating transcriptional programs in erythropoiesis, angiogenesis and metabolism. These programs promote the growth and progression of many tumours, making HIFs attractive anticancer targets. Transcriptionally active HIFs consist of HIF-alpha and ARNT (also called HIF-1 beta) subunits. Here we describe crystal structures for each of mouse HIF-2 alpha-ARNT and HIF-1 alpha-ARNT heterodimers in states that include bound small molecules and their hypoxia response element. A highly integrated quaternary architecture is shared by HIF-2 alpha-ARNT and HIF-1 alpha-ARNT, wherein ARNT spirals around the outside of each HIF-alpha subunit. Five distinct pockets are observed that permit small-molecule binding, including PAS domain encapsulated sites and an interfacial cavity formed through subunit heterodimerization. The DNA-reading head rotates, extends and cooperates with a distal PAS domain to bind hypoxia response elements. HIF-alpha mutations linked to human cancers map to sensitive sites that establish DNA binding and the stability of PAS domains and pockets.

  8. Protein Structure and Function Prediction Using I-TASSER.

    PubMed

    Yang, Jianyi; Zhang, Yang

    2015-12-17

    I-TASSER is a hierarchical protocol for automated protein structure prediction and structure-based function annotation. Starting from the amino acid sequence of target proteins, I-TASSER first generates full-length atomic structural models from multiple threading alignments and iterative structural assembly simulations followed by atomic-level structure refinement. The biological functions of the protein, including ligand-binding sites, enzyme commission number, and gene ontology terms, are then inferred from known protein function databases based on sequence and structure profile comparisons. I-TASSER is freely available as both an on-line server and a stand-alone package. This unit describes how to use the I-TASSER protocol to generate structure and function prediction and how to interpret the prediction results, as well as alternative approaches for further improving the I-TASSER modeling quality for distant-homologous and multi-domain protein targets.

  9. A Software Pipeline for Protein Structure Prediction

    DTIC Science & Technology

    2006-11-01

    programs, such as GenTHREADER (Jones 1999), FUGUE (Shi, Blundell et al. 2001), and 3D- PSSM (Kelley, MacCallum et al. 2000), use hybrid approaches...2000: Enhanced genome annotation using structural profiles in the program 3D- PSSM , J Mol Biol, 299, 499- 520. Kim, D., D. Xu, et al., 2003: PROSPECT

  10. Predicting drug-target interactions by dual-network integrated logistic matrix factorization

    NASA Astrophysics Data System (ADS)

    Hao, Ming; Bryant, Stephen H.; Wang, Yanli

    2017-01-01

    In this work, we propose a dual-network integrated logistic matrix factorization (DNILMF) algorithm to predict potential drug-target interactions (DTI). The prediction procedure consists of four steps: (1) inferring new drug/target profiles and constructing profile kernel matrix; (2) diffusing drug profile kernel matrix with drug structure kernel matrix; (3) diffusing target profile kernel matrix with target sequence kernel matrix; and (4) building DNILMF model and smoothing new drug/target predictions based on their neighbors. We compare our algorithm with the state-of-the-art method based on the benchmark dataset. Results indicate that the DNILMF algorithm outperforms the previously reported approaches in terms of AUPR (area under precision-recall curve) and AUC (area under curve of receiver operating characteristic) based on the 5 trials of 10-fold cross-validation. We conclude that the performance improvement depends on not only the proposed objective function, but also the used nonlinear diffusion technique which is important but under studied in the DTI prediction field. In addition, we also compile a new DTI dataset for increasing the diversity of currently available benchmark datasets. The top prediction results for the new dataset are confirmed by experimental studies or supported by other computational research.

  11. Predicting drug-target interactions by dual-network integrated logistic matrix factorization

    PubMed Central

    Hao, Ming; Bryant, Stephen H.; Wang, Yanli

    2017-01-01

    In this work, we propose a dual-network integrated logistic matrix factorization (DNILMF) algorithm to predict potential drug-target interactions (DTI). The prediction procedure consists of four steps: (1) inferring new drug/target profiles and constructing profile kernel matrix; (2) diffusing drug profile kernel matrix with drug structure kernel matrix; (3) diffusing target profile kernel matrix with target sequence kernel matrix; and (4) building DNILMF model and smoothing new drug/target predictions based on their neighbors. We compare our algorithm with the state-of-the-art method based on the benchmark dataset. Results indicate that the DNILMF algorithm outperforms the previously reported approaches in terms of AUPR (area under precision-recall curve) and AUC (area under curve of receiver operating characteristic) based on the 5 trials of 10-fold cross-validation. We conclude that the performance improvement depends on not only the proposed objective function, but also the used nonlinear diffusion technique which is important but under studied in the DTI prediction field. In addition, we also compile a new DTI dataset for increasing the diversity of currently available benchmark datasets. The top prediction results for the new dataset are confirmed by experimental studies or supported by other computational research. PMID:28079135

  12. WeFold: A Coopetition for Protein Structure Prediction

    PubMed Central

    Khoury, George A.; Liwo, Adam; Khatib, Firas; Zhou, Hongyi; Chopra, Gaurav; Bacardit, Jaume; Bortot, Leandro O.; Faccioli, Rodrigo A.; Deng, Xin; He, Yi; Krupa, Pawel; Li, Jilong; Mozolewska, Magdalena A.; Sieradzan, Adam K.; Smadbeck, James; Wirecki, Tomasz; Cooper, Seth; Flatten, Jeff; Xu, Kefan; Baker, David; Cheng, Jianlin; Delbem, Alexandre C. B.; Floudas, Christodoulos A.; Keasar, Chen; Levitt, Michael; Popović, Zoran; Scheraga, Harold A.; Skolnick, Jeffrey; Crivelli, Silvia N.; Players, Foldit

    2014-01-01

    The protein structure prediction problem continues to elude scientists. Despite the introduction of many methods, only modest gains were made over the last decade for certain classes of prediction targets. To address this challenge, a social-media based worldwide collaborative effort, named WeFold, was undertaken by thirteen labs. During the collaboration, the labs were simultaneously competing with each other. Here, we present the first attempt at “coopetition” in scientific research applied to the protein structure prediction and refinement problems. The coopetition was possible by allowing the participating labs to contribute different components of their protein structure prediction pipelines and create new hybrid pipelines that they tested during CASP10. This manuscript describes both successes and areas needing improvement as identified throughout the first WeFold experiment and discusses the efforts that are underway to advance this initiative. A footprint of all contributions and structures are publicly accessible at http://www.wefold.org. PMID:24677212

  13. Investigation of threaded fastener structural integrity

    NASA Technical Reports Server (NTRS)

    1977-01-01

    Technical nondestructive evaluation approaches to the determination of fastener integrity were assessed. Existing instruments and methods used to measure stress or strain were examined, with particular interest in fastener shank stress. Industry procedures being followed were evaluated to establish fastener integrity criteria.

  14. A predictive structural model for bulk metallic glasses.

    PubMed

    Laws, K J; Miracle, D B; Ferry, M

    2015-09-15

    Great progress has been made in understanding the atomic structure of metallic glasses, but there is still no clear connection between atomic structure and glass-forming ability. Here we give new insights into perhaps the most important question in the field of amorphous metals: how can glass-forming ability be predicted from atomic structure? We give a new approach to modelling metallic glass atomic structures by solving three long-standing problems: we discover a new family of structural defects that discourage glass formation; we impose efficient local packing around all atoms simultaneously; and we enforce structural self-consistency. Fewer than a dozen binary structures satisfy these constraints, but extra degrees of freedom in structures with three or more different atom sizes significantly expand the number of relatively stable, 'bulk' metallic glasses. The present work gives a new approach towards achieving the long-sought goal of a predictive capability for bulk metallic glasses.

  15. A manufacturer's approach to ensure long term structural integrity

    NASA Technical Reports Server (NTRS)

    Ansell, Hans; Fredriksson, Billy; Holm, Ingvar

    1992-01-01

    The main features of the design concepts for the Saab 340 and Saab 2000 aircraft are described with respect to structural integrity and high reliability. Also described is the approach taken at Saab Aircraft to ensure structural integrity and high reliability. The concepts of global and local loads and sequences, and the fatigue and damage tolerance sizing and their verification are discussed. Also described is quality assurance in the production and structural maintenance program. Structural repair and feedback from operators are also covered.

  16. Integration of Design, Thermal, Structural, and Optical Analysis, Including Thermal Animation

    NASA Technical Reports Server (NTRS)

    Amundsen, Ruth M.

    1993-01-01

    In many industries there has recently been a concerted movement toward 'quality management' and the issue of how to accomplish work more efficiently. Part of this effort is focused on concurrent engineering; the idea of integrating the design and analysis processes so that they are not separate, sequential processes (often involving design rework due to analytical findings) but instead form an integrated system with smooth transfers of information. Presented herein are several specific examples of concurrent engineering methods being carried out at Langley Research Center (LaRC): integration of thermal, structural and optical analyses to predict changes in optical performance based on thermal and structural effects; integration of the CAD design process with thermal and structural analyses; and integration of analysis and presentation by animating the thermal response of a system as an active color map -- a highly effective visual indication of heat flow.

  17. Methods for evaluating the predictive accuracy of structural dynamic models

    NASA Technical Reports Server (NTRS)

    Hasselman, Timothy K.; Chrostowski, Jon D.

    1991-01-01

    Modeling uncertainty is defined in terms of the difference between predicted and measured eigenvalues and eigenvectors. Data compiled from 22 sets of analysis/test results was used to create statistical databases for large truss-type space structures and both pretest and posttest models of conventional satellite-type space structures. Modeling uncertainty is propagated through the model to produce intervals of uncertainty on frequency response functions, both amplitude and phase. This methodology was used successfully to evaluate the predictive accuracy of several structures, including the NASA CSI Evolutionary Structure tested at Langley Research Center. Test measurements for this structure were within + one-sigma intervals of predicted accuracy for the most part, demonstrating the validity of the methodology and computer code.

  18. Improving structure-based function prediction using molecular dynamics

    PubMed Central

    Glazer, Dariya S.; Radmer, Randall J.; Altman, Russ B.

    2009-01-01

    Summary The number of molecules with solved three-dimensional structure but unknown function is increasing rapidly. Particularly problematic are novel folds with little detectable similarity to molecules of known function. Experimental assays can determine the functions of such molecules, but are time-consuming and expensive. Computational approaches can identify potential functional sites; however, these approaches generally rely on single static structures and do not use information about dynamics. In fact, structural dynamics can enhance function prediction: we coupled molecular dynamics simulations with structure-based function prediction algorithms that identify Ca2+ binding sites. When applied to 11 challenging proteins, both methods showed substantial improvement in performance, revealing 22 more sites in one case and 12 more in the other, with a modest increase in apparent false positives. Thus, we show that treating molecules as dynamic entities improves the performance of structure-based function prediction methods. PMID:19604472

  19. High-speed prediction of crystal structures for organic molecules

    NASA Astrophysics Data System (ADS)

    Obata, Shigeaki; Goto, Hitoshi

    2015-02-01

    We developed a master-worker type parallel algorithm for allocating tasks of crystal structure optimizations to distributed compute nodes, in order to improve a performance of simulations for crystal structure predictions. The performance experiments were demonstrated on TUT-ADSIM supercomputer system (HITACHI HA8000-tc/HT210). The experimental results show that our parallel algorithm could achieve speed-ups of 214 and 179 times using 256 processor cores on crystal structure optimizations in predictions of crystal structures for 3-aza-bicyclo(3.3.1)nonane-2,4-dione and 2-diazo-3,5-cyclohexadiene-1-one, respectively. We expect that this parallel algorithm is always possible to reduce computational costs of any crystal structure predictions.

  20. Brain structure predicts risk for obesity ☆

    PubMed Central

    Smucny, Jason; Cornier, Marc-Andre; Eichman, Lindsay C.; Thomas, Elizabeth A.; Bechtell, Jamie L.; Tregellas, Jason R.

    2014-01-01

    The neurobiology of obesity is poorly understood. Here we report findings of a study designed to examine the differences in brain regional gray matter volume in adults recruited as either Obese Prone or Obese Resistant based on self-identification, body mass index, and personal/family weight history. Magnetic resonance imaging was performed in 28 Obese Prone (14 male, 14 female) and 25 Obese Resistant (13 male, 12 female) healthy adults. Voxel-based morphometry was used to identify gray matter volume differences between groups. Gray matter volume was found to be lower in the insula, medial orbitofrontal cortex and cerebellum in Obese Prone, as compared to Obese Resistant individuals. Adjusting for body fat mass did not impact these results. Insula gray matter volume was negatively correlated with leptin concentration and measures of hunger. These findings suggest that individuals at risk for weight gain have structural differences in brain regions known to be important in energy intake regulation, and that these differences, particularly in the insula, may be related to leptin. PMID:22963736

  1. Ceramide structure predicts tumor ganglioside immunosuppressive activity.

    PubMed Central

    Ladisch, S; Li, R; Olson, E

    1994-01-01

    Molecular determinants of biological activity of gangliosides are generally believed to be carbohydrate in nature. However, our studies of immunomodulation by highly purified naturally occurring tumor gangliosides provide another perspective: while the immunosuppressive activity of gangliosides requires the intact molecule (both carbohydrate and ceramide moieties), ceramide structure strikingly influences ganglioside immunosuppressive activity. Molecular species of human neuroblastoma GD2 ganglioside in which the ceramide contains a shorter fatty acyl chain (C16:0, C18:0) were 6- to 10-fold more active than those with a longer fatty acyl chain (C22:0/C24:1, C24:0). These findings were confirmed in studies of ceramide species of human leukemia sialosylparagloboside and murine lymphoma GalNAcGM1b. Gangliosides that contain shorter-chain fatty acids (and are most immunosuppressive) are known to be preferentially shed by tumor cells. Therefore, the results suggest that the tumor cell is optimized to protect itself from host immune destruction by selective shedding of highly active ceramide species of gangliosides. Images PMID:8127917

  2. Evaluation of several lightweight stochastic context-free grammars for RNA secondary structure prediction

    PubMed Central

    Dowell, Robin D; Eddy, Sean R

    2004-01-01

    Background RNA secondary structure prediction methods based on probabilistic modeling can be developed using stochastic context-free grammars (SCFGs). Such methods can readily combine different sources of information that can be expressed probabilistically, such as an evolutionary model of comparative RNA sequence analysis and a biophysical model of structure plausibility. However, the number of free parameters in an integrated model for consensus RNA structure prediction can become untenable if the underlying SCFG design is too complex. Thus a key question is, what small, simple SCFG designs perform best for RNA secondary structure prediction? Results Nine different small SCFGs were implemented to explore the tradeoffs between model complexity and prediction accuracy. Each model was tested for single sequence structure prediction accuracy on a benchmark set of RNA secondary structures. Conclusions Four SCFG designs had prediction accuracies near the performance of current energy minimization programs. One of these designs, introduced by Knudsen and Hein in their PFOLD algorithm, has only 21 free parameters and is significantly simpler than the others. PMID:15180907

  3. Integrable structure in discrete shell membrane theory

    PubMed Central

    Schief, W. K.

    2014-01-01

    We present natural discrete analogues of two integrable classes of shell membranes. By construction, these discrete shell membranes are in equilibrium with respect to suitably chosen internal stresses and external forces. The integrability of the underlying equilibrium equations is proved by relating the geometry of the discrete shell membranes to discrete O surface theory. We establish connections with generalized barycentric coordinates and nine-point centres and identify a discrete version of the classical Gauss equation of surface theory. PMID:24808755

  4. DUET: a server for predicting effects of mutations on protein stability using an integrated computational approach.

    PubMed

    Pires, Douglas E V; Ascher, David B; Blundell, Tom L

    2014-07-01

    Cancer genome and other sequencing initiatives are generating extensive data on non-synonymous single nucleotide polymorphisms (nsSNPs) in human and other genomes. In order to understand the impacts of nsSNPs on the structure and function of the proteome, as well as to guide protein engineering, accurate in silicomethodologies are required to study and predict their effects on protein stability. Despite the diversity of available computational methods in the literature, none has proven accurate and dependable on its own under all scenarios where mutation analysis is required. Here we present DUET, a web server for an integrated computational approach to study missense mutations in proteins. DUET consolidates two complementary approaches (mCSM and SDM) in a consensus prediction, obtained by combining the results of the separate methods in an optimized predictor using Support Vector Machines (SVM). We demonstrate that the proposed method improves overall accuracy of the predictions in comparison with either method individually and performs as well as or better than similar methods. The DUET web server is freely and openly available at http://structure.bioc.cam.ac.uk/duet.

  5. Full-length RNA structure prediction of the HIV-1 genome reveals a conserved core domain

    PubMed Central

    Sükösd, Zsuzsanna; Andersen, Ebbe S.; Seemann, Stefan E.; Jensen, Mads Krogh; Hansen, Mathias; Gorodkin, Jan; Kjems, Jørgen

    2015-01-01

    A distance constrained secondary structural model of the ≈10 kb RNA genome of the HIV-1 has been predicted but higher-order structures, involving long distance interactions, are currently unknown. We present the first global RNA secondary structure model for the HIV-1 genome, which integrates both comparative structure analysis and information from experimental data in a full-length prediction without distance constraints. Besides recovering known structural elements, we predict several novel structural elements that are conserved in HIV-1 evolution. Our results also indicate that the structure of the HIV-1 genome is highly variable in most regions, with a limited number of stable and conserved RNA secondary structures. Most interesting, a set of long distance interactions form a core organizing structure (COS) that organize the genome into three major structural domains. Despite overlapping protein-coding regions the COS is supported by a particular high frequency of compensatory base changes, suggesting functional importance for this element. This new structural element potentially organizes the whole genome into three major domains protruding from a conserved core structure with potential roles in replication and evolution for the virus. PMID:26476446

  6. Full-length RNA structure prediction of the HIV-1 genome reveals a conserved core domain.

    PubMed

    Sükösd, Zsuzsanna; Andersen, Ebbe S; Seemann, Stefan E; Jensen, Mads Krogh; Hansen, Mathias; Gorodkin, Jan; Kjems, Jørgen

    2015-12-02

    A distance constrained secondary structural model of the ≈10 kb RNA genome of the HIV-1 has been predicted but higher-order structures, involving long distance interactions, are currently unknown. We present the first global RNA secondary structure model for the HIV-1 genome, which integrates both comparative structure analysis and information from experimental data in a full-length prediction without distance constraints. Besides recovering known structural elements, we predict several novel structural elements that are conserved in HIV-1 evolution. Our results also indicate that the structure of the HIV-1 genome is highly variable in most regions, with a limited number of stable and conserved RNA secondary structures. Most interesting, a set of long distance interactions form a core organizing structure (COS) that organize the genome into three major structural domains. Despite overlapping protein-coding regions the COS is supported by a particular high frequency of compensatory base changes, suggesting functional importance for this element. This new structural element potentially organizes the whole genome into three major domains protruding from a conserved core structure with potential roles in replication and evolution for the virus.

  7. Evolving networks-Using past structure to predict the future

    NASA Astrophysics Data System (ADS)

    Shang, Ke-ke; Yan, Wei-sheng; Small, Michael

    2016-08-01

    Many previous studies on link prediction have focused on using common neighbors to predict the existence of links between pairs of nodes. More broadly, research into the structural properties of evolving temporal networks and temporal link prediction methods have recently attracted increasing attention. In this study, for the first time, we examine the use of links between a pair of nodes to predict their common neighbors and analyze the relationship between the weight and the structure in static networks, evolving networks, and in the corresponding randomized networks. We propose both new unweighted and weighted prediction methods and use six kinds of real networks to test our algorithms. In unweighted networks, we find that if a pair of nodes connect to each other in the current network, they will have a higher probability to connect common nodes both in the current and the future networks-and the probability will decrease with the increase of the number of neighbors. Furthermore, we find that the original networks have their particular structure and statistical characteristics which benefit link prediction. In weighted networks, the prediction algorithm performance of networks which are dominated by human factors decrease with the decrease of weight and are in general better in static networks. Furthermore, we find that geographical position and link weight both have significant influence on the transport network. Moreover, the evolving financial network has the lowest predictability. In addition, we find that the structure of non-social networks has more robustness than social networks. The structure of engineering networks has both best predictability and also robustness.

  8. Analysis and Design of Fuselage Structures Including Residual Strength Prediction Methodology

    NASA Technical Reports Server (NTRS)

    Knight, Norman F.

    1998-01-01

    The goal of this research project is to develop and assess methodologies for the design and analysis of fuselage structures accounting for residual strength. Two primary objectives are included in this research activity: development of structural analysis methodology for predicting residual strength of fuselage shell-type structures; and the development of accurate, efficient analysis, design and optimization tool for fuselage shell structures. Assessment of these tools for robustness, efficient, and usage in a fuselage shell design environment will be integrated with these two primary research objectives.

  9. Referent Predictability Is Affected by Syntactic Structure: Evidence from Chinese

    ERIC Educational Resources Information Center

    Cheng, Wei; Almor, Amit

    2017-01-01

    This paper examines the effect of syntactic structures on referent predictability. Focusing on stimulus-experiencer (SE) verbs, we conducted two sentence-completion experiments in Chinese by contrasting SE verbs in three structures (active canonical, active "ba," and passive). The results showed that although verb semantics and discourse…

  10. Structural basis for retroviral integration into nucleosomes.

    PubMed

    Maskell, Daniel P; Renault, Ludovic; Serrao, Erik; Lesbats, Paul; Matadeen, Rishi; Hare, Stephen; Lindemann, Dirk; Engelman, Alan N; Costa, Alessandro; Cherepanov, Peter

    2015-07-16

    Retroviral integration is catalysed by a tetramer of integrase (IN) assembled on viral DNA ends in a stable complex, known as the intasome. How the intasome interfaces with chromosomal DNA, which exists in the form of nucleosomal arrays, is currently unknown. Here we show that the prototype foamy virus (PFV) intasome is proficient at stable capture of nucleosomes as targets for integration. Single-particle cryo-electron microscopy reveals a multivalent intasome-nucleosome interface involving both gyres of nucleosomal DNA and one H2A-H2B heterodimer. While the histone octamer remains intact, the DNA is lifted from the surface of the H2A-H2B heterodimer to allow integration at strongly preferred superhelix location ±3.5 positions. Amino acid substitutions disrupting these contacts impinge on the ability of the intasome to engage nucleosomes in vitro and redistribute viral integration sites on the genomic scale. Our findings elucidate the molecular basis for nucleosome capture by the viral DNA recombination machinery and the underlying nucleosome plasticity that allows integration.

  11. Integrated Control Using the SOFFT Control Structure

    NASA Technical Reports Server (NTRS)

    Halyo, Nesim

    1996-01-01

    The need for integrated/constrained control systems has become clearer as advanced aircraft introduced new coupled subsystems such as new propulsion subsystems with thrust vectoring and new aerodynamic designs. In this study, we develop an integrated control design methodology which accomodates constraints among subsystem variables while using the Stochastic Optimal Feedforward/Feedback Control Technique (SOFFT) thus maintaining all the advantages of the SOFFT approach. The Integrated SOFFT Control methodology uses a centralized feedforward control and a constrained feedback control law. The control thus takes advantage of the known coupling among the subsystems while maintaining the identity of subsystems for validation purposes and the simplicity of the feedback law to understand the system response in complicated nonlinear scenarios. The Variable-Gain Output Feedback Control methodology (including constant gain output feedback) is extended to accommodate equality constraints. A gain computation algorithm is developed. The designer can set the cross-gains between two variables or subsystems to zero or another value and optimize the remaining gains subject to the constraint. An integrated control law is designed for a modified F-15 SMTD aircraft model with coupled airframe and propulsion subsystems using the Integrated SOFFT Control methodology to produce a set of desired flying qualities.

  12. Internally directed cognition and mindfulness: an integrative perspective derived from predictive and reactive control systems theory

    PubMed Central

    Tops, Mattie; Boksem, Maarten A. S.; Quirin, Markus; IJzerman, Hans; Koole, Sander L.

    2013-01-01

    In the present paper, we will apply the predictive and reactive control systems (PARCS) theory as a framework that integrates competing theories of neural substrates of awareness by describing the “default mode network” (DMN) and anterior insula (AI) as parts of two different behavioral and homeostatic control systems. The DMN, a network that becomes active at rest when there is no external stimulation or task to perform, has been implicated in self-reflective awareness and prospection. By contrast, the AI is associated with awareness and task-related attention. This has led to competing theories stressing the role of the DMN in self-awareness vs. the role of interoceptive and emotional information integration in the AI in awareness of the emotional moment. In PARCS, the respective functions of the DMN and AI in a specific control system explains their association with different qualities of awareness, and how mental states can shift from one state (e.g., prospective self-reflection) to the other (e.g., awareness of the emotional moment) depending on the relative dominance of control systems. These shifts between reactive and predictive control are part of processes that enable the intake of novel information, integration of this novel information within existing knowledge structures, and the creation of a continuous personal context in which novel information can be integrated and understood. As such, PARCS can explain key characteristics of mental states, such as their temporal and spatial focus (e.g., a focus on the here and now vs. the future; a first person vs. a third person perspective). PARCS further relates mental states to brain states and functions, such as activation of the DMN or hemispheric asymmetry in frontal cortical functions. Together, PARCS deepens the understanding of a broad range of mental states, including mindfulness, mind wandering, rumination, autobiographical memory, imagery, and the experience of self. PMID:24904455

  13. Structure Prediction of RNA Loops with a Probabilistic Approach

    PubMed Central

    Li, Jun; Zhang, Jian; Wang, Jun; Li, Wenfei; Wang, Wei

    2016-01-01

    The knowledge of the tertiary structure of RNA loops is important for understanding their functions. In this work we develop an efficient approach named RNApps, specifically designed for predicting the tertiary structure of RNA loops, including hairpin loops, internal loops, and multi-way junction loops. It includes a probabilistic coarse-grained RNA model, an all-atom statistical energy function, a sequential Monte Carlo growth algorithm, and a simulated annealing procedure. The approach is tested with a dataset including nine RNA loops, a 23S ribosomal RNA, and a large dataset containing 876 RNAs. The performance is evaluated and compared with a homology modeling based predictor and an ab initio predictor. It is found that RNApps has comparable performance with the former one and outdoes the latter in terms of structure predictions. The approach holds great promise for accurate and efficient RNA tertiary structure prediction. PMID:27494763

  14. 3D protein structure prediction using Imperialist Competitive algorithm and half sphere exposure prediction.

    PubMed

    Khaji, Erfan; Karami, Masoumeh; Garkani-Nejad, Zahra

    2016-02-21

    Predicting the native structure of proteins based on half-sphere exposure and contact numbers has been studied deeply within recent years. Online predictors of these vectors and secondary structures of amino acids sequences have made it possible to design a function for the folding process. By choosing variant structures and directs for each secondary structure, a random conformation can be generated, and a potential function can then be assigned. Minimizing the potential function utilizing meta-heuristic algorithms is the final step of finding the native structure of a given amino acid sequence. In this work, Imperialist Competitive algorithm was used in order to accelerate the process of minimization. Moreover, we applied an adaptive procedure to apply revolutionary changes. Finally, we considered a more accurate tool for prediction of secondary structure. The results of the computational experiments on standard benchmark show the superiority of the new algorithm over the previous methods with similar potential function.

  15. Blind Test of Physics-Based Prediction of Protein Structures

    PubMed Central

    Shell, M. Scott; Ozkan, S. Banu; Voelz, Vincent; Wu, Guohong Albert; Dill, Ken A.

    2009-01-01

    We report here a multiprotein blind test of a computer method to predict native protein structures based solely on an all-atom physics-based force field. We use the AMBER 96 potential function with an implicit (GB/SA) model of solvation, combined with replica-exchange molecular-dynamics simulations. Coarse conformational sampling is performed using the zipping and assembly method (ZAM), an approach that is designed to mimic the putative physical routes of protein folding. ZAM was applied to the folding of six proteins, from 76 to 112 monomers in length, in CASP7, a community-wide blind test of protein structure prediction. Because these predictions have about the same level of accuracy as typical bioinformatics methods, and do not utilize information from databases of known native structures, this work opens up the possibility of predicting the structures of membrane proteins, synthetic peptides, or other foldable polymers, for which there is little prior knowledge of native structures. This approach may also be useful for predicting physical protein folding routes, non-native conformations, and other physical properties from amino acid sequences. PMID:19186130

  16. Global identification predicts gay-male identity integration and well-being among Turkish gay men.

    PubMed

    Koc, Yasin; Vignoles, Vivian L

    2016-12-01

    In most parts of the world, hegemonic masculinity requires men to endorse traditional masculine ideals, one of which is rejection of homosexuality. Wherever hegemonic masculinity favours heterosexuality over homosexuality, gay males may feel under pressure to negotiate their conflicting male gender and gay sexual identities to maintain positive self-perceptions. However, globalization, as a source of intercultural interaction, might provide a beneficial context for people wishing to create alternative masculinities in the face of hegemonic masculinity. Hence, we tested if global identification would predict higher levels of gay-male identity integration, and indirectly subjective well-being, via alternative masculinity representations for gay and male identities. A community sample of 219 gay and bisexual men from Turkey completed the study. Structural equation modelling revealed that global identification positively predicted gay-male identity integration, and indirectly subjective well-being; however, alternative masculinity representations did not mediate this relationship. Our findings illustrate how identity categories in different domains can intersect and affect each other in complex ways. Moreover, we discuss mental health and well-being implications for gay men living in cultures where they experience high levels of prejudice and stigma.

  17. SPOT-Seq-RNA: predicting protein-RNA complex structure and RNA-binding function by fold recognition and binding affinity prediction.

    PubMed

    Yang, Yuedong; Zhao, Huiying; Wang, Jihua; Zhou, Yaoqi

    2014-01-01

    RNA-binding proteins (RBPs) play key roles in RNA metabolism and post-transcriptional regulation. Computational methods have been developed separately for prediction of RBPs and RNA-binding residues by machine-learning techniques and prediction of protein-RNA complex structures by rigid or semiflexible structure-to-structure docking. Here, we describe a template-based technique called SPOT-Seq-RNA that integrates prediction of RBPs, RNA-binding residues, and protein-RNA complex structures into a single package. This integration is achieved by combining template-based structure-prediction software, SPARKS X, with binding affinity prediction software, DRNA. This tool yields reasonable sensitivity (46 %) and high precision (84 %) for an independent test set of 215 RBPs and 5,766 non-RBPs. SPOT-Seq-RNA is computationally efficient for genome-scale prediction of RBPs and protein-RNA complex structures. Its application to human genome study has revealed a similar sensitivity and ability to uncover hundreds of novel RBPs beyond simple homology. The online server and downloadable version of SPOT-Seq-RNA are available at http://sparks-lab.org/server/SPOT-Seq-RNA/.

  18. Clathrate Structure Determination by Combining Crystal Structure Prediction with Computational and Experimental (129) Xe NMR Spectroscopy.

    PubMed

    Selent, Marcin; Nyman, Jonas; Roukala, Juho; Ilczyszyn, Marek; Oilunkaniemi, Raija; Bygrave, Peter J; Laitinen, Risto; Jokisaari, Jukka; Day, Graeme M; Lantto, Perttu

    2017-01-23

    An approach is presented for the structure determination of clathrates using NMR spectroscopy of enclathrated xenon to select from a set of predicted crystal structures. Crystal structure prediction methods have been used to generate an ensemble of putative structures of o- and m-fluorophenol, whose previously unknown clathrate structures have been studied by (129) Xe NMR spectroscopy. The high sensitivity of the (129) Xe chemical shift tensor to the chemical environment and shape of the crystalline cavity makes it ideal as a probe for porous materials. The experimental powder NMR spectra can be used to directly confirm or reject hypothetical crystal structures generated by computational prediction, whose chemical shift tensors have been simulated using density functional theory. For each fluorophenol isomer one predicted crystal structure was found, whose measured and computed chemical shift tensors agree within experimental and computational error margins and these are thus proposed as the true fluorophenol xenon clathrate structures.

  19. A Bayesian approach to improved calibration and prediction of groundwater models with structural error

    NASA Astrophysics Data System (ADS)

    Xu, Tianfang; Valocchi, Albert J.

    2015-11-01

    Numerical groundwater flow and solute transport models are usually subject to model structural error due to simplification and/or misrepresentation of the real system, which raises questions regarding the suitability of conventional least squares regression-based (LSR) calibration. We present a new framework that explicitly describes the model structural error statistically in an inductive, data-driven way. We adopt a fully Bayesian approach that integrates Gaussian process error models into the calibration, prediction, and uncertainty analysis of groundwater flow models. We test the usefulness of the fully Bayesian approach with a synthetic case study of the impact of pumping on surface-ground water interaction. We illustrate through this example that the Bayesian parameter posterior distributions differ significantly from parameters estimated by conventional LSR, which does not account for model structural error. For the latter method, parameter compensation for model structural error leads to biased, overconfident prediction under changing pumping condition. In contrast, integrating Gaussian process error models significantly reduces predictive bias and leads to prediction intervals that are more consistent with validation data. Finally, we carry out a generalized LSR recalibration step to assimilate the Bayesian prediction while preserving mass conservation and other physical constraints, using a full error covariance matrix obtained from Bayesian results. It is found that the recalibrated model achieved lower predictive bias compared to the model calibrated using conventional LSR. The results highlight the importance of explicit treatment of model structural error especially in circumstances where subsequent decision-making and risk analysis require accurate prediction and uncertainty quantification.

  20. An integrated approach to structural genomics.

    PubMed

    Heinemann, U; Frevert, J; Hofmann, K; Illing, G; Maurer, C; Oschkinat, H; Saenger, W

    2000-01-01

    Structural genomics aims at determining a set of protein structures that will represent all domain folds present in the biosphere. These structures can be used as the basis for the homology modelling of the majority of all remaining protein domains or, indeed, proteins. Structural genomics therefore promises to provide a comprehensive structural description of the protein universe. To achieve this, a broad scientific effort is required. The Berlin-based "Protein Structure Factory" (PSF) plans to contribute to this effort by setting up a local infrastructure for the low-cost, high-throughput analysis of soluble human proteins. In close collaboration with the German Human Genome Project (DHGP) protein-coding genes will be expressed in Escherichia coli or yeast. Affinity-tagged proteins will be purified semi-automatically for biophysical characterization and structure analysis by X-ray diffraction methods and NMR spectroscopy. In all steps of the structure analysis process, possibilities for automation, parallelization and standardization will be explored. Major new facilities that are created for the PSF include a robotic station for large-scale protein crystallization, an NMR center and an experimental station for protein crystallography at the synchrotron storage ring BESSY II in Berlin.

  1. Contingency Table Browser − prediction of early stage protein structure

    PubMed Central

    Kalinowska, Barbara; Krzykalski, Artur; Roterman, Irena

    2015-01-01

    The Early Stage (ES) intermediate represents the starting structure in protein folding simulations based on the Fuzzy Oil Drop (FOD) model. The accuracy of FOD predictions is greatly dependent on the accuracy of the chosen intermediate. A suitable intermediate can be constructed using the sequence-structure relationship information contained in the so-called contingency table − this table expresses the likelihood of encountering various structural motifs for each tetrapeptide fragment in the amino acid sequence. The limited accuracy with which such structures could previously be predicted provided the motivation for a more indepth study of the contingency table itself. The Contingency Table Browser is a tool which can visualize, search and analyze the table. Our work presents possible applications of Contingency Table Browser, among them − analysis of specific protein sequences from the point of view of their structural ambiguity. PMID:26664034

  2. A life prediction model for laminated composite structural components

    NASA Technical Reports Server (NTRS)

    Allen, David H.

    1990-01-01

    A life prediction methodology for laminated continuous fiber composites subjected to fatigue loading conditions was developed. A summary is presented of research completed. A phenomenological damage evolution law was formulated for matrix cracking which is independent of stacking sequence. Mechanistic and physical support was developed for the phenomenological evolution law proposed above. The damage evolution law proposed above was implemented to a finite element computer program. And preliminary predictions were obtained for a structural component undergoing fatigue loading induced damage.

  3. Integrated aerodynamic/structural design of a sailplane wing

    NASA Technical Reports Server (NTRS)

    Grossman, B.; Gurdal, Z.; Haftka, R. T.; Strauch, G. J.; Eppard, W. M.

    1986-01-01

    Using lifting-line theory and beam analysis, the geometry (planiform and twist) and composite material structural sizes (skin thickness, spar cap, and web thickness) were designed for a sailplane wing, subject to both structural and aerodynamic constraints. For all elements, the integrated design (simultaneously designing the aerodynamics and the structure) was superior in terms of performance and weight to the sequential design (where the aerodynamic geometry is designed to maximize the performance, following which a structural/aeroelastic design minimizes the weight). Integrated designs produced less rigid, higher aspect ratio wings with favorable aerodynamic/structural interactions.

  4. Toward the Prediction of Organic Hydrate Crystal Structures.

    PubMed

    Hulme, Ashley T; Price, Sarah L

    2007-07-01

    Lattice energy minimization studies on four ordered crystal structures of ice and 22 hydrates of approximately rigid organic molecules (along with 11 corresponding anhydrate structures) were used to establish a model potential scheme, based on the use of a distributed multipole electrostatic model, that can reasonably reproduce the crystal structures. Transferring the empirical repulsion-dispersion potentials for organic oxygen and polar hydrogen atoms to water appears more successful for modeling ice phases than using common water potentials derived from liquid properties. Lattice energy differences are reasonable but quite sensitive to the exact conformation of water and the organic molecule used in the rigid molecule modeling. This potential scheme was used to test a new approach of predicting the crystal structure of 5-azauracil monohydrate (an isolated site hydrate) based on seeking dense crystal packings of 66 5-azauracil···water hydrogen-bonded clusters, derived from an analysis of hydrate hydrogen bond geometries involving the carbonyl- and aza-group acceptors in the Cambridge Structural Database. The known structure was found within 5 kJ mol(-1) of the global minimum in static lattice energy and as the third most stable structure, within 1 kJ mol(-1), when thermal effects at ambient temperature were considered. Thus, although the computational prediction of whether an organic molecule will crystallize in a hydrated form poses many challenges, the prediction of plausible structures for hydrogen-bonded monohydrates is now possible.

  5. 2. View, structures in Systems Integration Laboratory complex, looking north. ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    2. View, structures in Systems Integration Laboratory complex, looking north. The Components Test Laboratory (T-27) is located in the immediate foreground. Immediately uphill to the left of T-27 is the Boiler Chiller Plant (T-28H). To the left of T-28H is the Oxidizer Conditioning Structure (T-28D). Behind the T-28D is the Long-Term Oxidizer Silo (T-28B). The twin gantry structure at the left is the Systems Integration Laboratory (T-28). - Air Force Plant PJKS, Systems Integration Laboratory, Waterton Canyon Road & Colorado Highway 121, Lakewood, Jefferson County, CO

  6. Integrating Biological and Chemical Data for Hepatotoxicity Prediction (SOT)

    EPA Science Inventory

    The U.S. EPA ToxCastTM program is screening thousands of environmental chemicals for bioactivity using hundreds of high-throughput in vitro assays to build predictive models of toxicity. A set of 677 chemicals were represented by 711 bioactivity descriptors (from ToxCast assays),...

  7. Predicting phenology by integrating ecology, evolution and climate science

    USGS Publications Warehouse

    Pau, Stephanie; Wolkovich, Elizabeth M.; Cook, Benjamin I.; Davies, T. Jonathan; Kraft, Nathan J.B.; Bolmgren, Kjell; Betancourt, Julio L.; Cleland, Elsa E.

    2011-01-01

    Forecasting how species and ecosystems will respond to climate change has been a major aim of ecology in recent years. Much of this research has focused on phenology — the timing of life-history events. Phenology has well-demonstrated links to climate, from genetic to landscape scales; yet our ability to explain and predict variation in phenology across species, habitats and time remains poor. Here, we outline how merging approaches from ecology, climate science and evolutionary biology can advance research on phenological responses to climate variability. Using insight into seasonal and interannual climate variability combined with niche theory and community phylogenetics, we develop a predictive approach for species' reponses to changing climate. Our approach predicts that species occupying higher latitudes or the early growing season should be most sensitive to climate and have the most phylogenetically conserved phenologies. We further predict that temperate species will respond to climate change by shifting in time, while tropical species will respond by shifting space, or by evolving. Although we focus here on plant phenology, our approach is broadly applicable to ecological research of plant responses to climate variability.

  8. A new protein structure representation for efficient protein function prediction.

    PubMed

    Maghawry, Huda A; Mostafa, Mostafa G M; Gharib, Tarek F

    2014-12-01

    One of the challenging problems in bioinformatics is the prediction of protein function. Protein function is the main key that can be used to classify different proteins. Protein function can be inferred experimentally with very small throughput or computationally with very high throughput. Computational methods are sequence based or structure based. Structure-based methods produce more accurate protein function prediction. In this article, we propose a new protein structure representation for efficient protein function prediction. The representation is based on three-dimensional patterns of protein residues. In the analysis, we used protein function based on enzyme activity through six mechanistically diverse enzyme superfamilies: amidohydrolase, crotonase, haloacid dehalogenase, isoprenoid synthase type I, and vicinal oxygen chelate. We applied three different classification methods, naïve Bayes, k-nearest neighbors, and random forest, to predict the enzyme superfamily of a given protein. The prediction accuracy using the proposed representation outperforms a recently introduced representation method that is based only on the distance patterns. The results show that the proposed representation achieved prediction accuracy up to 98%, with improvement of about 10% on average.

  9. Microfabricated structures for integrated DNA analysis.

    PubMed Central

    Burns, M A; Mastrangelo, C H; Sammarco, T S; Man, F P; Webster, J R; Johnsons, B N; Foerster, B; Jones, D; Fields, Y; Kaiser, A R; Burke, D T

    1996-01-01

    Photolithographic micromachining of silicon is a candidate technology for the construction of high-throughput DNA analysis devices. However, the development of complex silicon microfabricated systems has been hindered in part by the lack of a simple, versatile pumping method for integrating individual components. Here we describe a surface-tension-based pump able to move discrete nanoliter drops through enclosed channels using only local heating. This thermocapillary pump can accurately mix, measure, and divide drops by simple electronic control. In addition, we have constructed thermal-cycling chambers, gel electrophoresis channels, and radiolabeled DNA detectors that are compatible with the fabrication of thermocapillary pump channels. Since all of the components are made by conventional photolithographic techniques, they can be assembled into more complex integrated systems. The combination of pump and components into self-contained miniaturized devices may provide significant improvements in DNA analysis speed, portability, and cost. The potential of microfabricated systems lies in the low unit cost of silicon-based construction and in the efficient sample handling afforded by component integration. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 Fig. 5 PMID:8643614

  10. Integrating electrostatic adhesion to composite structures

    NASA Astrophysics Data System (ADS)

    Heath, Callum J. C.; Bond, Ian P.; Potter, Kevin D.

    2015-04-01

    Additional functionality within load bearing components holds potential for adding value to a structure, design or product. We consider the adaptation of an established technology, electrostatic adhesion or electroadhesion, for application in glass fibre reinforced polymer (GFRP) composite materials. Electroadhesion uses high potential difference (~2-3 kV) between co-planar electrodes to generate temporary holding forces to both electrically conductive and nonconductive contact surfaces. Using a combination of established fabrication techniques, electroadhesive elements are co-cured within a composite host structure during manufacture. This provides an almost symbiotic relationship between the electroadhesive and the composite structure, with the electroadhesive providing an additional functionality, whilst the epoxy matrix material of the composite acts as a dielectric for the high voltage electrodes of the device. Silicone rubber coated devices have been shown to offer high shear load (85kPa) capability for GFRP components held together using this technique. Through careful control of the connection interface, we consider the incorporation of these devices within complete composite structures for additional functionality. The ability to vary the internal connectivity of structural elements could allow for incremental changes in connectivity between discrete sub-structures, potentially introducing variable stiffness to the global structure.

  11. Cloud prediction of protein structure and function with PredictProtein for Debian.

    PubMed

    Kaján, László; Yachdav, Guy; Vicedo, Esmeralda; Steinegger, Martin; Mirdita, Milot; Angermüller, Christof; Böhm, Ariane; Domke, Simon; Ertl, Julia; Mertes, Christian; Reisinger, Eva; Staniewski, Cedric; Rost, Burkhard

    2013-01-01

    We report the release of PredictProtein for the Debian operating system and derivatives, such as Ubuntu, Bio-Linux, and Cloud BioLinux. The PredictProtein suite is available as a standard set of open source Debian packages. The release covers the most popular prediction methods from the Rost Lab, including methods for the prediction of secondary structure and solvent accessibility (profphd), nuclear localization signals (predictnls), and intrinsically disordered regions (norsnet). We also present two case studies that successfully utilize PredictProtein packages for high performance computing in the cloud: the first analyzes protein disorder for whole organisms, and the second analyzes the effect of all possible single sequence variants in protein coding regions of the human genome.

  12. Cloud Prediction of Protein Structure and Function with PredictProtein for Debian

    PubMed Central

    Kaján, László; Yachdav, Guy; Vicedo, Esmeralda; Steinegger, Martin; Mirdita, Milot; Angermüller, Christof; Böhm, Ariane; Domke, Simon; Ertl, Julia; Mertes, Christian; Reisinger, Eva; Rost, Burkhard

    2013-01-01

    We report the release of PredictProtein for the Debian operating system and derivatives, such as Ubuntu, Bio-Linux, and Cloud BioLinux. The PredictProtein suite is available as a standard set of open source Debian packages. The release covers the most popular prediction methods from the Rost Lab, including methods for the prediction of secondary structure and solvent accessibility (profphd), nuclear localization signals (predictnls), and intrinsically disordered regions (norsnet). We also present two case studies that successfully utilize PredictProtein packages for high performance computing in the cloud: the first analyzes protein disorder for whole organisms, and the second analyzes the effect of all possible single sequence variants in protein coding regions of the human genome. PMID:23971032

  13. A novel approach to improve numerical weather prediction skills by using anomaly integration and historical data

    NASA Astrophysics Data System (ADS)

    Peng, Xindong; Che, Yuzhang; Chang, Jun

    2013-08-01

    Using the concept of anomaly integration and historical climate data, we have developed a novel operational framework to implement deterministic numerical weather prediction within 15 days. Real-case validation shows pronounced improvements in the forecasts of global geopotential heights in 20 out of 30 cases with the Community Atmosphere Model version 3.0. Seven other cases are marginally improved, and only three are deteriorated, in which all are ameliorated within the first-week period. The average of the 30 cases shows an obvious increase of anomaly correlation coefficient (ACC) and a decrease of root mean square error (RMSE) of the geopotential height over global, hemispherical, and tropical zones. Significant amelioration on tropical circulation is displayed within the first-week prediction. The forecasting skill is extended by 0.6 day in terms of days of the ACC greater than 0.6 for 500 hPa 30 case averaged geopotential height on global scale. The 30 case mean ACC and RMSE of 500 hPa temperature show the increment of 0.2 and -1.6 K, respectively, in the first-week prediction. In the case of January 2008, much more reasonable horizontal distribution and vertical structure are achieved in bias-corrected model geopotential height, temperature, relative humidity, and horizontal wind components in comparison to reanalysis data. In spite of a need for additional storage of historical modeling data, the new method does not increase computational costs and therefore is suitable for routine application.

  14. An Integrated Approach to Predicting Carbon Dioxide Storage Capacity in Carbonate Reservoirs

    NASA Astrophysics Data System (ADS)

    Smith, M. M.; Hao, Y.; Mason, H. E.; Carroll, S.

    2015-12-01

    Carbonate reservoirs are widespread globally but pose unique challenges for geologic carbon dioxide (CO2) storage due to the reactive nature of carbonate minerals and the inherently heterogeneous pore structures of these rock types. Carbonate mineral dissolution resulting from CO2-acidified fluids may actually create new storage capacity, but predicting the extent and location of enhanced storage is complicated by the presence of pore size distributions spanning orders of magnitude as well as common microfractures. To address this issue, core samples spanning a wide range of depths and predicted permeabilities were procured from wells drilled into the Weyburn-Midale reservoir from the IEA GHG's CO2 Monitoring and Storage Project, Saskatchewan, Canada; and from the Arbuckle dolomite at the Kansas Geological Survey's South-central Kansas CO2 Project. Our approach integrated non-invasive characterization, complex core-flooding experiments, and 3-D reactive transport simulations to calibrate relevant CO2 storage relationships among fluid flow, porosity, permeability, and chemical reactivity. The resulting observations from this work permit us to constrain (and place uncertainty limits on) some of the model parameters needed for estimating evolving reservoir CO2 storage capacity. The challenge remains, however, as to how to best interpret and implement these observations at the actual reservoir scale. We present our key findings from these projects and recommendations for storage capacity predictions. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.

  15. Correlating structural order with structural rearrangement in dusty plasma liquids: can structural rearrangement be predicted by static structural information?

    PubMed

    Su, Yen-Shuo; Liu, Yu-Hsuan; I, Lin

    2012-11-09

    Whether the static microstructural order information is strongly correlated with the subsequent structural rearrangement (SR) and their predicting power for SR are investigated experimentally in the quenched dusty plasma liquid with microheterogeneities. The poor local structural order is found to be a good alarm to identify the soft spot and predict the short term SR. For the site with good structural order, the persistent time for sustaining the structural memory until SR has a large mean value but a broad distribution. The deviation of the local structural order from that averaged over nearest neighbors serves as a good second alarm to further sort out the short time SR sites. It has the similar sorting power to that using the temporal fluctuation of the local structural order over a small time interval.

  16. HOPE: a homotopy optimization method for protein structure prediction.

    PubMed

    Dunlavy, Daniel M; O'Leary, Dianne P; Klimov, Dmitri; Thirumalai, D

    2005-12-01

    We use a homotopy optimization method, HOPE, to minimize the potential energy associated with a protein model. The method uses the minimum energy conformation of one protein as a template to predict the lowest energy structure of a query sequence. This objective is achieved by following a path of conformations determined by a homotopy between the potential energy functions for the two proteins. Ensembles of solutions are produced by perturbing conformations along the path, increasing the likelihood of predicting correct structures. Successful results are presented for pairs of homologous proteins, where HOPE is compared to a variant of Newton's method and to simulated annealing.

  17. Fast and accurate automatic structure prediction with HHpred.

    PubMed

    Hildebrand, Andrea; Remmert, Michael; Biegert, Andreas; Söding, Johannes

    2009-01-01

    Automated protein structure prediction is becoming a mainstream tool for biological research. This has been fueled by steady improvements of publicly available automated servers over the last decade, in particular their ability to build good homology models for an increasing number of targets by reliably detecting and aligning more and more remotely homologous templates. Here, we describe the three fully automated versions of the HHpred server that participated in the community-wide blind protein structure prediction competition CASP8. What makes HHpred unique is the combination of usability, short response times (typically under 15 min) and a model accuracy that is competitive with those of the best servers in CASP8.

  18. Predictive Modeling and Integrative Physiology: The Physiome Projects

    PubMed Central

    Bassingthwaighte, James B.

    2012-01-01

    The fundamental paradigm in physiological research is integration. Biological researchers are now ready to define for a species a mathematical construct, the Physiome, the all-encompassing quantitative model of an organism. The goal of the human Physiome project is improved health care, through deep understanding of the organism, all the way down to the genes, reconciling contradictions and clarifying cause and effect. The strategies for accomplishing this long term aim include the systematic gathering of old and new knowledge into shared databases, and integrating the information into self consistent, reproducible, mathematical models. Multiscale models, for practicality, cover only a few levels at a time. Beginning at the middle level, the cell, where the knowledge base is largest and most secure, and the elements well defined as functional biophysical/biochemical modules, the plan is to work up to the organism level and down to the gene level, in the end providing clear linkages between phenotype and the genome. PMID:22919435

  19. PROTEUS2: a web server for comprehensive protein structure prediction and structure-based annotation.

    PubMed

    Montgomerie, Scott; Cruz, Joseph A; Shrivastava, Savita; Arndt, David; Berjanskii, Mark; Wishart, David S

    2008-07-01

    PROTEUS2 is a web server designed to support comprehensive protein structure prediction and structure-based annotation. PROTEUS2 accepts either single sequences (for directed studies) or multiple sequences (for whole proteome annotation) and predicts the secondary and, if possible, tertiary structure of the query protein(s). Unlike most other tools or servers, PROTEUS2 bundles signal peptide identification, transmembrane helix prediction, transmembrane beta-strand prediction, secondary structure prediction (for soluble proteins) and homology modeling (i.e. 3D structure generation) into a single prediction pipeline. Using a combination of progressive multi-sequence alignment, structure-based mapping, hidden Markov models, multi-component neural nets and up-to-date databases of known secondary structure assignments, PROTEUS is able to achieve among the highest reported levels of predictive accuracy for signal peptides (Q2 = 94%), membrane spanning helices (Q2 = 87%) and secondary structure (Q3 score of 81.3%). PROTEUS2's homology modeling services also provide high quality 3D models that compare favorably with those generated by SWISS-MODEL and 3D JigSaw (within 0.2 A RMSD). The average PROTEUS2 prediction takes approximately 3 min per query sequence. The PROTEUS2 server along with source code for many of its modules is accessible a http://wishart.biology.ualberta.ca/proteus2.

  20. Integrated Design Software Predicts the Creep Life of Monolithic Ceramic Components

    NASA Technical Reports Server (NTRS)

    1996-01-01

    Significant improvements in propulsion and power generation for the next century will require revolutionary advances in high-temperature materials and structural design. Advanced ceramics are candidate materials for these elevated-temperature applications. As design protocols emerge for these material systems, designers must be aware of several innate features, including the degrading ability of ceramics to carry sustained load. Usually, time-dependent failure in ceramics occurs because of two different, delayedfailure mechanisms: slow crack growth and creep rupture. Slow crack growth initiates at a preexisting flaw and continues until a critical crack length is reached, causing catastrophic failure. Creep rupture, on the other hand, occurs because of bulk damage in the material: void nucleation and coalescence that eventually leads to macrocracks which then propagate to failure. Successful application of advanced ceramics depends on proper characterization of material behavior and the use of an appropriate design methodology. The life of a ceramic component can be predicted with the NASA Lewis Research Center's Ceramics Analysis and Reliability Evaluation of Structures (CARES) integrated design programs. CARES/CREEP determines the expected life of a component under creep conditions, and CARES/LIFE predicts the component life due to fast fracture and subcritical crack growth. The previously developed CARES/LIFE program has been used in numerous industrial and Government applications.

  1. Sizing Structures and Predicting Weight of a Spacecraft

    NASA Technical Reports Server (NTRS)

    Cerro, Jeffrey; Shore, C. P.

    2006-01-01

    EZDESIT is a computer program for choosing the sizes of structural components and predicting the weight of a spacecraft, aircraft, or other vehicle. In designing a vehicle, EZDESIT is used in conjunction with a finite-element structural- analysis program: Each structural component is sized within EZDESIT to withstand the loads expected to be encountered during operation, then the weights of all the structural finite elements are added to obtain the structural weight of the vehicle. The sizing of the structural components elements also alters the stiffness properties of the finiteelement model. The finite-element analysis and structural component sizing are iterated until the weight of the vehicle converges to a prescribed iterative difference.

  2. DSSTox EPA Integrated Risk Information System Structure ...

    EPA Pesticide Factsheets

    EPA's Integrated Risk Information System (IRIS) database was developed and is maintained by EPA's Office of Research and Developement, National Center for Environmental Assessment. IRIS is a database of human health effects that may result from exposure to various substances found in the environment. The information in IRIS is intended for those without extensive training in toxicology, but with some knowledge of sciences. IRIS chemical files contain descriptive and quantitative information in oral reference doses and inhalation reference concentrations and hazard identification, oral slope factors, and oral and inhalation unit risks for carcinogenic effects.

  3. Distance matrix-based approach to protein structure prediction.

    PubMed

    Kloczkowski, Andrzej; Jernigan, Robert L; Wu, Zhijun; Song, Guang; Yang, Lei; Kolinski, Andrzej; Pokarowski, Piotr

    2009-03-01

    Much structural information is encoded in the internal distances; a distance matrix-based approach can be used to predict protein structure and dynamics, and for structural refinement. Our approach is based on the square distance matrix D = [r(ij)(2)] containing all square distances between residues in proteins. This distance matrix contains more information than the contact matrix C, that has elements of either 0 or 1 depending on whether the distance r (ij) is greater or less than a cutoff value r (cutoff). We have performed spectral decomposition of the distance matrices D = sigma lambda(k)V(k)V(kT), in terms of eigenvalues lambda kappa and the corresponding eigenvectors v kappa and found that it contains at most five nonzero terms. A dominant eigenvector is proportional to r (2)--the square distance of points from the center of mass, with the next three being the principal components of the system of points. By predicting r (2) from the sequence we can approximate a distance matrix of a protein with an expected RMSD value of about 7.3 A, and by combining it with the prediction of the first principal component we can improve this approximation to 4.0 A. We can also explain the role of hydrophobic interactions for the protein structure, because r is highly correlated with the hydrophobic profile of the sequence. Moreover, r is highly correlated with several sequence profiles which are useful in protein structure prediction, such as contact number, the residue-wise contact order (RWCO) or mean square fluctuations (i.e. crystallographic temperature factors). We have also shown that the next three components are related to spatial directionality of the secondary structure elements, and they may be also predicted from the sequence, improving overall structure prediction. We have also shown that the large number of available HIV-1 protease structures provides a remarkable sampling of conformations, which can be viewed as direct structural information about the

  4. Prediction of Harmful Human Health Effects of Chemicals from Structure

    NASA Astrophysics Data System (ADS)

    Cronin, Mark T. D.

    There is a great need to assess the harmful effects of chemicals to which man is exposed. Various in silico techniques including chemical grouping and category formation, as well as the use of (Q)SARs can be applied to predict the toxicity of chemicals for a number of toxicological effects. This chapter provides an overview of the state of the art of the prediction of the harmful effects of chemicals to human health. A variety of existing data can be used to obtain information; many such data are formalized into freely available and commercial databases. (Q)SARs can be developed (as illustrated with reference to skin sensitization) for local and global data sets. In addition, chemical grouping techniques can be applied on "similar" chemicals to allow for read-across predictions. Many "expert systems" are now available that incorporate these approaches. With these in silico approaches available, the techniques to apply them successfully have become essential. Integration of different in silico approaches with each other, as well as with other alternative approaches, e.g., in vitro and -omics through the development of integrated testing strategies, will assist in the more efficient prediction of the harmful health effects of chemicals

  5. Finite Element Prediction of Acoustic Scattering and Radiation from Submerged Elastic Structures

    NASA Technical Reports Server (NTRS)

    Everstine, G. C.; Henderson, F. M.; Lipman, R. R.

    1984-01-01

    A finite element formulation is derived for the scattering and radiation of acoustic waves from submerged elastic structures. The formulation uses as fundamental unknowns the displacement in the structure and a velocity potential in the field. Symmetric coefficient matrices result. The outer boundary of the fluid region is terminated with an approximate local wave-absorbing boundary condition which assumes that outgoing waves are locally planar. The finite element model is capable of predicting only the near-field acoustic pressures. Far-field sound pressure levels may be determined by integrating the surface pressures and velocities over the wet boundary of the structure using the Helmholtz integral. Comparison of finite element results with analytic results show excellent agreement. The coupled fluid-structure problem may be solved with general purpose finite element codes by using an analogy between the equations of elasticity and the wave equation of linear acoustics.

  6. Exploration of Genomic, Proteomic, and Histopathological Image Data Integration Methods for Clinical Prediction

    PubMed Central

    Poruthoor, A.; Phan, J.H.; Kothari, S.; Wang, May D.

    2016-01-01

    The emergence of large multi-platform and multi-scale data repositories in biomedicine has enabled the exploration of data integration for holistic decision making. In this research, we investigate multi-modal genomic, proteomic, and histopathological image data integration for prediction of ovarian cancer clinical endpoints in The Cancer Genome Atlas (TCGA). Specifically, we study two data integration techniques, simple data concatenation and ensemble classification, to determine whether they can improve prediction of ovarian cancer grade or patient survival. Results indicate that integration via ensemble classification is more effective than simple data concatenation. We also highlight several key factors impacting data integration outcome such as predictability of endpoint, class prevalence, and unbalanced representation of features from different data modalities.

  7. Embedded Sensor Array Development for Composite Structure Integrity Monitoring

    SciTech Connect

    Kumar, A.; Bryan, W. L.; Clonts, L. G.; Franks, S.

    2007-06-26

    The purpose of this Cooperative Research and Development Agreement (CRADA) between UT-Battelle, LLC (the "Contractor") and Accellent Technologies, Inc. (the "Participant") was for the development of an embedded ultrasonic sensor system for composite structure integrity monitoring.

  8. Electromechanical co-design and experiment of structurally integrated antenna

    NASA Astrophysics Data System (ADS)

    Zhou, Jinzhu; Huang, Jin; Song, Liwei; Zhang, Dan; Ma, Yunchao

    2015-03-01

    This paper proposes an electromechanical co-design method of a structurally integrated antenna to simultaneously meet mechanical and electrical requirements. The method consists of three stages. The first stage involves finishing an initial design of the microstrip antenna without a facesheet or honeycomb, according to some predefined performances. Subsequently, the facesheet and honeycomb of the structurally integrated antenna are designed using an electromechanical co-design optimization. Based on the results from the first and second stages, a fine full-wave electromagnetic model is developed and the coarse design results are further optimized to meet the electrical performance. The co-design method is applied to the design of a 2.5 GHz structurally integrated antenna, and then the designed antenna is fabricated. Experiments from the mechanical and electrical performances are conducted, and the results confirm the effectiveness of the co-design method. This method shows great promise for the multidisciplinary design of a structurally integrated antenna.

  9. Structure-based Methods for Computational Protein Functional Site Prediction

    PubMed Central

    Dukka, B KC

    2013-01-01

    Due to the advent of high throughput sequencing techniques and structural genomic projects, the number of gene and protein sequences has been ever increasing. Computational methods to annotate these genes and proteins are even more indispensable. Proteins are important macromolecules and study of the function of proteins is an important problem in structural bioinformatics. This paper discusses a number of methods to predict protein functional site especially focusing on protein ligand binding site prediction. Initially, a short overview is presented on recent advances in methods for selection of homologous sequences. Furthermore, a few recent structural based approaches and sequence-and-structure based approaches for protein functional sites are discussed in details. PMID:24688745

  10. PSPP: A Protein Structure Prediction Pipeline for Computing Clusters

    DTIC Science & Technology

    2009-07-01

    Clusters 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7...Fold recognition/threading [34] [60] PSIPRED Jones Secondary structure prediction [21] [61] Rosetta Baker Ab initio folder [41] [62] SCOP/ ASTRAL Chothia...the folds of the models that result from the Rosetta code, the structures of the top few models are compared against ASTRAL PDB-style coordinates of

  11. Addressable-Matrix Integrated-Circuit Test Structure

    NASA Technical Reports Server (NTRS)

    Sayah, Hoshyar R.; Buehler, Martin G.

    1991-01-01

    Method of quality control based on use of row- and column-addressable test structure speeds collection of data on widths of resistor lines and coverage of steps in integrated circuits. By use of straightforward mathematical model, line widths and step coverages deduced from measurements of electrical resistances in each of various combinations of lines, steps, and bridges addressable in test structure. Intended for use in evaluating processes and equipment used in manufacture of application-specific integrated circuits.

  12. A system structure for predictive relations in penetration mechanics

    NASA Astrophysics Data System (ADS)

    Korjack, Thomas A.

    1992-02-01

    The availability of a software system yielding quick numerical models to predict ballistic behavior is a requisite for any research laboratory engaged in material behavior. What is especially true about accessibility of rapid prototyping for terminal impaction is the enhancement of a system structure which will direct the specific material and impact situation towards a specific predictive model. This is of particular importance when the ranges of validity are at stake and the pertinent constraints associated with the impact are unknown. Hence, a compilation of semiempirical predictive penetration relations for various physical phenomena has been organized into a data structure for the purpose of developing a knowledge-based decision aided expert system to predict the terminal ballistic behavior of projectiles and targets. The ranges of validity and constraints of operation of each model were examined and cast into a decision tree structure to include target type, target material, projectile types, projectile materials, attack configuration, and performance or damage measures. This decision system implements many penetration relations, identifies formulas that match user-given conditions, and displays the predictive relation coincident with the match in addition to a numerical solution. The physical regimes under consideration encompass the hydrodynamic, transitional, and solid; the targets are either semi-infinite or plate, and the projectiles include kinetic and chemical energy. A preliminary databases has been constructed to allow further development of inductive and deductive reasoning techniques applied to ballistic situations involving terminal mechanics.

  13. CENTROIDFOLD: a web server for RNA secondary structure prediction.

    PubMed

    Sato, Kengo; Hamada, Michiaki; Asai, Kiyoshi; Mituyama, Toutai

    2009-07-01

    The CENTROIDFOLD web server (http://www.ncrna.org/centroidfold/) is a web application for RNA secondary structure prediction powered by one of the most accurate prediction engine. The server accepts two kinds of sequence data: a single RNA sequence and a multiple alignment of RNA sequences. It responses with a prediction result shown as a popular base-pair notation and a graph representation. PDF version of the graph representation is also available. For a multiple alignment sequence, the server predicts a common secondary structure. Usage of the server is quite simple. You can paste a single RNA sequence (FASTA or plain sequence text) or a multiple alignment (CLUSTAL-W format) into the textarea then click on the 'execute CentroidFold' button. The server quickly responses with a prediction result. The major advantage of this server is that it employs our original CentroidFold software as its prediction engine which scores the best accuracy in our benchmark results. Our web server is freely available with no login requirement.

  14. Development of an integrated method for long-term water quality prediction using seasonal climate forecast

    NASA Astrophysics Data System (ADS)

    Cho, Jaepil; Shin, Chang-Min; Choi, Hwan-Kyu; Kim, Kyong-Hyeon; Choi, Ji-Yong

    2016-10-01

    The APEC Climate Center (APCC) produces climate prediction information utilizing a multi-climate model ensemble (MME) technique. In this study, four different downscaling methods, in accordance with the degree of utilizing the seasonal climate prediction information, were developed in order to improve predictability and to refine the spatial scale. These methods include: (1) the Simple Bias Correction (SBC) method, which directly uses APCC's dynamic prediction data with a 3 to 6 month lead time; (2) the Moving Window Regression (MWR) method, which indirectly utilizes dynamic prediction data; (3) the Climate Index Regression (CIR) method, which predominantly uses observation-based climate indices; and (4) the Integrated Time Regression (ITR) method, which uses predictors selected from both CIR and MWR. Then, a sampling-based temporal downscaling was conducted using the Mahalanobis distance method in order to create daily weather inputs to the Soil and Water Assessment Tool (SWAT) model. Long-term predictability of water quality within the Wecheon watershed of the Nakdong River Basin was evaluated. According to the Korean Ministry of Environment's Provisions of Water Quality Prediction and Response Measures, modeling-based predictability was evaluated by using 3-month lead prediction data issued in February, May, August, and November as model input of SWAT. Finally, an integrated approach, which takes into account various climate information and downscaling methods for water quality prediction, was presented. This integrated approach can be used to prevent potential problems caused by extreme climate in advance.

  15. Process for predicting structural performance of mechanical systems

    DOEpatents

    Gardner, D.R.; Hendrickson, B.A.; Plimpton, S.J.; Attaway, S.W.; Heinstein, M.W.; Vaughan, C.T.

    1998-05-19

    A process for predicting the structural performance of a mechanical system represents the mechanical system by a plurality of surface elements. The surface elements are grouped according to their location in the volume occupied by the mechanical system so that contacts between surface elements can be efficiently located. The process is well suited for efficient practice on multiprocessor computers. 12 figs.

  16. Process for predicting structural performance of mechanical systems

    DOEpatents

    Gardner, David R.; Hendrickson, Bruce A.; Plimpton, Steven J.; Attaway, Stephen W.; Heinstein, Martin W.; Vaughan, Courtenay T.

    1998-01-01

    A process for predicting the structural performance of a mechanical system represents the mechanical system by a plurality of surface elements. The surface elements are grouped according to their location in the volume occupied by the mechanical system so that contacts between surface elements can be efficiently located. The process is well suited for efficient practice on multiprocessor computers.

  17. A Web-Accessible Protein Structure Prediction Pipeline

    DTIC Science & Technology

    2009-06-01

    almost all of these programs, the input is a protein position-specific substitution matrix ( PSSM ), in addition to the protein sequence itself. We...calculate a single PSSM for each of the input proteins using PSI-BLAST[8] and the NR database. Once the structural properties are predicted using the

  18. Structural Damage Prediction and Analysis for Hypervelocity Impact: Consulting

    NASA Technical Reports Server (NTRS)

    1995-01-01

    A portion of the contract NAS8-38856, 'Structural Damage Prediction and Analysis for Hypervelocity Impacts,' from NASA Marshall Space Flight Center (MSFC), included consulting which was to be documented in the final report. This attachment to the final report contains memos produced as part of that consulting.

  19. Multidimensional models for predicting muscle structure and fascicle pennation.

    PubMed

    Randhawa, Avleen; Wakeling, James M

    2015-10-07

    Pennation angles change during muscle contraction and must be tracked by muscle models. When muscles contract they can change in depth (distance between the bounding sheets of aponeurosis) or width, and this is related to pennation angle and muscle fascicle length. As a simplification to these relationships, many models of pennate muscle assume a constant distance between aponeuroses during contraction (constant depth). It is possible that these 1D models do not recreate the internal structure of muscles adequately, whereas 2D panel models that assume a constant panel area, or 3D models that assume a constant muscle volume may better predict the structural changes that occur within muscle during contraction. However, these ideas have never been validated in man. The purpose of this study was to test the accuracy with which 1D, 2D or 3D structural models of muscle could predict the pennation and muscle depth within the medial gastrocnemius (MG) and lateral gastrocnemius (LG) in man during ankle plantarflexions. The 1D model, by definition, was unable to account for changes in muscle depth. The 2D model predicted change in depth as the aponeurosis was loaded, but could only allow a decrease in depth as the aponeurosis is stretched. This was not sufficient to predict the increases in depth that occur in the LG during plantarflexion. The 3D model had the ability to predict either increases or decreases in depth during the ankle plantarflexions and predicted opposing changes in depth that occurred between the MG and LG, whilst simultaneously predicting the pennation more accurately than the 1D or 2D models. However, when using mean parameters, the 3D model performed no better than the more simple 1D model, and so if the intent of a model is purely to establish a good relation between fascicle length and pennation then the 1D model is a suitable choice for these muscles.

  20. Predictive modeling of neuroanatomic structures for brain atrophy detection

    NASA Astrophysics Data System (ADS)

    Hu, Xintao; Guo, Lei; Nie, Jingxin; Li, Kaiming; Liu, Tianming

    2010-03-01

    In this paper, we present an approach of predictive modeling of neuroanatomic structures for the detection of brain atrophy based on cross-sectional MRI image. The underlying premise of applying predictive modeling for atrophy detection is that brain atrophy is defined as significant deviation of part of the anatomy from what the remaining normal anatomy predicts for that part. The steps of predictive modeling are as follows. The central cortical surface under consideration is reconstructed from brain tissue map and Regions of Interests (ROI) on it are predicted from other reliable anatomies. The vertex pair-wise distance between the predicted vertex and the true one within the abnormal region is expected to be larger than that of the vertex in normal brain region. Change of white matter/gray matter ratio within a spherical region is used to identify the direction of vertex displacement. In this way, the severity of brain atrophy can be defined quantitatively by the displacements of those vertices. The proposed predictive modeling method has been evaluated by using both simulated atrophies and MRI images of Alzheimer's disease.

  1. 1. View, structures in Systems Integration Laboratory complex, looking northwest. ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    1. View, structures in Systems Integration Laboratory complex, looking northwest. The twin gantry structure in the center is the Systems Integration Laboratory (T-28). To its immediate left in the foreground is a truck well, concrete retaining wall, piping, and stack associated with the oxidizer vault storage area. To the immediate right of T-28 is the concrete Signal Transfer Building (T-28A). At the extreme right is the Long-Term Hydrazine Silo (T-28E). - Air Force Plant PJKS, Systems Integration Laboratory, Waterton Canyon Road & Colorado Highway 121, Lakewood, Jefferson County, CO

  2. Integrated Strategy Improves the Prediction Accuracy of miRNA in Large Dataset

    PubMed Central

    Lipps, David; Devineni, Sree

    2016-01-01

    MiRNAs are short non-coding RNAs of about 22 nucleotides, which play critical roles in gene expression regulation. The biogenesis of miRNAs is largely determined by the sequence and structural features of their parental RNA molecules. Based on these features, multiple computational tools have been developed to predict if RNA transcripts contain miRNAs or not. Although being very successful, these predictors started to face multiple challenges in recent years. Many predictors were optimized using datasets of hundreds of miRNA samples. The sizes of these datasets are much smaller than the number of known miRNAs. Consequently, the prediction accuracy of these predictors in large dataset becomes unknown and needs to be re-tested. In addition, many predictors were optimized for either high sensitivity or high specificity. These optimization strategies may bring in serious limitations in applications. Moreover, to meet continuously raised expectations on these computational tools, improving the prediction accuracy becomes extremely important. In this study, a meta-predictor mirMeta was developed by integrating a set of non-linear transformations with meta-strategy. More specifically, the outputs of five individual predictors were first preprocessed using non-linear transformations, and then fed into an artificial neural network to make the meta-prediction. The prediction accuracy of meta-predictor was validated using both multi-fold cross-validation and independent dataset. The final accuracy of meta-predictor in newly-designed large dataset is improved by 7% to 93%. The meta-predictor is also proved to be less dependent on datasets, as well as has refined balance between sensitivity and specificity. This study has two folds of importance: First, it shows that the combination of non-linear transformations and artificial neural networks improves the prediction accuracy of individual predictors. Second, a new miRNA predictor with significantly improved prediction accuracy

  3. MS-kNN: protein function prediction by integrating multiple data sources

    PubMed Central

    2013-01-01

    Background Protein function determination is a key challenge in the post-genomic era. Experimental determination of protein functions is accurate, but time-consuming and resource-intensive. A cost-effective alternative is to use the known information about sequence, structure, and functional properties of genes and proteins to predict functions using statistical methods. In this paper, we describe the Multi-Source k-Nearest Neighbor (MS-kNN) algorithm for function prediction, which finds k-nearest neighbors of a query protein based on different types of similarity measures and predicts its function by weighted averaging of its neighbors' functions. Specifically, we used 3 data sources to calculate the similarity scores: sequence similarity, protein-protein interactions, and gene expressions. Results We report the results in the context of 2011 Critical Assessment of Function Annotation (CAFA). Prior to CAFA submission deadline, we evaluated our algorithm on 1,302 human test proteins that were represented in all 3 data sources. Using only the sequence similarity information, MS-kNN had term-based Area Under the Curve (AUC) accuracy of Gene Ontology (GO) molecular function predictions of 0.728 when 7,412 human training proteins were used, and 0.819 when 35,622 training proteins from multiple eukaryotic and prokaryotic organisms were used. By aggregating predictions from all three sources, the AUC was further improved to 0.848. Similar result was observed on prediction of GO biological processes. Testing on 595 proteins that were annotated after the CAFA submission deadline showed that overall MS-kNN accuracy was higher than that of baseline algorithms Gotcha and BLAST, which were based solely on sequence similarity information. Since only 10 of the 595 proteins were represented by all 3 data sources, and 66 by two data sources, the difference between 3-source and one-source MS-kNN was rather small. Conclusions Based on our results, we have several useful insights: (1

  4. Integrative Structural Biomechanical Concepts of Ankylosing Spondylitis

    PubMed Central

    Masi, Alfonse T.; Nair, Kalyani; Andonian, Brian J.; Prus, Kristina M.; Kelly, Joseph; Sanchez, Jose R.; Henderson, Jacqueline

    2011-01-01

    Ankylosing spondylitis (AS) is not fully explained by inflammatory processes. Clinical, epidemiological, genetic, and course of disease features indicate additional host-related risk processes and predispositions. Collectively, the pattern of predisposition to onset in adolescent and young adult ages, male preponderance, and widely varied severity of AS is unique among rheumatic diseases. However, this pattern could reflect biomechanical and structural differences between the sexes, naturally occurring musculoskeletal changes over life cycles, and a population polymorphism. During juvenile development, the body is more flexible and weaker than during adolescent maturation and young adulthood, when strengthening and stiffening considerably increase. During middle and later ages, the musculoskeletal system again weakens. The novel concept of an innate axial myofascial hypertonicity reflects basic mechanobiological principles in human function, tissue reactivity, and pathology. However, these processes have been little studied and require critical testing. The proposed physical mechanisms likely interact with recognized immunobiological pathways. The structural biomechanical processes and tissue reactions might possibly precede initiation of other AS-related pathways. Research in the combined structural mechanobiology and immunobiology processes promises to improve understanding of the initiation and perpetuation of AS than prevailing concepts. The combined processes might better explain characteristic enthesopathic and inflammatory processes in AS. PMID:22216409

  5. Integrated aerodynamic-structural-control wing design

    NASA Technical Reports Server (NTRS)

    Rais-Rohani, M.; Haftka, R. T.; Grossman, B.; Unger, E. R.

    1992-01-01

    The aerodynamic-structural-control design of a forward-swept composite wing for a high subsonic transport aircraft is considered. The structural analysis is based on a finite-element method. The aerodynamic calculations are based on a vortex-lattice method, and the control calculations are based on an output feedback control. The wing is designed for minimum weight subject to structural, performance/aerodynamic and control constraints. Efficient methods are used to calculate the control-deflection and control-effectiveness sensitivities which appear as second-order derivatives in the control constraint equations. To suppress the aeroelastic divergence of the forward-swept wing, and to reduce the gross weight of the design aircraft, two separate cases are studied: (1) combined application of aeroelastic tailoring and active controls; and (2) aeroelastic tailoring alone. The results of this study indicated that, for this particular example, aeroelastic tailoring is sufficient for suppressing the aeroelastic divergence, and the use of active controls was not necessary.

  6. Predicted performance of an integrated modular engine system

    NASA Technical Reports Server (NTRS)

    Binder, Michael; Felder, James L.

    1993-01-01

    Space vehicle propulsion systems are traditionally comprised of a cluster of discrete engines, each with its own set of turbopumps, valves, and a thrust chamber. The Integrated Modular Engine (IME) concept proposes a vehicle propulsion system comprised of multiple turbopumps, valves, and thrust chambers which are all interconnected. The IME concept has potential advantages in fault-tolerance, weight, and operational efficiency compared with the traditional clustered engine configuration. The purpose of this study is to examine the steady-state performance of an IME system with various components removed to simulate fault conditions. An IME configuration for a hydrogen/oxygen expander cycle propulsion system with four sets of turbopumps and eight thrust chambers has been modeled using the Rocket Engine Transient Simulator (ROCETS) program. The nominal steady-state performance is simulated, as well as turbopump thrust chamber and duct failures. The impact of component failures on system performance is discussed in the context of the system's fault tolerant capabilities.

  7. Surface Integrity in Turning of Annealed Brass: Hardness Prediction

    NASA Astrophysics Data System (ADS)

    Zurita, O.; Di Graci, V.

    2012-07-01

    The purpose of this study was to obtain a comprehensive understanding of the effects of cutting parameters (depth of cut, feed rate, and cutting speed) on the surface integrity of, in terms of superficial hardening, annealed brass during a turning process. The results indicate that no significant phase transformations occurred for any of the turning conditions evaluated; however, microstructural changes were observed, as well as changes in the superficial hardness were measured. It was found that when the studied cutting parameters increase, the superficial hardness increases, with the cutting speed having less influence (2.56%), and feed rate having the greatest effect (22.67%). Finally, a mathematical expression is proposed, which relates the cutting parameters to the maximum hardness obtained for a given cutting condition.

  8. Predicted performance of an Integrated Modular Engine system

    NASA Technical Reports Server (NTRS)

    Binder, Michael; Felder, James L.

    1993-01-01

    Space vehicle propulsion systems are traditionally comprised of a cluster of discrete engines, each with its own set of turbopumps, valves, and a thrust chamber. The Integrated Modular Engine (IME) concept proposes a vehicle propulsion system comprised of multiple turbopumps, valves, and thrust chambers which are all interconnected. The IME concept has potential advantages in fault-tolerance, weight, and operational efficiency compared with the traditional clustered engine configuration. The purpose of this study is to examine the steady-state performance of an IME system with various components removed to simulate fault conditions. An IME configuration for a hydrogen/oxygen expander cycle propulsion system with four sets of turbopumps and eight thrust chambers has been modeled using the Rocket Engine Transient Simulator program. The nominal steady-state performance is simulated, as well as turbopump, thrust chamber, and duct failures. The impact of component failures on system performance is discussed in the context of the system's fault tolerant capabilities.

  9. Prediction of RNA secondary structure, including pseudoknotting, by computer simulation.

    PubMed Central

    Abrahams, J P; van den Berg, M; van Batenburg, E; Pleij, C

    1990-01-01

    A computer program is presented which determines the secondary structure of linear RNA molecules by simulating a hypothetical process of folding. This process implies the concept of 'nucleation centres', regions in RNA which locally trigger the folding. During the simulation, the RNA is allowed to fold into pseudoknotted structures, unlike all other programs predicting RNA secondary structure. The simulation uses published, experimentally determined free energy values for nearest neighbour base pair stackings and loop regions, except for new extrapolated values for loops larger than seven nucleotides. The free energy value for a loop arising from pseudoknot formation is set to a single, estimated value of 4.2 kcal/mole. Especially in the case of long RNA sequences, our program appears superior to other secondary structure predicting programs described so far, as tests on tRNAs, the LSU intron of Tetrahymena thermophila and a number of plant viral RNAs show. In addition, pseudoknotted structures are often predicted successfully. The program is written in mainframe APL and is adapted to run on IBM compatible PCs, Atari ST and Macintosh personal computers. On an 8 MHz 8088 standard PC without coprocessor, using STSC APL, it folds a sequence of 700 nucleotides in one and a half hour. PMID:1693421

  10. RNA Secondary Structure Prediction Using High-throughput SHAPE

    PubMed Central

    Purzycka, Katarzyna J.; Rausch, Jason W.; Le Grice, Stuart F.J.

    2013-01-01

    Understanding the function of RNA involved in biological processes requires a thorough knowledge of RNA structure. Toward this end, the methodology dubbed "high-throughput selective 2' hydroxyl acylation analyzed by primer extension", or SHAPE, allows prediction of RNA secondary structure with single nucleotide resolution. This approach utilizes chemical probing agents that preferentially acylate single stranded or flexible regions of RNA in aqueous solution. Sites of chemical modification are detected by reverse transcription of the modified RNA, and the products of this reaction are fractionated by automated capillary electrophoresis (CE). Since reverse transcriptase pauses at those RNA nucleotides modified by the SHAPE reagents, the resulting cDNA library indirectly maps those ribonucleotides that are single stranded in the context of the folded RNA. Using ShapeFinder software, the electropherograms produced by automated CE are processed and converted into nucleotide reactivity tables that are themselves converted into pseudo-energy constraints used in the RNAStructure (v5.3) prediction algorithm. The two-dimensional RNA structures obtained by combining SHAPE probing with in silico RNA secondary structure prediction have been found to be far more accurate than structures obtained using either method alone. PMID:23748604

  11. A Model for Predicting Integrated Man-Machine System Reliability: Model Logic and Description

    DTIC Science & Technology

    1974-11-01

    A MODEL FOR PREDICTING INTEGRATED MAN-MACHINE SYSTEMS RELIABILITY prepared for Naval Si nand Deparrmem aw nr. Con :’III’lit UNCLASSIFIED...was substantially modified so as to allow its use for system reliability and system availability predictive purposes. The resultant new model is...from 4 to 20 members was substantially modified so as to allow its use for system reliability and system availability predictive purposes. The

  12. Integrated controls-structures optimization of a large space structure

    NASA Technical Reports Server (NTRS)

    Padula, Sharon L.; Walsh, Joanne L.; Sandridge, Chris A.; Haftka, Raphael T.

    1990-01-01

    A technique for the simultaneous optimization of structural and control elements of a large space structure is developed and demonstrated for a test problem, the NASA COFS-I Mast Flight System. General-purpose control and structural-analysis codes are applied directly to a large detailed model, with realistic objective and constraint functions. The steps in the process (structural optimization, control optimization, and system coordination) are described and illustrated with diagrams; the numerical implementation (using different computers for different steps) is discussed; and results showing significant design improvements in three COFS-I configurations are presented in graphs. When the weights of both structure and power-generating equipment are taken into account, a 40-bay truss design is found to be better than designs with 42 or 44 bays.

  13. Three-dimensional protein structure prediction: Methods and computational strategies.

    PubMed

    Dorn, Márcio; E Silva, Mariel Barbachan; Buriol, Luciana S; Lamb, Luis C

    2014-10-12

    A long standing problem in structural bioinformatics is to determine the three-dimensional (3-D) structure of a protein when only a sequence of amino acid residues is given. Many computational methodologies and algorithms have been proposed as a solution to the 3-D Protein Structure Prediction (3-D-PSP) problem. These methods can be divided in four main classes: (a) first principle methods without database information; (b) first principle methods with database information; (c) fold recognition and threading methods; and (d) comparative modeling methods and sequence alignment strategies. Deterministic computational techniques, optimization techniques, data mining and machine learning approaches are typically used in the construction of computational solutions for the PSP problem. Our main goal with this work is to review the methods and computational strategies that are currently used in 3-D protein prediction.

  14. Structure prediction and targeted synthesis: a new Na(n)N2 diazenide crystalline structure.

    PubMed

    Zhang, Xiuwen; Zunger, Alex; Trimarchi, Giancarlo

    2010-11-21

    Significant progress in theoretical and computational techniques for predicting stable crystal structures has recently begun to stimulate targeted synthesis of such predicted structures. Using a global space-group optimization (GSGO) approach that locates ground-state structures and stable stoichiometries from first-principles energy functionals by objectively starting from randomly selected lattice vectors and random atomic positions, we predict the first alkali diazenide compound Na(n)N(2), manifesting homopolar N-N bonds. The previously predicted Na(3)N structure manifests only heteropolar Na-N bonds and has positive formation enthalpy. It was calculated based on local Hartree-Fock relaxation of a fixed-structure type (Li(3)P-type) found by searching an electrostatic point-ion model. Synthesis attempts of this positive ΔH compound using activated nitrogen yielded another structure (anti-ReO(3)-type). The currently predicted (negative formation enthalpy) diazenide Na(2)N(2) completes the series of previously known BaN(2) and SrN(2) diazenides where the metal sublattice transfers charge into the empty N(2) Π(g) orbital. This points to a new class of alkali nitrides with fundamentally different bonding, i.e., homopolar rather than heteropolar bonds and, at the same time, illustrates some of the crucial subtleties and pitfalls involved in structure predictions versus planned synthesis. Attempts at synthesis of the stable Na(2)N(2) predicted here will be interesting.

  15. Application of Functional Use Predictions to Aid in Structure ...

    EPA Pesticide Factsheets

    Humans are potentially exposed to thousands of anthropogenic chemicals in commerce. Recent work has shown that the bulk of this exposure may occur in near-field indoor environments (e.g., home, school, work, etc.). Advances in suspect screening analyses (SSA) now allow an improved understanding of the chemicals present in these environments. However, due to the nature of suspect screening techniques, investigators are often left with chemical formula predictions, with the possibility of many chemical structures matching to each formula. Here, newly developed quantitative structure-use relationship (QSUR) models are used to identify potential exposure sources for candidate structures. Previously, a suspect screening workflow was introduced and applied to house dust samples collected from the U.S. Department of Housing and Urban Development’s American Healthy Homes Survey (AHHS) [Rager, et al., Env. Int. 88 (2016)]. This workflow utilized the US EPA’s Distributed Structure-Searchable Toxicity (DSSTox) Database to link identified molecular features to molecular formulas, and ultimately chemical structures. Multiple QSUR models were applied to support the evaluation of candidate structures. These QSURs predict the likelihood of a chemical having a functional use commonly associated with consumer products having near-field use. For 3,228 structures identified as possible chemicals in AHHS house dust samples, we were able to obtain the required descriptors to appl

  16. 'Unite and conquer': enhanced prediction of protein subcellular localization by integrating multiple specialized tools

    PubMed Central

    Shen, Yao Qing; Burger, Gertraud

    2007-01-01

    Background Knowing the subcellular location of proteins provides clues to their function as well as the interconnectivity of biological processes. Dozens of tools are available for predicting protein location in the eukaryotic cell. Each tool performs well on certain data sets, but their predictions often disagree for a given protein. Since the individual tools each have particular strengths, we set out to integrate them in a way that optimally exploits their potential. The method we present here is applicable to various subcellular locations, but tailored for predicting whether or not a protein is localized in mitochondria. Knowledge of the mitochondrial proteome is relevant to understanding the role of this organelle in global cellular processes. Results In order to develop a method for enhanced prediction of subcellular localization, we integrated the outputs of available localization prediction tools by several strategies, and tested the performance of each strategy with known mitochondrial proteins. The accuracy obtained (up to 92%) surpasses by far the individual tools. The method of integration proved crucial to the performance. For the prediction of mitochondrion-located proteins, integration via a two-layer decision tree clearly outperforms simpler methods, as it allows emphasis of biologically relevant features such as the mitochondrial targeting peptide and transmembrane domains. Conclusion We developed an approach that enhances the prediction accuracy of mitochondrial proteins by uniting the strength of specialized tools. The combination of machine-learning based integration with biological expert knowledge leads to improved performance. This approach also alleviates the conundrum of how to choose between conflicting predictions. Our approach is easy to implement, and applicable to predicting subcellular locations other than mitochondria, as well as other biological features. For a trial of our approach, we provide a webservice for mitochondrial protein

  17. Integration of Multi-Modal Biomedical Data to Predict Cancer Grade and Patient Survival

    PubMed Central

    Phan, John H.; Hoffman, Ryan; Kothari, Sonal; Wu, Po-Yen; Wang, May D.

    2016-01-01

    The Big Data era in Biomedical research has resulted in large-cohort data repositories such as The Cancer Genome Atlas (TCGA). These repositories routinely contain hundreds of matched patient samples for genomic, proteomic, imaging, and clinical data modalities, enabling holistic and multi-modal integrative analysis of human disease. Using TCGA renal and ovarian cancer data, we conducted a novel investigation of multi-modal data integration by combining histopathological image and RNA-seq data. We compared the performances of two integrative prediction methods: majority vote and stacked generalization. Results indicate that integration of multiple data modalities improves prediction of cancer grade and outcome. Specifically, stacked generalization, a method that integrates multiple data modalities to produce a single prediction result, outperforms both single-data-modality prediction and majority vote. Moreover, stacked generalization reveals the contribution of each data modality (and specific features within each data modality) to the final prediction result and may provide biological insights to explain prediction performance. PMID:27493999

  18. Model reduction in integrated controls-structures design

    NASA Technical Reports Server (NTRS)

    Maghami, Peiman G.

    1993-01-01

    It is the objective of this paper to present a model reduction technique developed for the integrated controls-structures design of flexible structures. Integrated controls-structures design problems are typically posed as nonlinear mathematical programming problems, where the design variables consist of both structural and control parameters. In the solution process, both structural and control design variables are constantly changing; therefore, the dynamic characteristics of the structure are also changing. This presents a problem in obtaining a reduced-order model for active control design and analysis which will be valid for all design points within the design space. In other words, the frequency and number of the significant modes of the structure (modes that should be included) may vary considerably throughout the design process. This is also true as the locations and/or masses of the sensors and actuators change. Moreover, since the number of design evaluations in the integrated design process could easily run into thousands, any feasible order-reduction method should not require model reduction analysis at every design iteration. In this paper a novel and efficient technique for model reduction in the integrated controls-structures design process, which addresses these issues, is presented.

  19. Structural Integrity and Durability of Reusable Space Propulsion Systems

    NASA Technical Reports Server (NTRS)

    1987-01-01

    A two-day conference on the structural integrity and durability of reusable space propulsion systems was held on May 12 and 13, 1987, at the NASA Lewis research Center. Aerothermodynamic loads; instrumentation; fatigue, fracture, and constitutive modeling; and structural dynamics were discussed.

  20. A Fully Bayesian Approach to Improved Calibration and Prediction of Groundwater Models With Structure Error

    NASA Astrophysics Data System (ADS)

    Xu, T.; Valocchi, A. J.

    2014-12-01

    Effective water resource management typically relies on numerical models to analyse groundwater flow and solute transport processes. These models are usually subject to model structure error due to simplification and/or misrepresentation of the real system. As a result, the model outputs may systematically deviate from measurements, thus violating a key assumption for traditional regression-based calibration and uncertainty analysis. On the other hand, model structure error induced bias can be described statistically in an inductive, data-driven way based on historical model-to-measurement misfit. We adopt a fully Bayesian approach that integrates a Gaussian process error model to account for model structure error to the calibration, prediction and uncertainty analysis of groundwater models. The posterior distributions of parameters of the groundwater model and the Gaussian process error model are jointly inferred using DREAM, an efficient Markov chain Monte Carlo sampler. We test the usefulness of the fully Bayesian approach towards a synthetic case study of surface-ground water interaction under changing pumping conditions. We first illustrate through this example that traditional least squares regression without accounting for model structure error yields biased parameter estimates due to parameter compensation as well as biased predictions. In contrast, the Bayesian approach gives less biased parameter estimates. Moreover, the integration of a Gaussian process error model significantly reduces predictive bias and leads to prediction intervals that are more consistent with observations. The results highlight the importance of explicit treatment of model structure error especially in circumstances where subsequent decision-making and risk analysis require accurate prediction and uncertainty quantification. In addition, the data-driven error modelling approach is capable of extracting more information from observation data than using a groundwater model alone.

  1. Runoff prediction using an integrated hybrid modelling scheme

    NASA Astrophysics Data System (ADS)

    Remesan, Renji; Shamim, Muhammad Ali; Han, Dawei; Mathew, Jimson

    2009-06-01

    SummaryRainfall runoff is a very complicated process due to its nonlinear and multidimensional dynamics, and hence difficult to model. There are several options for a modeller to consider, for example: the type of input data to be used, the length of model calibration (training) data and whether or not the input data be treated as signals with different frequency bands so that they can be modelled separately. This paper describes a new hybrid modelling scheme to answer the above mentioned questions. The proposed methodology is based on a hybrid model integrating wavelet transformation, a modelling engine (Artificial Neural Network) and the Gamma Test. First, the Gamma Test is used to decide the required input data dimensions and its length. Second, the wavelet transformation decomposes the input signals into different frequency bands. Finally, a modelling engine (ANN in this study) is used to model the decomposed signals separately. The proposed scheme was tested using the Brue catchment, Southwest England, as a case study and has produced very positive results. The hybrid model outperforms all other models tested. This study has a wider implication in the hydrological modelling field since its general framework could be applied to other model combinations (e.g., model engine could be Support Vector Machines, neuro-fuzzy systems, or even a conceptual model. The signal decomposition could be carried out by Fourier transformation).

  2. Application of integrated fluid-thermal-structural analysis methods

    NASA Technical Reports Server (NTRS)

    Wieting, Allan R.; Dechaumphai, Pramote; Bey, Kim S.; Thornton, Earl A.; Morgan, Ken

    1988-01-01

    Hypersonic vehicles operate in a hostile aerothermal environment which has a significant impact on their aerothermostructural performance. Significant coupling occurs between the aerodynamic flow field, structural heat transfer, and structural response creating a multidisciplinary interaction. Interfacing state-of-the-art disciplinary analysis methods is not efficient, hence interdisciplinary analysis methods integrated into a single aerothermostructural analyzer are needed. The NASA Langley Research Center is developing such methods in an analyzer called LIFTS (Langley Integrated Fluid-Thermal-Structural) analyzer. The evolution and status of LIFTS is reviewed and illustrated through applications.

  3. Integrating Transcriptomic and Proteomic Data Using Predictive Regulatory Network Models of Host Response to Pathogens.

    PubMed

    Chasman, Deborah; Walters, Kevin B; Lopes, Tiago J S; Eisfeld, Amie J; Kawaoka, Yoshihiro; Roy, Sushmita

    2016-07-01

    Mammalian host response to pathogenic infections is controlled by a complex regulatory network connecting regulatory proteins such as transcription factors and signaling proteins to target genes. An important challenge in infectious disease research is to understand molecular similarities and differences in mammalian host response to diverse sets of pathogens. Recently, systems biology studies have produced rich collections of omic profiles measuring host response to infectious agents such as influenza viruses at multiple levels. To gain a comprehensive understanding of the regulatory network driving host response to multiple infectious agents, we integrated host transcriptomes and proteomes using a network-based approach. Our approach combines expression-based regulatory network inference, structured-sparsity based regression, and network information flow to infer putative physical regulatory programs for expression modules. We applied our approach to identify regulatory networks, modules and subnetworks that drive host response to multiple influenza infections. The inferred regulatory network and modules are significantly enriched for known pathways of immune response and implicate apoptosis, splicing, and interferon signaling processes in the differential response of viral infections of different pathogenicities. We used the learned network to prioritize regulators and study virus and time-point specific networks. RNAi-based knockdown of predicted regulators had significant impact on viral replication and include several previously unknown regulators. Taken together, our integrated analysis identified novel module level patterns that capture strain and pathogenicity-specific patterns of expression and helped identify important regulators of host response to influenza infection.

  4. Integrating Transcriptomic and Proteomic Data Using Predictive Regulatory Network Models of Host Response to Pathogens

    PubMed Central

    Chasman, Deborah; Walters, Kevin B.; Lopes, Tiago J. S.; Eisfeld, Amie J.; Kawaoka, Yoshihiro; Roy, Sushmita

    2016-01-01

    Mammalian host response to pathogenic infections is controlled by a complex regulatory network connecting regulatory proteins such as transcription factors and signaling proteins to target genes. An important challenge in infectious disease research is to understand molecular similarities and differences in mammalian host response to diverse sets of pathogens. Recently, systems biology studies have produced rich collections of omic profiles measuring host response to infectious agents such as influenza viruses at multiple levels. To gain a comprehensive understanding of the regulatory network driving host response to multiple infectious agents, we integrated host transcriptomes and proteomes using a network-based approach. Our approach combines expression-based regulatory network inference, structured-sparsity based regression, and network information flow to infer putative physical regulatory programs for expression modules. We applied our approach to identify regulatory networks, modules and subnetworks that drive host response to multiple influenza infections. The inferred regulatory network and modules are significantly enriched for known pathways of immune response and implicate apoptosis, splicing, and interferon signaling processes in the differential response of viral infections of different pathogenicities. We used the learned network to prioritize regulators and study virus and time-point specific networks. RNAi-based knockdown of predicted regulators had significant impact on viral replication and include several previously unknown regulators. Taken together, our integrated analysis identified novel module level patterns that capture strain and pathogenicity-specific patterns of expression and helped identify important regulators of host response to influenza infection. PMID:27403523

  5. Integrated Controls-Structures Design Methodology for Flexible Spacecraft

    NASA Technical Reports Server (NTRS)

    Maghami, P. G.; Joshi, S. M.; Price, D. B.

    1995-01-01

    This paper proposes an approach for the design of flexible spacecraft, wherein the structural design and the control system design are performed simultaneously. The integrated design problem is posed as an optimization problem in which both the structural parameters and the control system parameters constitute the design variables, which are used to optimize a common objective function, thereby resulting in an optimal overall design. The approach is demonstrated by application to the integrated design of a geostationary platform, and to a ground-based flexible structure experiment. The numerical results obtained indicate that the integrated design approach generally yields spacecraft designs that are substantially superior to the conventional approach, wherein the structural design and control design are performed sequentially.

  6. PDBalert: automatic, recurrent remote homology tracking and protein structure prediction

    PubMed Central

    Agarwal, Vatsal; Remmert, Michael; Biegert, Andreas; Söding, Johannes

    2008-01-01

    Background During the last years, methods for remote homology detection have grown more and more sensitive and reliable. Automatic structure prediction servers relying on these methods can generate useful 3D models even below 20% sequence identity between the protein of interest and the known structure (template). When no homologs can be found in the protein structure database (PDB), the user would need to rerun the same search at regular intervals in order to make timely use of a template once it becomes available. Results PDBalert is a web-based automatic system that sends an email alert as soon as a structure with homology to a protein in the user's watch list is released to the PDB database or appears among the sequences on hold. The mail contains links to the search results and to an automatically generated 3D homology model. The sequence search is performed with the same software as used by the very sensitive and reliable remote homology detection server HHpred, which is based on pairwise comparison of Hidden Markov models. Conclusion PDBalert will accelerate the information flow from the PDB database to all those who can profit from the newly released protein structures for predicting the 3D structure or function of their proteins of interest. PMID:19025670

  7. Generalized Pattern Search Algorithm for Peptide Structure Prediction

    PubMed Central

    Nicosia, Giuseppe; Stracquadanio, Giovanni

    2008-01-01

    Finding the near-native structure of a protein is one of the most important open problems in structural biology and biological physics. The problem becomes dramatically more difficult when a given protein has no regular secondary structure or it does not show a fold similar to structures already known. This situation occurs frequently when we need to predict the tertiary structure of small molecules, called peptides. In this research work, we propose a new ab initio algorithm, the generalized pattern search algorithm, based on the well-known class of Search-and-Poll algorithms. We performed an extensive set of simulations over a well-known set of 44 peptides to investigate the robustness and reliability of the proposed algorithm, and we compared the peptide conformation with a state-of-the-art algorithm for peptide structure prediction known as PEPstr. In particular, we tested the algorithm on the instances proposed by the originators of PEPstr, to validate the proposed algorithm; the experimental results confirm that the generalized pattern search algorithm outperforms PEPstr by 21.17% in terms of average root mean-square deviation, RMSD Cα. PMID:18487293

  8. 3D-Fun: predicting enzyme function from structure.

    PubMed

    von Grotthuss, Marcin; Plewczynski, Dariusz; Vriend, Gert; Rychlewski, Leszek

    2008-07-01

    The 'omics' revolution is causing a flurry of data that all needs to be annotated for it to become useful. Sequences of proteins of unknown function can be annotated with a putative function by comparing them with proteins of known function. This form of annotation is typically performed with BLAST or similar software. Structural genomics is nowadays also bringing us three dimensional structures of proteins with unknown function. We present here software that can be used when sequence comparisons fail to determine the function of a protein with known structure but unknown function. The software, called 3D-Fun, is implemented as a server that runs at several European institutes and is freely available for everybody at all these sites. The 3D-Fun servers accept protein coordinates in the standard PDB format and compare them with all known protein structures by 3D structural superposition using the 3D-Hit software. If structural hits are found with proteins with known function, these are listed together with their function and some vital comparison statistics. This is conceptually very similar in 3D to what BLAST does in 1D. Additionally, the superposition results are displayed using interactive graphics facilities. Currently, the 3D-Fun system only predicts enzyme function but an expanded version with Gene Ontology predictions will be available soon. The server can be accessed at http://3dfun.bioinfo.pl/ or at http://3dfun.cmbi.ru.nl/.

  9. Comparative analysis of grapevine whole-genome gene predictions, functional annotation, categorization and integration of the predicted gene sequences

    PubMed Central

    2012-01-01

    Background The first draft assembly and gene prediction of the grapevine genome (8X base coverage) was made available to the scientific community in 2007, and functional annotation was developed on this gene prediction. Since then additional Sanger sequences were added to the 8X sequences pool and a new version of the genomic sequence with superior base coverage (12X) was produced. Results In order to more efficiently annotate the function of the genes predicted in the new assembly, it is important to build on as much of the previous work as possible, by transferring 8X annotation of the genome to the 12X version. The 8X and 12X assemblies and gene predictions of the grapevine genome were compared to answer the question, “Can we uniquely map 8X predicted genes to 12X predicted genes?” The results show that while the assemblies and gene structure predictions are too different to make a complete mapping between them, most genes (18,725) showed a one-to-one relationship between 8X predicted genes and the last version of 12X predicted genes. In addition, reshuffled genomic sequence structures appeared. These highlight regions of the genome where the gene predictions need to be taken with caution. Based on the new grapevine gene functional annotation and in-depth functional categorization, twenty eight new molecular networks have been created for VitisNet while the existing networks were updated. Conclusions The outcomes of this study provide a functional annotation of the 12X genes, an update of VitisNet, the system of the grapevine molecular networks, and a new functional categorization of genes. Data are available at the VitisNet website (http://www.sdstate.edu/ps/research/vitis/pathways.cfm). PMID:22554261

  10. Preliminary analytical results using surface current integration for predicting effects of surface pillows on RF performance

    NASA Technical Reports Server (NTRS)

    Farrell, C. E.; Strange, D. A.

    1982-01-01

    An overview of the fast integral RF evaluation (FIRE) program is presented. This program uses surface current integration to evaluate RF performance of antenna systems. It requires modeling of surfaces in X, Y, Z coordinates along equally spaced X and Y grids with Z in the focal directon. The far field contribution of each surface point includes the effects of the Z-component of surface current which is not included in the aperture integration technique. Because of this, surface current integration is the most effective and inclusive technique for predicting RF performance on non-ideal reflectors. Results obtained from use of the FIRE program and an aperture integration program to predict RF performance of a LSS antenna concept are presented.

  11. Predicting the integration of overlapping memories by decoding mnemonic processing states during learning.

    PubMed

    Richter, Franziska R; Chanales, Avi J H; Kuhl, Brice A

    2016-01-01

    The hippocampal memory system is thought to alternate between two opposing processing states: encoding and retrieval. When present experience overlaps with past experience, this creates a potential tradeoff between encoding the present and retrieving the past. This tradeoff may be resolved by memory integration-that is, by forming a mnemonic representation that links present experience with overlapping past experience. Here, we used fMRI decoding analyses to predict when - and establish how - past and present experiences become integrated in memory. In an initial experiment, we alternately instructed subjects to adopt encoding, retrieval or integration states during overlapping learning. We then trained across-subject pattern classifiers to 'read out' the instructed processing states from fMRI activity patterns. We show that an integration state was clearly dissociable from encoding or retrieval states. Moreover, trial-by-trial fluctuations in decoded evidence for an integration state during learning reliably predicted behavioral expressions of successful memory integration. Strikingly, the decoding algorithm also successfully predicted specific instances of spontaneous memory integration in an entirely independent sample of subjects for whom processing state instructions were not administered. Finally, we show that medial prefrontal cortex and hippocampus differentially contribute to encoding, retrieval, and integration states: whereas hippocampus signals the tradeoff between encoding vs. retrieval states, medial prefrontal cortex actively represents past experience in relation to new learning.

  12. Integrated structural control design of large space structures

    SciTech Connect

    Allen, J.J.; Lauffer, J.P.

    1995-01-01

    Active control of structures has been under intensive development for the last ten years. Reference 2 reviews much of the identification and control technology for structural control developed during this time. The technology was initially focused on space structure and weapon applications; however, recently the technology is also being directed toward applications in manufacturing and transportation. Much of this technology focused on multiple-input/multiple-output (MIMO) identification and control methodology because many of the applications require a coordinated control involving multiple disturbances and control objectives where multiple actuators and sensors are necessary for high performance. There have been many optimal robust control methods developed for the design of MIMO robust control laws; however, there appears to be a significant gap between the theoretical development and experimental evaluation of control and identification methods to address structural control applications. Many methods have been developed for MIMO identification and control of structures, such as the Eigensystem Realization Algorithm (ERA), Q-Markov Covariance Equivalent Realization (Q-Markov COVER) for identification; and, Linear Quadratic Gaussian (LQG), Frequency Weighted LQG and H-/ii-synthesis methods for control. Upon implementation, many of the identification and control methods have shown limitations such as the excitation of unmodelled dynamics and sensitivity to system parameter variations. As a result, research on methods which address these problems have been conducted.

  13. Structural design of integral tankage for advanced space transportation systems

    NASA Technical Reports Server (NTRS)

    Macconochie, I. O.; Davis, R. B.; Lemessurier, R. W.

    1982-01-01

    Fully reusable launch vehicle concepts being studied for post-Shuttle era transports present major challenges for the structural design of large propellant tankage. The dominant structural elements are internal tankage for both cryogenic and non-cryogenic propellants which must operate in a broad range of thermal environments while meeting requirements for low weight and reusability. Several approaches to integral tank design are discussed and an analysis of a hot structure honeycomb sandwich tank for a circular body vehicle is presented.

  14. Development and Characterization of Multilayer Integrated Warhead Structure.

    DTIC Science & Technology

    1985-05-01

    the final concept. Steel castings ( 17 - 4PH ) were made and specimens were machined to characterize the structural properties of the concept. The pioperty...casting 17 - 4PH test specimens and characterizing these composite structures. It was anticipated that problem would occur in the transition . from...MULTILAYER Final Report INTEGRATED WARHEAD STRUCTURE 3/ 17 /83 to 9/30/84 G. PERFORMING ORG. REPORT NUMBER 7. AUTHOR(a) 0. CONTRACT OR GRANT NUMBER(s) D

  15. An integrated computer procedure for sizing composite airframe structures

    NASA Technical Reports Server (NTRS)

    Sobieszczanski-Sobieski, J.

    1979-01-01

    A computerized algorithm to generate cross-sectional dimensions and fiber orientations for composite airframe structures is described, and its application in a wing structural synthesis is established. The algorithm unifies computations of aeroelastic loads, stresses, and deflections, as well as optimal structural sizing and fiber orientations in an open-ended system of integrated computer programs. A finite-element analysis and a mathematical-optimization technique are discussed.

  16. Large-Deformation Displacement Transfer Functions for Shape Predictions of Highly Flexible Slender Aerospace Structures

    NASA Technical Reports Server (NTRS)

    Ko, William L.; Fleischer, Van Tran

    2013-01-01

    Large deformation displacement transfer functions were formulated for deformed shape predictions of highly flexible slender structures like aircraft wings. In the formulation, the embedded beam (depth wise cross section of structure along the surface strain sensing line) was first evenly discretized into multiple small domains, with surface strain sensing stations located at the domain junctures. Thus, the surface strain (bending strains) variation within each domain could be expressed with linear of nonlinear function. Such piecewise approach enabled piecewise integrations of the embedded beam curvature equations [classical (Eulerian), physical (Lagrangian), and shifted curvature equations] to yield closed form slope and deflection equations in recursive forms.

  17. OVERVIEW OF HANFORD SINGLE SHELL TANK (SST) STRUCTURAL INTEGRITY - 12123

    SciTech Connect

    RAST RS; RINKER MW; WASHENFELDER DJ; JOHNSON JB

    2012-01-25

    To improve the understanding of the single-shell tanks (SSTs) integrity, Washington River Protection Solutions, LLC (WRPS), the USDOE Hanford Site tank contractor, developed an enhanced Single-Shell Tank Integrity Project in 2009. An expert panel on SST integrity, consisting of various subject matters experts in industry and academia, was created to provide recommendations supporting the development of the project. This panel developed 33 recommendations in four main areas of interest: structural integrity, liner degradation, leak integrity and prevention, and mitigation of contamination migration. Seventeen of these recommendations were used to develop the basis for the M-45-10-1 Change Package for the Hanford Federal Agreement and Compliance Order, which is also known as the Tri-Party Agreement. The structural integrity of the tanks is a key element in completing the cleanup mission at the Hanford Site. There are eight primary recommendations related to the structural integrity of Hanford SSTs. Six recommendations are being implemented through current and planned activities. The structural integrity of the Hanford SSTs is being evaluated through analysis, monitoring, inspection, materials testing, and construction document review. Structural evaluation in the form of analysis is performed using modern finite element models generated in ANSYS{reg_sign} The analyses consider in-situ, thermal, operating loads and natural phenomena such as earthquakes. Structural analysis of 108 of 149 Hanford SSTs has concluded that the tanks are structurally sound and meet current industry standards. Analyses of the remaining Hanford SSTs are scheduled for FY2013. Hanford SSTs are monitored through a dome deflection program. The program looks for deflections of the tank dome greater than 1/4 inch. No such deflections have been recorded. The tanks are also subjected to visual inspection. Digital cameras record the interior surface of the concrete tank domes, looking for cracks and

  18. Overview of Hanford Single Shell Tank (SST) Structural Integrity

    SciTech Connect

    Rast, Richard S.; Washenfelder, Dennis J.; Johnson, Jeremy M.

    2013-11-14

    To improve the understanding of the single-shell tanks (SSTs) integrity, Washington River Protection Solutions, LLC (WRPS), the USDOE Hanford Site tank contractor, developed an enhanced Single-Shell Tank Integrity Project (SSTIP) in 2009. An expert panel on SST integrity, consisting of various subject matters experts in industry and academia, was created to provide recommendations supporting the development of the project. This panel developed 33 recommendations in four main areas of interest: structural integrity, liner degradation, leak integrity and prevention, and mitigation of contamination migration, Seventeen of these recommendations were used to develop the basis for the M-45-10-1 Change Package for the Hanford Federal Agreement and Compliance Order, which is also known as the Tri-Party Agreement. The structural integrity of the tanks is a key element in completing the cleanup mission at the Hanford Site. There are eight primary recommendations related to the structural integrity of Hanford Single-Shell Tanks. Six recommendations are being implemented through current and planned activities. The structural integrity of the Hanford is being evaluated through analysis, monitoring, inspection, materials testing, and construction document review. Structural evaluation in the form of analysis is performed using modern finite element models generated in ANSYS. The analyses consider in-situ, thermal, operating loads and natural phenomena such as earthquakes. Structural analysis of 108 of 149 Hanford Single-Shell Tanks has concluded that the tanks are structurally sound and meet current industry standards. Analysis of the remaining Hanford Single-Shell Tanks is scheduled for FY2014. Hanford Single-Shell Tanks are monitored through a dome deflection program. The program looks for deflections of the tank dome greater than 1/4 inch. No such deflections have been recorded. The tanks are also subjected to visual inspection. Digital cameras record the interior surface of

  19. Integrated Machine Learning Approaches for Predicting Ischemic Stroke and Thromboembolism in Atrial Fibrillation

    PubMed Central

    Li, Xiang; Liu, Haifeng; Du, Xin; Zhang, Ping; Hu, Gang; Xie, Guotong; Guo, Shijing; Xu, Meilin; Xie, Xiaoping

    2016-01-01

    Atrial fibrillation (AF) is a common cardiac rhythm disorder, which increases the risk of ischemic stroke and other thromboembolism (TE). Accurate prediction of TE is highly valuable for early intervention to AF patients. However, the prediction performance of previous TE risk models for AF is not satisfactory. In this study, we used integrated machine learning and data mining approaches to build 2-year TE prediction models for AF from Chinese Atrial Fibrillation Registry data. We first performed data cleansing and imputation on the raw data to generate available dataset. Then a series of feature construction and selection methods were used to identify predictive risk factors, based on which supervised learning methods were applied to build the prediction models. The experimental results show that our approach can achieve higher prediction performance (AUC: 0.71~0.74) than previous TE prediction models for AF (AUC: 0.66~0.69), and identify new potential risk factors as well. PMID:28269876

  20. Integrated Machine Learning Approaches for Predicting Ischemic Stroke and Thromboembolism in Atrial Fibrillation.

    PubMed

    Li, Xiang; Liu, Haifeng; Du, Xin; Zhang, Ping; Hu, Gang; Xie, Guotong; Guo, Shijing; Xu, Meilin; Xie, Xiaoping

    2016-01-01

    Atrial fibrillation (AF) is a common cardiac rhythm disorder, which increases the risk of ischemic stroke and other thromboembolism (TE). Accurate prediction of TE is highly valuable for early intervention to AF patients. However, the prediction performance of previous TE risk models for AF is not satisfactory. In this study, we used integrated machine learning and data mining approaches to build 2-year TE prediction models for AF from Chinese Atrial Fibrillation Registry data. We first performed data cleansing and imputation on the raw data to generate available dataset. Then a series of feature construction and selection methods were used to identify predictive risk factors, based on which supervised learning methods were applied to build the prediction models. The experimental results show that our approach can achieve higher prediction performance (AUC: 0.71~0.74) than previous TE prediction models for AF (AUC: 0.66~0.69), and identify new potential risk factors as well.

  1. Quantitative genetics of shape in cricket wings: developmental integration in a functional structure.

    PubMed

    Klingenberg, Christian Peter; Debat, Vincent; Roff, Derek A

    2010-10-01

    The role of developmental and genetic integration for evolution is contentious. One hypothesis states that integration acts as a constraint on evolution, whereas an alternative is that developmental and genetic systems evolve to match the functional modularity of organisms. This study examined a morphological structure, the cricket wing, where developmental and functional modules are discordant, making it possible to distinguish the two alternatives. Wing shape was characterized with geometric morphometrics, quantitative genetic information was extracted using a full-sibling breeding design, and patterns of developmental integration were inferred from fluctuating asymmetry of wing shape. The patterns of genetic, phenotypic, and developmental integration were clearly similar, but not identical. Heritabilities for different shape variables varied widely, but no shape variables were devoid of genetic variation. Simulated selection for specific shape changes produced predicted responses with marked deflections due to the genetic covariance structure. Three hypotheses of modularity according to the wing structures involved in sound production were inconsistent with the genetic, phenotypic, or developmental covariance structure. Instead, there appears to be strong integration throughout the wing. The hypothesis that genetic and developmental integration evolve to match functional modularity can therefore be rejected for this example.

  2. Predicting loop-helix tertiary structural contacts in RNA pseudoknots.

    PubMed

    Cao, Song; Giedroc, David P; Chen, Shi-Jie

    2010-03-01

    Tertiary interactions between loops and helical stems play critical roles in the biological function of many RNA pseudoknots. However, quantitative predictions for RNA tertiary interactions remain elusive. Here we report a statistical mechanical model for the prediction of noncanonical loop-stem base-pairing interactions in RNA pseudoknots. Central to the model is the evaluation of the conformational entropy for the pseudoknotted folds with defined loop-stem tertiary structural contacts. We develop an RNA virtual bond-based conformational model (Vfold model), which permits a rigorous computation of the conformational entropy for a given fold that contains loop-stem tertiary contacts. With the entropy parameters predicted from the Vfold model and the energy parameters for the tertiary contacts as inserted parameters, we can then predict the RNA folding thermodynamics, from which we can extract the tertiary contact thermodynamic parameters from theory-experimental comparisons. These comparisons reveal a contact enthalpy (DeltaH) of -14 kcal/mol and a contact entropy (DeltaS) of -38 cal/mol/K for a protonated C(+)*(G-C) base triple at pH 7.0, and (DeltaH = -7 kcal/mol, DeltaS = -19 cal/mol/K) for an unprotonated base triple. Tests of the model for a series of pseudoknots show good theory-experiment agreement. Based on the extracted energy parameters for the tertiary structural contacts, the model enables predictions for the structure, stability, and folding pathways for RNA pseudoknots with known or postulated loop-stem tertiary contacts from the nucleotide sequence alone.

  3. Virality Prediction and Community Structure in Social Networks

    NASA Astrophysics Data System (ADS)

    Weng, Lilian; Menczer, Filippo; Ahn, Yong-Yeol

    2013-08-01

    How does network structure affect diffusion? Recent studies suggest that the answer depends on the type of contagion. Complex contagions, unlike infectious diseases (simple contagions), are affected by social reinforcement and homophily. Hence, the spread within highly clustered communities is enhanced, while diffusion across communities is hampered. A common hypothesis is that memes and behaviors are complex contagions. We show that, while most memes indeed spread like complex contagions, a few viral memes spread across many communities, like diseases. We demonstrate that the future popularity of a meme can be predicted by quantifying its early spreading pattern in terms of community concentration. The more communities a meme permeates, the more viral it is. We present a practical method to translate data about community structure into predictive knowledge about what information will spread widely. This connection contributes to our understanding in computational social science, social media analytics, and marketing applications.

  4. One Single Static Measurement Predicts Wave Localization in Complex Structures.

    PubMed

    Lefebvre, Gautier; Gondel, Alexane; Dubois, Marc; Atlan, Michael; Feppon, Florian; Labbé, Aimé; Gillot, Camille; Garelli, Alix; Ernoult, Maxence; Mayboroda, Svitlana; Filoche, Marcel; Sebbah, Patrick

    2016-08-12

    A recent theoretical breakthrough has brought a new tool, called the localization landscape, for predicting the localization regions of vibration modes in complex or disordered systems. Here, we report on the first experiment which measures the localization landscape and demonstrates its predictive power. Holographic measurement of the static deformation under uniform load of a thin plate with complex geometry provides direct access to the landscape function. When put in vibration, this system shows modes precisely confined within the subregions delineated by the landscape function. Also the maxima of this function match the measured eigenfrequencies, while the minima of the valley network gives the frequencies at which modes become extended. This approach fully characterizes the low frequency spectrum of a complex structure from a single static measurement. It paves the way for controlling and engineering eigenmodes in any vibratory system, especially where a structural or microscopic description is not accessible.

  5. Virality prediction and community structure in social networks.

    PubMed

    Weng, Lilian; Menczer, Filippo; Ahn, Yong-Yeol

    2013-01-01

    How does network structure affect diffusion? Recent studies suggest that the answer depends on the type of contagion. Complex contagions, unlike infectious diseases (simple contagions), are affected by social reinforcement and homophily. Hence, the spread within highly clustered communities is enhanced, while diffusion across communities is hampered. A common hypothesis is that memes and behaviors are complex contagions. We show that, while most memes indeed spread like complex contagions, a few viral memes spread across many communities, like diseases. We demonstrate that the future popularity of a meme can be predicted by quantifying its early spreading pattern in terms of community concentration. The more communities a meme permeates, the more viral it is. We present a practical method to translate data about community structure into predictive knowledge about what information will spread widely. This connection contributes to our understanding in computational social science, social media analytics, and marketing applications.

  6. An Integrated and Interdisciplinary Model for Predicting the Risk of Injury and Death in Future Earthquakes

    PubMed Central

    Shapira, Stav; Novack, Lena; Bar-Dayan, Yaron; Aharonson-Daniel, Limor

    2016-01-01

    Background A comprehensive technique for earthquake-related casualty estimation remains an unmet challenge. This study aims to integrate risk factors related to characteristics of the exposed population and to the built environment in order to improve communities’ preparedness and response capabilities and to mitigate future consequences. Methods An innovative model was formulated based on a widely used loss estimation model (HAZUS) by integrating four human-related risk factors (age, gender, physical disability and socioeconomic status) that were identified through a systematic review and meta-analysis of epidemiological data. The common effect measures of these factors were calculated and entered to the existing model’s algorithm using logistic regression equations. Sensitivity analysis was performed by conducting a casualty estimation simulation in a high-vulnerability risk area in Israel. Results the integrated model outcomes indicated an increase in the total number of casualties compared with the prediction of the traditional model; with regard to specific injury levels an increase was demonstrated in the number of expected fatalities and in the severely and moderately injured, and a decrease was noted in the lightly injured. Urban areas with higher populations at risk rates were found more vulnerable in this regard. Conclusion The proposed model offers a novel approach that allows quantification of the combined impact of human-related and structural factors on the results of earthquake casualty modelling. Investing efforts in reducing human vulnerability and increasing resilience prior to an occurrence of an earthquake could lead to a possible decrease in the expected number of casualties. PMID:26959647

  7. Structural imaging biomarkers of Alzheimer's disease: predicting disease progression.

    PubMed

    Eskildsen, Simon F; Coupé, Pierrick; Fonov, Vladimir S; Pruessner, Jens C; Collins, D Louis

    2015-01-01

    Optimized magnetic resonance imaging (MRI)-based biomarkers of Alzheimer's disease (AD) may allow earlier detection and refined prediction of the disease. In addition, they could serve as valuable tools when designing therapeutic studies of individuals at risk of AD. In this study, we combine (1) a novel method for grading medial temporal lobe structures with (2) robust cortical thickness measurements to predict AD among subjects with mild cognitive impairment (MCI) from a single T1-weighted MRI scan. Using AD and cognitively normal individuals, we generate a set of features potentially discriminating between MCI subjects who convert to AD and those who remain stable over a period of 3 years. Using mutual information-based feature selection, we identify 5 key features optimizing the classification of MCI converters. These features are the left and right hippocampi gradings and cortical thicknesses of the left precuneus, left superior temporal sulcus, and right anterior part of the parahippocampal gyrus. We show that these features are highly stable in cross-validation and enable a prediction accuracy of 72% using a simple linear discriminant classifier, the highest prediction accuracy obtained on the baseline Alzheimer's Disease Neuroimaging Initiative first phase cohort to date. The proposed structural features are consistent with Braak stages and previously reported atrophic patterns in AD and are easy to transfer to new cohorts and to clinical practice.

  8. Structurally Integrated Coatings for Wear and Corrosion

    SciTech Connect

    Beardsley, M. Brad; Sebright, Jason L.

    2008-11-18

    Wear and corrosion of structures cuts across industries and continues to challenge materials scientists and engineers to develop cost effective solutions. Industries typically seek mature technologies that can be implemented for production with rapid or minimal development and have little appetite for the longer-term materials research and development required to solve complex problems. The collaborative work performed in this project addressed the complexity of this problem in a multi-year program that industries would be reluctant to undertake without government partnership. This effort built upon the prior development of Advanced Abrasion Resistant Materials conduct by Caterpillar Inc. under DOE Cooperative Agreement No. DE-FC26-01NT41054. In this referenced work, coatings were developed that exhibited significant wear life improvements over standard carburized heat treated steel in abrasive wear applications. The technology used in this referenced work, arc lamp fusing of thermal spray coatings, was one of the primary technical paths in this work effort. In addition to extending the capability of the coating technology to address corrosion issues, additional competitive coating technologies were evaluated to insure that the best technology was developed to meet the goals of the program. From this, plasma transferred arc (PTA) welding was selected as the second primary technology that was investigated. Specifically, this project developed improved, cost effective surfacing materials and processes for wear and corrosion resistance in both sliding and abrasive wear applications. Materials with wear and corrosion performance improvements that are 4 to 5 times greater than heat treated steels were developed. The materials developed were based on low cost material systems utilizing ferrous substrates and stainless steel type matrix with hard particulates formed from borides and carbides. Affordability was assessed against other competing hard surfacing or coating

  9. Prediction of protein function from protein sequence and structure.

    PubMed

    Whisstock, James C; Lesk, Arthur M

    2003-08-01

    The sequence of a genome contains the plans of the possible life of an organism, but implementation of genetic information depends on the functions of the proteins and nucleic acids that it encodes. Many individual proteins of known sequence and structure present challenges to the understanding of their function. In particular, a number of genes responsible for diseases have been identified but their specific functions are unknown. Whole-genome sequencing projects are a major source of proteins of unknown function. Annotation of a genome involves assignment of functions to gene products, in most cases on the basis of amino-acid sequence alone. 3D structure can aid the assignment of function, motivating the challenge of structural genomics projects to make structural information available for novel uncharacterized proteins. Structure-based identification of homologues often succeeds where sequence-alone-based methods fail, because in many cases evolution retains the folding pattern long after sequence similarity becomes undetectable. Nevertheless, prediction of protein function from sequence and structure is a difficult problem, because homologous proteins often have different functions. Many methods of function prediction rely on identifying similarity in sequence and/or structure between a protein of unknown function and one or more well-understood proteins. Alternative methods include inferring conservation patterns in members of a functionally uncharacterized family for which many sequences and structures are known. However, these inferences are tenuous. Such methods provide reasonable guesses at function, but are far from foolproof. It is therefore fortunate that the development of whole-organism approaches and comparative genomics permits other approaches to function prediction when the data are available. These include the use of protein-protein interaction patterns, and correlations between occurrences of related proteins in different organisms, as

  10. Sixth blind test of organic crystal-structure prediction methods.

    PubMed

    Groom, Colin R; Reilly, Anthony M

    2014-08-01

    Over the past 15 years progress in predicting crystal structures of small organic molecules has been charted by a series of blind tests hosted by the Cambridge Crystallographic Data Centre. This letter announces a sixth blind test to take place between September 2014 and August 2015, giving details of the target systems and the revised procedure. We hope that as many methods as possible will be assessed and benchmarked in this new blind test.

  11. Prediction of interface structures and energies via virtual screening

    PubMed Central

    Kiyohara, Shin; Oda, Hiromi; Miyata, Tomohiro; Mizoguchi, Teruyasu

    2016-01-01

    Interfaces markedly affect the properties of materials because of differences in their atomic configurations. Determining the atomic structure of the interface is therefore one of the most significant tasks in materials research. However, determining the interface structure usually requires extensive computation. If the interface structure could be efficiently predicted, our understanding of the mechanisms that give rise to the interface properties would be significantly facilitated, and this would pave the way for the design of material interfaces. Using a virtual screening method based on machine learning, we demonstrate a powerful technique to determine interface energies and structures. On the basis of the results obtained by a nonlinear regression using training data from 4 interfaces, structures and energies for 13 other interfaces were predicted. Our method achieved an efficiency that is more than several hundred to several tens of thousand times higher than that of the previously reported methods. Because the present method uses geometrical factors, such as bond length and atomic density, as descriptors for the regression analysis, the method presented here is robust and general and is expected to be beneficial to understanding the nature of any interface. PMID:28138517

  12. Prediction of interface structures and energies via virtual screening.

    PubMed

    Kiyohara, Shin; Oda, Hiromi; Miyata, Tomohiro; Mizoguchi, Teruyasu

    2016-11-01

    Interfaces markedly affect the properties of materials because of differences in their atomic configurations. Determining the atomic structure of the interface is therefore one of the most significant tasks in materials research. However, determining the interface structure usually requires extensive computation. If the interface structure could be efficiently predicted, our understanding of the mechanisms that give rise to the interface properties would be significantly facilitated, and this would pave the way for the design of material interfaces. Using a virtual screening method based on machine learning, we demonstrate a powerful technique to determine interface energies and structures. On the basis of the results obtained by a nonlinear regression using training data from 4 interfaces, structures and energies for 13 other interfaces were predicted. Our method achieved an efficiency that is more than several hundred to several tens of thousand times higher than that of the previously reported methods. Because the present method uses geometrical factors, such as bond length and atomic density, as descriptors for the regression analysis, the method presented here is robust and general and is expected to be beneficial to understanding the nature of any interface.

  13. Dopamine prediction error responses integrate subjective value from different reward dimensions.

    PubMed

    Lak, Armin; Stauffer, William R; Schultz, Wolfram

    2014-02-11

    Prediction error signals enable us to learn through experience. These experiences include economic choices between different rewards that vary along multiple dimensions. Therefore, an ideal way to reinforce economic choice is to encode a prediction error that reflects the subjective value integrated across these reward dimensions. Previous studies demonstrated that dopamine prediction error responses reflect the value of singular reward attributes that include magnitude, probability, and delay. Obviously, preferences between rewards that vary along one dimension are completely determined by the manipulated variable. However, it is unknown whether dopamine prediction error responses reflect the subjective value integrated from different reward dimensions. Here, we measured the preferences between rewards that varied along multiple dimensions, and as such could not be ranked according to objective metrics. Monkeys chose between rewards that differed in amount, risk, and type. Because their choices were complete and transitive, the monkeys chose "as if" they integrated different rewards and attributes into a common scale of value. The prediction error responses of single dopamine neurons reflected the integrated subjective value inferred from the choices, rather than the singular reward attributes. Specifically, amount, risk, and reward type modulated dopamine responses exactly to the extent that they influenced economic choices, even when rewards were vastly different, such as liquid and food. This prediction error response could provide a direct updating signal for economic values.

  14. Multiple methods integration for structural mechanics analysis and design

    NASA Technical Reports Server (NTRS)

    Housner, J. M.; Aminpour, M. A.

    1991-01-01

    A new research area of multiple methods integration is proposed for joining diverse methods of structural mechanics analysis which interact with one another. Three categories of multiple methods are defined: those in which a physical interface are well defined; those in which a physical interface is not well-defined, but selected; and those in which the interface is a mathematical transformation. Two fundamental integration procedures are presented that can be extended to integrate various methods (e.g., finite elements, Rayleigh Ritz, Galerkin, and integral methods) with one another. Since the finite element method will likely be the major method to be integrated, its enhanced robustness under element distortion is also examined and a new robust shell element is demonstrated.

  15. Residual Strength Prediction of Fuselage Structures with Multiple Site Damage

    NASA Technical Reports Server (NTRS)

    Chen, Chuin-Shan; Wawrzynek, Paul A.; Ingraffea, Anthony R.

    1999-01-01

    This paper summarizes recent results on simulating full-scale pressure tests of wide body, lap-jointed fuselage panels with multiple site damage (MSD). The crack tip opening angle (CTOA) fracture criterion and the FRANC3D/STAGS software program were used to analyze stable crack growth under conditions of general yielding. The link-up of multiple cracks and residual strength of damaged structures were predicted. Elastic-plastic finite element analysis based on the von Mises yield criterion and incremental flow theory with small strain assumption was used. A global-local modeling procedure was employed in the numerical analyses. Stress distributions from the numerical simulations are compared with strain gage measurements. Analysis results show that accurate representation of the load transfer through the rivets is crucial for the model to predict the stress distribution accurately. Predicted crack growth and residual strength are compared with test data. Observed and predicted results both indicate that the occurrence of small MSD cracks substantially reduces the residual strength. Modeling fatigue closure is essential to capture the fracture behavior during the early stable crack growth. Breakage of a tear strap can have a major influence on residual strength prediction.

  16. Improved hybrid optimization algorithm for 3D protein structure prediction.

    PubMed

    Zhou, Changjun; Hou, Caixia; Wei, Xiaopeng; Zhang, Qiang

    2014-07-01

    A new improved hybrid optimization algorithm - PGATS algorithm, which is based on toy off-lattice model, is presented for dealing with three-dimensional protein structure prediction problems. The algorithm combines the particle swarm optimization (PSO), genetic algorithm (GA), and tabu search (TS) algorithms. Otherwise, we also take some different improved strategies. The factor of stochastic disturbance is joined in the particle swarm optimization to improve the search ability; the operations of crossover and mutation that are in the genetic algorithm are changed to a kind of random liner method; at last tabu search algorithm is improved by appending a mutation operator. Through the combination of a variety of strategies and algorithms, the protein structure prediction (PSP) in a 3D off-lattice model is achieved. The PSP problem is an NP-hard problem, but the problem can be attributed to a global optimization problem of multi-extremum and multi-parameters. This is the theoretical principle of the hybrid optimization algorithm that is proposed in this paper. The algorithm combines local search and global search, which overcomes the shortcoming of a single algorithm, giving full play to the advantage of each algorithm. In the current universal standard sequences, Fibonacci sequences and real protein sequences are certified. Experiments show that the proposed new method outperforms single algorithms on the accuracy of calculating the protein sequence energy value, which is proved to be an effective way to predict the structure of proteins.

  17. Improved finite element methodology for integrated thermal structural analysis

    NASA Technical Reports Server (NTRS)

    Dechaumphai, P.; Thornton, E. A.

    1982-01-01

    An integrated thermal-structural finite element approach for efficient coupling of thermal and structural analysis is presented. New thermal finite elements which yield exact nodal and element temperatures for one dimensional linear steady state heat transfer problems are developed. A nodeless variable formulation is used to establish improved thermal finite elements for one dimensional nonlinear transient and two dimensional linear transient heat transfer problems. The thermal finite elements provide detailed temperature distributions without using additional element nodes and permit a common discretization with lower order congruent structural finite elements. The accuracy of the integrated approach is evaluated by comparisons with analytical solutions and conventional finite element thermal structural analyses for a number of academic and more realistic problems. Results indicate that the approach provides a significant improvement in the accuracy and efficiency of thermal stress analysis for structures with complex temperature distributions.

  18. Improved finite element methodology for integrated thermal structural analysis

    NASA Technical Reports Server (NTRS)

    Dechaumphai, P.; Thornton, E. A.

    1982-01-01

    An integrated thermal-structural finite element approach for efficient coupling of thermal and structural analyses is presented. New thermal finite elements which yield exact nodal and element temperature for one dimensional linear steady state heat transfer problems are developed. A nodeless variable formulation is used to establish improved thermal finite elements for one dimensional nonlinear transient and two dimensional linear transient heat transfer problems. The thermal finite elements provide detailed temperature distributions without using additional element nodes and permit a common discretization with lower order congruent structural finite elements. The accuracy of the integrated approach is evaluated by comparisons with analytical solutions and conventional finite element thermal-structural analyses for a number of academic and more realistic problems. Results indicate that the approach provides a significant improvement in the accuracy and efficiency of thermal stress analysis for structures with complex temperature distributions.

  19. Structural Integrity Evaluation of the Lear Fan 2100 Aircraft

    NASA Technical Reports Server (NTRS)

    Kan, H. P.; Dyer, T. A.

    1996-01-01

    An in-situ nondestructive inspection was conducted to detect manufacturing and assembly induced defects in the upper two wing surfaces (skin s) and upper fuselage skin of the Lear Fan 2100 aircraft E009. The effects of the defects, detected during the inspection, on the integrity of the structure was analytically evaluated. A systematic evaluation was also conducted to determine the damage tolerance capability of the upper wing skin against impact threats and assembly induced damage. The upper wing skin was divided into small regions for damage tolerance evaluations. Structural reliability, margin of safety, allowable strains, and allowable damage size were computed. The results indicated that the impact damage threat imposed on composite military aircraft structures is too severe for the Lear Fan 2100 upper wing skin. However, the structural integrity is not significantly degraded by the assembly induced damage for properly assembled structures, such as the E009 aircraft.

  20. Improved Displacement Transfer Functions for Structure Deformed Shape Predictions Using Discretely Distributed Surface Strains

    NASA Technical Reports Server (NTRS)

    Ko, William L.; Fleischer, Van Tran

    2012-01-01

    In the formulations of earlier Displacement Transfer Functions for structure shape predictions, the surface strain distributions, along a strain-sensing line, were represented with piecewise linear functions. To improve the shape-prediction accuracies, Improved Displacement Transfer Functions were formulated using piecewise nonlinear strain representations. Through discretization of an embedded beam (depth-wise cross section of a structure along a strain-sensing line) into multiple small domains, piecewise nonlinear functions were used to describe the surface strain distributions along the discretized embedded beam. Such piecewise approach enabled the piecewise integrations of the embedded beam curvature equations to yield slope and deflection equations in recursive forms. The resulting Improved Displacement Transfer Functions, written in summation forms, were expressed in terms of beam geometrical parameters and surface strains along the strain-sensing line. By feeding the surface strains into the Improved Displacement Transfer Functions, structural deflections could be calculated at multiple points for mapping out the overall structural deformed shapes for visual display. The shape-prediction accuracies of the Improved Displacement Transfer Functions were then examined in view of finite-element-calculated deflections using different tapered cantilever tubular beams. It was found that by using the piecewise nonlinear strain representations, the shape-prediction accuracies could be greatly improved, especially for highly-tapered cantilever tubular beams.

  1. Ocean circulation model predicts high genetic structure observed in a long-lived pelagic developer.

    PubMed

    Sunday, J M; Popovic, I; Palen, W J; Foreman, M G G; Hart, M W

    2014-10-01

    Understanding the movement of genes and individuals across marine seascapes is a long-standing challenge in marine ecology and can inform our understanding of local adaptation, the persistence and movement of populations, and the spatial scale of effective management. Patterns of gene flow in the ocean are often inferred based on population genetic analyses coupled with knowledge of species' dispersive life histories. However, genetic structure is the result of time-integrated processes and may not capture present-day connectivity between populations. Here, we use a high-resolution oceanographic circulation model to predict larval dispersal along the complex coastline of western Canada that includes the transition between two well-studied zoogeographic provinces. We simulate dispersal in a benthic sea star with a 6-10 week pelagic larval phase and test predictions of this model against previously observed genetic structure including a strong phylogeographic break within the zoogeographical transition zone. We also test predictions with new genetic sampling in a site within the phylogeographic break. We find that the coupled genetic and circulation model predicts the high degree of genetic structure observed in this species, despite its long pelagic duration. High genetic structure on this complex coastline can thus be explained through ocean circulation patterns, which tend to retain passive larvae within 20-50 km of their parents, suggesting a necessity for close-knit design of Marine Protected Area networks.

  2. A performance comparison of integration algorithms in simulating flexible structures

    NASA Technical Reports Server (NTRS)

    Howe, R. M.

    1989-01-01

    Asymptotic formulas for the characteristic root errors as well as transfer function gain and phase errors are presented for a number of traditional and new integration methods. Normalized stability regions in the lambda h plane are compared for the various methods. In particular, it is shown that a modified form of Euler integration with root matching is an especially efficient method for simulating lightly-damped structural modes. The method has been used successfully for structural bending modes in the real-time simulation of missiles. Performance of this algorithm is compared with other special algorithms, including the state-transition method. A predictor-corrector version of the modified Euler algorithm permits it to be extended to the simulation of nonlinear models of the type likely to be obtained when using the discretized structure approach. Performance of the different integration methods is also compared for integration step sizes larger than those for which the asymptotic formulas are valid. It is concluded that many traditional integration methods, such as RD-4, are not competitive in the simulation of lightly damped structures.

  3. Graphlet kernels for prediction of functional residues in protein structures.

    PubMed

    Vacic, Vladimir; Iakoucheva, Lilia M; Lonardi, Stefano; Radivojac, Predrag

    2010-01-01

    We introduce a novel graph-based kernel method for annotating functional residues in protein structures. A structure is first modeled as a protein contact graph, where nodes correspond to residues and edges connect spatially neighboring residues. Each vertex in the graph is then represented as a vector of counts of labeled non-isomorphic subgraphs (graphlets), centered on the vertex of interest. A similarity measure between two vertices is expressed as the inner product of their respective count vectors and is used in a supervised learning framework to classify protein residues. We evaluated our method on two function prediction problems: identification of catalytic residues in proteins, which is a well-studied problem suitable for benchmarking, and a much less explored problem of predicting phosphorylation sites in protein structures. The performance of the graphlet kernel approach was then compared against two alternative methods, a sequence-based predictor and our implementation of the FEATURE framework. On both tasks, the graphlet kernel performed favorably; however, the margin of difference was considerably higher on the problem of phosphorylation site prediction. While there is data that phosphorylation sites are preferentially positioned in intrinsically disordered regions, we provide evidence that for the sites that are located in structured regions, neither the surface accessibility alone nor the averaged measures calculated from the residue microenvironments utilized by FEATURE were sufficient to achieve high accuracy. The key benefit of the graphlet representation is its ability to capture neighborhood similarities in protein structures via enumerating the patterns of local connectivity in the corresponding labeled graphs.

  4. Prediction of gene expression in embryonic structures of Drosophila melanogaster.

    PubMed

    Samsonova, Anastasia A; Niranjan, Mahesan; Russell, Steven; Brazma, Alvis

    2007-07-01

    Understanding how sets of genes are coordinately regulated in space and time to generate the diversity of cell types that characterise complex metazoans is a major challenge in modern biology. The use of high-throughput approaches, such as large-scale in situ hybridisation and genome-wide expression profiling via DNA microarrays, is beginning to provide insights into the complexities of development. However, in many organisms the collection and annotation of comprehensive in situ localisation data is a difficult and time-consuming task. Here, we present a widely applicable computational approach, integrating developmental time-course microarray data with annotated in situ hybridisation studies, that facilitates the de novo prediction of tissue-specific expression for genes that have no in vivo gene expression localisation data available. Using a classification approach, trained with data from microarray and in situ hybridisation studies of gene expression during Drosophila embryonic development, we made a set of predictions on the tissue-specific expression of Drosophila genes that have not been systematically characterised by in situ hybridisation experiments. The reliability of our predictions is confirmed by literature-derived annotations in FlyBase, by overrepresentation of Gene Ontology biological process annotations, and, in a selected set, by detailed gene-specific studies from the literature. Our novel organism-independent method will be of considerable utility in enriching the annotation of gene function and expression in complex multicellular organisms.

  5. Structure Prediction: New Insights into Decrypting Long Noncoding RNAs

    PubMed Central

    Yan, Kun; Arfat, Yasir; Li, Dijie; Zhao, Fan; Chen, Zhihao; Yin, Chong; Sun, Yulong; Hu, Lifang; Yang, Tuanmin; Qian, Airong

    2016-01-01

    Long noncoding RNAs (lncRNAs), which form a diverse class of RNAs, remain the least understood type of noncoding RNAs in terms of their nature and identification. Emerging evidence has revealed that a small number of newly discovered lncRNAs perform important and complex biological functions such as dosage compensation, chromatin regulation, genomic imprinting, and nuclear organization. However, understanding the wide range of functions of lncRNAs related to various processes of cellular networks remains a great experimental challenge. Structural versatility is critical for RNAs to perform various functions and provides new insights into probing the functions of lncRNAs. In recent years, the computational method of RNA structure prediction has been developed to analyze the structure of lncRNAs. This novel methodology has provided basic but indispensable information for the rapid, large-scale and in-depth research of lncRNAs. This review focuses on mainstream RNA structure prediction methods at the secondary and tertiary levels to offer an additional approach to investigating the functions of lncRNAs. PMID:26805815

  6. An Integrated Children Disease Prediction Tool within a Special Social Network.

    PubMed

    Apostolova Trpkovska, Marika; Yildirim Yayilgan, Sule; Besimi, Adrian

    2016-01-01

    This paper proposes a social network with an integrated children disease prediction system developed by the use of the specially designed Children General Disease Ontology (CGDO). This ontology consists of children diseases and their relationship with symptoms and Semantic Web Rule Language (SWRL rules) that are specially designed for predicting diseases. The prediction process starts by filling data about the appeared signs and symptoms by the user which are after that mapped with the CGDO ontology. Once the data are mapped, the prediction results are presented. The phase of prediction executes the rules which extract the predicted disease details based on the SWRL rule specified. The motivation behind the development of this system is to spread knowledge about the children diseases and their symptoms in a very simple way using the specialized social networking website www.emama.mk.

  7. An integrable system and associated integrable models as well as Hamiltonian structures

    NASA Astrophysics Data System (ADS)

    Tam, Hon-Wah; Zhang, Yufeng

    2012-10-01

    Starting from an existed Lie algebra introduces a new Lie algebra A1 = {e1, e2, e3} so that two isospectral Lax matrices are established. By employing the Tu scheme an integrable equation hierarchy denoted by IEH is obtained from which a few reduced evolution equations are presented. One of them is the mKdV equation. The elliptic variable solutions and three kinds of Darboux transformations for one coupled equation which is from the IEH are worked out, respectively. Finally, we take use of the Lie algebra A1 to generate eight higher-dimensional Lie algebras from which the linear integrable couplings, the nonlinear integrable couplings, and the bi-integrable couplings of the IEH are engendered, whose Hamiltonian structures are also obtained by the variational identity. Then further reduce one coupled integrable equation to get a nonlinear generalized mKdV equation.

  8. EVO—Evolutionary algorithm for crystal structure prediction

    NASA Astrophysics Data System (ADS)

    Bahmann, Silvia; Kortus, Jens

    2013-06-01

    We present EVO—an evolution strategy designed for crystal structure search and prediction. The concept and main features of biological evolution such as creation of diversity and survival of the fittest have been transferred to crystal structure prediction. EVO successfully demonstrates its applicability to find crystal structures of the elements of the 3rd main group with their different spacegroups. For this we used the number of atoms in the conventional cell and multiples of it. Running EVO with different numbers of carbon atoms per unit cell yields graphite as the lowest energy structure as well as a diamond-like structure, both in one run. Our implementation also supports the search for 2D structures and was able to find a boron sheet with structural features so far not considered in literature. Program summaryProgram title: EVO Catalogue identifier: AEOZ_v1_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/AEOZ_v1_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: GNU General Public License version 3 No. of lines in distributed program, including test data, etc.: 23488 No. of bytes in distributed program, including test data, etc.: 1830122 Distribution format: tar.gz Programming language: Python. Computer: No limitations known. Operating system: Linux. RAM: Negligible compared to the requirements of the electronic structure programs used Classification: 7.8. External routines: Quantum ESPRESSO (http://www.quantum-espresso.org/), GULP (https://projects.ivec.org/gulp/) Nature of problem: Crystal structure search is a global optimisation problem in 3N+3 dimensions where N is the number of atoms in the unit cell. The high dimensional search space is accompanied by an unknown energy landscape. Solution method: Evolutionary algorithms transfer the main features of biological evolution to use them in global searches. The combination of the "survival of the fittest" (deterministic) and the

  9. Predicting protein ligand binding sites by combining evolutionary sequence conservation and 3D structure.

    PubMed

    Capra, John A; Laskowski, Roman A; Thornton, Janet M; Singh, Mona; Funkhouser, Thomas A

    2009-12-01

    Identifying a protein's functional sites is an important step towards characterizing its molecular function. Numerous structure- and sequence-based methods have been developed for this problem. Here we introduce ConCavity, a small molecule binding site prediction algorithm that integrates evolutionary sequence conservation estimates with structure-based methods for identifying protein surface cavities. In large-scale testing on a diverse set of single- and multi-chain protein structures, we show that ConCavity substantially outperforms existing methods for identifying both 3D ligand binding pockets and individual ligand binding residues. As part of our testing, we perform one of the first direct comparisons of conservation-based and structure-based methods. We find that the two approaches provide largely complementary information, which can be combined to improve upon either approach alone. We also demonstrate that ConCavity has state-of-the-art performance in predicting catalytic sites and drug binding pockets. Overall, the algorithms and analysis presented here significantly improve our ability to identify ligand binding sites and further advance our understanding of the relationship between evolutionary sequence conservation and structural and functional attributes of proteins. Data, source code, and prediction visualizations are available on the ConCavity web site (http://compbio.cs.princeton.edu/concavity/).

  10. Predicting the stability of large structured food webs.

    PubMed

    Allesina, Stefano; Grilli, Jacopo; Barabás, György; Tang, Si; Aljadeff, Johnatan; Maritan, Amos

    2015-07-22

    The stability of ecological systems has been a long-standing focus of ecology. Recently, tools from random matrix theory have identified the main drivers of stability in ecological communities whose network structure is random. However, empirical food webs differ greatly from random graphs. For example, their degree distribution is broader, they contain few trophic cycles, and they are almost interval. Here we derive an approximation for the stability of food webs whose structure is generated by the cascade model, in which 'larger' species consume 'smaller' ones. We predict the stability of these food webs with great accuracy, and our approximation also works well for food webs whose structure is determined empirically or by the niche model. We find that intervality and broad degree distributions tend to stabilize food webs, and that average interaction strength has little influence on stability, compared with the effect of variance and correlation.

  11. Predicting the stability of large structured food webs

    PubMed Central

    Allesina, Stefano; Grilli, Jacopo; Barabás, György; Tang, Si; Aljadeff, Johnatan; Maritan, Amos

    2015-01-01

    The stability of ecological systems has been a long-standing focus of ecology. Recently, tools from random matrix theory have identified the main drivers of stability in ecological communities whose network structure is random. However, empirical food webs differ greatly from random graphs. For example, their degree distribution is broader, they contain few trophic cycles, and they are almost interval. Here we derive an approximation for the stability of food webs whose structure is generated by the cascade model, in which ‘larger' species consume ‘smaller' ones. We predict the stability of these food webs with great accuracy, and our approximation also works well for food webs whose structure is determined empirically or by the niche model. We find that intervality and broad degree distributions tend to stabilize food webs, and that average interaction strength has little influence on stability, compared with the effect of variance and correlation. PMID:26198207

  12. Structure-based prediction of host-pathogen protein interactions.

    PubMed

    Mariano, Rachelle; Wuchty, Stefan

    2017-03-16

    The discovery, validation, and characterization of protein-based interactions from different species are crucial for translational research regarding a variety of pathogens, ranging from the malaria parasite Plasmodium falciparum to HIV-1. Here, we review recent advances in the prediction of host-pathogen protein interfaces using structural information. In particular, we observe that current methods chiefly perform machine learning on sequence and domain information to produce large sets of candidate interactions that are further assessed and pruned to generate final, highly probable sets. Structure-based studies have also emphasized the electrostatic properties and evolutionary transformations of pathogenic interfaces, supplying crucial insight into antigenic determinants and the ways pathogens compete for host protein binding. Advancements in spectroscopic and crystallographic methods complement the aforementioned techniques, permitting the rigorous study of true positives at a molecular level. Together, these approaches illustrate how protein structure on a variety of levels functions coordinately and dynamically to achieve host takeover.

  13. Multi-omics integration accurately predicts cellular state in unexplored conditions for Escherichia coli

    PubMed Central

    Kim, Minseung; Rai, Navneet; Zorraquino, Violeta; Tagkopoulos, Ilias

    2016-01-01

    A significant obstacle in training predictive cell models is the lack of integrated data sources. We develop semi-supervised normalization pipelines and perform experimental characterization (growth, transcriptional, proteome) to create Ecomics, a consistent, quality-controlled multi-omics compendium for Escherichia coli with cohesive meta-data information. We then use this resource to train a multi-scale model that integrates four omics layers to predict genome-wide concentrations and growth dynamics. The genetic and environmental ontology reconstructed from the omics data is substantially different and complementary to the genetic and chemical ontologies. The integration of different layers confers an incremental increase in the prediction performance, as does the information about the known gene regulatory and protein-protein interactions. The predictive performance of the model ranges from 0.54 to 0.87 for the various omics layers, which far exceeds various baselines. This work provides an integrative framework of omics-driven predictive modelling that is broadly applicable to guide biological discovery. PMID:27713404

  14. RNAex: an RNA secondary structure prediction server enhanced by high-throughput structure-probing data

    PubMed Central

    Wu, Yang; Qu, Rihao; Huang, Yiming; Shi, Binbin; Liu, Mengrong; Li, Yang; Lu, Zhi John

    2016-01-01

    Several high-throughput technologies have been developed to probe RNA base pairs and loops at the transcriptome level in multiple species. However, to obtain the final RNA secondary structure, extensive effort and considerable expertise is required to statistically process the probing data and combine them with free energy models. Therefore, we developed an RNA secondary structure prediction server that is enhanced by experimental data (RNAex). RNAex is a web interface that enables non-specialists to easily access cutting-edge structure-probing data and predict RNA secondary structures enhanced by in vivo and in vitro data. RNAex annotates the RNA editing, RNA modification and SNP sites on the predicted structures. It provides four structure-folding methods, restrained MaxExpect, SeqFold, RNAstructure (Fold) and RNAfold that can be selected by the user. The performance of these four folding methods has been verified by previous publications on known structures. We re-mapped the raw sequencing data of the probing experiments to the whole genome for each species. RNAex thus enables users to predict secondary structures for both known and novel RNA transcripts in human, mouse, yeast and Arabidopsis. The RNAex web server is available at http://RNAex.ncrnalab.org/. PMID:27137891

  15. Crack Turning and Arrest Mechanisms for Integral Structure

    NASA Technical Reports Server (NTRS)

    Pettit, Richard; Ingraffea, Anthony

    1999-01-01

    In the course of several years of research efforts to predict crack turning and flapping in aircraft fuselage structures and other problems related to crack turning, the 2nd order maximum tangential stress theory has been identified as the theory most capable of predicting the observed test results. This theory requires knowledge of a material specific characteristic length, and also a computation of the stress intensity factors and the T-stress, or second order term in the asymptotic stress field in the vicinity of the crack tip. A characteristic length, r(sub c), is proposed for ductile materials pertaining to the onset of plastic instability, as opposed to the void spacing theories espoused by previous investigators. For the plane stress case, an approximate estimate of r(sub c), is obtained from the asymptotic field for strain hardening materials given by Hutchinson, Rice and Rosengren (HRR). A previous study using of high order finite element methods to calculate T-stresses by contour integrals resulted in extremely high accuracy values obtained for selected test specimen geometries, and a theoretical error estimation parameter was defined. In the present study, it is shown that a large portion of the error in finite element computations of both K and T are systematic, and can be corrected after the initial solution if the finite element implementation utilizes a similar crack tip discretization scheme for all problems. This scheme is applied for two-dimensional problems to a both a p-version finite element code, showing that sufficiently accurate values of both K(sub I) and T can be obtained with fairly low order elements if correction is used. T-stress correction coefficients are also developed for the singular crack tip rosette utilized in the adaptive mesh finite element code FRANC2D, and shown to reduce the error in the computed T-stress significantly. Stress intensity factor correction was not attempted for FRANC2D because it employs a highly accurate

  16. A new hybrid coding for protein secondary structure prediction based on primary structure similarity.

    PubMed

    Li, Zhong; Wang, Jing; Zhang, Shunpu; Zhang, Qifeng; Wu, Wuming

    2017-03-16

    The coding pattern of protein can greatly affect the prediction accuracy of protein secondary structure. In this paper, a novel hybrid coding method based on the physicochemical properties of amino acids and tendency factors is proposed for the prediction of protein secondary structure. The principal component analysis (PCA) is first applied to the physicochemical properties of amino acids to construct a 3-bit-code, and then the 3 tendency factors of amino acids are calculated to generate another 3-bit-code. Two 3-bit-codes are fused to form a novel hybrid 6-bit-code. Furthermore, we make a geometry-based similarity comparison of the protein primary structure between the reference set and the test set before the secondary structure prediction. We finally use the support vector machine (SVM) to predict those amino acids which are not detected by the primary structure similarity comparison. Experimental results show that our method achieves a satisfactory improvement in accuracy in the prediction of protein secondary structure.

  17. Quantitative structure-property relationships for predicting Henry's law constant from molecular structure.

    PubMed

    Dearden, John C; Schüürmann, Gerrit

    2003-08-01

    Various models are available for the prediction of Henry's law constant (H) or the air-water partition coefficient (Kaw), its dimensionless counterpart. Incremental methods are based on structural features such as atom types, bond types, and local structural environments; other regression models employ physicochemical properties, structural descriptors such as connectivity indices, and descriptors reflecting the electronic structure. There are also methods to calculate H from the ratio of vapor pressure (p(v)) and water solubility (S(w)) that in turn can be estimated from molecular structure, and quantum chemical continuum-solvation models to predict H via the solvation-free energy (deltaG(s)). This review is confined to methods that calculate H from molecular structure without experimental information and covers more than 40 methods published in the last 26 years. For a subset of eight incremental methods and four continuum-solvation models, a comparative analysis of their prediction performance is made using a test set of 700 compounds that includes a significant number of more complex and drug-like chemical structures. The results reveal substantial differences in the application range as well as in the prediction capability, a general decrease in prediction performance with decreasing H, and surprisingly large individual prediction errors, which are particularly striking for some quantum chemical schemes. The overall best-performing method appears to be the bond contribution method as implemented in the HENRYWIN software package, yielding a predictive squared correlation coefficient (q2) of 0.87 and a standard error of 1.03 log units for the test set.

  18. Integrated control/structure optimization by multilevel decomposition

    NASA Technical Reports Server (NTRS)

    Zeiler, Thomas A.; Gilbert, Michael G.

    1990-01-01

    A method for integrated control/structure optimization by multilevel decomposition is presented. It is shown that several previously reported methods were actually partial decompositions wherein only the control was decomposed into a subsystem design. One of these partially decomposed problems was selected as a benchmark example for comparison. The present paper fully decomposes the system into structural and control subsystem designs and produces an improved design. Theory, implementation, and results for the method are presented and compared with the benchmark example.

  19. Modeling the Dependency Structure of Integrated Intensity Processes

    PubMed Central

    Ma, Yong-Ki

    2015-01-01

    This paper studies an important issue of dependence structure. To model this structure, the intensities within the Cox processes are driven by dependent shot noise processes, where jumps occur simultaneously and their sizes are correlated. The joint survival probability of the integrated intensities is explicitly obtained from the copula with exponential marginal distributions. Subsequently, this result can provide a very useful guide for credit risk management. PMID:26270638

  20. Structural Integrity Program for INTEC Calcined Solids Storage Facilities

    SciTech Connect

    Jeffrey Bryant

    2008-08-30

    This report documents the activities of the structural integrity program at the Idaho Nuclear Technology and Engineering Center relevant to the high-level waste Calcined Solids Storage Facilities and associated equipment, as required by DOE M 435.1-1, 'Radioactive Waste Management Manual'. Based on the evaluation documented in this report, the Calcined Solids Storage Facilities are not leaking and are structurally sound for continued service. Recommendations are provided for continued monitoring of the Calcined Solids Storage Facilities.

  1. Addressing the Role of Conformational Diversity in Protein Structure Prediction

    PubMed Central

    Parisi, Gustavo; Fornasari, Maria Silvina

    2016-01-01

    Computational modeling of tertiary structures has become of standard use to study proteins that lack experimental characterization. Unfortunately, 3D structure prediction methods and model quality assessment programs often overlook that an ensemble of conformers in equilibrium populates the native state of proteins. In this work we collected sets of publicly available protein models and the corresponding target structures experimentally solved and studied how they describe the conformational diversity of the protein. For each protein, we assessed the quality of the models against known conformers by several standard measures and identified those models ranked best. We found that model rankings are defined by both the selected target conformer and the similarity measure used. 70% of the proteins in our datasets show that different models are structurally closest to different conformers of the same protein target. We observed that model building protocols such as template-based or ab initio approaches describe in similar ways the conformational diversity of the protein, although for template-based methods this description may depend on the sequence similarity between target and template sequences. Taken together, our results support the idea that protein structure modeling could help to identify members of the native ensemble, highlight the importance of considering conformational diversity in protein 3D quality evaluations and endorse the study of the variability of the native structure for a meaningful biological analysis. PMID:27159429

  2. StructBoost: Boosting Methods for Predicting Structured Output Variables.

    PubMed

    Chunhua Shen; Guosheng Lin; van den Hengel, Anton

    2014-10-01

    Boosting is a method for learning a single accurate predictor by linearly combining a set of less accurate weak learners. Recently, structured learning has found many applications in computer vision. Inspired by structured support vector machines (SSVM), here we propose a new boosting algorithm for structured output prediction, which we refer to as StructBoost. StructBoost supports nonlinear structured learning by combining a set of weak structured learners. As SSVM generalizes SVM, our StructBoost generalizes standard boosting approaches such as AdaBoost, or LPBoost to structured learning. The resulting optimization problem of StructBoost is more challenging than SSVM in the sense that it may involve exponentially many variables and constraints. In contrast, for SSVM one usually has an exponential number of constraints and a cutting-plane method is used. In order to efficiently solve StructBoost, we formulate an equivalent 1-slack formulation and solve it using a combination of cutting planes and column generation. We show the versatility and usefulness of StructBoost on a range of problems such as optimizing the tree loss for hierarchical multi-class classification, optimizing the Pascal overlap criterion for robust visual tracking and learning conditional random field parameters for image segmentation.

  3. Prediction of common folding structures of homologous RNAs.

    PubMed Central

    Han, K; Kim, H J

    1993-01-01

    We have developed an algorithm and a computer program for simultaneously folding homologous RNA sequences. Given an alignment of M homologous sequences of length N, the program performs phylogenetic comparative analysis and predicts a common secondary structure conserved in the sequences. When the structure is not uniquely determined, it infers multiple structures which appear most plausible. This method is superior to energy minimization methods in the sense that it is not sensitive to point mutation of a sequence. It is also superior to usual phylogenetic comparative methods in that it does not require manual scrutiny for covariation or secondary structures. The most plausible 1-5 structures are produced in O(MN2 + N3) time and O(N2) space, which are the same requirements as those of widely used dynamic programs based on energy minimization for folding a single sequence. This is the first algorithm probably practical both in terms of time and space for finding secondary structures of homologous RNA sequences. The algorithm has been implemented in C on a Sun SparcStation, and has been verified by testing on tRNAs, 5S rRNAs, 16S rRNAs, TAR RNAs of human immunodeficiency virus type 1 (HIV-1), and RRE RNAs of HIV-1. We have also applied the program to cis-acting packaging sequences of HIV-1, for which no generally accepted structures yet exist, and propose potentially stable structures. Simulation of the program with random sequences with the same base composition and the same degree of similarity as the above sequences shows that structures common to homologous sequences are very unlikely to occur by chance in random sequences. PMID:7681944

  4. Integrated structural and optical modeling of the orbiting stellar interferometer

    NASA Astrophysics Data System (ADS)

    Shaklan, Stuart B.; Yu, Jeffrey W.; Briggs, Hugh C.

    1993-11-01

    The Integrated Modeling of Optical Systems (IMOS) Integration Workbench at JPL has been used to model the effects of structural perturbations on the optics in the proposed Orbiting Stellar Interferometer (OSI). OSI consists of 3 pairs of interferometers and delay lines attached to a 7.5 meter truss. They are interferometrically monitored from a separate boom by a laser metrology system. The spatially distributed nature of the science instrument calls for a high level of integration between the optics and support structure. Because OSI is designed to achieve micro-arcsecond astrometry, many of its alignment, stability, and knowledge tolerances are in the submicron regime. The spacecraft will be subject to vibrations caused by reaction wheels and on-board equipment, as well as thermal strain due to solar and terrestrial heating. These perturbations affect optical parameters such as optical path differences and beam co-parallelism which are critical to instrument performance. IMOS provides an environment that allows one to design and perturb the structure, attach optics to structural or non-structural nodes, trace rays, and analyze the impact of mechanical perturbations on optical performance. This tool makes it simple to change the structure and immediately see performance enhancement/degradation. We have employed IMOS to analyze the effect of reaction wheel disturbances on the optical path difference in both the science and metrology interferometers.

  5. Integrated Modeling Activities for the James Webb Space Telescope (JWST): Structural-Thermal-Optical Analysis

    NASA Technical Reports Server (NTRS)

    Johnston, John D.; Parrish, Keith; Howard, Joseph M.; Mosier, Gary E.; McGinnis, Mark; Bluth, Marcel; Kim, Kevin; Ha, Hong Q.

    2004-01-01

    This is a continuation of a series of papers on modeling activities for JWST. The structural-thermal- optical, often referred to as "STOP", analysis process is used to predict the effect of thermal distortion on optical performance. The benchmark STOP analysis for JWST assesses the effect of an observatory slew on wavefront error. The paper begins an overview of multi-disciplinary engineering analysis, or integrated modeling, which is a critical element of the JWST mission. The STOP analysis process is then described. This process consists of the following steps: thermal analysis, structural analysis, and optical analysis. Temperatures predicted using geometric and thermal math models are mapped to the structural finite element model in order to predict thermally-induced deformations. Motions and deformations at optical surfaces are input to optical models and optical performance is predicted using either an optical ray trace or WFE estimation techniques based on prior ray traces or first order optics. Following the discussion of the analysis process, results based on models representing the design at the time of the System Requirements Review. In addition to baseline performance predictions, sensitivity studies are performed to assess modeling uncertainties. Of particular interest is the sensitivity of optical performance to uncertainties in temperature predictions and variations in metal properties. The paper concludes with a discussion of modeling uncertainty as it pertains to STOP analysis.

  6. Development of Probabilistic Structural Analysis Integrated with Manufacturing Processes

    NASA Technical Reports Server (NTRS)

    Pai, Shantaram S.; Nagpal, Vinod K.

    2007-01-01

    An effort has been initiated to integrate manufacturing process simulations with probabilistic structural analyses in order to capture the important impacts of manufacturing uncertainties on component stress levels and life. Two physics-based manufacturing process models (one for powdered metal forging and the other for annular deformation resistance welding) have been linked to the NESSUS structural analysis code. This paper describes the methodology developed to perform this integration including several examples. Although this effort is still underway, particularly for full integration of a probabilistic analysis, the progress to date has been encouraging and a software interface that implements the methodology has been developed. The purpose of this paper is to report this preliminary development.

  7. Predicting US Infants' and Toddlers' TV/Video Viewing Rates: Mothers' Cognitions and Structural Life Circumstances

    PubMed Central

    Vaala, Sarah E.; Hornik, Robert C.

    2014-01-01

    There has been rising international concern over media use with children under two. As little is known about the factors associated with more or less viewing among very young children, this study examines maternal factors predictive of TV/video viewing rates among American infants and toddlers. Guided by the Integrative Model of Behavioral Prediction, this survey study examines relationships between children's rates of TV/video viewing and their mothers' structural life circumstances (e.g., number of children in the home; mother's screen use), and cognitions (e.g., attitudes; norms). Results suggest that mothers' structural circumstances and cognitions respectively contribute independent explanatory power to the prediction of children's TV/video viewing. Influence of structural circumstances is partially mediated through cognitions. Mothers' attitudes as well as their own TV/video viewing behavior were particularly predictive of children's viewing. Implications of these findings for international efforts to understand and reduce infant/toddler TV/video exposure are discussed. PMID:25489335

  8. STRUCTURAL INTEGRITY MONITORING FOR IMPROVED DRINKING WATER INFRASTRUCTURE SUSTAINABILITY

    EPA Science Inventory

    Structural integrity monitoring (SIM) is the systematic detection, location, and quantification of pipe wall damage or associated indicators. Each of the adverse situations below has the potential to be reduced by more effective and economical SIM of water mains:
    1) the dr...

  9. Integration of fluidic jet actuators in composite structures

    NASA Astrophysics Data System (ADS)

    Schueller, Martin; Lipowski, Mathias; Schirmer, Eckart; Walther, Marco; Otto, Thomas; Geßner, Thomas; Kroll, Lothar

    2015-04-01

    Fluidic Actuated Flow Control (FAFC) has been introduced as a technology that influences the boundary layer by actively blowing air through slots or holes in the aircraft skin or wind turbine rotor blade. Modern wing structures are or will be manufactured using composite materials. In these state of the art systems, AFC actuators are integrated in a hybrid approach. The new idea is to directly integrate the active fluidic elements (such as SJAs and PJAs) and their components in the structure of the airfoil. Consequently, the integration of such fluidic devices must fit the manufacturing process and the material properties of the composite structure. The challenge is to integrate temperature-sensitive active elements and to realize fluidic cavities at the same time. The transducer elements will be provided for the manufacturing steps using roll-to-roll processes. The fluidic parts of the actuators will be manufactured using the MuCell® process that provides on the one hand the defined reproduction of the fluidic structures and, on the other hand, a high light weight index. Based on the first design concept, a demonstrator was developed in order to proof the design approach. The output velocity on the exit was measured using a hot-wire anemometer.

  10. Predicting the structure of the light-harvesting complex II of Rhodospirillum molischianum.

    PubMed Central

    Hu, X.; Xu, D.; Hamer, K.; Schulten, K.; Koepke, J.; Michel, H.

    1995-01-01

    We attempted to predict through computer modeling the structure of the light-harvesting complex II (LH-II) of Rhodospirillum molischianum, before the impending publication of the structure of a homologous protein solved by means of X-ray diffraction. The protein studied is an integral membrane protein of 16 independent polypeptides, 8 alpha-apoproteins and 8 beta-apoproteins, which aggregate and bind to 24 bacteriochlorophyll-a's and 12 lycopenes. Available diffraction data of a crystal of the protein, which could not be phased due to a lack of heavy metal derivatives, served to test the predicted structure, guiding the search. In order to determine the secondary structure, hydropathy analysis was performed to identify the putative transmembrane segments and multiple sequence alignment propensity analyses were used to pinpoint the exact sites of the 20-residue-long transmembrane segment and the 4-residue-long terminal sequence at both ends, which were independently verified and improved by homology modeling. A consensus assignment for the secondary structure was derived from a combination of all the prediction methods used. Three-dimensional structures for the alpha- and the beta-apoprotein were built by comparative modeling. The resulting tertiary structures are combined, using X-PLOR, into an alpha beta dimer pair with bacteriochlorophyll-a's attached under constraints provided by site-directed mutagenesis and spectral data. The alpha beta dimer pairs were then aggregated into a quaternary structure through further molecular dynamics simulations and energy minimization. The structure of LH-II so determined is an octamer of alpha beta heterodimers forming a ring with a diameter of 70 A. PMID:8528066

  11. Brain white matter structural properties predict transition to chronic pain.

    PubMed

    Mansour, Ali R; Baliki, Marwan N; Huang, Lejian; Torbey, Souraya; Herrmann, Kristi M; Schnitzer, Thomas J; Apkarian, A Vania

    2013-10-01

    Neural mechanisms mediating the transition from acute to chronic pain remain largely unknown. In a longitudinal brain imaging study, we followed up patients with a single sub-acute back pain (SBP) episode for more than 1 year as their pain recovered (SBPr), or persisted (SBPp) representing a transition to chronic pain. We discovered brain white matter structural abnormalities (n=24 SBP patients; SBPp=12 and SBPr=12), as measured by diffusion tensor imaging (DTI), at entry into the study in SBPp in comparison to SBPr. These white matter fractional anisotropy (FA) differences accurately predicted pain persistence over the next year, which was validated in a second cohort (n=22 SBP patients; SBPp=11 and SBPr=11), and showed no further alterations over a 1-year period. Tractography analysis indicated that abnormal regional FA was linked to differential structural connectivity to medial vs lateral prefrontal cortex. Local FA was correlated with functional connectivity between medial prefrontal cortex and nucleus accumbens in SBPr. As we have earlier shown that the latter functional connectivity accurately predicts transition to chronic pain, we can conclude that brain structural differences, most likely existing before the back pain-inciting event and independent of the back pain, predispose subjects to pain chronification.

  12. Predicted primary and antigenic structure of canine corticotropin releasing hormone.

    PubMed

    Mol, J A; van Wolferen, M; Kwant, M; Meloen, R

    1994-07-01

    Although the dog has been recognized as a useful model for the study of the cerebrospinal and peripheral actions of corticotropin releasing hormone (CRH) the exact amino acid composition of canine CRH is still unknown. In the present study the structure of canine CRH was predicted from the partial sequence of the gene encoding canine CRH. The CRH gene was amplified from genomic DNA obtained from white blood cells by a polymerase chain reaction and subsequently sequenced using the dideoxy method. The likely structure of canine CRH is: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, which is identical to the structure of human, rat and equine CRH. PEPSCAN analysis of 3 different CRH antisera predicted an antiserum raised against a conjugate of human CRH and CNBr -activated thyroglobulin to be the antiserum of choice for the measurement of CRH in the dog. Preliminary data confirmed the existence of the highest cross-reactivity of a canine hypothalamus extract, known to have a high content of CRH, with antisera directed against human, rat CRH. As a result of the present study immunological tools for CRH estimations are characterized. Also, a homologous DNA probe for in situ hybridizations has become available for further investigations.

  13. Integrated Controls-Structures Design Methodology: Redesign of an Evolutionary Test Structure

    NASA Technical Reports Server (NTRS)

    Maghami, Peiman G.; Gupta, Sandeep; Elliot, Kenny B.; Joshi, Suresh M.

    1997-01-01

    An optimization-based integrated controls-structures design methodology for a class of flexible space structures is described, and the phase-0 Controls-Structures-Integration evolutionary model, a laboratory testbed at NASA Langley, is redesigned using this integrated design methodology. The integrated controls-structures design is posed as a nonlinear programming problem to minimize the control effort required to maintain a specified line-of-sight pointing performance, under persistent white noise disturbance. Static and dynamic dissipative control strategies are employed for feedback control, and parameters of these controllers are considered as the control design variables. Sizes of strut elements in various sections of the CEM are used as the structural design variables. Design guides for the struts are developed and employed in the integrated design process, to ensure that the redesigned structure can be effectively fabricated. The superiority of the integrated design methodology over the conventional design approach is demonstrated analytically by observing a significant reduction in the average control power needed to maintain specified pointing performance with the integrated design approach.

  14. Integration of encapsulated piezoelectric actuators in highly loaded CFRP structures

    NASA Astrophysics Data System (ADS)

    Bachmann, Florian; Ermanni, Paolo

    2010-04-01

    The present work has been initiated in the frame of the European research project DREAM. Within this highly interdisciplinary project we are focusing on the development and application of vibration damping solutions based on piezoelectric shunt circuits for future aeroelastic applications. The scientific community has put significant effort into the investigation of piezoelectric shunt damping in conjuction with typical engineering test structures such as beams and plates. However, investigations are mainly restricted to surface bonded piezoelectric elements. Commercially available actuators and sensors can be easily bonded to structures using standard epoxy resins. Yet, the structural integration into composite laminates is cumbersome, due to the implications in terms of overall structural integrity and functionality, and due to the problems in achieving a good electrical conductivity, intimate contact betwen electrode and piezoceramic material as well as a perfect isolation from the surrounding host structure. This contribution is concerned with technological aspects related to the integration of piezoceramic actuators into highly loaded CFRP structures. In particular, we present results of a comparative study aiming at the characterization of less invasive electrodes to establish electrical contact between the piezoceramic material and possible shunt circuits. Another drawback of commercial actuators are their limited strain allowables ranging from 0.1% to 0.3% which is not sufficient for high performance lighweight structures. The second part of this contribution is therefore dedicated to the description of a novel prestressing procedure which is used to fabricate actuators that command 170% higher strain allowables than non-prestressed actuators. Mechanical testing of these prestressed actuators are very encouraging, showing high strain allowables, perfect electrical isolation from the host structure, excellent electric contacting of the piezoelectric material

  15. Failure prediction of thin beryllium sheets used in spacecraft structures

    NASA Technical Reports Server (NTRS)

    Roschke, Paul N.; Papados, Photios; Mascorro, Edward

    1991-01-01

    In an attempt to predict failure for cross-rolled beryllium sheet structures, high order macroscopic failure criteria are used. These require the knowledge of in-plane uniaxial and shear strengths. Test results are included for in-plane biaxial tension, uniaxial compression for two different material orientations, and shear. All beryllium specimens have the same chemical composition. In addition, all experimental work was performed in a controlled laboratory environment. Numerical simulation complements these tests. A brief bibliography supplements references listed in a previous report.

  16. Offspring social network structure predicts fitness in families.

    PubMed

    Royle, Nick J; Pike, Thomas W; Heeb, Philipp; Richner, Heinz; Kölliker, Mathias

    2012-12-22

    Social structures such as families emerge as outcomes of behavioural interactions among individuals, and can evolve over time if families with particular types of social structures tend to leave more individuals in subsequent generations. The social behaviour of interacting individuals is typically analysed as a series of multiple dyadic (pair-wise) interactions, rather than a network of interactions among multiple individuals. However, in species where parents feed dependant young, interactions within families nearly always involve more than two individuals simultaneously. Such social networks of interactions at least partly reflect conflicts of interest over the provision of costly parental investment. Consequently, variation in family network structure reflects variation in how conflicts of interest are resolved among family members. Despite its importance in understanding the evolution of emergent properties of social organization such as family life and cooperation, nothing is currently known about how selection acts on the structure of social networks. Here, we show that the social network structure of broods of begging nestling great tits Parus major predicts fitness in families. Although selection at the level of the individual favours large nestlings, selection at the level of the kin-group primarily favours families that resolve conflicts most effectively.

  17. Gene function prediction based on the Gene Ontology hierarchical structure.

    PubMed

    Cheng, Liangxi; Lin, Hongfei; Hu, Yuncui; Wang, Jian; Yang, Zhihao

    2014-01-01

    The information of the Gene Ontology annotation is helpful in the explanation of life science phenomena, and can provide great support for the research of the biomedical field. The use of the Gene Ontology is gradually affecting the way people store and understand bioinformatic data. To facilitate the prediction of gene functions with the aid of text mining methods and existing resources, we transform it into a multi-label top-down classification problem and develop a method that uses the hierarchical relationships in the Gene Ontology structure to relieve the quantitative imbalance of positive and negative training samples. Meanwhile the method enhances the discriminating ability of classifiers by retaining and highlighting the key training samples. Additionally, the top-down classifier based on a tree structure takes the relationship of target classes into consideration and thus solves the incompatibility between the classification results and the Gene Ontology structure. Our experiment on the Gene Ontology annotation corpus achieves an F-value performance of 50.7% (precision: 52.7% recall: 48.9%). The experimental results demonstrate that when the size of training set is small, it can be expanded via topological propagation of associated documents between the parent and child nodes in the tree structure. The top-down classification model applies to the set of texts in an ontology structure or with a hierarchical relationship.

  18. Offspring social network structure predicts fitness in families

    PubMed Central

    Royle, Nick J.; Pike, Thomas W.; Heeb, Philipp; Richner, Heinz; Kölliker, Mathias

    2012-01-01

    Social structures such as families emerge as outcomes of behavioural interactions among individuals, and can evolve over time if families with particular types of social structures tend to leave more individuals in subsequent generations. The social behaviour of interacting individuals is typically analysed as a series of multiple dyadic (pair-wise) interactions, rather than a network of interactions among multiple individuals. However, in species where parents feed dependant young, interactions within families nearly always involve more than two individuals simultaneously. Such social networks of interactions at least partly reflect conflicts of interest over the provision of costly parental investment. Consequently, variation in family network structure reflects variation in how conflicts of interest are resolved among family members. Despite its importance in understanding the evolution of emergent properties of social organization such as family life and cooperation, nothing is currently known about how selection acts on the structure of social networks. Here, we show that the social network structure of broods of begging nestling great tits Parus major predicts fitness in families. Although selection at the level of the individual favours large nestlings, selection at the level of the kin-group primarily favours families that resolve conflicts most effectively. PMID:23097505

  19. Structured Set Intra Prediction With Discriminative Learning in a Max-Margin Markov Network for High Efficiency Video Coding

    PubMed Central

    Dai, Wenrui; Xiong, Hongkai; Jiang, Xiaoqian; Chen, Chang Wen

    2014-01-01

    This paper proposes a novel model on intra coding for High Efficiency Video Coding (HEVC), which simultaneously predicts blocks of pixels with optimal rate distortion. It utilizes the spatial statistical correlation for the optimal prediction based on 2-D contexts, in addition to formulating the data-driven structural interdependences to make the prediction error coherent with the probability distribution, which is desirable for successful transform and coding. The structured set prediction model incorporates a max-margin Markov network (M3N) to regulate and optimize multiple block predictions. The model parameters are learned by discriminating the actual pixel value from other possible estimates to maximize the margin (i.e., decision boundary bandwidth). Compared to existing methods that focus on minimizing prediction error, the M3N-based model adaptively maintains the coherence for a set of predictions. Specifically, the proposed model concurrently optimizes a set of predictions by associating the loss for individual blocks to the joint distribution of succeeding discrete cosine transform coefficients. When the sample size grows, the prediction error is asymptotically upper bounded by the training error under the decomposable loss function. As an internal step, we optimize the underlying Markov network structure to find states that achieve the maximal energy using expectation propagation. For validation, we integrate the proposed model into HEVC for optimal mode selection on rate-distortion optimization. The proposed prediction model obtains up to 2.85% bit rate reduction and achieves better visual quality in comparison to the HEVC intra coding. PMID:25505829

  20. Curved Displacement Transfer Functions for Geometric Nonlinear Large Deformation Structure Shape Predictions

    NASA Technical Reports Server (NTRS)

    Ko, William L.; Fleischer, Van Tran; Lung, Shun-Fat

    2017-01-01

    For shape predictions of structures under large geometrically nonlinear deformations, Curved Displacement Transfer Functions were formulated based on a curved displacement, traced by a material point from the undeformed position to deformed position. The embedded beam (depth-wise cross section of a structure along a surface strain-sensing line) was discretized into multiple small domains, with domain junctures matching the strain-sensing stations. Thus, the surface strain distribution could be described with a piecewise linear or a piecewise nonlinear function. The discretization approach enabled piecewise integrations of the embedded-beam curvature equations to yield the Curved Displacement Transfer Functions, expressed in terms of embedded beam geometrical parameters and surface strains. By entering the surface strain data into the Displacement Transfer Functions, deflections along each embedded beam can be calculated at multiple points for mapping the overall structural deformed shapes. Finite-element linear and nonlinear analyses of a tapered cantilever tubular beam were performed to generate linear and nonlinear surface strains and the associated deflections to be used for validation. The shape prediction accuracies were then determined by comparing the theoretical deflections with the finiteelement- generated deflections. The results show that the newly developed Curved Displacement Transfer Functions are very accurate for shape predictions of structures under large geometrically nonlinear deformations.

  1. Making the difference: integrating structural variation detection tools.

    PubMed

    Lin, Ke; Smit, Sandra; Bonnema, Guusje; Sanchez-Perez, Gabino; de Ridder, Dick

    2015-09-01

    From prokaryotes to eukaryotes, phenotypic variation, adaptation and speciation has been associated with structural variation between genomes of individuals within the same species. Many computer algorithms detecting such variations (callers) have recently been developed, spurred by the advent of the next-generation sequencing technology. Such callers mainly exploit split-read mapping or paired-end read mapping. However, as different callers are geared towards different types of structural variation, there is still no single caller that can be considered a community standard; instead, increasingly the various callers are combined in integrated pipelines. In this article, we review a wide range of callers, discuss challenges in the integration step and present a survey of pipelines used in population genomics studies. Based on our findings, we provide general recommendations on how to set-up such pipelines. Finally, we present an outlook on future challenges in structural variation detection.

  2. COMPUTING THERAPY FOR PRECISION MEDICINE: COLLABORATIVE FILTERING INTEGRATES AND PREDICTS MULTI-ENTITY INTERACTIONS

    PubMed Central

    REGENBOGEN, SAM; WILKINS, ANGELA D.; LICHTARGE, OLIVIER

    2015-01-01

    Biomedicine produces copious information it cannot fully exploit. Specifically, there is considerable need to integrate knowledge from disparate studies to discover connections across domains. Here, we used a Collaborative Filtering approach, inspired by online recommendation algorithms, in which non-negative matrix factorization (NMF) predicts interactions among chemicals, genes, and diseases only from pairwise information about their interactions. Our approach, applied to matrices derived from the Comparative Toxicogenomics Database, successfully recovered Chemical-Disease, Chemical-Gene, and Disease-Gene networks in 10-fold cross-validation experiments. Additionally, we could predict each of these interaction matrices from the other two. Integrating all three CTD interaction matrices with NMF led to good predictions of STRING, an independent, external network of protein-protein interactions. Finally, this approach could integrate the CTD and STRING interaction data to improve Chemical-Gene cross-validation performance significantly, and, in a time-stamped study, it predicted information added to CTD after a given date, using only data prior to that date. We conclude that collaborative filtering can integrate information across multiple types of biological entities, and that as a first step towards precision medicine it can compute drug repurposing hypotheses. PMID:26776170

  3. Predicting Examination Performance Using an Expanded Integrated Hierarchical Model of Test Emotions and Achievement Goals

    ERIC Educational Resources Information Center

    Putwain, Dave; Deveney, Carolyn

    2009-01-01

    The aim of this study was to examine an expanded integrative hierarchical model of test emotions and achievement goal orientations in predicting the examination performance of undergraduate students. Achievement goals were theorised as mediating the relationship between test emotions and performance. 120 undergraduate students completed…

  4. Adjunct Faculty Characteristics that May Predict Intention to Integrate Technology into Instruction

    ERIC Educational Resources Information Center

    Paver, Jonathan; Walker, David A.; Hung, Wei-Chen

    2014-01-01

    This study examined the demographic factors that predict intention to integrate technology into instruction by community college adjunct faculty. Regression model findings indicated that the demographic characteristics of years of teaching experience, teaching discipline, hours of preparation time, and years of experience using computers were…

  5. IN SILICO METHODOLOGIES FOR PREDICTIVE EVALUATION OF TOXICITY BASED ON INTEGRATION OF DATABASES

    EPA Science Inventory

    In silico methodologies for predictive evaluation of toxicity based on integration of databases

    Chihae Yang1 and Ann M. Richard2, 1LeadScope, Inc. 1245 Kinnear Rd. Columbus, OH. 43212 2National Health & Environmental Effects Research Lab, U.S. EPA, Research Triangle Park, ...

  6. Predicting carbon dynamics in integrated production systems in Brazil using the CQESTR model

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Process-based carbon models are research tools to predict management impact on soil organic carbon (SOC) and options to increase SOC stocks and reduce CO2. The CQESTR model was used to examine the effect of soil management practices, including integrated crop-livestock system (iCLS), and various sc...

  7. Comparison of SWAT Predictions with Stream Biological Integrity Observations in an Agricultural Watershed

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The SWAT model is calibrated with USGS data for an agricultural watershed located on the Eastern Shore of Maryland. Model predictions of runoff, sediment, nitrogen and phosphorus amounts, at the outlet of sub-watersheds, are compared to measurements of stream biological integrity conducted throughou...

  8. Integrated fuzzy concentration addition-independent action (IFCA-IA) model outperforms two-stage prediction (TSP) for predicting mixture toxicity.

    PubMed

    Wang, Zhuang; Chen, Jingwen; Huang, Liping; Wang, Ying; Cai, Xiyun; Qiao, Xianliang; Dong, Yuying

    2009-02-01

    Mixture toxicities were determined for 12 industrial organic chemicals bearing four different modes of toxic action (MOAs) to Vibrio fischeri, to compare the predictability of the integrated fuzzy concentration addition-independent action (IFCA-IA) model and the two-stage prediction (TSP) model. Three mixtures were designed: The first and second mixtures were based on the ratios of each component at the 1% and 50% effect concentrations (EC(1) and EC(50)), respectively; and the third mixture contained an equimolar ratio of individual components. For the EC(1), EC(50) and equimolar ratio, prediction errors from the IFCA-IA model at the 50% experimental mixture effects were 0.3%, 6% and 0.6%, respectively; while for the TSP model, the corresponding errors were 2.8%, 19% and 24%, respectively. Thus, the IFCA-IA model performed better than the TSP model. The IFCA-IA model calculated two weight coefficients from the molecular structural descriptors, which weigh the relation between concentration addition (CA) and independent action (IA) through the fuzzy membership functions. Thus, MOAs are not pre-requisites for mixture toxicity prediction by the IFCA-IA approach, implying the practicability of this method in toxicity assessment of mixtures.

  9. AVCpred: an integrated web server for prediction and design of antiviral compounds.

    PubMed

    Qureshi, Abid; Kaur, Gazaldeep; Kumar, Manoj

    2017-01-01

    Viral infections constantly jeopardize the global public health due to lack of effective antiviral therapeutics. Therefore, there is an imperative need to speed up the drug discovery process to identify novel and efficient drug candidates. In this study, we have developed quantitative structure-activity relationship (QSAR)-based models for predicting antiviral compounds (AVCs) against deadly viruses like human immunodeficiency virus (HIV), hepatitis C virus (HCV), hepatitis B virus (HBV), human herpesvirus (HHV) and 26 others using publicly available experimental data from the ChEMBL bioactivity database. Support vector machine (SVM) models achieved a maximum Pearson correlation coefficient of 0.72, 0.74, 0.66, 0.68, and 0.71 in regression mode and a maximum Matthew's correlation coefficient 0.91, 0.93, 0.70, 0.89, and 0.71, respectively, in classification mode during 10-fold cross-validation. Furthermore, similar performance was observed on the independent validation sets. We have integrated these models in the AVCpred web server, freely available at http://crdd.osdd.net/servers/avcpred. In addition, the datasets are provided in a searchable format. We hope this web server will assist researchers in the identification of potential antiviral agents. It would also save time and cost by prioritizing new drugs against viruses before their synthesis and experimental testing.

  10. Three Dimensional Structure Prediction of Fatty Acid Binding Site on Human Transmembrane Receptor CD36.

    PubMed

    Tarhda, Zineb; Semlali, Oussama; Kettani, Anas; Moussa, Ahmed; Abumrad, Nada A; Ibrahimi, Azeddine

    2013-01-01

    CD36 is an integral membrane protein which is thought to have a hairpin-like structure with alpha-helices at the C and N terminals projecting through the membrane as well as a larger extracellular loop. This receptor interacts with a number of ligands including oxidized low density lipoprotein and long chain fatty acids (LCFAs). It is also implicated in lipid metabolism and heart diseases. It is therefore important to determine the 3D structure of the CD36 site involved in lipid binding. In this study, we predict the 3D structure of the fatty acid (FA) binding site [127-279 aa] of the CD36 receptor based on homology modeling with X-ray structure of Human Muscle Fatty Acid Binding Protein (PDB code: 1HMT). Qualitative and quantitative analysis of the resulting model suggests that this model was reliable and stable, taking in consideration over 97.8% of the residues in the most favored regions as well as the significant overall quality factor. Protein analysis, which relied on the secondary structure prediction of the target sequence and the comparison of 1HMT and CD36 [127-279 aa] secondary structures, led to the determination of the amino acid sequence consensus. These results also led to the identification of the functional sites on CD36 and revealed the presence of residues which may play a major role during ligand-protein interactions.

  11. Three Dimensional Structure Prediction of Fatty Acid Binding Site on Human Transmembrane Receptor CD36

    PubMed Central

    Tarhda, Zineb; Semlali, Oussama; Kettani, Anas; Moussa, Ahmed; Abumrad, Nada A.; Ibrahimi, Azeddine

    2013-01-01

    CD36 is an integral membrane protein which is thought to have a hairpin-like structure with alpha-helices at the C and N terminals projecting through the membrane as well as a larger extracellular loop. This receptor interacts with a number of ligands including oxidized low density lipoprotein and long chain fatty acids (LCFAs). It is also implicated in lipid metabolism and heart diseases. It is therefore important to determine the 3D structure of the CD36 site involved in lipid binding. In this study, we predict the 3D structure of the fatty acid (FA) binding site [127–279 aa] of the CD36 receptor based on homology modeling with X-ray structure of Human Muscle Fatty Acid Binding Protein (PDB code: 1HMT). Qualitative and quantitative analysis of the resulting model suggests that this model was reliable and stable, taking in consideration over 97.8% of the residues in the most favored regions as well as the significant overall quality factor. Protein analysis, which relied on the secondary structure prediction of the target sequence and the comparison of 1HMT and CD36 [127–279 aa] secondary structures, led to the determination of the amino acid sequence consensus. These results also led to the identification of the functional sites on CD36 and revealed the presence of residues which may play a major role during ligand-protein interactions. PMID:24348024

  12. Factors Influencing Progressive Failure Analysis Predictions for Laminated Composite Structure

    NASA Technical Reports Server (NTRS)

    Knight, Norman F., Jr.

    2008-01-01

    Progressive failure material modeling methods used for structural analysis including failure initiation and material degradation are presented. Different failure initiation criteria and material degradation models are described that define progressive failure formulations. These progressive failure formulations are implemented in a user-defined material model for use with a nonlinear finite element analysis tool. The failure initiation criteria include the maximum stress criteria, maximum strain criteria, the Tsai-Wu failure polynomial, and the Hashin criteria. The material degradation model is based on the ply-discounting approach where the local material constitutive coefficients are degraded. Applications and extensions of the progressive failure analysis material model address two-dimensional plate and shell finite elements and three-dimensional solid finite elements. Implementation details are described in the present paper. Parametric studies for laminated composite structures are discussed to illustrate the features of the progressive failure modeling methods that have been implemented and to demonstrate their influence on progressive failure analysis predictions.

  13. Methods for evaluating the predictive accuracy of structural dynamic models

    NASA Technical Reports Server (NTRS)

    Hasselman, T. K.; Chrostowski, Jon D.

    1990-01-01

    Uncertainty of frequency response using the fuzzy set method and on-orbit response prediction using laboratory test data to refine an analytical model are emphasized with respect to large space structures. Two aspects of the fuzzy set approach were investigated relative to its application to large structural dynamics problems: (1) minimizing the number of parameters involved in computing possible intervals; and (2) the treatment of extrema which may occur in the parameter space enclosed by all possible combinations of the important parameters of the model. Extensive printer graphics were added to the SSID code to help facilitate model verification, and an application of this code to the LaRC Ten Bay Truss is included in the appendix to illustrate this graphics capability.

  14. Prediction of Halocarbon Toxicity from Structure: A Hierarchical QSAR Approach

    SciTech Connect

    Gute, B D; Balasubramanian, K; Geiss, K; Basak, S C

    2003-04-11

    Mathematical structural invariants and quantum theoretical descriptors have been used extensively in quantitative structure-activity relationships (QSARs) for the estimation of pharmaceutical activities, biological properties, physicochemical properties, and the toxicities of chemicals. Recently our research team has explored the relative importance of various levels of chemodescriptors, i.e., topostructural, topochemical, geometrical, and quantum theoretical descriptors, in property estimation. This study examines the contribution of chemodescriptors ranging from topostructural to quantum theoretic calculations up to the Gaussian STO-3G level in the prediction of the toxicity of a set of twenty halocarbons. We also report the results of experimental cell-level toxicity studies on these twenty halocarbons to validate our models.

  15. Universal structural parameter to quantitatively predict metallic glass properties

    NASA Astrophysics Data System (ADS)

    Ding, Jun; Cheng, Yong-Qiang; Sheng, Howard; Asta, Mark; Ritchie, Robert O.; Ma, Evan

    2016-12-01

    Quantitatively correlating the amorphous structure in metallic glasses (MGs) with their physical properties has been a long-sought goal. Here we introduce `flexibility volume' as a universal indicator, to bridge the structural state the MG is in with its properties, on both atomic and macroscopic levels. The flexibility volume combines static atomic volume with dynamics information via atomic vibrations that probe local configurational space and interaction between neighbouring atoms. We demonstrate that flexibility volume is a physically appropriate parameter that can quantitatively predict the shear modulus, which is at the heart of many key properties of MGs. Moreover, the new parameter correlates strongly with atomic packing topology, and also with the activation energy for thermally activated relaxation and the propensity for stress-driven shear transformations. These correlations are expected to be robust across a very wide range of MG compositions, processing conditions and length scales.

  16. Universal structural parameter to quantitatively predict metallic glass properties

    PubMed Central

    Ding, Jun; Cheng, Yong-Qiang; Sheng, Howard; Asta, Mark; Ritchie, Robert O.; Ma, Evan

    2016-01-01

    Quantitatively correlating the amorphous structure in metallic glasses (MGs) with their physical properties has been a long-sought goal. Here we introduce ‘flexibility volume' as a universal indicator, to bridge the structural state the MG is in with its properties, on both atomic and macroscopic levels. The flexibility volume combines static atomic volume with dynamics information via atomic vibrations that probe local configurational space and interaction between neighbouring atoms. We demonstrate that flexibility volume is a physically appropriate parameter that can quantitatively predict the shear modulus, which is at the heart of many key properties of MGs. Moreover, the new parameter correlates strongly with atomic packing topology, and also with the activation energy for thermally activated relaxation and the propensity for stress-driven shear transformations. These correlations are expected to be robust across a very wide range of MG compositions, processing conditions and length scales. PMID:27941922

  17. Predicting fracture in micron-scale polycrystalline silicon MEMS structures.

    SciTech Connect

    Hazra, Siddharth S.; de Boer, Maarten Pieter; Boyce, Brad Lee; Ohlhausen, James Anthony; Foulk, James W., III; Reedy, Earl David, Jr.

    2010-09-01

    Designing reliable MEMS structures presents numerous challenges. Polycrystalline silicon fractures in a brittle manner with considerable variability in measured strength. Furthermore, it is not clear how to use a measured tensile strength distribution to predict the strength of a complex MEMS structure. To address such issues, two recently developed high throughput MEMS tensile test techniques have been used to measure strength distribution tails. The measured tensile strength distributions enable the definition of a threshold strength as well as an inferred maximum flaw size. The nature of strength-controlling flaws has been identified and sources of the observed variation in strength investigated. A double edge-notched specimen geometry was also tested to study the effect of a severe, micron-scale stress concentration on the measured strength distribution. Strength-based, Weibull-based, and fracture mechanics-based failure analyses were performed and compared with the experimental results.

  18. On Predicting the Crystal Structure of Energetic Materials From Quantum Mechanics

    DTIC Science & Technology

    2008-12-01

    ON PREDICTING THE CRYSTAL STRUCTURE OF ENERGETIC MATERIALS FROM QUANTUM MECHANICS Betsy M. Rice* U. S. Army Research Laboratory, AMSRD-ARL-WM...cyclotrimethylenetrinitramine (RDX) is used to predict polymorphic structures of crystalline RDX. The potential was first used in crystal structure prediction...methods which generate polymorphs of RDX and provide a 0 K ordering in energy. The 13 low energy- structures generated by crystal structure prediction

  19. Integrated Multidisciplinary Constrained Optimization of Offshore Support Structures

    NASA Astrophysics Data System (ADS)

    Haghi, Rad; Ashuri, Turaj; van der Valk, Paul L. C.; Molenaar, David P.

    2014-12-01

    In the current offshore wind turbine support structure design method, the tower and foundation, which form the support structure are designed separately by the turbine and foundation designer. This method yields a suboptimal design and it results in a heavy, overdesigned and expensive support structure. This paper presents an integrated multidisciplinary approach to design the tower and foundation simultaneously. Aerodynamics, hydrodynamics, structure and soil mechanics are the modeled disciplines to capture the full dynamic behavior of the foundation and tower under different environmental conditions. The objective function to be minimized is the mass of the support structure. The model includes various design constraints: local and global buckling, modal frequencies, and fatigue damage along different stations of the structure. To show the usefulness of the method, an existing SWT-3.6-107 offshore wind turbine where its tower and foundation are designed separately is used as a case study. The result of the integrated multidisciplinary design optimization shows 12.1% reduction in the mass of the support structure, while satisfying all the design constraints.

  20. An optimization-based integrated controls-structures design methodology for flexible space structures

    NASA Technical Reports Server (NTRS)

    Maghami, Peiman G.; Joshi, Suresh M.; Armstrong, Ernest S.

    1993-01-01

    An approach for an optimization-based integrated controls-structures design is presented for a class of flexible spacecraft that require fine attitude pointing and vibration suppression. The integrated design problem is posed in the form of simultaneous optimization of both structural and control design variables. The approach is demonstrated by application to the integrated design of a generic space platform and to a model of a ground-based flexible structure. The numerical results obtained indicate that the integrated design approach can yield spacecraft designs that have substantially superior performance over a conventional design wherein the structural and control designs are performed sequentially. For example, a 40-percent reduction in the pointing error is observed along with a slight reduction in mass, or an almost twofold increase in the controlled performance is indicated with more than a 5-percent reduction in the overall mass of the spacecraft (a reduction of hundreds of kilograms).

  1. Information integration based predictions about the conscious states of a spiking neural network.

    PubMed

    Gamez, David

    2010-03-01

    This paper describes how Tononi's information integration theory of consciousness was used to make detailed predictions about the distribution of phenomenal states in a spiking neural network. This network had approximately 18,000 neurons and 700,000 connections and it used models of emotion and imagination to control the eye movements of a virtual robot and avoid 'negative' stimuli. The first stage in the analysis was the development of a formal definition of Tononi's theory of consciousness. The network was then analysed for information integration and detailed predictions were made about the distribution of consciousness for each time step of recorded activity. This work demonstrates how an artificial system can be analysed for consciousness using a particular theory and in the future this approach could be used to make predictions about the phenomenal states associated with biological systems.

  2. Subtask 2.4 - Integration and Synthesis in Climate Change Predictive Modeling

    SciTech Connect

    Jaroslav Solc

    2009-06-01

    The Energy & Environmental Research Center (EERC) completed a brief evaluation of the existing status of predictive modeling to assess options for integration of our previous paleohydrologic reconstructions and their synthesis with current global climate scenarios. Results of our research indicate that short-term data series available from modern instrumental records are not sufficient to reconstruct past hydrologic events or predict future ones. On the contrary, reconstruction of paleoclimate phenomena provided credible information on past climate cycles and confirmed their integration in the context of regional climate history is possible. Similarly to ice cores and other paleo proxies, acquired data represent an objective, credible tool for model calibration and validation of currently observed trends. It remains a subject of future research whether further refinement of our results and synthesis with regional and global climate observations could contribute to improvement and credibility of climate predictions on a regional and global scale.

  3. The integration of remote sensing data into global weather prediction, wave forecasting, and ocean circulation computer based systems

    NASA Technical Reports Server (NTRS)

    Pierson, W. J., Jr.

    1970-01-01

    Data from infrared imaging systems and satellite infrared spectrometer (SIRS) for determining sea surface temperature and the atmospheric structure in cloudless areas over the oceans are discussed. Although some interpretations differ, it is clear that simultaneous measurements of radar sea return and passive microwave temperature will provide estimates of the wind speed, and perhaps wind direction, over the oceans, especially in cloudless areas, for a wide range of wind speeds. The problem of integrating the data that would be obtained by a spacecraft, especially one with a combination radar-radiometer, into global analysis procedures for meteorological, wave, and oceanographic predictions is described.

  4. Structural integrity and durability for Space Shuttle main engine and future reusable space propulsion systems

    NASA Technical Reports Server (NTRS)

    Marsik, S. J.; Gawrylowicz, H. T.

    1986-01-01

    NASA is conducting a program which will establish a technology base for the orderly evolution of reusable space propulsion systems. As part of that program, NASA initiated a Structural Integrity and Durability effort for advanced high-pressure oxygen-hydrogen rocket engine technology. That effort focuses on the development of: (1) accurate analytical models to describe flow fields; aerothermodynamic loads; structural responses; and fatigue/fracture, from which life prediction codes can be evolved; and (2) advanced instrumentation with capabilities to verify the codes in an SSME-like environment as well as the potential for future use as diagnostic sensors for real-time condition monitoring of critical engine components.

  5. Structure-Based Predictive model for Coal Char Combustion.

    SciTech Connect

    Hurt, R.; Colo, J; Essenhigh, R.; Hadad, C; Stanley, E.

    1997-09-24

    During the third quarter of this project, progress was made on both major technical tasks. Progress was made in the chemistry department at OSU on the calculation of thermodynamic properties for a number of model organic compounds. Modelling work was carried out at Brown to adapt a thermodynamic model of carbonaceous mesophase formation, originally applied to pitch carbonization, to the prediction of coke texture in coal combustion. This latter work makes use of the FG-DVC model of coal pyrolysis developed by Advanced Fuel Research to specify the pool of aromatic clusters that participate in the order/disorder transition. This modelling approach shows promise for the mechanistic prediction of the rank dependence of char structure and will therefore be pursued further. Crystalline ordering phenomena were also observed in a model char prepared from phenol-formaldehyde carbonized at 900{degrees}C and 1300{degrees}C using high-resolution TEM fringe imaging. Dramatic changes occur in the structure between 900 and 1300{degrees}C, making this char a suitable candidate for upcoming in situ work on the hot stage TEM. Work also proceeded on molecular dynamics simulations at Boston University and on equipment modification and testing for the combustion experiments with widely varying flame types at Ohio State.

  6. Adaptivity demonstration of inflatable rigidized integrated structures (IRIS)

    NASA Astrophysics Data System (ADS)

    Natori, M. C.; Higuchi, Ken; Sekine, Koji; Okazaki, Kakuma

    1995-10-01

    An inflatable rigidized integrated structure (IRIS), which is composed of membrane elements and cable networks, and whose structural accuracy is decided by mainly cable networks, has various design adaptivity, since it is a high performance deployable structure for future space applications. In order to keep some stiffness after deployment, materials of membrane are assumed to be rigidized in space, and sometimes the cable network is also rigidized. The concept can cover various structural elements and structure systems. The accuracy analysis of reflector surface constrained by inside hard points and the manufacturing of a simple reflector model is introduced. Test results of rigidized cable columns to show many variations of IRIS to be feasible are also reported.

  7. Facial Structure Predicts Sexual Orientation in Both Men and Women.

    PubMed

    Skorska, Malvina N; Geniole, Shawn N; Vrysen, Brandon M; McCormick, Cheryl M; Bogaert, Anthony F

    2015-07-01

    Biological models have typically framed sexual orientation in terms of effects of variation in fetal androgen signaling on sexual differentiation, although other biological models exist. Despite marked sex differences in facial structure, the relationship between sexual orientation and facial structure is understudied. A total of 52 lesbian women, 134 heterosexual women, 77 gay men, and 127 heterosexual men were recruited at a Canadian campus and various Canadian Pride and sexuality events. We found that facial structure differed depending on sexual orientation; substantial variation in sexual orientation was predicted using facial metrics computed by a facial modelling program from photographs of White faces. At the univariate level, lesbian and heterosexual women differed in 17 facial features (out of 63) and four were unique multivariate predictors in logistic regression. Gay and heterosexual men differed in 11 facial features at the univariate level, of which three were unique multivariate predictors. Some, but not all, of the facial metrics differed between the sexes. Lesbian women had noses that were more turned up (also more turned up in heterosexual men), mouths that were more puckered, smaller foreheads, and marginally more masculine face shapes (also in heterosexual men) than heterosexual women. Gay men had more convex cheeks, shorter noses (also in heterosexual women), and foreheads that were more tilted back relative to heterosexual men. Principal components analysis and discriminant functions analysis generally corroborated these results. The mechanisms underlying variation in craniofacial structure--both related and unrelated to sexual differentiation--may thus be important in understanding the development of sexual orientation.

  8. Crystal Structure Prediction from First Principles: The Crystal Structures of Glycine

    PubMed Central

    Lund, Albert M.; Pagola, Gabriel I.; Orendt, Anita M.; Ferraro, Marta B.; Facelli, Julio C.

    2015-01-01

    Here we present the results of our unbiased searches of glycine polymorphs obtained using the Genetic Algorithms search implemented in Modified Genetic Algorithm for Crystals coupled with the local optimization and energy evaluation provided by Quantum Espresso. We demonstrate that it is possible to predict the crystal structures of a biomedical molecule using solely first principles calculations. We were able to find all the ambient pressure stable glycine polymorphs, which are found in the same energetic ordering as observed experimentally and the agreement between the experimental and predicted structures is of such accuracy that the two are visually almost indistinguishable. PMID:25843964

  9. Crystal structure prediction from first principles: The crystal structures of glycine

    NASA Astrophysics Data System (ADS)

    Lund, Albert M.; Pagola, Gabriel I.; Orendt, Anita M.; Ferraro, Marta B.; Facelli, Julio C.

    2015-04-01

    Here we present the results of our unbiased searches of glycine polymorphs obtained using the genetic algorithms search implemented in MGAC, modified genetic algorithm for crystals, coupled with the local optimization and energy evaluation provided by Quantum Espresso. We demonstrate that it is possible to predict the crystal structures of a biomedical molecule using solely first principles calculations. We were able to find all the ambient pressure stable glycine polymorphs, which are found in the same energetic ordering as observed experimentally and the agreement between the experimental and predicted structures is of such accuracy that the two are visually almost indistinguishable.

  10. Protein structure prediction with local adjust tabu search algorithm

    PubMed Central

    2014-01-01

    Background Protein folding structure prediction is one of the most challenging problems in the bioinformatics domain. Because of the complexity of the realistic protein structure, the simplified structure model and the computational method should be adopted in the research. The AB off-lattice model is one of the simplification models, which only considers two classes of amino acids, hydrophobic (A) residues and hydrophilic (B) residues. Results The main work of this paper is to discuss how to optimize the lowest energy configurations in 2D off-lattice model and 3D off-lattice model by using Fibonacci sequences and real protein sequences. In order to avoid falling into local minimum and faster convergence to the global minimum, we introduce a novel method (SATS) to the protein structure problem, which combines simulated annealing algorithm and tabu search algorithm. Various strategies, such as the new encoding strategy, the adaptive neighborhood generation strategy and the local adjustment strategy, are adopted successfully for high-speed searching the optimal conformation corresponds to the lowest energy of the protein sequences. Experimental results show that some of the results obtained by the improved SATS are better than those reported in previous literatures, and we can sure that the lowest energy folding state for short Fibonacci sequences have been found. Conclusions Although the off-lattice models is not very realistic, they can reflect some important characteristics of the realistic protein. It can be found that 3D off-lattice model is more like native folding structure of the realistic protein than 2D off-lattice model. In addition, compared with some previous researches, the proposed hybrid algorithm can more effectively and more quickly search the spatial folding structure of a protein chain. PMID:25474708

  11. An efficient algorithm to integrate network and attribute data for gene function prediction.

    PubMed

    Vembu, Shankar; Morris, Quaid

    2014-01-01

    Label propagation methods are extremely well-suited for a variety of biomedical prediction tasks based on network data. However, these algorithms cannot be used to integrate feature-based data sources with networks. We propose an efficient learning algorithm to integrate these two types of heterogeneous data sources to perform binary prediction tasks on node features (e.g., gene prioritization, disease gene prediction). Our method, LMGraph, consists of two steps. In the first step, we extract a small set of "network features" from the nodes of networks that represent connectivity with labeled nodes in the prediction tasks. In the second step, we apply a simple weighting scheme in conjunction with linear classifiers to combine these network features with other feature data. This two-step procedure allows us to (i) learn highly scalable and computationally efficient linear classifiers, (ii) and seamlessly combine feature-based data sources with networks. Our method is much faster than label propagation which is already known to be computationally efficient on large-scale prediction problems. Experiments on multiple functional interaction networks from three species (mouse, y, C.elegans) with tens of thousands of nodes and hundreds of binary prediction tasks demonstrate the efficacy of our method.

  12. Protein subcellular localization prediction based on compartment-specific features and structure conservation

    PubMed Central

    Su, Emily Chia-Yu; Chiu, Hua-Sheng; Lo, Allan; Hwang, Jenn-Kang; Sung, Ting-Yi; Hsu, Wen-Lian

    2007-01-01

    Background Protein subcellular localization is crucial for genome annotation, protein function prediction, and drug discovery. Determination of subcellular localization using experimental approaches is time-consuming; thus, computational approaches become highly desirable. Extensive studies of localization prediction have led to the development of several methods including composition-based and homology-based methods. However, their performance might be significantly degraded if homologous sequences are not detected. Moreover, methods that integrate various features could suffer from the problem of low coverage in high-throughput proteomic analyses due to the lack of information to characterize unknown proteins. Results We propose a hybrid prediction method for Gram-negative bacteria that combines a one-versus-one support vector machines (SVM) model and a structural homology approach. The SVM model comprises a number of binary classifiers, in which biological features derived from Gram-negative bacteria translocation pathways are incorporated. In the structural homology approach, we employ secondary structure alignment for structural similarity comparison and assign the known localization of the top-ranked protein as the predicted localization of a query protein. The hybrid method achieves overall accuracy of 93.7% and 93.2% using ten-fold cross-validation on the benchmark data sets. In the assessment of the evaluation data sets, our method also attains accurate prediction accuracy of 84.0%, especially when testing on sequences with a low level of homology to the training data. A three-way data split procedure is also incorporated to prevent overestimation of the predictive performance. In addition, we show that the prediction accuracy should be approximately 85% for non-redundant data sets of sequence identity less than 30%. Conclusion Our results demonstrate that biological features derived from Gram-negative bacteria translocation pathways yield a significant

  13. How evolutionary crystal structure prediction works--and why.

    PubMed

    Oganov, Artem R; Lyakhov, Andriy O; Valle, Mario

    2011-03-15

    Once the crystal structure of a chemical substance is known, many properties can be predicted reliably and routinely. Therefore if researchers could predict the crystal structure of a material before it is synthesized, they could significantly accelerate the discovery of new materials. In addition, the ability to predict crystal structures at arbitrary conditions of pressure and temperature is invaluable for the study of matter at extreme conditions, where experiments are difficult. Crystal structure prediction (CSP), the problem of finding the most stable arrangement of atoms given only the chemical composition, has long remained a major unsolved scientific problem. Two problems are entangled here: search, the efficient exploration of the multidimensional energy landscape, and ranking, the correct calculation of relative energies. For organic crystals, which contain a few molecules in the unit cell, search can be quite simple as long as a researcher does not need to include many possible isomers or conformations of the molecules; therefore ranking becomes the main challenge. For inorganic crystals, quantum mechanical methods often provide correct relative energies, making search the most critical problem. Recent developments provide useful practical methods for solving the search problem to a considerable extent. One can use simulated annealing, metadynamics, random sampling, basin hopping, minima hopping, and data mining. Genetic algorithms have been applied to crystals since 1995, but with limited success, which necessitated the development of a very different evolutionary algorithm. This Account reviews CSP using one of the major techniques, the hybrid evolutionary algorithm USPEX (Universal Structure Predictor: Evolutionary Xtallography). Using recent developments in the theory of energy landscapes, we unravel the reasons evolutionary techniques work for CSP and point out their limitations. We demonstrate that the energy landscapes of chemical systems have an

  14. Integrating data sources to improve hydraulic head predictions : a hierarchical machine learning approach.

    SciTech Connect

    Michael, W. J.; Minsker, B. S.; Tcheng, D.; Valocchi, A. J.; Quinn, J. J.; Environmental Assessment; Univ. of Illinois

    2005-03-26

    This study investigates how machine learning methods can be used to improve hydraulic head predictions by integrating different types of data, including data from numerical models, in a hierarchical approach. A suite of four machine learning methods (decision trees, instance-based weighting, inverse distance weighting, and neural networks) are tested in several hierarchical configurations with different types of data from the 317/319 area at Argonne National Laboratory-East. The best machine learning model had a mean predicted head error 50% smaller than an existing MODFLOW numerical flow model, and a standard deviation of predicted head error 67% lower than the MODFLOW model, computed across all sampled locations used for calibrating the MODFLOW model. These predictions were obtained using decision trees trained with all historical quarterly data; the hourly head measurements were not as useful for prediction, most likely because of their poor spatial coverage. The results show promise for using hierarchical machine learning approaches to improve predictions and to identify the most essential types of data to guide future sampling efforts. Decision trees were also combined with an existing MODFLOW model to test their capabilities for updating numerical models to improve predictions as new data are collected. The combined model had a mean error 50% lower than the MODFLOW model alone. These results demonstrate that hierarchical machine learning approaches can be used to improve predictive performance of existing numerical models in areas with good data coverage. Further research is needed to compare this approach with methods such as Kalman filtering.

  15. Development of advanced structural analysis methodologies for predicting widespread fatigue damage in aircraft structures

    NASA Technical Reports Server (NTRS)

    Harris, Charles E.; Starnes, James H., Jr.; Newman, James C., Jr.

    1995-01-01

    NASA is developing a 'tool box' that includes a number of advanced structural analysis computer codes which, taken together, represent the comprehensive fracture mechanics capability required to predict the onset of widespread fatigue damage. These structural analysis tools have complementary and specialized capabilities ranging from a finite-element-based stress-analysis code for two- and three-dimensional built-up structures with cracks to a fatigue and fracture analysis code that uses stress-intensity factors and material-property data found in 'look-up' tables or from equations. NASA is conducting critical experiments necessary to verify the predictive capabilities of the codes, and these tests represent a first step in the technology-validation and industry-acceptance processes. NASA has established cooperative programs with aircraft manufacturers to facilitate the comprehensive transfer of this technology by making these advanced structural analysis codes available to industry.

  16. Predicting DNA-binding proteins and binding residues by complex structure prediction and application to human proteome.

    PubMed

    Zhao, Huiying; Wang, Jihua; Zhou, Yaoqi; Yang, Yuedong

    2014-01-01

    As more and more protein sequences are uncovered from increasingly inexpensive sequencing techniques, an urgent task is to find their functions. This work presents a highly reliable computational technique for predicting DNA-binding function at the level of protein-DNA complex structures, rather than low-resolution two-state prediction of DNA-binding as most existing techniques do. The method first predicts protein-DNA complex structure by utilizing the template-based structure prediction technique HHblits, followed by binding affinity prediction based on a knowledge-based energy function (Distance-scaled finite ideal-gas reference state for protein-DNA interactions). A leave-one-out cross validation of the method based on 179 DNA-binding and 3797 non-binding protein domains achieves a Matthews correlation coefficient (MCC) of 0.77 with high precision (94%) and high sensitivity (65%). We further found 51% sensitivity for 82 newly determined structures of DNA-binding proteins and 56% sensitivity for the human proteome. In addition, the method provides a reasonably accurate prediction of DNA-binding residues in proteins based on predicted DNA-binding complex structures. Its application to human proteome leads to more than 300 novel DNA-binding proteins; some of these predicted structures were validated by known structures of homologous proteins in APO forms. The method [SPOT-Seq (DNA)] is available as an on-line server at http://sparks-lab.org.

  17. Structural Integrity of Single Shell Tanks at Hanford - 9491

    SciTech Connect

    Rinker, Michael W.; Pilli, Siva Prasad; Karri, Naveen K.; Deibler, John E.; Johnson, Kenneth I.; Holbery, James D.; Mullen, O Dennis; Hurley, David E.

    2009-03-01

    The 149 Single Shell Tanks at the Hanford Site were constructed between the 1940’s and the 1960’s. Many of the tanks are either known or suspected to have leaked in the past. While the free liquids have been removed from the tanks, they still contain significant waste volumes. Recently, the tank farm operations contractor established a Single Shell Tank Integrity Program. Structural integrity is one aspect of the program. The structural analysis of the Single Shell Tanks has several challenging factors. There are several tank sizes and configurations that need to be analyzed. Tank capacities range from fifty-five thousand gallons to one-million gallons. The smallest tank type is approximately twenty feet in diameter, and the three other tank types are all seventy-five feet in diameter. Within each tank type there are varying concrete strengths, types of steel, tank floor arrangements, in-tank hardware, riser sizes and locations, and other appurtenances that need to be addressed. Furthermore, soil properties vary throughout the tank farms. The Pacific Northwest National Laboratory has been conducting preliminary structural analyses of the various single shell tank types to address these parameters. The preliminary analyses will assess which aspects of the tanks will require further detailed analysis. Evaluation criteria to which the tanks will be analyzed are also being developed for the Single Shell Tank Integrity Program. This information will be reviewed by the Single Shell Tank Integrity Expert Panel that has been formed to issue recommendations to the DOE and to the tank farm operations contractor regarding Single Shell Tank Integrity. This paper provides a summary of the preliminary analysis of the single shell tanks, a summary of the recommendations for the detailed analyses, and the proposed evaluation criteria by which the tanks will be judged.

  18. Approximation method to compute domain related integrals in structural studies

    NASA Astrophysics Data System (ADS)

    Oanta, E.; Panait, C.; Raicu, A.; Barhalescu, M.; Axinte, T.

    2015-11-01

    Various engineering calculi use integral calculus in theoretical models, i.e. analytical and numerical models. For usual problems, integrals have mathematical exact solutions. If the domain of integration is complicated, there may be used several methods to calculate the integral. The first idea is to divide the domain in smaller sub-domains for which there are direct calculus relations, i.e. in strength of materials the bending moment may be computed in some discrete points using the graphical integration of the shear force diagram, which usually has a simple shape. Another example is in mathematics, where the surface of a subgraph may be approximated by a set of rectangles or trapezoids used to calculate the definite integral. The goal of the work is to introduce our studies about the calculus of the integrals in the transverse section domains, computer aided solutions and a generalizing method. The aim of our research is to create general computer based methods to execute the calculi in structural studies. Thus, we define a Boolean algebra which operates with ‘simple’ shape domains. This algebraic standpoint uses addition and subtraction, conditioned by the sign of every ‘simple’ shape (-1 for the shapes to be subtracted). By ‘simple’ shape or ‘basic’ shape we define either shapes for which there are direct calculus relations, or domains for which their frontiers are approximated by known functions and the according calculus is carried out using an algorithm. The ‘basic’ shapes are linked to the calculus of the most significant stresses in the section, refined aspect which needs special attention. Starting from this idea, in the libraries of ‘basic’ shapes, there were included rectangles, ellipses and domains whose frontiers are approximated by spline functions. The domain triangularization methods suggested that another ‘basic’ shape to be considered is the triangle. The subsequent phase was to deduce the exact relations for the

  19. Computational prediction of atomic structures of helical membrane proteins aided by EM maps.

    PubMed

    Kovacs, Julio A; Yeager, Mark; Abagyan, Ruben

    2007-09-15

    Integral membrane proteins pose a major challenge for protein-structure prediction because only approximately 100 high-resolution structures are available currently, thereby impeding the development of rules or empirical potentials to predict the packing of transmembrane alpha-helices. However, when an intermediate-resolution electron microscopy (EM) map is available, it can be used to provide restraints which, in combination with a suitable computational protocol, make structure prediction feasible. In this work we present such a protocol, which proceeds in three stages: 1), generation of an ensemble of alpha-helices by flexible fitting into each of the density rods in the low-resolution EM map, spanning a range of rotational angles around the main helical axes and translational shifts along the density rods; 2), fast optimization of side chains and scoring of the resulting conformations; and 3), refinement of the lowest-scoring conformations with internal coordinate mechanics, by optimizing the van der Waals, electrostatics, hydrogen bonding, torsional, and solvation energy contributions. In addition, our method implements a penalty term through a so-called tethering map, derived from the EM map, which restrains the positions of the alpha-helices. The protocol was validated on three test cases: GpA, KcsA, and MscL.

  20. Disulfide Connectivity Prediction Based on Modelled Protein 3D Structural Information and Random Forest Regression.

    PubMed

    Yu, Dong-Jun; Li, Yang; Hu, Jun; Yang, Xibei; Yang, Jing-Yu; Shen, Hong-Bin

    2015-01-01

    Disulfide connectivity is an important protein structural characteristic. Accurately predicting disulfide connectivity solely from protein sequence helps to improve the intrinsic understanding of protein structure and function, especially in the post-genome era where large volume of sequenced proteins without being functional annotated is quickly accumulated. In this study, a new feature extracted from the predicted protein 3D structural information is proposed and integrated with traditional features to form discriminative features. Based on the extracted features, a random forest regression model is performed to predict protein disulfide connectivity. We compare the proposed method with popular existing predictors by performing both cross-validation and independent validation tests on benchmark datasets. The experimental results demonstrate the superiority of the proposed method over existing predictors. We believe the superiority of the proposed method benefits from both the good discriminative capability of the newly developed features and the powerful modelling capability of the random forest. The web server implementation, called TargetDisulfide, and the benchmark datasets are freely available at: http://csbio.njust.edu.cn/bioinf/TargetDisulfide for academic use.

  1. Integrated structural analysis of the human nuclear pore complex scaffold.

    PubMed

    Bui, Khanh Huy; von Appen, Alexander; DiGuilio, Amanda L; Ori, Alessandro; Sparks, Lenore; Mackmull, Marie-Therese; Bock, Thomas; Hagen, Wim; Andrés-Pons, Amparo; Glavy, Joseph S; Beck, Martin

    2013-12-05

    The nuclear pore complex (NPC) is a fundamental component of all eukaryotic cells that facilitates nucleocytoplasmic exchange of macromolecules. It is assembled from multiple copies of about 30 nucleoporins. Due to its size and complex composition, determining the structure of the NPC is an enormous challenge, and the overall architecture of the NPC scaffold remains elusive. In this study, we have used an integrated approach based on electron tomography, single-particle electron microscopy, and crosslinking mass spectrometry to determine the structure of a major scaffold motif of the human NPC, the Nup107 subcomplex, in both isolation and integrated into the NPC. We show that 32 copies of the Nup107 subcomplex assemble into two reticulated rings, one each at the cytoplasmic and nuclear face of the NPC. This arrangement may explain how changes of the diameter are realized that would accommodate transport of huge cargoes.

  2. Performance optimized, small structurally integrated ion thruster system

    NASA Technical Reports Server (NTRS)

    Hyman, J., Jr.

    1973-01-01

    A 5-cm structurally integrated ion thruster has been developed for attitude control and stationkeeping of synchronous satellites. As optimized with a conventional ion extraction system, the system demonstrates a thrust T = 0.47 mlb at a beam voltage of 1600 V, total mass efficiency of 76%, and electrical efficiency of 56%. Under the subject contract effort, no significant performance change was noted for operation with two dimensional electrostatic thrust-vectoring grids. Structural integrity with the vectoring grids was demonstrated for shock (+ or - 30 G), sinusoidal (9 G), and random (19.9 G rms) accelerations. System envelope is 31.2 cm long by 13.4 cm flange bolt circle, with a mass of 9.0 Kg, including 6.8 Kg mercury propellant.

  3. Bionic intraocular lens with variable focus and integrated structure

    NASA Astrophysics Data System (ADS)

    Liang, Dan; Wang, Xuan-Yin; Du, Jia-Wei; Xiang, Ke

    2015-10-01

    This paper proposes a bionic accommodating intraocular lens (IOL) for ophthalmic surgery. The designed lens has a solid-liquid mixed integrated structure, which mainly consists of a support ring, elastic membrane, rigid lens, and optical liquid. The lens focus can be adjusted through the deformation of the lens front surface when compressed. The integrated structure of the IOL is presented, as well as a detailed description of the lens materials and fabrication process. Images under different radial pressures are captured, and the lens deformation process, accommodating range, density, and optical property are analyzed. The designed lens achieves a 14.6 D accommodating range under a radial pressure of 51.4 mN and a 0.24 mm alteration of the lens outer radius. The deformation property of the lens matches well with the characteristic of the eye and shows the potential to help patients fully recover their vision accommodation ability after the cataract surgery.

  4. Integrative Analysis of Metabolic Models – from Structure to Dynamics

    PubMed Central

    Hartmann, Anja; Schreiber, Falk

    2015-01-01

    The characterization of biological systems with respect to their behavior and functionality based on versatile biochemical interactions is a major challenge. To understand these complex mechanisms at systems level modeling approaches are investigated. Different modeling formalisms allow metabolic models to be analyzed depending on the question to be solved, the biochemical knowledge and the availability of experimental data. Here, we describe a method for an integrative analysis of the structure and dynamics represented by qualitative and quantitative metabolic models. Using various formalisms, the metabolic model is analyzed from different perspectives. Determined structural and dynamic properties are visualized in the context of the metabolic model. Interaction techniques allow the exploration and visual analysis thereby leading to a broader understanding of the behavior and functionality of the underlying biological system. The System Biology Metabolic Model Framework (SBM2 – Framework) implements the developed method and, as an example, is applied for the integrative analysis of the crop plant potato. PMID:25674560

  5. Conformational States of macromolecular assemblies explored by integrative structure calculation.

    PubMed

    Thalassinos, Konstantinos; Pandurangan, Arun Prasad; Xu, Min; Alber, Frank; Topf, Maya

    2013-09-03

    A detailed description of macromolecular assemblies in multiple conformational states can be very valuable for understanding cellular processes. At present, structural determination of most assemblies in different biologically relevant conformations cannot be achieved by a single technique and thus requires an integrative approach that combines information from multiple sources. Different techniques require different computational methods to allow efficient and accurate data processing and analysis. Here, we summarize the latest advances and future challenges in computational methods that help the interpretation of data from two techniques-mass spectrometry and three-dimensional cryo-electron microscopy (with focus on alignment and classification of heterogeneous subtomograms from cryo-electron tomography). We evaluate how new developments in these two broad fields will lead to further integration with atomic structures to broaden our picture of the dynamic behavior of assemblies in their native environment.

  6. Short-term solar flare prediction using multi-model integration method

    NASA Astrophysics Data System (ADS)

    Liu, Jin-Fu; Li, Fei; Wan, Jie; Yu, Da-Ren

    2017-03-01

    A multi-model integration method is proposed to develop a multi-source and heterogeneous model for short-term solar flare prediction. Different prediction models are constructed on the basis of extracted predictors from a pool of observation databases. The outputs of the base models are normalized first because these established models extract predictors from many data resources using different prediction methods. Then weighted integration of the base models is used to develop a multi-model integrated model (MIM). The weight set that single models assign is optimized by a genetic algorithm. Seven base models and data from Solar and Heliospheric Observatory/Michelson Doppler Imager longitudinal magnetograms are used to construct the MIM, and then its performance is evaluated by cross validation. Experimental results showed that the MIM outperforms any individual model in nearly every data group, and the richer the diversity of the base models, the better the performance of the MIM. Thus, integrating more diversified models, such as an expert system, a statistical model and a physical model, will greatly improve the performance of the MIM.

  7. Reward Dependent Invigoration Relates to Theta Oscillations and Is Predicted by Dopaminergic Midbrain Integrity in Healthy Elderly

    PubMed Central

    Steiger, Tineke K.; Bunzeck, Nico

    2017-01-01

    Motivation can have invigorating effects on behavior via dopaminergic neuromodulation. While this relationship has mainly been established in theoretical models and studies in younger subjects, the impact of structural declines of the dopaminergic system during healthy aging remains unclear. To investigate this issue, we used electroencephalography (EEG) in healthy young and elderly humans in a reward-learning paradigm. Specifically, scene images were initially encoded by combining them with cues predicting monetary reward (high vs. low reward). Subsequently, recognition memory for the scenes was tested. As a main finding, we can show that response times (RTs) during encoding were faster for high reward predicting images in the young but not elderly participants. This pattern was resembled in power changes in the theta-band (4–7 Hz). Importantly, analyses of structural MRI data revealed that individual reward-related differences in the elderlies’ response time could be predicted by the structural integrity of the dopaminergic substantia nigra (SN; as measured by magnetization transfer (MT)). These findings suggest a close relationship between reward-based invigoration, theta oscillations and age-dependent changes of the dopaminergic system. PMID:28174533

  8. The eye in hand: predicting others' behavior by integrating multiple sources of information

    PubMed Central

    Pezzulo, Giovanni; Costantini, Marcello

    2015-01-01

    The ability to predict the outcome of other beings' actions confers significant adaptive advantages. Experiments have assessed that human action observation can use multiple information sources, but it is currently unknown how they are integrated and how conflicts between them are resolved. To address this issue, we designed an action observation paradigm requiring the integration of multiple, potentially conflicting sources of evidence about the action target: the actor's gaze direction, hand preshape, and arm trajectory, and their availability and relative uncertainty in time. In two experiments, we analyzed participants' action prediction ability by using eye tracking and behavioral measures. The results show that the information provided by the actor's gaze affected participants' explicit predictions. However, results also show that gaze information was disregarded as soon as information on the actor's hand preshape was available, and this latter information source had widespread effects on participants' prediction ability. Furthermore, as the action unfolded in time, participants relied increasingly more on the arm movement source, showing sensitivity to its increasing informativeness. Therefore, the results suggest that the brain forms a robust estimate of the actor's motor intention by integrating multiple sources of information. However, when informative motor cues such as a preshaped hand with a given grip are available and might help in selecting action targets, people tend to capitalize on such motor cues, thus turning out to be more accurate and fast in inferring the object to be manipulated by the other's hand. PMID:25568158

  9. Integrated Structural/Control Design via Multiobjective Optimization

    DTIC Science & Technology

    1990-05-10

    members, Dr Vadim Komkov and Lt Col Ronald Bagley, for their help and advice, as well as Dr Brad Liebst for his careful * the thorough review of my work...very strong, frequently unintentional and adverse coupling between the flexible structure and active control system, a wholistic or simultaneous...feedback). The primary contribution has been to treat the problem in an integrated or simultaneous fashion vice sequential design iterations on the two

  10. The extended evolutionary synthesis: its structure, assumptions and predictions

    PubMed Central

    Laland, Kevin N.; Uller, Tobias; Feldman, Marcus W.; Sterelny, Kim; Müller, Gerd B.; Moczek, Armin; Jablonka, Eva; Odling-Smee, John

    2015-01-01

    Scientific activities take place within the structured sets of ideas and assumptions that define a field and its practices. The conceptual framework of evolutionary biology emerged with the Modern Synthesis in the early twentieth century and has since expanded into a highly successful research program to explore the processes of diversification and adaptation. Nonetheless, the ability of that framework satisfactorily to accommodate the rapid advances in developmental biology, genomics and ecology has been questioned. We review some of these arguments, focusing on literatures (evo-devo, developmental plasticity, inclusive inheritance and niche construction) whose implications for evolution can be interpreted in two ways—one that preserves the internal structure of contemporary evolutionary theory and one that points towards an alternative conceptual framework. The latter, which we label the ‘extended evolutionary synthesis' (EES), retains the fundaments of evolutionary theory, but differs in its emphasis on the role of constructive processes in development and evolution, and reciprocal portrayals of causation. In the EES, developmental processes, operating through developmental bias, inclusive inheritance and niche construction, share responsibility for the direction and rate of evolution, the origin of character variation and organism–environment complementarity. We spell out the structure, core assumptions and novel predictions of the EES, and show how it can be deployed to stimulate and advance research in those fields that study or use evolutionary biology. PMID:26246559

  11. The extended evolutionary synthesis: its structure, assumptions and predictions.

    PubMed

    Laland, Kevin N; Uller, Tobias; Feldman, Marcus W; Sterelny, Kim; Müller, Gerd B; Moczek, Armin; Jablonka, Eva; Odling-Smee, John

    2015-08-22

    Scientific activities take place within the structured sets of ideas and assumptions that define a field and its practices. The conceptual framework of evolutionary biology emerged with the Modern Synthesis in the early twentieth century and has since expanded into a highly successful research program to explore the processes of diversification and adaptation. Nonetheless, the ability of that framework satisfactorily to accommodate the rapid advances in developmental biology, genomics and ecology has been questioned. We review some of these arguments, focusing on literatures (evo-devo, developmental plasticity, inclusive inheritance and niche construction) whose implications for evolution can be interpreted in two ways—one that preserves the internal structure of contemporary evolutionary theory and one that points towards an alternative conceptual framework. The latter, which we label the 'extended evolutionary synthesis' (EES), retains the fundaments of evolutionary theory, but differs in its emphasis on the role of constructive processes in development and evolution, and reciprocal portrayals of causation. In the EES, developmental processes, operating through developmental bias, inclusive inheritance and niche construction, share responsibility for the direction and rate of evolution, the origin of character variation and organism-environment complementarity. We spell out the structure, core assumptions and novel predictions of the EES, and show how it can be deployed to stimulate and advance research in those fields that study or use evolutionary biology.

  12. Synthesis of aircraft structures using integrated design and analysis methods

    NASA Technical Reports Server (NTRS)

    Sobieszczanski-Sobieski, J.; Goetz, R. C.

    1978-01-01

    A systematic research is reported to develop and validate methods for structural sizing of an airframe designed with the use of composite materials and active controls. This research program includes procedures for computing aeroelastic loads, static and dynamic aeroelasticity, analysis and synthesis of active controls, and optimization techniques. Development of the methods is concerned with the most effective ways of integrating and sequencing the procedures in order to generate structural sizing and the associated active control system, which is optimal with respect to a given merit function constrained by strength and aeroelasticity requirements.

  13. Structural Integrity and Durability of Reusable Space Propulsion Systems

    NASA Technical Reports Server (NTRS)

    1991-01-01

    A two-day conference on the structural integrity and durability of reusable space propulsion systems was held on 14 to 15 May 1991 at the NASA Lewis Research Center. Presentations were made by industry, university, and government researchers organized into four sessions: (1) aerothermodynamic loads; (2) instrumentation; (3) fatigue, fracture, and constitutive modeling; and (4) structural dynamics. The principle objectives were to disseminate research results and future plans in each of four areas. This publication contains extended abstracts and the visual material presented during the conference. Particular emphasis is placed on the Space Shuttle Main Engine (SSME) and the SSME turbopump.

  14. Efficient optimization of integrated aerodynamic-structural design

    NASA Technical Reports Server (NTRS)

    Haftka, R. T.; Grossman, B.; Eppard, W. M.; Kao, P. J.; Polen, D. M.

    1989-01-01

    Techniques for reducing the computational complexity of multidisciplinary design optimization (DO) of aerodynamic structures are described and demonstrated. The basic principles of aerodynamic and structural DO are reviewed; the formulation of the combined DO problem is outlined; and particular attention is given to (1) the application of perturbation methods to cross-sensitivity computations and (2) numerical approximation procedures. Trial DOs of a simple sailplane design are presented in tables and graphs and discussed in detail. The IBM 3090 CPU time for the entire integrated DO was reduced from an estimated 10 h to about 6 min.

  15. Large-Scale Predictive Drug Safety: From Structural Alerts to Biological Mechanisms.

    PubMed

    Garcia-Serna, Ricard; Vidal, David; Remez, Nikita; Mestres, Jordi

    2015-10-19

    The recent explosion of data linking drugs, proteins, and pathways with safety events has promoted the development of integrative systems approaches to large-scale predictive drug safety. The added value of such approaches is that, beyond the traditional identification of potentially labile chemical fragments for selected toxicity end points, they have the potential to provide mechanistic insights for a much larger and diverse set of safety events in a statistically sound nonsupervised manner, based on the similarity to drug classes, the interaction with secondary targets, and the interference with biological pathways. The combined identification of chemical and biological hazards enhances our ability to assess the safety risk of bioactive small molecules with higher confidence than that using structural alerts only. We are still a very long way from reliably predicting drug safety, but advances toward gaining a better understanding of the mechanisms leading to adverse outcomes represent a step forward in this direction.

  16. Ageing increases reliance on sensorimotor prediction through structural and functional differences in frontostriatal circuits.

    PubMed

    Wolpe, Noham; Ingram, James N; Tsvetanov, Kamen A; Geerligs, Linda; Kievit, Rogier A; Henson, Richard N; Wolpert, Daniel M; Rowe, James B

    2016-10-03

    The control of voluntary movement changes markedly with age. A critical component of motor control is the integration of sensory information with predictions of the consequences of action, arising from internal models of movement. This leads to sensorimotor attenuation-a reduction in the perceived intensity of sensations from self-generated compared with external actions. Here we show that sensorimotor attenuation occurs in 98% of adults in a population-based cohort (n=325; 18-88 years; the Cambridge Centre for Ageing and Neuroscience). Importantly, attenuation increases with age, in proportion to reduced sensory sensitivity. This effect is associated with differences in the structure and functional connectivity of the pre-supplementary motor area (pre-SMA), assessed with magnetic resonance imaging. The results suggest that ageing alters the balance between the sensorium and predictive models, mediated by the pre-SMA and its connectivity in frontostriatal circuits. This shift may contribute to the motor and cognitive changes observed with age.

  17. Thermodynamics and structure of a two-dimensional electrolyte by integral equation theory

    SciTech Connect

    Aupic, Jana; Urbic, Tomaz

    2014-05-14

    Monte Carlo simulations and integral equation theory were used to predict the thermodynamics and structure of a two-dimensional Coulomb fluid. We checked the possibility that integral equations reproduce Kosterlitz-Thouless and vapor-liquid phase transitions of the electrolyte and critical points. Integral equation theory results were compared to Monte Carlo data and the correctness of selected closure relations was assessed. Among selected closures hypernetted-chain approximation results matched computer simulation data best, but these equations unfortunately break down at temperatures well above the Kosterlitz-Thouless transition. The Kovalenko-Hirata closure produces results even at very low temperatures and densities, but no sign of phase transition was detected.

  18. Sensitivity method for integrated structure/active control law design

    NASA Technical Reports Server (NTRS)

    Gilbert, Michael G.

    1987-01-01

    The development is described of an integrated structure/active control law design methodology for aeroelastic aircraft applications. A short motivating introduction to aeroservoelasticity is given along with the need for integrated structures/controls design algorithms. Three alternative approaches to development of an integrated design method are briefly discussed with regards to complexity, coordination and tradeoff strategies, and the nature of the resulting solutions. This leads to the formulation of the proposed approach which is based on the concepts of sensitivity of optimum solutions and multi-level decompositions. The concept of sensitivity of optimum is explained in more detail and compared with traditional sensitivity concepts of classical control theory. The analytical sensitivity expressions for the solution of the linear, quadratic cost, Gaussian (LQG) control problem are summarized in terms of the linear regulator solution and the Kalman Filter solution. Numerical results for a state space aeroelastic model of the DAST ARW-II vehicle are given, showing the changes in aircraft responses to variations of a structural parameter, in this case first wing bending natural frequency.

  19. The structural integrity of affordable thick-section fiber composites

    SciTech Connect

    DeTeresa, S

    1999-06-01

    The Long-Term Research Objectives are to advance the understanding of the mechanics of polymers and polymer composites; develop predictive capabilities as well as experimental characterization and validation tools for the mechanical behavior of these materials; and further develop our knowledge of structure-mechanical property relationships for this class of materials. The approach used was to develop novel experimental tools and use them to characterize the multiaxial failure and fatigue behavior of materials for thick-section fiber composite structures. These tools include capabilities for applying well-defined biaxial and triaxial stress states. These experiments are carefully chosen to provide results that can be used for discriminating evaluation of predictive failure models.

  20. Poling of PVDF matrix composites for integrated structural load sensing

    NASA Astrophysics Data System (ADS)

    Haghiashtiani, Ghazaleh; Greminger, Michael A.; Zhao, Ping

    2014-03-01

    The purpose of this study is to create and evaluate a smart composite structure that can be used for integrated load sensing and structural health monitoring. In this structure, PVDF films are used as the matrix material instead of epoxy resin or other thermoplastics. The reinforcements are two layers of carbon fiber with one layer of Kevlar separating them. Due to the electrical conductivity properties of carbon fiber and the dielectric effect of Kevlar, the structure acts as a capacitor. Furthermore, the piezoelectric properties of the PVDF matrix can be used to monitor the response of the structure under applied loads. In order to exploit the piezoelectric properties of PVDF, the PVDF material must be polarized to align the dipole moments of its crystalline structure. The optimal condition for poling the structure was found by performing a 23 factorial design of experiment (DoE). The factors that were studied in DoE were temperature, voltage, and duration of poling. Finally, the response of the poled structure was monitored by exposing the samples to an applied load.

  1. Predictive regulatory models in Drosophila melanogaster by integrative inference of transcriptional networks.

    PubMed

    Marbach, Daniel; Roy, Sushmita; Ay, Ferhat; Meyer, Patrick E; Candeias, Rogerio; Kahveci, Tamer; Bristow, Christopher A; Kellis, Manolis

    2012-07-01

    Gaining insights on gene regulation from large-scale functional data sets is a grand challenge in systems biology. In this article, we develop and apply methods for transcriptional regulatory network inference from diverse functional genomics data sets and demonstrate their value for gene function and gene expression prediction. We formulate the network inference problem in a machine-learning framework and use both supervised and unsupervised methods to predict regulatory edges by integrating transcription factor (TF) binding, evolutionarily conserved sequence motifs, gene expression, and chromatin modification data sets as input features. Applying these methods to Drosophila melanogaster, we predict ∼300,000 regulatory edges in a network of ∼600 TFs and 12,000 target genes. We validate our predictions using known regulatory interactions, gene functional annotations, tissue-specific expression, protein-protein interactions, and three-dimensional maps of chromosome conformation. We use the inferred network to identify putative functions for hundreds of previously uncharacterized genes, including many in nervous system development, which are independently confirmed based on their tissue-specific expression patterns. Last, we use the regulatory network to predict target gene expression levels as a function of TF expression, and find significantly higher predictive power for integrative networks than for motif or ChIP-based networks. Our work reveals the complementarity between physical evidence of regulatory interactions (TF binding, motif conservation) and functional evidence (coordinated expression or chromatin patterns) and demonstrates the power of data integration for network inference and studies of gene regulation at the systems level.

  2. Neural networks for structural design - An integrated system implementation

    NASA Technical Reports Server (NTRS)

    Berke, Laszlo; Hafez, Wassim; Pao, Yoh-Han

    1992-01-01

    The development of powerful automated procedures to aid the creative designer is becoming increasingly critical for complex design tasks. In the work described here Artificial Neural Nets are applied to acquire structural analysis and optimization domain expertise. Based on initial instructions from the user an automated procedure generates random instances of structural analysis and/or optimization 'experiences' that cover a desired domain. It extracts training patterns from the created instances, constructs and trains an appropriate network architecture and checks the accuracy of net predictions. The final product is a trained neural net that can estimate analysis and/or optimization results instantaneously.

  3. Influence of Weld Porosity on the Integrity of Marine Structures

    DTIC Science & Technology

    1989-02-01

    Bruce Mustain Mr. Alexander B . Stavov; U. S. MERCHANT MARINE ACADEMY NATIONAL ACADEMY OF SCIENCES Dr. C. B . Kim COMMITTEE ON MARINE STRUCTURE,, U. S...FIGURE 9(a). STRESS-LIFE PLOT SHOWING ACTUAL FATIGUE LIVES VERSUS PREDICTED FATIGUE LIVES OF WELDS CONTAINING POROSITY 32 FIGURE 9( b ). STRESS-LIFE PLOT...37 FIGURE 11. CLASS A AND CLASS B POROSITY CHART FOR 0.5 INCH (12.5 MM) THICK MATERIAL ....... ...................... ... 38 FIGURE 12

  4. Computer-aided prediction of high-frequency performance limits in silicon bipolar integrated circuits

    NASA Technical Reports Server (NTRS)

    Burns, J. L.; Choma, J., Jr.

    1982-01-01

    A circuit model for an existing silicon integrated bipolar junction transistor (IBJT) is used to evaluate presently achievable high frequency circuit performance. The relationship between circuit model and processing parameters are semi-quantitatively explored to make predictions on the frequency response, which can be achieved through realistic device fabrication modifications. A new figure of merit is introduced, which is defined as the signal frequency at which an integrated bipolar junction transistor can deliver a power gain of G. The most sensitive parameter influencing attainable high frequency IBJT performance is base resistance.

  5. Structural Acoustic Prediction and Interior Noise Control Technology

    NASA Technical Reports Server (NTRS)

    Mathur, G. P.; Chin, C. L.; Simpson, M. A.; Lee, J. T.; Palumbo, Daniel L. (Technical Monitor)

    2001-01-01

    This report documents the results of Task 14, "Structural Acoustic Prediction and Interior Noise Control Technology". The task was to evaluate the performance of tuned foam elements (termed Smart Foam) both analytically and experimentally. Results taken from a three-dimensional finite element model of an active, tuned foam element are presented. Measurements of sound absorption and sound transmission loss were taken using the model. These results agree well with published data. Experimental performance data were taken in Boeing's Interior Noise Test Facility where 12 smart foam elements were applied to a 757 sidewall. Several configurations were tested. Noise reductions of 5-10 dB were achieved over the 200-800 Hz bandwidth of the controller. Accelerometers mounted on the panel provided a good reference for the controller. Configurations with far-field error microphones outperformed near-field cases.

  6. Detecting and representing predictable structure during auditory scene analysis.

    PubMed

    Sohoglu, Ediz; Chait, Maria

    2016-09-07

    We use psychophysics and MEG to test how sensitivity to input statistics facilitates auditory-scene-analysis (ASA). Human subjects listened to 'scenes' comprised of concurrent tone-pip streams (sources). On occasional trials a new source appeared partway. Listeners were more accurate and quicker to detect source appearance in scenes comprised of temporally-regular (REG), rather than random (RAND), sources. MEG in passive listeners and those actively detecting appearance events revealed increased sustained activity in auditory and parietal cortex in REG relative to RAND scenes, emerging ~400 ms of scene-onset. Over and above this, appearance in REG scenes was associated with increased responses relative to RAND scenes. The effect of temporal structure on appearance-evoked responses was delayed when listeners were focused on the scenes relative to when listening passively, consistent with the notion that attention reduces 'surprise'. Overall, the results implicate a mechanism that tracks predictability of multiple concurrent sources to facilitate active and passive ASA.

  7. Prediction of silicon-based layered structures for optoelectronic applications.

    PubMed

    Luo, Wei; Ma, Yanming; Gong, Xingao; Xiang, Hongjun

    2014-11-12

    A method based on the particle swarm optimization algorithm is presented to design quasi-two-dimensional materials. With this development, various single-layer and bilayer materials of C, Si, Ge, Sn, and Pb were predicted. A new Si bilayer structure is found to have a more favored energy than the previously widely accepted configuration. Both single-layer and bilayer Si materials have small band gaps, limiting their usages in optoelectronic applications. Hydrogenation has therefore been used to tune the electronic and optical properties of Si layers. We discover two hydrogenated materials of layered Si8H2 and Si6H2 possessing quasidirect band gaps of 0.75 and 1.59 eV, respectively. Their potential applications for light-emitting diode and photovoltaics are proposed and discussed. Our study opened up the possibility of hydrogenated Si layered materials as next-generation optoelectronic devices.

  8. Simple neural substrate predicts complex rhythmic structure in duetting birds

    NASA Astrophysics Data System (ADS)

    Amador, Ana; Trevisan, M. A.; Mindlin, G. B.

    2005-09-01

    Horneros (Furnarius Rufus) are South American birds well known for their oven-looking nests and their ability to sing in couples. Previous work has analyzed the rhythmic organization of the duets, unveiling a mathematical structure behind the songs. In this work we analyze in detail an extended database of duets. The rhythms of the songs are compatible with the dynamics presented by a wide class of dynamical systems: forced excitable systems. Compatible with this nonlinear rule, we build a biologically inspired model for how the neural and the anatomical elements may interact to produce the observed rhythmic patterns. This model allows us to synthesize songs presenting the acoustic and rhythmic features observed in real songs. We also make testable predictions in order to support our hypothesis.

  9. Optimizing Non-Decomposable Loss Functions in Structured Prediction

    PubMed Central

    Ranjbar, Mani; Lan, Tian; Wang, Yang; Robinovitch, Steven N.; Li, Ze-Nian; Mori, Greg

    2012-01-01

    We develop an algorithm for structured prediction with non-decomposable performance measures. The algorithm learns parameters of Markov random fields and can be applied to multivariate performance measures. Examples include performance measures such as Fβ score (natural language processing), intersection over union (object category segmentation), Precision/Recall at k (search engines) and ROC area (binary classifiers). We attack this optimization problem by approximating the loss function with a piecewise linear function. The loss augmented inference forms a quadratic program (QP), which we solve using LP relaxation. We apply this approach to two tasks: object class-specific segmentation and human action retrieval from videos. We show significant improvement over baseline approaches that either use simple loss functions or simple scoring functions on the PASCAL VOC and H3D Segmentation datasets, and a nursing home action recognition dataset. PMID:22868650

  10. Can computationally designed protein sequences improve secondary structure prediction?

    PubMed

    Bondugula, Rajkumar; Wallqvist, Anders; Lee, Michael S

    2011-05-01

    Computational sequence design methods are used to engineer proteins with desired properties such as increased thermal stability and novel function. In addition, these algorithms can be used to identify an envelope of sequences that may be compatible with a particular protein fold topology. In this regard, we hypothesized that sequence-property prediction, specifically secondary structure, could be significantly enhanced by using a large database of computationally designed sequences. We performed a large-scale test of this hypothesis with 6511 diverse protein domains and 50 designed sequences per domain. After analysis of the inherent accuracy of the designed sequences database, we realized that it was necessary to put constraints on what fraction of the native sequence should be allowed to change. With mutational constraints, accuracy was improved vs. no constraints, but the diversity of designed sequences, and hence effective size of the database, was moderately reduced. Overall, the best three-state prediction accuracy (Q(3)) that we achieved was nearly a percentage point improved over using a natural sequence database alone, well below the theoretical possibility for improvement of 8-10 percentage points. Furthermore, our nascent method was used to augment the state-of-the-art PSIPRED program by a percentage point.

  11. Engineering Property Prediction Tools for Tailored Polymer Composite Structures

    SciTech Connect

    Nguyen, Ba Nghiep; Foss, Peter; Wyzgoski, Michael; Trantina, Gerry; Kunc, Vlastimil; Schutte, Carol; Smith, Mark T.

    2009-12-23

    This report summarizes our FY 2009 research activities for the project titled:"Engineering Property Prediction Tools for Tailored Polymer Composite Structures." These activities include (i) the completion of the development of a fiber length attrition model for injection-molded long-fiber thermoplastics (LFTs), (ii) development of the a fatigue damage model for LFTs and its implementation in ABAQUS, (iii) development of an impact damage model for LFTs and its implementation in ABAQUS, (iv) development of characterization methods for fatigue testing, (v) characterization of creep and fatigue responses of glass-fiber/polyamide (PA6,6) and glass-fiber/polypropylene (PP), (vi) characterization of fiber length distribution along the flow length of glass/PA6,6 and glass-fiber/PP, and (vii) characterization of impact responses of glass-fiber/PA6,6. The fiber length attrition model accurately captures the fiber length distribution along the flow length of the studied glass-fiber/PP material. The fatigue damage model is able to predict the S-N and stiffness reduction data which are valuable to the fatigue design of LFTs. The impact damage model correctly captures damage accumulation observed in experiments of glass-fiber/PA6,6 plaques.Further work includes validations of these models for representative LFT materials and a complex LFT part.

  12. High Precision Prediction of Functional Sites in Protein Structures

    PubMed Central

    Buturovic, Ljubomir; Wong, Mike; Tang, Grace W.; Altman, Russ B.; Petkovic, Dragutin

    2014-01-01

    We address the problem of assigning biological function to solved protein structures. Computational tools play a critical role in identifying potential active sites and informing screening decisions for further lab analysis. A critical parameter in the practical application of computational methods is the precision, or positive predictive value. Precision measures the level of confidence the user should have in a particular computed functional assignment. Low precision annotations lead to futile laboratory investigations and waste scarce research resources. In this paper we describe an advanced version of the protein function annotation system FEATURE, which achieved 99% precision and average recall of 95% across 20 representative functional sites. The system uses a Support Vector Machine classifier operating on the microenvironment of physicochemical features around an amino acid. We also compared performance of our method with state-of-the-art sequence-level annotator Pfam in terms of precision, recall and localization. To our knowledge, no other functional site annotator has been rigorously evaluated against these key criteria. The software and predictive models are incorporated into the WebFEATURE service at http://feature.stanford.edu/wf4.0-beta. PMID:24632601

  13. Structure analysis, fatigue testing, and lifetime prediction of composite steels

    NASA Astrophysics Data System (ADS)

    Sokolkin, Yu. V.; Chekalkin, A. A.; Babushkin, A. V.

    1998-05-01

    Composite steels prepared by technology of powder metallurgy are widely used as low cost parts with good resistance to wear, fracture, and corrosion. The development of powder composite steels is directly related to strength under vibration, fatigue stabilizing, and accurate lifetime prediction for actual composite topology. The fatigue behavior of powder steels was studied by experimental and numerical methods of composite mechanics and materials sciences. The chemical composition of composite steel is a pure iron powder as the base material and a handful of carbon, chromium, nickel, or phosphorus powders. The powder multi-component mixture is compacted by cold isostatic pressing to a rectangular form. The compactants are sintered in protective atmosphere. The microscale examination of the composite structure included an METAM-RV-21 metallographic optic microscope with a high-resolution ScanNexIIc scanner and an image processing package on the PC platform. The phase composition of powder steels has complex disordered topology with irregular ferrite/austenite grains, iron carbide inclusions, and pores. The microstructure images are treated according to the theory of stochastic processes as ergodic probability functions; statistical moments and a structural covariance function of the composite steels are given. The microscale stress-strain state of the composite steel is analyzed by finite element methods. The stiffness matrix of the composite steel is also presented together with stiffness matrices of ferrite/austenite grains, iron carbide inclusions, and pores as zero matrices. Endurance limits of the microstructural components are described by the Basquin or Coffin-Manson laws, respectively, as high and low cycle fatigue; cumulative microdamage in loading with a variable amplitude is taken from the Palmgren-Miner rule. Planar specimens were tested by console bending. Symmetric fatigue cycling was performed at a stable frequency of 20 Hz with endurance limits up

  14. Structural integrity of wind turbines impacted by tropical cyclones: A case study from China

    NASA Astrophysics Data System (ADS)

    Chen, Xiao; Li, Chuanfeng; Tang, Jing

    2016-09-01

    This study presents a case study on wind turbines impacted by tropical cyclones in China. A quantitative investigation is conducted by integrating aerodynamic, aero-elastic and structural analysis to provide insights into structural integrity of wind turbines under extreme wind conditions. Local mean wind profiles at each turbine site are reconstructed using threedimensional CFD calculation considering terrain topography of the wind farm. Failure modes and failure locations of rotor blades and tubular towers are predicted using finite element analysis. “The lesser of two evils” principle in the turbine design is addressed regarding the criticality of blade fracture and tower collapse. Referring to the current IEC standard for wind turbine design, it is suggested that the partial safety factor associated with failure of turbine tower should be larger than, instead of equal to, the one for the rotor blade to reduce the risk of the total loss of wind turbines in extreme wind conditions.

  15. Materials, Structures and Manufacturing: An Integrated Approach to Develop Expandable Structures

    NASA Technical Reports Server (NTRS)

    Belvin, W. Keith; Zander, Martin E.; Sleight, Daid W.; Connell, John; Holloway, Nancy; Palmieri, Frank

    2012-01-01

    Membrane dominated space structures are lightweight and package efficiently for launch; however, they must be expanded (deployed) in-orbit to achieve the desired geometry. These expandable structural systems include solar sails, solar power arrays, antennas, and numerous other large aperture devices that are used to collect, reflect and/or transmit electromagnetic radiation. In this work, an integrated approach to development of thin-film damage tolerant membranes is explored using advanced manufacturing. Bio-inspired hierarchical structures were printed on films using additive manufacturing to achieve improved tear resistance and to facilitate membrane deployment. High precision, robust expandable structures can be realized using materials that are both space durable and processable using additive manufacturing. Test results show this initial work produced higher tear resistance than neat film of equivalent mass. Future research and development opportunities for expandable structural systems designed using an integrated approach to structural design, manufacturing, and materials selection are discussed.

  16. Protein structure prediction provides comparable performance to crystallographic structures in docking-based virtual screening.

    PubMed

    Du, Hongying; Brender, Jeffrey R; Zhang, Jian; Zhang, Yang

    2015-01-01

    Structure based virtual screening has largely been limited to protein targets for which either an experimental structure is available or a strongly homologous template exists so that a high-resolution model can be constructed. The performance of state of the art protein structure predictions in virtual screening in systems where only weakly homologous templates are available is largely untested. Using the challenging DUD database of structural decoys, we show here that even using templates with only weak sequence homology (<30% sequence identity) structural models can be constructed by I-TASSER which achieve comparable enrichment rates to using the experimental bound crystal structure in the majority of the cases studied. For 65% of the targets, the I-TASSER models, which are constructed essentially in the apo conformations, reached 70% of the virtual screening performance of using the holo-crystal structures. A correlation was observed between the success of I-TASSER in modeling the global fold and local structures in the binding pockets of the proteins versus the relative success in virtual screening. The virtual screening performance can be further improved by the recognition of chemical features of the ligand compounds. These results suggest that the combination of structure-based docking and advanced protein structure modeling methods should be a valuable approach to the large-scale drug screening and discovery studies, especially for the proteins lacking crystallographic structures.

  17. Analysis and prediction of integrated kinetic energy in Atlantic tropical cyclones

    NASA Astrophysics Data System (ADS)

    Kozar, Michael E.

    Integrated kinetic energy (IKE) is a recently developed metric that approximates the destructive potential of a tropical cyclone by assessing the size and strength of its wind field. Despite the potential usefulness of the IKE metric, there are few, if any, operational tools that are specifically designed to forecast IKE in real-time. Therefore, IKE and tropical cyclone structure are analyzed within historical Atlantic tropical cyclones from the past two decades in order to develop an understanding of the environmental and internal storm-driven processes that govern IKE variability. This analysis concurs with past research that IKE growth and decay is influenced by both traditional tropical cyclone development mechanisms and by other features such as extratropical transition and trough interactions. Using this framework, a series of statistical prediction tools are created in an effort to project IKE in Atlantic tropical cyclones from a series of relevant normalized input parameters. The resulting IKE prediction schemes are titled the "Statistical Prediction of Integrated Kinetic Energy (SPIKE)". The first version of SPIKE utilizes simple linear regression to project historical IKE quantities in a perfect prognostic mode for all storms between 1990 and 2011. This primitive model acts as a proof of concept, revealing that IKE can be skillfully forecasted relative to persistence out to 72 hours by even the simplest of statistical models if given accurate estimates of various metrics measured throughout the storm and its environment. The proof-of-concept version of SPIKE is improved upon in its second version, SPIKE2, by incorporating a more sophisticated system of adaptive statistical models. A system of artificial neural networks replaces the linear regression model to better capture the nonlinear relationships in the TC-environment system. In a perfect prognostic approach with analyzed input parameters, the neural networks outperform the linear models in nearly

  18. Computational methods toward accurate RNA structure prediction using coarse-grained and all-atom models.

    PubMed

    Krokhotin, Andrey; Dokholyan, Nikolay V

    2015-01-01

    Computational methods can provide significant insights into RNA structure and dynamics, bridging the gap in our understanding of the relationship between structure and biological function. Simulations enrich and enhance our understanding of data derived on the bench, as well as provide feasible alternatives to costly or technically challenging experiments. Coarse-grained computational models of RNA are especially important in this regard, as they allow analysis of events occurring in timescales relevant to RNA biological function, which are inaccessible through experimental methods alone. We have developed a three-bead coarse-grained model of RNA for discrete molecular dynamics simulations. This model is efficient in de novo prediction of short RNA tertiary structure, starting from RNA primary sequences of less than 50 nucleotides. To complement this model, we have incorporated additional base-pairing constraints and have developed a bias potential reliant on data obtained from hydroxyl probing experiments that guide RNA folding to its correct state. By introducing experimentally derived constraints to our computer simulations, we are able to make reliable predictions of RNA tertiary structures up to a few hundred nucleotides. Our refined model exemplifies a valuable benefit achieved through integration of computation and experimental methods.

  19. An integrated prediction and optimization model of biogas production system at a wastewater treatment facility.

    PubMed

    Akbaş, Halil; Bilgen, Bilge; Turhan, Aykut Melih

    2015-11-01

    This study proposes an integrated prediction and optimization model by using multi-layer perceptron neural network and particle swarm optimization techniques. Three different objective functions are formulated. The first one is the maximization of methane percentage with single output. The second one is the maximization of biogas production with single output. The last one is the maximization of biogas quality and biogas production with two outputs. Methane percentage, carbon dioxide percentage, and other contents' percentage are used as the biogas quality criteria. Based on the formulated models and data from a wastewater treatment facility, optimal values of input variables and their corresponding maximum output values are found out for each model. It is expected that the application of the integrated prediction and optimization models increases the biogas production and biogas quality, and contributes to the quantity of electricity production at the wastewater treatment facility.

  20. The Global Integrated Drought Monitoring and Prediction System (GIDMaPS): Overview and Capabilities

    NASA Astrophysics Data System (ADS)

    AghaKouchak, A.; Hao, Z.; Farahmand, A.; Nakhjiri, N.

    2013-12-01

    Development of reliable monitoring and prediction indices and tools are fundamental to drought preparedness and management. Motivated by the Global Drought Information Systems (GDIS) activities, this paper presents the Global Integrated Drought Monitoring and Prediction System (GIDMaPS) which provides near real-time drought information using both remote sensing observations and model simulations. The monthly data from the NASA Modern-Era Retrospective analysis for Research and Applications (MERRA-Land), North American Land Data Assimilation System (NLDAS), and remotely sensed precipitation data are used as input to GIDMaPS. Numerous indices have been developed for drought monitoring based on various indicator variables (e.g., precipitation, soil moisture, water storage). Defining droughts based on a single variable (e.g., precipitation, soil moisture or runoff) may not be sufficient for reliable risk assessment and decision making. GIDMaPS provides drought information based on multiple indices including Standardized Precipitation Index (SPI), Standardized Soil Moisture Index (SSI) and the Multivariate Standardized Drought Index (MSDI) which combines SPI and SSI probabilistically. In other words, MSDI incorporates the meteorological and agricultural drought conditions for overall characterization of droughts. The seasonal prediction component of GIDMaPS is based on a persistence model which requires historical data and near-past observations. The seasonal drought prediction component is based on two input data sets (MERRA and NLDAS) and three drought indicators (SPI, SSI and MSDI). The drought prediction model provides the empirical probability of drought for different severity levels. In this presentation, both monitoring and prediction components of GIDMaPS will be discussed, and the results from several major droughts including the 2013 Namibia, 2012-2013 United States, 2011-2012 Horn of Africa, and 2010 Amazon Droughts will be presented. The results indicate

  1. An integral equation formulation for predicting radiation patterns of a space shuttle annular slot antenna

    NASA Technical Reports Server (NTRS)

    Jones, J. E.; Richmond, J. H.

    1974-01-01

    An integral equation formulation is applied to predict pitch- and roll-plane radiation patterns of a thin VHF/UHF (very high frequency/ultra high frequency) annular slot communications antenna operating at several locations in the nose region of the space shuttle orbiter. Digital computer programs used to compute radiation patterns are given and the use of the programs is illustrated. Experimental verification of computed patterns is given from measurements made on 1/35-scale models of the orbiter.

  2. Structure-Based Predictive model for Coal Char Combustion.

    SciTech Connect

    Hurt, R.; Calo, J.; Essenhigh, R.; Hadad, C.; Stanley, E.

    1997-06-25

    During the second quarter of this project, progress was made on both major technical tasks. Three parallel efforts were initiated on the modeling of carbon structural evolution. Structural ordering during carbonization was studied by a numerical simulation scheme proposed by Alan Kerstein involving molecular weight growth and rotational mobility. Work was also initiated to adapt a model of carbonaceous mesophase formation, originally developed under parallel NSF funding, to the prediction of coke texture. This latter work makes use of the FG-DVC model of coal pyrolysis developed by Advanced Fuel Research to specify the pool of aromatic clusters that participate in the order/disorder transition. Boston University has initiated molecular dynamics simulations of carbonization processes and Ohio State has begun theoretical treatment of surface reactions. Experimental work has also begun on model compound studies at Brown and on pilot-scale combustion systems with widely varying flame types at OSE. The work on mobility / growth models shows great promise and is discussed in detail in the body of the report.

  3. Prediction of new crystal structure phases in metal borides

    NASA Astrophysics Data System (ADS)

    Kolmogorov, Aleksey

    2006-03-01

    Identification of novel crystal structures is an important step for predicting new stable compounds in alloys, since most theoretical search algorithms are restricted to a given prototype library or a lattice type. Performing ab initio data mining [1] of intermetallic compounds we have discovered that even in such a well-studied class of systems as metal borides there are previously unknown phases comparable in energy to the existing ones [2]. We demonstrate that even though the new structures are relatively simple, their identification is not straightforward. We systematically investigate the stability and electronic properties of the new metal boride phases. Our calculations show that some phases exhibit electronic features similar to those in the famous MgB2 and could be good superconductors. The new phases are likely to have random stacking faults, so they might not be detected with standard x-ray methods. Our results could thus be used as an important guide in the search for new superconducting metal borides. [1] S. Curtarolo et al., Phys. Rev. Lett. 91, 135503 (2003). [2] A.N. Kolmogorov et al., submitted (2005).

  4. Prediction of grain structures in various solidification processes

    SciTech Connect

    Rappaz, M.; Gandin, C.A.; Desbiolles, J.L.; Thevoz, P.

    1996-03-01

    Grain structure formation during solidification can be simulated via the use of stochastic models providing the physical mechanisms of nucleation and dendrite growth are accounted for. With this goal in mind, a physically based cellular automaton (CA) model has been coupled with finite element (FE) heat flow computations and implemented into the code 3-MOS. The CA enmeshment of the solidifying domain with small square cells is first generated automatically from the FE mesh. Within each time-step, the variation of enthalpy at each node of the FE mesh is calculated using an implicit scheme and a Newton-type linearization method. After interpolation of the explicit temperature and of the enthalpy variation at the cell location, the nucleation and growth of grains are simulated using the CA algorithm. This algorithm accounts for the heterogeneous nucleation in the bulk and at the surface of the ingot, for the growth and preferential growth directions of the dendrites, and for microsegregation. The variation of volume fraction of solid at the cell location are then summed up at the FE nodes in order to find the new temperatures. This CAFE model, which allows the prediction and the visualization of grain structures during and after solidification, is applied to various solidification processes: the investment casting of turbine blades, the continuous casting of rods, and the laser remelting or welding of plates. Because the CAFE model is yet two-dimensional (2-D), the simulation results are compared in a qualitative way with experimental findings.

  5. Combining Structural Modeling with Ensemble Machine Learning to Accurately Predict Protein Fold Stability and Binding Affinity Effects upon Mutation

    PubMed Central

    Garcia Lopez, Sebastian; Kim, Philip M.

    2014-01-01

    Advances in sequencing have led to a rapid accumulation of mutations, some of which are associated with diseases. However, to draw mechanistic conclusions, a biochemical understanding of these mutations is necessary. For coding mutations, accurate prediction of significant changes in either the stability of proteins or their affinity to their binding partners is required. Traditional methods have used semi-empirical force fields, while newer methods employ machine learning of sequence and structural features. Here, we show how combining both of these approaches leads to a marked boost in accuracy. We introduce ELASPIC, a novel ensemble machine learning approach that is able to predict stability effects upon mutation in both, domain cores and domain-domain interfaces. We combine semi-empirical energy terms, sequence conservation, and a wide variety of molecular details with a Stochastic Gradient Boosting of Decision Trees (SGB-DT) algorithm. The accuracy of our predictions surpasses existing methods by a considerable margin, achieving correlation coefficients of 0.77 for stability, and 0.75 for affinity predictions. Notably, we integrated homology modeling to enable proteome-wide prediction and show that accurate prediction on modeled structures is possible. Lastly, ELASPIC showed significant differences between various types of disease-associated mutations, as well as between disease and common neutral mutations. Unlike pure sequence-based prediction methods that try to predict phenotypic effects of mutations, our predictions unravel the molecular details governing the protein instability, and help us better understand the molecular causes of diseases. PMID:25243403

  6. Music and language perception: expectations, structural integration, and cognitive sequencing.

    PubMed

    Tillmann, Barbara

    2012-10-01

    Music can be described as sequences of events that are structured in pitch and time. Studying music processing provides insight into how complex event sequences are learned, perceived, and represented by the brain. Given the temporal nature of sound, expectations, structural integration, and cognitive sequencing are central in music perception (i.e., which sounds are most likely to come next and at what moment should they occur?). This paper focuses on similarities in music and language cognition research, showing that music cognition research provides insight into the understanding of not only music processing but also language processing and the processing of other structured stimuli. The hypothesis of shared resources between music and language processing and of domain-general dynamic attention has motivated the development of research to test music as a means to stimulate sensory, cognitive, and motor processes.

  7. Fluorescence microscopy for the characterization of structural integrity

    NASA Technical Reports Server (NTRS)

    Street, Kenneth W.; Leonhardt, Todd A.

    1991-01-01

    The absorption characteristics of light and the optical technique of fluorescence microscopy for enhancing metallographic interpretation are presented. Characterization of thermally sprayed coatings by optical microscopy suffers because of the tendency for misidentification of the microstructure produced by metallographic preparation. Gray scale, in bright field microscopy, is frequently the only means of differentiating the actual structural details of porosity, cracking, and debonding of coatings. Fluorescence microscopy is a technique that helps to distinguish the artifacts of metallographic preparation (pullout, cracking, debonding) from the microstructure of the specimen by color contrasting structural differences. Alternative instrumentation and the use of other dye systems are also discussed. The combination of epoxy vacuum infiltration with fluorescence microscopy to verify microstructural defects is an effective means to characterize advanced materials and to assess structural integrity.

  8. Topology prediction of Brucella abortus Omp2b and Omp2a porins after critical assessment of transmembrane beta strands prediction by several secondary structure prediction methods.

    PubMed

    Paquet, J Y; Vinals, C; Wouters, J; Letesson, J J; Depiereux, E

    2000-02-01

    In order to propose a reliable model for Brucella porin topology, several structure prediction methods were evaluated in their ability to predict porin topology. Four porins of known structure were selected as test-cases and their secondary structure delineated. The specificity and sensitivity of 11 methods were separately evaluated. Our critical assessment shows that some secondary structure prediction methods (PHD, Dsc, Sopma) originally designed to predict globular protein structure are useful on porin topology prediction. The overall best prediction is obtained by combining these three "generalist" methods with a transmembrane beta strand prediction technique. This "consensus" method was applied to Brucella porins Omp2b and Omp2a, sharing no sequence homology with any other porin. The predicted topology is a 16-stranded antiparallel beta barrel with Omp2a showing a higher number of negatively charged residue in the exposed loops than Omp2b. Experiments are in progress to validate the proposed topology and the functional hypotheses. The ability of the proposed consensus method to predict topology of complex outer membrane protein is briefly discussed.

  9. Integrated modeling for the GPi flexure sensitive structure

    NASA Astrophysics Data System (ADS)

    Erickson, Darren; Roberts, Scott; Pazder, John S.; Fletcher, J. Murray

    2008-07-01

    The Gemini Planet Imager (GPi) is comprised of three main opto-mechanical systems: the Adaptive Optics (AO) system, the Calibration (CAL) system, and the Integral Field Spectrograph (IFS). Each of these subsystems are built and aligned independently, and then integrated into the final instrument. A truss framework called the Flexure Sensitive Structure (FSS) has been designed to locate each optical subsystem within the instrument, utilizing kinematic bipods to eliminate distortion due to flexure and thermal changes. Due to the distributed nature of the optical system, an end-to-end opto-mechanical modeling approach is taken using the NRC Integrated Model (NRCIM). This set of numerical tools was originally developed to support the Canadian VLOT and TMT telescope studies. The instrument structural response is calculated using a commercial finite element package; and the 6 degree-of-freedom rigid body motions of the optical elements are then passed to an optical model. Ray-tracing is performed to determine the line-of-sight errors at numerous critical focal planes and pupil planes. Disturbances to the system include gravity induced flexure and thermal distortions. Optical compensation using a combination of closedloop feedback and open-loop models are then applied using steering mirrors to improve the line-of-sight figures of merit. Finally, these figures of merit are compared against the system optical error budget to assess the overall performance of the opto-mechanical system.

  10. The Application of a Boundary Integral Equation Method to the Prediction of Ducted Fan Engine Noise

    NASA Technical Reports Server (NTRS)

    Dunn, M. H.; Tweed, J.; Farassat, F.

    1999-01-01

    The prediction of ducted fan engine noise using a boundary integral equation method (BIEM) is considered. Governing equations for the BIEM are based on linearized acoustics and describe the scattering of incident sound by a thin, finite-length cylindrical duct in the presence of a uniform axial inflow. A classical boundary value problem (BVP) is derived that includes an axisymmetric, locally reacting liner on the duct interior. Using potential theory, the BVP is recast as a system of hypersingular boundary integral equations with subsidiary conditions. We describe the integral equation derivation and solution procedure in detail. The development of the computationally efficient ducted fan noise prediction program TBIEM3D, which implements the BIEM, and its utility in conducting parametric noise reduction studies are discussed. Unlike prediction methods based on spinning mode eigenfunction expansions, the BIEM does not require the decomposition of the interior acoustic field into its radial and axial components which, for the liner case, avoids the solution of a difficult complex eigenvalue problem. Numerical spectral studies are presented to illustrate the nexus between the eigenfunction expansion representation and BIEM results. We demonstrate BIEM liner capability by examining radiation patterns for several cases of practical interest.

  11. Integrated design of electrical distribution systems: Phase balancing and phase prediction case studies

    NASA Astrophysics Data System (ADS)

    Dilek, Murat

    Distribution system analysis and design has experienced a gradual development over the past three decades. The once loosely assembled and largely ad hoc procedures have been progressing toward being well-organized. The increasing power of computers now allows for managing the large volumes of data and other obstacles inherent to distribution system studies. A variety of sophisticated optimization methods, which were impossible to conduct in the past, have been developed and successfully applied to distribution systems. Among the many procedures that deal with making decisions about the state and better operation of a distribution system, two decision support procedures will be addressed in this study: phase balancing and phase prediction. The former recommends re-phasing of single- and double-phase laterals in a radial distribution system in order to improve circuit loss while also maintaining/improving imbalances at various balance point locations. Phase balancing calculations are based on circuit loss information and current magnitudes that are calculated from a power flow solution. The phase balancing algorithm is designed to handle time-varying loads when evaluating phase moves that will result in improved circuit losses over all load points. Applied to radial distribution systems, the phase prediction algorithm attempts to predict the phases of single- and/or double phase laterals that have no phasing information previously recorded by the electric utility. In such an attempt, it uses available customer data and kW/kVar measurements taken at various locations in the system. It is shown that phase balancing is a special case of phase prediction. Building on the phase balancing and phase prediction design studies, this work introduces the concept of integrated design, an approach for coordinating the effects of various design calculations. Integrated design considers using results of multiple design applications rather than employing a single application for a

  12. Integrative EEG biomarkers predict progression to Alzheimer's disease at the MCI stage

    PubMed Central

    Poil, Simon-Shlomo; de Haan, Willem; van der Flier, Wiesje M.; Mansvelder, Huibert D.; Scheltens, Philip; Linkenkaer-Hansen, Klaus

    2013-01-01

    Alzheimer's disease (AD) is a devastating disorder of increasing prevalence in modern society. Mild cognitive impairment (MCI) is considered a transitional stage between normal aging and AD; however, not all subjects with MCI progress to AD. Prediction of conversion to AD at an early stage would enable an earlier, and potentially more effective, treatment of AD. Electroencephalography (EEG) biomarkers would provide a non-invasive and relatively cheap screening tool to predict conversion to AD; however, traditional EEG biomarkers have not been considered accurate enough to be useful in clinical practice. Here, we aim to combine the information from multiple EEG biomarkers into a diagnostic classification index in order to improve the accuracy of predicting conversion from MCI to AD within a 2-year period. We followed 86 patients initially diagnosed with MCI for 2 years during which 25 patients converted to AD. We show that multiple EEG biomarkers mainly related to activity in the beta-frequency range (13–30 Hz) can predict conversion from MCI to AD. Importantly, by integrating six EEG biomarkers into a diagnostic index using logistic regression the prediction improved compared with the classification using the individual biomarkers, with a sensitivity of 88% and specificity of 82%, compared with a sensitivity of 64% and specificity of 62% of the best individual biomarker in this index. In order to identify this diagnostic index we developed a data mining approach implemented in the Neurophysiological Biomarker Toolbox (http://www.nbtwiki.net/). We suggest that this approach can be used to identify optimal combinations of biomarkers (integrative biomarkers) also in other modalities. Potentially, these integrative biomarkers could be more sensitive to disease progression and response to therapeutic intervention. PMID:24106478

  13. A Tool Preference Choice Method for RNA Secondary Structure Prediction by SVM with Statistical Tests

    PubMed Central

    Hor, Chiou-Yi; Yang, Chang-Biau; Chang, Chia-Hung; Tseng, Chiou-Ting; Chen, Hung-Hsin

    2013-01-01

    The Prediction of RNA secondary structures has drawn much attention from both biologists and computer scientists. Many useful tools have been developed for this purpose. These tools have their individual strengths and weaknesses. As a result, based on support vector machines (SVM), we propose a tool choice method which integrates three prediction tools: pknotsRG, RNAStructure, and NUPACK. Our method first extracts features from the target RNA sequence, and adopts two information-theoretic feature selection methods for feature ranking. We propose a method to combine feature selection and classifier fusion in an incremental manner. Our test data set contains 720 RNA sequences, where 225 pseudoknotted RNA sequences are obtained from PseudoBase, and 495 nested RNA sequences are obtained from RNA SSTRAND. The method serves as a preprocessing way in analyzing RNA sequences before the RNA secondary structure prediction tools are employed. In addition, the performance of various configurations is subject to statistical tests to examine their significance. The best base-pair accuracy achieved is 75.5%, which is obtained by the proposed incremental method, and is significantly higher than 68.8%, which is associated with the best predictor, pknotsRG. PMID:23641141

  14. Predicting complex syntactic structure in real time: Processing of negative sentences in Russian.

    PubMed

    Kazanina, Nina

    2016-09-19

    In Russian negative sentences the verb's direct object may appear either in the accusative case, which is licensed by the verb (as is common cross-linguistically), or in the genitive case, which is licensed by the negation (Russian-specific "genitive-of-negation" phenomenon). Such sentences were used to investigate whether case marking is employed for anticipating syntactic structure, and whether lexical heads other than the verb can be predicted on the basis of a case-marked noun phrase. Experiment 1, a completion task, confirmed that genitive-of-negation is part of Russian speakers' active grammatical repertoire. In Experiments 2 and 3, the genitive/accusative case manipulation on the preverbal object led to shorter reading times at the negation and verb in the genitive versus accusative condition. Furthermore, Experiment 3 manipulated linear order of the direct object and the negated verb in order to distinguish whether the abovementioned facilitatory effect was predictive or integrative in nature, and concluded that the parser actively predicts a verb and (otherwise optional) negation on the basis of a preceding genitive-marked object. Similarly to a head-final language, case-marking information on preverbal noun phrases (NPs) is used by the parser to enable incremental structure building in a free-word-order language such as Russian.

  15. RegPredict: an integrated system for regulon inference in prokaryotes by comparative genomics approach

    SciTech Connect

    Novichkov, Pavel S.; Rodionov, Dmitry A.; Stavrovskaya, Elena D.; Novichkova, Elena S.; Kazakov, Alexey E.; Gelfand, Mikhail S.; Arkin, Adam P.; Mironov, Andrey A.; Dubchak, Inna

    2010-05-26

    RegPredict web server is designed to provide comparative genomics tools for reconstruction and analysis of microbial regulons using comparative genomics approach. The server allows the user to rapidly generate reference sets of regulons and regulatory motif profiles in a group of prokaryotic genomes. The new concept of a cluster of co-regulated orthologous operons allows the user to distribute the analysis of large regulons and to perform the comparative analysis of multiple clusters independently. Two major workflows currently implemented in RegPredict are: (i) regulon reconstruction for a known regulatory motif and (ii) ab initio inference of a novel regulon using several scenarios for the generation of starting gene sets. RegPredict provides a comprehensive collection of manually curated positional weight matrices of regulatory motifs. It is based on genomic sequences, ortholog and operon predictions from the MicrobesOnline. An interactive web interface of RegPredict integrates and presents diverse genomic and functional information about the candidate regulon members from several web resources. RegPredict is freely accessible at http://regpredict.lbl.gov.

  16. Integrating environmental and genetic effects to predict responses of tree populations to climate.

    PubMed

    Wang, Tongli; O'Neill, Gregory A; Aitken, Sally N

    2010-01-01

    Climate is a major environmental factor affecting the phenotype of trees and is also a critical agent of natural selection that has molded among-population genetic variation. Population response functions describe the environmental effect of planting site climates on the performance of a single population, whereas transfer functions describe among-population genetic variation molded by natural selection for climate. Although these approaches are widely used to predict the responses of trees to climate change, both have limitations. We present a novel approach that integrates both genetic and environmental effects into a single "universal response function" (URF) to better predict the influence of climate on phenotypes. Using a large lodgepole pine (Pinus contorta Dougl. ex Loud.) field transplant experiment composed of 140 populations planted on 62 sites to demonstrate the methodology, we show that the URF makes full use of data from provenance trials to: (1) improve predictions of climate change impacts on phenotypes; (2) reduce the size and cost of future provenance trials without compromising predictive power; (3) more fully exploit existing, less comprehensive provenance tests; (4) quantify and compare environmental and genetic effects of climate on population performance; and (5) predict the performance of any population growing in any climate. Finally, we discuss how the last attribute allows the URF to be used as a mechanistic model to predict population and species ranges for the future and to guide assisted migration of seed for reforestation, restoration, or afforestation and genetic conservation in a changing climate.

  17. Prediction of clinical phenotypes in invasive breast carcinomas from the integration of radiomics and genomics data.

    PubMed

    Guo, Wentian; Li, Hui; Zhu, Yitan; Lan, Li; Yang, Shengjie; Drukker, Karen; Morris, Elizabeth; Burnside, Elizabeth; Whitman, Gary; Giger, Maryellen L; Ji, Yuan

    2015-10-01

    Genomic and radiomic imaging profiles of invasive breast carcinomas from The Cancer Genome Atlas and The Cancer Imaging Archive were integrated and a comprehensive analysis was conducted to predict clinical outcomes using the radiogenomic features. Variable selection via LASSO and logistic regression were used to select the most-predictive radiogenomic features for the clinical phenotypes, including pathological stage, lymph node metastasis, and status of estrogen receptor (ER), progesterone receptor (PR), and human epidermal growth factor receptor 2 (HER2). Cross-validation with receiver operating characteristic (ROC) analysis was performed and the area under the ROC curve (AUC) was employed as the prediction metric. Higher AUCs were obtained in the prediction of pathological stage, ER, and PR status than for lymph node metastasis and HER2 status. Overall, the prediction performances by genomics alone, radiomics alone, and combined radiogenomics features showed statistically significant correlations with clinical outcomes; however, improvement on the prediction performance by combining genomics and radiomics data was not found to be statistically significant, most likely due to the small sample size of 91 cancer cases with 38 radiomic features and 144 genomic features.

  18. Prediction of clinical phenotypes in invasive breast carcinomas from the integration of radiomics and genomics data

    PubMed Central

    Guo, Wentian; Li, Hui; Zhu, Yitan; Lan, Li; Yang, Shengjie; Drukker, Karen; Morris, Elizabeth; Burnside, Elizabeth; Whitman, Gary; Giger, Maryellen L.; Ji, Yuan; TCGA Breast Phenotype Research Group

    2015-01-01

    Abstract. Genomic and radiomic imaging profiles of invasive breast carcinomas from The Cancer Genome Atlas and The Cancer Imaging Archive were integrated and a comprehensive analysis was conducted to predict clinical outcomes using the radiogenomic features. Variable selection via LASSO and logistic regression were used to select the most-predictive radiogenomic features for the clinical phenotypes, including pathological stage, lymph node metastasis, and status of estrogen receptor (ER), progesterone receptor (PR), and human epidermal growth factor receptor 2 (HER2). Cross-validation with receiver operating characteristic (ROC) analysis was performed and the area under the ROC curve (AUC) was employed as the prediction metric. Higher AUCs were obtained in the prediction of pathological stage, ER, and PR status than for lymph node metastasis and HER2 status. Overall, the prediction performances by genomics alone, radiomics alone, and combined radiogenomics features showed statistically significant correlations with clinical outcomes; however, improvement on the prediction performance by combining genomics and radiomics data was not found to be statistically significant, most likely due to the small sample size of 91 cancer cases with 38 radiomic features and 144 genomic features. PMID:26835491

  19. Cross-scale integration of knowledge for predicting species ranges: a metamodeling framework

    PubMed Central

    Talluto, Matthew V.; Boulangeat, Isabelle; Ameztegui, Aitor; Aubin, Isabelle; Berteaux, Dominique; Butler, Alyssa; Doyon, Frédérik; Drever, C. Ronnie; Fortin, Marie-Josée; Franceschini, Tony; Liénard, Jean; McKenney, Dan; Solarik, Kevin A.; Strigul, Nikolay; Thuiller, Wilfried; Gravel, Dominique

    2016-01-01

    Aim Current interest in forecasting changes to species ranges have resulted in a multitude of approaches to species distribution models (SDMs). However, most approaches include only a small subset of the available information, and many ignore smaller-scale processes such as growth, fecundity, and dispersal. Furthermore, different approaches often produce divergent predictions with no simple method to reconcile them. Here, we present a flexible framework for integrating models at multiple scales using hierarchical Bayesian methods. Location Eastern North America (as an example). Methods Our framework builds a metamodel that is constrained by the results of multiple sub-models and provides probabilistic estimates of species presence. We applied our approach to a simulated dataset to demonstrate the integration of a correlative SDM with a theoretical model. In a second example, we built an integrated model combining the results of a physiological model with presence-absence data for sugar maple (Acer saccharum), an abundant tree native to eastern North America. Results For both examples, the integrated models successfully included information from all data sources and substantially improved the characterization of uncertainty. For the second example, the integrated model outperformed the source models with respect to uncertainty when modelling the present range of the species. When projecting into the future, the model provided a consensus view of two models that differed substantially in their predictions. Uncertainty was reduced where the models agreed and was greater where they diverged, providing a more realistic view of the state of knowledge than either source model. Main conclusions We conclude by discussing the potential applications of our method and its accessibility to applied ecologists. In ideal cases, our framework can be easily implemented using off-the-shelf software. The framework has wide potential for use in species distribution modelling and can

  20. A data integration framework for prediction of transcription factor targets: a BCL6 case study

    PubMed Central

    Nykter, Matti; Lähdesmäki, Harri; Rust, Alistair; Thorsson, Vesteinn; Shmulevich, Ilya

    2009-01-01

    We present a computational framework for predicting targets of transcription factor regulation. The framework is based on the integration of a number of sources of evidence, derived from DNA sequence and gene expression data, using a weighted sum approach. Sources of evidence are prioritized based on a training set, and their relative contributions are then optimized. The performance of the proposed framework is demonstrated in the context of BCL6 target prediction. We show that this framework is able to uncover BCL6 targets reliably when biological prior information is utilized effectively, particularly in the case of sequence analysis. The framework results in a considerable gain in performance over scores in which sequence information was not incorporated. This analysis shows that with assessment of the quality and biological relevance of the data, reliable predictions can be obtained with this computational framework. PMID:19348642

  1. Simulation study of HL-2A-like plasma using integrated predictive modeling code

    SciTech Connect

    Poolyarat, N.; Onjun, T.; Promping, J.

    2009-11-15

    Self-consistent simulations of HL-2A-like plasma are carried out using 1.5D BALDUR integrated predictive modeling code. In these simulations, the core transport is predicted using the combination of Multi-mode (MMM95) anomalous core transport model and NCLASS neoclassical transport model. The evolution of plasma current, temperature and density is carried out. Consequently, the plasma current, temperature and density profiles, as well as other plasma parameters, are obtained as the predictions in each simulation. It is found that temperature and density profiles in these simulations are peak near the plasma center. In addition, the sawtooth period is studied using the Porcilli model and is found that before, during, and after the electron cyclotron resonance heating (ECRH) operation the sawtooth period are approximately the same. It is also observed that the mixing radius of sawtooth crashes is reduced during the ECRH operation.

  2. Terahertz filter integrated with a subwavelength structured antireflection coating

    NASA Astrophysics Data System (ADS)

    Woo, Jeong Min; Kim, Dae-Seon; Kim, Dong-Ju; Jang, Jae-Hyung

    2015-12-01

    Micro-pyramid shaped subwavelength structures (SWSs) were integrated on both sides of a terahertz (THz) filter by means of stamping methods. Two silicon-based stamping molds fabricated via crystallographic wet etching were utilized to replicate SWSs onto cyclo-olefin copolymer (COC) films coated onto both sides of a THz filter at the same time. The SWSs act as an broadband antireflection coating to reduce the surface reflection loss in a frequency range of 0.2 THz to 1.4 THz. Compared to a THz filter without SWSs, the filter integrated with double-sided SWSs exhibits a low standing wave ratio inside the substrate and THz signal transmission enhancement of up to 10.8%.

  3. Can benthic community structure be used to predict the process of bioturbation in real ecosystems?

    NASA Astrophysics Data System (ADS)

    Queirós, Ana M.; Stephens, Nicholas; Cook, Richard; Ravaglioli, Chiara; Nunes, Joana; Dashfield, Sarah; Harris, Carolyn; Tilstone, Gavin H.; Fishwick, James; Braeckman, Ulrike; Somerfield, Paul J.; Widdicombe, Stephen

    2015-09-01

    Disentangling the roles of environmental change and natural environmental variability on biologically mediated ecosystem processes is paramount to predict future marine ecosystem functioning. Bioturbation, the biogenic mixing of sediments, has a regulating role in marine biogeochemical processes. However, our understanding of bioturbation as a community level process and of its environmental drivers is still limited by loose use of terminology, and a lack of consensus about what bioturbation is. To help resolve these challenges, this empirical study investigated the links between four different attributes of bioturbation (bioturbation depth, activity and distance, and biodiffusive transport); the ability of an index of bioturbation (BPc) to predict each of them; and their relation to seasonality, in a shallow coastal system - the Western Channel Observatory, UK. Bioturbation distance depended on changes in benthic community structure, while the other three attributes were more directly influenced by seasonality in food availability. In parallel, BPc successfully predicted bioturbation distance but not the other attributes of bioturbation. This study therefore highlights that community bioturbation results from this combination of processes responding to environmental variability at different time-scales. However, community level measurements of bioturbation across environmental variability are still scarce, and BPc is calculated using commonly available data on benthic community structure and the functional classification of invertebrates. Therefore, BPc could be used to support the growth of landscape scale bioturbation research, but future uses of the index need to consider which bioturbation attributes the index actually predicts. As BPc predicts bioturbation distance, estimated here using a random-walk model applicable to community settings, studies using either of the metrics should be directly comparable and contribute to a more integrated future for

  4. Uncertainty quantification and integration of machine learning techniques for predicting acid rock drainage chemistry: a probability bounds approach.

    PubMed

    Betrie, Getnet D; Sadiq, Rehan; Morin, Kevin A; Tesfamariam, Solomon

    2014-08-15

    Acid rock drainage (ARD) is a major pollution problem globally that has adversely impacted the environment. Identification and quantification of uncertainties are integral parts of ARD assessment and risk mitigation, however previous studies on predicting ARD drainage chemistry have not fully addressed issues of uncertainties. In this study, artificial neural networks (ANN) and support vector machine (SVM) are used for the prediction of ARD drainage chemistry and their predictive uncertainties are quantified using probability bounds analysis. Furthermore, the predictions of ANN and SVM are integrated using four aggregation methods to improve their individual predictions. The results of this study showed that ANN performed better than SVM in enveloping the observed concentrations. In addition, integrating the prediction of ANN and SVM using the aggregation methods improved the predictions of individual techniques.

  5. Failure prediction of thin beryllium sheets used in spacecraft structures

    NASA Astrophysics Data System (ADS)

    Roschke, Paul N.; Mascorro, Edward; Papados, Photios; Serna, Oscar R.

    1991-12-01

    The primary objective of this study is to develop a method for prediction of failure of thin beryllium sheets that undergo complex states of stress. Major components of the research include experimental evaluation of strength parameters for cross-rolled beryllium sheet, application of the Tsai-Wu failure criterion to plate bending problems, development of a high order failure criterion, application of the new criterion to a variety of structures, and incorporation of both failure criteria into a finite element code. A Tsai-Wu failure model for SR-200 sheet material is developed from available tensile data, experiments carried out by NASA on two circular plates, and compression and off-axis experiments performed in this study. The failure surface obtained from the resulting criterion forms an ellipsoid. By supplementing experimental data used in the the two-dimensional criterion and modifying previously suggested failure criteria, a multi-dimensional failure surface is proposed for thin beryllium structures. The new criterion for orthotropic material is represented by a failure surface in six-dimensional stress space. In order to determine coefficients of the governing equation, a number of uniaxial, biaxial, and triaxial experiments are required. Details of these experiments and a complementary ultrasonic investigation are described in detail. Finally, validity of the criterion and newly determined mechanical properties is established through experiments on structures composed of SR200 sheet material. These experiments include a plate-plug arrangement under a complex state of stress and a series of plates with an out-of-plane central point load. Both criteria have been incorporated into a general purpose finite element analysis code. Numerical simulation incrementally applied loads to a structural component that is being designed and checks each nodal point in the model for exceedance of a failure criterion. If stresses at all locations do not exceed the failure

  6. Failure prediction of thin beryllium sheets used in spacecraft structures

    NASA Technical Reports Server (NTRS)

    Roschke, Paul N.; Mascorro, Edward; Papados, Photios; Serna, Oscar R.

    1991-01-01

    The primary objective of this study is to develop a method for prediction of failure of thin beryllium sheets that undergo complex states of stress. Major components of the research include experimental evaluation of strength parameters for cross-rolled beryllium sheet, application of the Tsai-Wu failure criterion to plate bending problems, development of a high order failure criterion, application of the new criterion to a variety of structures, and incorporation of both failure criteria into a finite element code. A Tsai-Wu failure model for SR-200 sheet material is developed from available tensile data, experiments carried out by NASA on two circular plates, and compression and off-axis experiments performed in this study. The failure surface obtained from the resulting criterion forms an ellipsoid. By supplementing experimental data used in the the two-dimensional criterion and modifying previously suggested failure criteria, a multi-dimensional failure surface is proposed for thin beryllium structures. The new criterion for orthotropic material is represented by a failure surface in six-dimensional stress space. In order to determine coefficients of the governing equation, a number of uniaxial, biaxial, and triaxial experiments are required. Details of these experiments and a complementary ultrasonic investigation are described in detail. Finally, validity of the criterion and newly determined mechanical properties is established through experiments on structures composed of SR200 sheet material. These experiments include a plate-plug arrangement under a complex state of stress and a series of plates with an out-of-plane central point load. Both criteria have been incorporated into a general purpose finite element analysis code. Numerical simulation incrementally applied loads to a structural component that is being designed and checks each nodal point in the model for exceedance of a failure criterion. If stresses at all locations do not exceed the failure

  7. An automated, integrated approach to Space Station structural modeling

    NASA Technical Reports Server (NTRS)

    Lindenmoyer, Alan J.; Habermeyer, John A.

    1989-01-01

    NASA and its contractors have developed an integrated, interdisciplinary CAD/analysis system designated IDEAS(double asterisk)2 in order to conduct evaluations of alternative Space Station concepts' performance over the projected course of the Station's evolution in orbit. Attention is presently given to the requirements associated with automated FEM-building methods applicable to Space Station system-level structural dynamic analysis, and the ways in which IDEAS(double asterisk)2 addresses these requirements. Advantage is taken of the interactive capabilities of the SUPERTAB FEM preprocessor system for Space Station model manipulation and modification.

  8. The effect of thermal stresses on the integrity of three built-up aircraft structures

    NASA Technical Reports Server (NTRS)

    Jenkins, J. M.

    1980-01-01

    A Mach 6 flight was simulated in order to examine heating effects on three frame/skin specimens. The specimens included: a titanium truss frame with a lockalloy skin; a stainless steel z-frame with a lockalloy skin; and a titanium z-frame with a lockalloy skin. Thermal stresses and temperature were measured on these specimens for the purpose of examining their efficiency, performance, and integrity. Measured thermal stresses were examined with respect to material yield strengths, buckling criteria, structural weight, and geometric locations. Principal thermal stresses were studied from the standpoint of uniaxial stress assumptions. Measured thermal stresses were compared to predicted values.

  9. Recursive protein modeling: a divide and conquer strategy for Protein Structure Prediction and its case study in CASP9.

    PubMed

    Cheng, Jianlin; Eickholt, Jesse; Wang, Zheng; Deng, Xin

    2012-06-01

    After decades of research, protein structure prediction remains a very challenging problem. In order to address the different levels of complexity of structural modeling, two types of modeling techniques--template-based modeling and template-free modeling--have been developed. Template-based modeling can often generate a moderate- to high-resolution model when a similar, homologous template structure is found for a query protein but fails if no template or only incorrect templates are found. Template-free modeling, such as fragment-based assembly, may generate models of moderate resolution for small proteins of low topological complexity. Seldom have the two techniques been integrated together to improve protein modeling. Here we develop a recursive protein modeling approach to selectively and collaboratively apply template-based and template-free modeling methods to model template-covered (i.e. certain) and template-free (i.e. uncertain) regions of a protein. A preliminary implementation of the approach was tested on a number of hard modeling cases during the 9th Critical Assessment of Techniques for Protein Structure Prediction (CASP9) and successfully improved the quality of modeling in most of these cases. Recursive modeling can significantly reduce the complexity of protein structure modeling and integrate template-based and template-free modeling to improve the quality and efficiency of protein structure prediction.

  10. RECURSIVE PROTEIN MODELING: A DIVIDE AND CONQUER STRATEGY FOR PROTEIN STRUCTURE PREDICTION AND ITS CASE STUDY IN CASP9

    PubMed Central

    CHENG, JIANLIN; EICKHOLT, JESSE; WANG, ZHENG; DENG, XIN

    2013-01-01

    After decades of research, protein structure prediction remains a very challenging problem. In order to address the different levels of complexity of structural modeling, two types of modeling techniques — template-based modeling and template-free modeling — have been developed. Template-based modeling can often generate a moderate- to high-resolution model when a similar, homologous template structure is found for a query protein but fails if no template or only incorrect templates are found. Template-free modeling, such as fragment-based assembly, may generate models of moderate resolution for small proteins of low topological complexity. Seldom have the two techniques been integrated together to improve protein modeling. Here we develop a recursive protein modeling approach to selectively and collaboratively apply template-based and template-free modeling methods to model template-covered (i.e. certain) and template-free (i.e. uncertain) regions of a protein. A preliminary implementation of the approach was tested on a number of hard modeling cases during the 9th Critical Assessment of Techniques for Protein Structure Prediction (CASP9) and successfully improved the quality of modeling in most of these cases. Recursive modeling can signicantly reduce the complexity of protein structure modeling and integrate template-based and template-free modeling to improve the quality and efficiency of protein structure prediction. PMID:22809379

  11. Structuration theory: open the black box of integrated care

    PubMed Central

    Esslinger, Adelheid Susanne

    2009-01-01

    Introduction The health care system is in transition. Integrated cares solutions are prominent and even forced by health care policy. But how can we understand the needs of different stakeholders in this system? Why do they still not act effectively and efficiently together? A closer look, using the structuration theory of Anthony Giddens, may be helpful. Theory The theory of structuration enables people to explain social interactions. As this is a matter of fact, the health care system was analyzed by the author in her habilitation thesis. The focus of the study laid on the effective and efficient care of the very old people in Germany. The structuration theory was presented, and as an example of practical translation of the theory, the implementation of the ‘Pflegestützpunkte’ (service point for care) was described. Practice Giddens' structuration theory is on the one hand complex in theory, and simple on the other hand in practice. Choosing the paradigm may be helpful to explain the motivation of the different stakeholders in the health care system. It would be necessary to create a suitable questionnaire, to get deeper insight in how the different actors in the system act and react. Such a questionnaire should be based on Giddens' theory. The following three dimensions are needed: structure (including domination, legitimation, and signification), interaction (including power, sanctioning, and communication) and modality/duality (including instruments of power, norms and interpretation).

  12. Structural kinematics based damage zone prediction in gradient structures using vibration database

    NASA Astrophysics Data System (ADS)

    Talha, Mohammad; Ashokkumar, Chimpalthradi R.

    2014-05-01

    To explore the applications of functionally graded materials (FGMs) in dynamic structures, structural kinematics based health monitoring technique becomes an important problem. Depending upon the displacements in three dimensions, the health of the material to withstand dynamic loads is inferred in this paper, which is based on the net compressive and tensile displacements that each structural degree of freedom takes. These net displacements at each finite element node predicts damage zones of the FGM where the material is likely to fail due to a vibration response which is categorized according to loading condition. The damage zone prediction of a dynamically active FGMs plate have been accomplished using Reddy's higher-order theory. The constituent material properties are assumed to vary in the thickness direction according to the power-law behavior. The proposed C0 finite element model (FEM) is applied to get net tensile and compressive displacement distributions across the structures. A plate made of Aluminum/Ziconia is considered to illustrate the concept of structural kinematics-based health monitoring aspects of FGMs.

  13. Integrating seasonal climate prediction and agricultural models for insights into agricultural practice

    PubMed Central

    Hansen, James W

    2005-01-01

    Interest in integrating crop simulation models with dynamic seasonal climate forecast models is expanding in response to a perceived opportunity to add value to seasonal climate forecasts for agriculture. Integrated modelling may help to address some obstacles to effective agricultural use of climate information. First, modelling can address the mismatch between farmers' needs and available operational forecasts. Probabilistic crop yield forecasts are directly relevant to farmers' livelihood decisions and, at a different scale, to early warning and market applications. Second, credible ex ante evidence of livelihood benefits, using integrated climate–crop–economic modelling in a value-of-information framework, may assist in the challenge of obtaining institutional, financial and political support; and inform targeting for greatest benefit. Third, integrated modelling can reduce the risk and learning time associated with adaptation and adoption, and related uncertainty on the part of advisors and advocates. It can provide insights to advisors, and enhance site-specific interpretation of recommendations when driven by spatial data. Model-based ‘discussion support systems’ contribute to learning and farmer–researcher dialogue. Integrated climate–crop modelling may play a genuine, but limited role in efforts to support climate risk management in agriculture, but only if they are used appropriately, with understanding of their capabilities and limitations, and with cautious evaluation of model predictions and of the insights that arises from model-based decision analysis. PMID:16433092

  14. Structural Damage Prediction and Analysis for Hypervelocity Impact

    NASA Technical Reports Server (NTRS)

    Elfer, Norman

    1995-01-01

    It is necessary to integrate a wide variety of technical disciplines to provide an analysis of structural damage to a spacecraft due to hypervelocity impact. There are many uncertainties, and more detailed investigation is warranted, in each technical discipline. However, a total picture of the debris and meteoroid hazard is required to support manned spaceflight in general, and the international Space Station in particular. In the performance of this contract, besides producing a handbook, research and development was conducted in several different areas. The contract was broken into six separate tasks. Each task objectives and accomplishments will be reviewed in the following sections. The Handbook and separate task reports are contained as attachments to the final report. The final section summarizes all of the recommendations coming out of this study. The analyses and comments are general design guidelines and not necessarily applicable to final Space Station designs since several configuration and detailed design changes were being made during the course of this contract. Rather, the analyses and comments may indicate either a point-in-time concept analysis, available test data, or desirable protection goals, not hindered by the design and operation constraints faced by Space Station designers.

  15. A Guided Ultrasonic Waves Array for Structural Integrity Monitoring

    SciTech Connect

    Fromme, P.; Wilcox, P.D.; Lowe, M.; Cawley, P.

    2005-04-09

    Constant, long-term monitoring of large plate-like structures, e.g., oil storage tanks, can be performed using permanently attached remote sensors. A guided ultrasonic waves array, consisting of piezoelectric transducer elements for the excitation and reception of the first antisymmetric Lamb wave mode A0, has been designed and built. Laboratory measurements for a steel plate containing various defects have been performed. The results are compared to theoretical predictions and the sensitivity of the array device for defect detection is ascertained.

  16. The hierarchical structure of common mental disorders: Connecting multiple levels of comorbidity, bifactor models, and predictive validity.

    PubMed

    Kim, Hyunsik; Eaton, Nicholas R

    2015-11-01

    Studies of mental disorder comorbidity have produced an unsynthesized literature with multiple competing transdiagnostic models. The current study attempted to (a) integrate these models into an overarching comorbidity hierarchy, (b) link the resulting transdiagnostic factors to the bifactor model of psychopathology, and (c) investigate predictive validity of transdiagnostic factors for important future outcomes. A series of exploratory structural equation models (ESEMs) was conducted on 12 common mental disorders from a large, 2-wave nationally representative sample, using the bass-ackwards method to explore the hierarchical structure of transdiagnostic comorbidity factors. These Wave 1 factors were then linked with the bifactor model and with mental disorders at Wave 2. Results indicated that common mental disorder comorbidity was structured into an interpretable hierarchy. Connections between the hierarchy's general factor of psychopathology (denoted p), internalizing, and distress were very strong; these factors also linked strongly with the bifactor model's p factor. Predictive validity analyses prospectively predicting subsequent diagnoses indicated that, overall: (a) transdiagnostic factors outperformed disorder-specific variance; (b) within hierarchy levels, transdiagnostic factors where disorders optimally loaded outperformed other transdiagnostic factors, but this differed by disorder type; and (c) between hierarchy levels, transdiagnostic factors where disorders optimally loaded showed similar predictive validity. We discuss implications for hierarchical structure modeling, the integration of multiple competing comorbidity models, and benefits of transdiagnostic factors for understanding the continuity of mental disorders over time.

  17. Prediction of Silicon-Based Layered Structures for Optoelectronic Applications

    NASA Astrophysics Data System (ADS)

    Luo, Wei; Ma, Yanming; Gong, Xingao; Xiang, Hongjun; CCMG Team

    2015-03-01

    A method based on the particle swarm optimization (PSO) algorithm is presented to design quasi-two-dimensional (Q2D) materials. With this development, various single-layer and bi-layer materials in C, Si, Ge, Sn, and Pb were predicted. A new Si bi-layer structure is found to have a much-favored energy than the previously widely accepted configuration. Both single-layer and bi-layer Si materials have small band gaps, limiting their usages in optoelectronic applications. Hydrogenation has therefore been used to tune the electronic and optical properties of Si layers. We discover two hydrogenated materials of layered Si8H2andSi6H2 possessing quasi-direct band gaps of 0.75 eV and 1.59 eV, respectively. Their potential applications for light emitting diode and photovoltaics are proposed and discussed. Our study opened up the possibility of hydrogenated Si layered materials as next-generation optoelectronic devices.

  18. Detecting and representing predictable structure during auditory scene analysis

    PubMed Central

    Sohoglu, Ediz; Chait, Maria

    2016-01-01

    We use psychophysics and MEG to test how sensitivity to input statistics facilitates auditory-scene-analysis (ASA). Human subjects listened to ‘scenes’ comprised of concurrent tone-pip streams (sources). On occasional trials a new source appeared partway. Listeners were more accurate and quicker to detect source appearance in scenes comprised of temporally-regular (REG), rather than random (RAND), sources. MEG in passive listeners and those actively detecting appearance events revealed increased sustained activity in auditory and parietal cortex in REG relative to RAND scenes, emerging ~400 ms of scene-onset. Over and above this, appearance in REG scenes was associated with increased responses relative to RAND scenes. The effect of temporal structure on appearance-evoked responses was delayed when listeners were focused on the scenes relative to when listening passively, consistent with the notion that attention reduces ‘surprise’. Overall, the results implicate a mechanism that tracks predictability of multiple concurrent sources to facilitate active and passive ASA. DOI: http://dx.doi.org/10.7554/eLife.19113.001 PMID:27602577

  19. Prediction of a structural transition in the hard disk fluid.

    PubMed

    Piasecki, Jarosław; Szymczak, Piotr; Kozak, John J

    2010-10-28

    Starting from the second equilibrium equation in the BBGKY hierarchy under the Kirkwood superposition closure, we implement a new method for studying the asymptotic decay of correlations in the hard disk fluid in the high density regime. From our analysis and complementary numerical studies, we find that exponentially damped oscillations can occur only up to a packing fraction η(∗)∼0.718, a value that is in substantial agreement with the packing fraction, η∼0.723, believed to characterize the transition from the ordered solid phase to a dense fluid phase, as inferred from Mak's Monte Carlo simulations [Phys. Rev. E 73, 065104 (2006)]. Next, we show that the same method of analysis predicts that the exponential damping of oscillations in the hard sphere fluid becomes impossible when λ=4nπσ(3)[1+H(1)]≥34.81, where H(1) is the contact value of the correlation function, n is the number density, and σ is the sphere diameter in exact agreement with the condition, λ≥34.8, which is first reported in a numerical study of the Kirkwood equation by Kirkwood et al. [J. Chem. Phys. 18, 1040 (1950)]. Finally, we show that our method confirms the absence of any structural transition in hard rods for the entire range of densities below close packing.

  20. Predictive modeling of pedestal structure in KSTAR using EPED model

    NASA Astrophysics Data System (ADS)

    Han, Hyunsun; Kwon, Ohjin; Kim, J. Y.

    2013-10-01

    A predictive calculation is given for the structure of edge pedestal in the H-mode plasma of the KSTAR (Korea Superconducting Tokamak Advanced Research) device using the EPED model. Particularly, the dependence of pedestal width and height on various plasma parameters is studied in detail. The two codes, ELITE and HELENA, are utilized for the stability analysis of the peeling-ballooning and kinetic ballooning modes, respectively. Summarizing the main results, the pedestal slope and height have a strong dependence on plasma current, rapidly increasing with it, while the pedestal width is almost independent of it. The plasma density or collisionality gives initially a mild stabilization, increasing the pedestal slope and height, but above some threshold value its effect turns to a destabilization, reducing the pedestal width and height. Among several plasma shape parameters, the triangularity gives the most dominant effect, rapidly increasing the pedestal width and height, while the effect of elongation and squareness appears to be relatively weak. Implication of these edge results, particularly in relation to the global plasma performance, is discussed.

  1. Predictive modeling of pedestal structure in KSTAR using EPED model

    SciTech Connect

    Han, Hyunsun; Kim, J. Y.; Kwon, Ohjin

    2013-10-15

    A predictive calculation is given for the structure of edge pedestal in the H-mode plasma of the KSTAR (Korea Superconducting Tokamak Advanced Research) device using the EPED model. Particularly, the dependence of pedestal width and height on various plasma parameters is studied in detail. The two codes, ELITE and HELENA, are utilized for the stability analysis of the peeling-ballooning and kinetic ballooning modes, respectively. Summarizing the main results, the pedestal slope and height have a strong dependence on plasma current, rapidly increasing with it, while the pedestal width is almost independent of it. The plasma density or collisionality gives initially a mild stabilization, increasing the pedestal slope and height, but above some threshold value its effect turns to a destabilization, reducing the pedestal width and height. Among several plasma shape parameters, the triangularity gives the most dominant effect, rapidly increasing the pedestal width and height, while the effect of elongation and squareness appears to be relatively weak. Implication of these edge results, particularly in relation to the global plasma performance, is discussed.

  2. ESB-Based Sensor Web Integration for the Prediction of Electric Power Supply System Vulnerability

    PubMed Central

    Stoimenov, Leonid; Bogdanovic, Milos; Bogdanovic-Dinic, Sanja

    2013-01-01

    Electric power supply companies increasingly rely on enterprise IT systems to provide them with a comprehensive view of the state of the distribution network. Within a utility-wide network, enterprise IT systems collect data from various metering devices. Such data can be effectively used for the prediction of power supply network vulnerability. The purpose of this paper is to present the Enterprise Service Bus (ESB)-based Sensor Web integration solution that we have developed with the purpose of enabling prediction of power supply network vulnerability, in terms of a prediction of defect probability for a particular network element. We will give an example of its usage and demonstrate our vulnerability prediction model on data collected from two different power supply companies. The proposed solution is an extension of the GinisSense Sensor Web-based architecture for collecting, processing, analyzing, decision making and alerting based on the data received from heterogeneous data sources. In this case, GinisSense has been upgraded to be capable of operating in an ESB environment and combine Sensor Web and GIS technologies to enable prediction of electric power supply system vulnerability. Aside from electrical values, the proposed solution gathers ambient values from additional sensors installed in the existing power supply network infrastructure. GinisSense aggregates gathered data according to an adapted Omnibus data fusion model and applies decision-making logic on the aggregated data. Detected vulnerabilities are visualized to end-users through means of a specialized Web GIS application. PMID:23955435

  3. ESB-based Sensor Web integration for the prediction of electric power supply system vulnerability.

    PubMed

    Stoimenov, Leonid; Bogdanovic, Milos; Bogdanovic-Dinic, Sanja

    2013-08-15

    Electric power supply companies increasingly rely on enterprise IT systems to provide them with a comprehensive view of the state of the distribution network. Within a utility-wide network, enterprise IT systems collect data from various metering devices. Such data can be effectively used for the prediction of power supply network vulnerability. The purpose of this paper is to present the Enterprise Service Bus (ESB)-based Sensor Web integration solution that we have developed with the purpose of enabling prediction of power supply network vulnerability, in terms of a prediction of defect probability for a particular network element. We will give an example of its usage and demonstrate our vulnerability prediction model on data collected from two different power supply companies. The proposed solution is an extension of the GinisSense Sensor Web-based architecture for collecting, processing, analyzing, decision making and alerting based on the data received from heterogeneous data sources. In this case, GinisSense has been upgraded to be capable of operating in an ESB environment and combine Sensor Web and GIS technologies to enable prediction of electric power supply system vulnerability. Aside from electrical values, the proposed solution gathers ambient values from additional sensors installed in the existing power supply network infrastructure. GinisSense aggregates gathered data according to an adapted Omnibus data fusion model and applies decision-making logic on the aggregated data. Detected vulnerabilities are visualized to end-users through means of a specialized Web GIS application.

  4. The integration of ground investigations and radar images on rice yield prediction

    NASA Astrophysics Data System (ADS)

    Syu, Chien-Hui; Lo, Wei-Shen; Guo, Horng-Yuh

    2016-04-01

    Rice is the staple food and the largest crop in terms of area in Taiwan. Developing the real-time and accurate methods to predict rice yield of large area is important for food security. However, due to the size of rice fields is small and fragmented, and the disturbed weather in Taiwan. It difficult to acquire the information of cropping area and rice yield by optical satellite data, such as SPOT and FORMOSAT-2, because of the cloud cover commonly observed in the region. In contrast, the RADARSAT image data can overcome such problems due to which can penetrate through cloud. The aim of this study is to integrate the data of ground investigations and radar images to predict the rice yield of large area. We used the data of rice yield (ground investigation) and radar images to do regression analysis, and then predict the rice yield of large area. The results of ground investigation indicated that there were high correlation between sample sites yield and real harvest yield (R2 = 0.99), it reveals the investigating method has a high representativeness. The results of the prediction of rice yield by multi-temporal radar images indicated that there was high correlation between ground trust and yield estimation (R2 = 0.68, proof data, 6 fields), and the yield estimation accuracy is higher than 85%. Therefore, this study suggests the application of multi-temporal radar image data can effective and accurate to predict the paddy rice yield in Taiwan.

  5. Airborne Transducer Integrity under Operational Environment for Structural Health Monitoring.

    PubMed

    Salmanpour, Mohammad Saleh; Sharif Khodaei, Zahra; Aliabadi, Mohammad Hossein

    2016-12-12

    This paper investigates the robustness of permanently mounted transducers used in airborne structural health monitoring systems, when exposed to the operational environment. Typical airliners operate in a range of conditions, hence, structural health monitoring (SHM) transducer robustness and integrity must be demonstrated for these environments. A set of extreme temperature, altitude and vibration environment test profiles are developed using the existing Radio Technical Commission for Aeronautics (RTCA)/DO-160 test methods. Commercially available transducers and manufactured versions bonded to carbon fibre reinforced polymer (CFRP) composite materials are tested. It was found that the DuraAct transducer is robust to environmental conditions tested, while the other transducer types degrade under the same conditions.

  6. Integrated Thermal Protection Systems and Heat Resistant Structures

    NASA Technical Reports Server (NTRS)

    Pichon, Thierry; Lacoste, Marc; Glass, David E.

    2006-01-01

    In the early stages of NASA's Exploration Initiative, Snecma Propulsion Solide was funded under the Exploration Systems Research & Technology program to develop integrated thermal protection systems and heat resistant structures for reentry vehicles. Due to changes within NASA's Exploration Initiative, this task was cancelled early. This presentation provides an overview of the work that was accomplished prior to cancellation. The Snecma team chose an Apollo-type capsule as the reference vehicle for the work. They began with the design of a ceramic aft heatshield (CAS) utilizing C/SiC panels as the capsule heatshield, a C/SiC deployable decelerator and several ablators. They additionally developed a health monitoring system, high temperature structures testing, and the insulation characterization. Though the task was pre-maturely cancelled, a significant quantity of work was accomplished.

  7. Interfacing modules for integrating discipline specific structural mechanics codes

    NASA Technical Reports Server (NTRS)

    Endres, Ned M.

    1989-01-01

    An outline of the organization and capabilities of the Engine Structures Computational Simulator (Simulator) at NASA Lewis Research Center is given. One of the goals of the research at Lewis is to integrate various discipline specific structural mechanics codes into a software system which can be brought to bear effectively on a wide range of engineering problems. This system must possess the qualities of being effective and efficient while still remaining user friendly. The simulator was initially designed for the finite element simulation of gas jet engine components. Currently, the simulator has been restricted to only the analysis of high pressure turbine blades and the accompanying rotor assembly, although the current installation can be expanded for other applications. The simulator presently assists the user throughout its procedures by performing information management tasks, executing external support tasks, organizing analysis modules and executing these modules in the user defined order while maintaining processing continuity.

  8. Airborne Transducer Integrity under Operational Environment for Structural Health Monitoring

    PubMed Central

    Salmanpour, Mohammad Saleh; Sharif Khodaei, Zahra; Aliabadi, Mohammad Hossein

    2016-01-01

    This paper investigates the robustness of permanently mounted transducers used in airborne structural health monitoring systems, when exposed to the operational environment. Typical airliners operate in a range of conditions, hence, structural health monitoring (SHM) transducer robustness and integrity must be demonstrated for these environments. A set of extreme temperature, altitude and vibration environment test profiles are developed using the existing Radio Technical Commission for Aeronautics (RTCA)/DO-160 test methods. Commercially available transducers and manufactured versions bonded to carbon fibre reinforced polymer (CFRP) composite materials are tested. It was found that the DuraAct transducer is robust to environmental conditions tested, while the other transducer types degrade under the same conditions. PMID:27973450

  9. Integrated aerodynamic-structural design of a transport wing

    NASA Technical Reports Server (NTRS)

    Grossman, B.; Haftka, R. T.; Kao, P.-J.; Polen, D. M.; Rais-Rohani, M.; Sobieszczanski-Sobieski, J.

    1989-01-01

    The integrated aerodynamic-structural design of a subsonic transport wing for minimum weight subject to required range is formulated and solved. The problem requires large computational resources, and two methods are used to alleviate the computational burden. First, a modular sensitivity method that permits the usage of black-box disciplinary software packages, is used to reduce the cost of sensitivity derivatives. In particular, it is shown that derivatives of the aeroelastic response and divergence speed can be calculated without the costly computation of derivatives of aerodynamic influence coefficient and structural stiffness matrices. A sequential approximate optimization is used to further reduce computational cost. The optimization procedure is shown to require a relatively small number of analysis and sensitivity calculations.

  10. Integrated mechanics for the passive damping of polymer-matrix composites and composite structures

    NASA Technical Reports Server (NTRS)

    Saravanos, D. A.; Chamis, Christos C.

    1991-01-01

    Some recent developments on integrated damping mechanics for unidirectional composites, laminates, and composite structures are reviewed. Simplified damping micromechanics relate the damping of on-axis and off-axis composites to constituent properties, fiber volume ratio, fiber orientation, temperature, and moisture. Laminate and structural damping mechanics for thin composites are summarized. Discrete layer damping mechanics for thick laminates, including the effects of interlaminar shear damping, are developed and semianalytical predictions of modal damping in thick simply supported specialty composite plates are presented. Applications show the advantages of the unified mechanics, and illustrate the effect of fiber volume ratio, fiber orientation, structural geometry, and temperature on the damping. Additional damping properties for composite plates of various laminations, aspect ratios, fiber content, and temperature illustrate the merits and ranges of applicability of each theory (thin or thick laminates).

  11. FKBP5 Genotype and Structural Integrity of the Posterior Cingulum

    PubMed Central

    Fani, Negar; King, Tricia Z; Reiser, Emily; Binder, Elisabeth B; Jovanovic, Tanja; Bradley, Bekh; Ressler, Kerry J

    2014-01-01

    Alterations in the microarchitecture of the posterior cingulum (PC), a white matter tract proximal to the hippocampus that facilitates communication between the entorhinal and cingulate cortices, have been observed in individuals with psychiatric disorders, such as depression and post-traumatic stress disorder (PTSD). PC decrements may be a heritable source of vulnerability for the development of affective disorders; however, genetic substrates for these white matter abnormalities have not been identified. The FKBP5 gene product modulates glucocorticoid receptor function and has been previously associated with differential hippocampal structure, function, and affect disorder risk. Thus, FKBP5 is an attractive genetic target for investigations of PC integrity. We examined associations between PC integrity, measured through diffusion tensor imaging (DTI) and fractional anisotropy (FA; an index of white matter integrity), and polymorphisms in the FKBP5 SNP rs1360780 in a sample of 82 traumatized female civilians. Findings indicated that, compared with individuals without this allele, individuals who carried two ‘risk' alleles for this FKBP5 SNP (T allele; previously associated with mood and anxiety disorder risk) demonstrated significantly lower FA in the left PC, even after statistically controlling for variance associated with age, trauma exposure, and PTSD symptoms. These data suggest that specific allelic variants for an FKBP5 polymorphism are associated with decrements in the left PC microarchitecture. These white matter abnormalities may be a heritable biological marker that indicates increased vulnerability for the development of psychiatric disorders, such as PTSD. PMID:24253961

  12. ERP evidence for memory and predictive mechanisms in word-to-text integration

    PubMed Central

    Stafura, Joseph Z.; Rickles, Benjamin; Perfetti, Charles A.

    2016-01-01

    During reading, word-to-text integration processes proceed quickly and incrementally through both prospective (predictive) and retrospective (memory) processes. Across a sentence boundary, where prediction may be less functional, memorial processes may be especially important. We tested predictive and memory mechanisms with event-related potentials (ERPs) recorded on the first content word across a sentence boundary by manipulating the direction of association between this word and one from the preceding sentence. For comparison with this text comprehension (TC) task, we tested these same word pairs in a word meaning judgment (MJ) task. In both tasks we found reduced N400 amplitudes over central scalp electrodes when the two words were either forward-associated (FA) or backward-associated (BA), relative to task-specific baseline conditions. In the MJ task, FA pairs produced a greater reduction in the N400 reduction than BA pairs over right parietal areas. However, in the TC task, BA pairs produced a greater N400 reduction than FA pairs over left parietal electrodes. A temporal principal component analysis of TC and MJ data showed a component reflecting the central N400. Additional components from TC data reflected FA-BA differences during early (N200) and late (parietal N400 and LPC) phases of processing. Comprehension skill predicted association effects in the MJ task, especially FA, and the BA central N400 effects in the TC task. The results demonstrate that, beyond N400 indicators of prediction effects, ERPs reflect the role of memory processes in word-to-text integration across sentences, part of a dynamic interplay between anticipatory and memorial processes that support comprehension. PMID:27110578

  13. Integration of preclinical and clinical knowledge to predict intravenous PK in human: bilastine case study.

    PubMed

    Vozmediano, Valvanera; Ortega, Ignacio; Lukas, John C; Gonzalo, Ana; Rodriguez, Monica; Lucero, Maria Luisa

    2014-03-01

    Modern pharmacometrics can integrate and leverage all prior proprietary and public knowledge. Such methods can be used to scale across species or comparators, perform clinical trial simulation across alternative designs, confirm hypothesis and potentially reduce development burden, time and costs. Crucial yet typically lacking in integration is the pre-clinical stage. Prediction of PK in man, using in vitro and in vivo studies in different animal species, is increasingly well theorized but could still find wider application in drug development. The aim of the present work was to explore methods for bridging pharmacokinetic knowledge from animal species (i.v. and p.o.) and man (p.o.) into i.v. in man using the antihistamine drug bilastine as example. A model, predictive of i.v. PK in man, was developed on data from two pre-clinical species (rat and dog) and p.o. in man bilastine trials performed earlier. In the knowledge application stage, two different approaches were used to predict human plasma concentration after i.v. of bilastine: allometry (several scaling methods) and a semi-physiological method. Both approaches led to successful predictions of key i.v. PK parameters of bilastine in man. The predictive i.v. PK model was validated using later data from a clinical study of i.v. bilastine. Introduction of such knowledge in development permits proper leveraging of all emergent knowledge as well as quantification-based exploration of PK scenario, e.g. in special populations (pediatrics, renal insufficiency, comedication). In addition, the methods permit reduction or elimination and certainly optimization of learning trials, particularly those concerning alternative off-label administration routes.

  14. STRUCTURE-BASED PREDICTIVE MODEL FOR COAL CHAR COMBUSTION

    SciTech Connect

    CHRISTOPHER M. HADAD; JOSEPH M. CALO; ROBERT H. ESSENHIGH; ROBERT H. HURT

    1998-06-04

    During the past quarter of this project, significant progress continued was made on both major technical tasks. Progress was made at OSU on advancing the application of computational chemistry to oxidative attack on model polyaromatic hydrocarbons (PAHs) and graphitic structures. This work is directed at the application of quantitative ab initio molecular orbital theory to address the decomposition products and mechanisms of coal char reactivity. Previously, it was shown that the �hybrid� B3LYP method can be used to provide quantitative information concerning the stability of the corresponding radicals that arise by hydrogen atom abstraction from monocyclic aromatic rings. In the most recent quarter, these approaches have been extended to larger carbocyclic ring systems, such as coronene, in order to compare the properties of a large carbonaceous PAH to that of the smaller, monocyclic aromatic systems. It was concluded that, at least for bond dissociation energy considerations, the properties of the large PAHs can be modeled reasonably well by smaller systems. In addition to the preceding work, investigations were initiated on the interaction of selected radicals in the �radical pool� with the different types of aromatic structures. In particular, the different pathways for addition vs. abstraction to benzene and furan by H and OH radicals were examined. Thus far, the addition channel appears to be significantly favored over abstraction on both kinetic and thermochemical grounds. Experimental work at Brown University in support of the development of predictive