First report of Schistocephalus sp. (Cestoda: Pseudophyllidea) in slimy sculpin, Cottus cognatus Richardson, 1836, from Lake Michigan, U.S.A.

USGS Publications Warehouse

French, J. R. P.; Muzzall, P.M.

2008-01-01

Plerocercoids of Schistocephalus sp. (Diphyllobothriidae) were found in the body cavities of 2 (0.9%) of 209 slimy sculpins, Cottus cognatus, collected in September 2003 from Lake Michigan, south of Manistique, Michigan, U.S.A. Mean intensity was 1. The mean lengths and weights of these 2 thawed, relaxed plerocercoids were 67 and 72 mm and 427 and 554 mg, respectively. The number of segments in each plerocercoid was 113, and both plerocercoids showed upturned edges of the first segment. The identification of these plerocercoids to species is discussed, and the occurrence of Schistocephalus sp. in fish from the Great Lakes is summarized. This is the first report of Schistocephalus in slimy sculpin from Lake Michigan and the second report of Schistocephalus infecting fish from this lake.

Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius).

PubMed

Conlon, J M; Schmidt, W E; Gallwitz, B; Falkmer, S; Thim, L

1986-12-30

The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.

Sensitivity of mottled sculpins (Cottus bairdi) and rainbow trout (Onchorhynchus mykiss) to acute and chronic toxicity of cadmium, copper, and zinc

USGS Publications Warehouse

Besser, John M.; Mebane, Christopher A.; Mount, David R.; Ivey, Chris D.; Kunz, James L.; Greer, I. Eugene; May, Thomas W.; Ingersoll, Christopher G.

2007-01-01

Studies of fish communities of streams draining mining areas suggest that sculpins (Cottus spp.) may be more sensitive than salmonids to adverse effects of metals. We compared the toxicity of zinc, copper, and cadmium to mottled sculpin (C. bairdi) and rainbow trout (Onchorhynchus mykiss) in laboratory toxicity tests. Acute (96-h) and early life-stage chronic (21- or 28-d) toxicity tests were conducted with rainbow trout and with mottled sculpins from populations in Minnesota and Missouri, USA, in diluted well water (hardness = 100 mg/L as CaCO3). Acute and chronic toxicity of metals to newly hatched and swim-up stages of mottled sculpins differed between the two source populations. Differences between populations were greatest for copper, with chronic toxicity values (ChV = geometric mean of lowest-observed-effect concentration and no-observed-effect concentration) of 4.4 μg/L for Missouri sculpins and 37 μg/L for Minnesota sculpins. Cadmium toxicity followed a similar trend, but differences between sculpin populations were less marked, with ChVs of 1.1 μg/L (Missouri) and 1.9 μg/L (Minnesota). Conversely, zinc was more toxic to Minnesota sculpins (ChV = 75 μg/L) than Missouri sculpins (chronic ChV = 219 μg/L). Species-average acute and chronic toxicity values for mottled sculpins were similar to or lower than those for rainbow trout and indicated that mottled sculpins were among the most sensitive aquatic species to toxicity of all three metals. Our results indicate that current acute and chronic water quality criteria for cadmium, copper, and zinc adequately protect rainbow trout but may not adequately protect some populations of mottled sculpins. Proposed water quality criteria for copper based on the biotic ligand model would be protective of both sculpin populations tested.

Sensitivity of mottled sculpins (Cottus bairdi) and rainbow trout (Onchorhynchus mykiss) to acute and chronic toxicity of cadmium, copper, and zinc

USGS Publications Warehouse

Besser, J.M.; Mebane, C.A.; Mount, D.R.; Ivey, C.D.; Kunz, J.L.; Greer, I.E.; May, T.W.; Ingersoll, C.G.

2007-01-01

Studies of fish communities of streams draining mining areas suggest that sculpins (Cottus spp.) may be more sensitive than salmonids to adverse effects of metals. We compared the toxicity of zinc, copper, and cadmium to mottled sculpin (C. bairdi) and rainbow trout (Onchorhynchus mykiss) in laboratory toxicity tests. Acute (96-h) and early life-stage chronic (21- or 28-d) toxicity tests were conducted with rainbow trout and with mottled sculpins from populations in Minnesota and Missouri, USA, in diluted well water (hardness = 100 mg/L as CaCO3). Acute and chronic toxicity of metals to newly hatched and swim-up stages of mottled sculpins differed between the two source populations. Differences between populations were greatest for copper, with chronic toxicity values (ChV = geometric mean of lowest-observed-effect concentration and no-observed-effect concentration) of 4.4 ??g/L for Missouri sculpins and 37 ??g/L for Minnesota sculpins. Cadmium toxicity followed a similar trend, but differences between sculpin populations were less marked, with ChVs of 1.1 ??g/L (Missouri) and 1.9 ??g/L (Minnesota). Conversely, zinc was more toxic to Minnesota sculpins (ChV = 75 ??g/L) than Missouri sculpins (chronic ChV = 219 ??g/L). Species-average acute and chronic toxicity values for mottled sculpins were similar to or lower than those for rainbow trout and indicated that mottled sculpins were among the most sensitive aquatic species to toxicity of all three metals. Our results indicate that current acute and chronic water quality criteria for cadmium, copper, and zinc adequately protect rainbow trout but may not adequately protect some populations of mottled sculpins. Proposed water quality criteria for copper based on the biotic ligand model would be protective of both sculpin populations tested. ?? 2007 SETAC.

Dermocystidium sp. infection in Blue Ridge Sculpin captured in Maryland

USGS Publications Warehouse

Blazer, Vicki S.; Hitt, Nathaniel P.; Snyder, Craig D.; Snook, Erin; Adams, Cynthia

2016-01-01

Raised pale cysts were observed on Blue Ridge Sculpin Cottus caeruleomentum during stream fish community surveys in Catoctin Mountain Park, Maryland. When examined histologically, preserved sculpin exhibited multiple cysts containing spherical endospores with a refractile central body characteristic of Dermocystidiumspp. Cysts were not observed on the gills or internally. The portion of the watershed in which affected sculpin were observed contained lower than expected numbers of sculpin, raising concerns about the population effects of this infection. A nearby stream lacked sculpin even though they are common in this region, further suggesting the possibility of regional effects. This is the first report of a Dermocystidium infecting any fish species in the eastern United States.

Acanthocephalan parasites of slimy sculpin, Cottus cognatus, and Ninespine Stickleback, Pungitius pungitius, from Lake Michigan, U.S.A.

USGS Publications Warehouse

Muzzall, Patrick M.; Lima, Michael; Gentile, Alex; Gunn, Jacob; Jones, Amanda; Morrison, Jamie; French, John R. P.

2012-01-01

In total, 288 slimy sculpins, Cottus cognatus, were collected in September 2003 from 6 Lake Michigan, U.S.A., ports, along with 220 ninespine sticklebacks, Pungitius pungitius, from 3 ports. The ports included Waukegan, Illinois; Port Washington (PW) and Sturgeon Bay (SB), Wisconsin; and Manistique (MS), Frankfort (FF), Ludington (LD), and Saugatuck, Michigan. Echinorhynchus salmonis infected sculpins from 6 ports, Acanthocephalus dirus infected sculpins from 4 ports, and Neoechinorhynchus pungitius infected sculpins from 3 ports. Echinorhynchus salmonis infected significantly more sculpins at PW and at FF than at MS and LD. There were several significant differences in the intensities and abundances of E. salmonis among ports. Acanthocephalus dirus significantly infected more sculpins and had significantly higher abundances at FF than at PW, MS, and LD. Echinorhynchus salmonis, A. dirus, and N. pungitius infected sticklebacks from SB, MS, and FF. Neoechinorhynchus pungitius significantly infected more sculpins and more sticklebacks, and it had significantly higher abundances at MS than at FF. Neoechinorhynchus pungitius was the most common acanthocephalan in C. cognatus and P. pungitius at MS. These acanthocephalan species infecting C. cognatus and P. pungitius corresponded in their occurrence to those organisms that serve as their intermediate hosts found in the stomachs of both fish species. Potential changes in the diet of C. cognatus played a role in significant differences found for E. salmonis and N. pungitius at MS. One of these acanthocephalan species was always the most numerous helminth species found in the digestive tracts of P. pungitius and C. cognatus from these Lake Michigan ports.

Effects of an introduced piscivorous fish on native benthic fishes in a coastal river

Treesearch

Jason L. White; Bret C. Harvey

2001-01-01

We used field surveys to compare the density and mesohabitat-scale distribution of the native coastrange sculpin (Cottus aleuticus) and the prickly sculpin (C. asper) in coastal rivers in northwestern California, U.S.A., with and without an introduced piscivorous fish, the Sacramento pikeminnow, Ptychocheilus grandis. We also measured mortality of tethered prickly...

Gastric evacuation rate, index of fullness, and daily ration of Lake Michigan slimy sculpin (Cottus cognatus) and deepwater sculpin (Myoxocephalus thompsonii)

USGS Publications Warehouse

Mychek-Londer, Justin G.; Bunnell, David B.

2013-01-01

Accurate estimates of fish consumption are required to understand trophic interactions and facilitate ecosystem-based fishery management. Despite their importance within the food-web, no method currently exists to estimate daily consumption for Great Lakes slimy (Cottus cognatus) and deepwater sculpin (Myoxocephalus thompsonii). We conducted experiments to estimate gastric evacuation (GEVAC) and collected field data from Lake Michigan to estimate index of fullness [(g prey/g fish weight)100%) to determine daily ration for water temperatures ranging 2–5 °C, coinciding with the winter and early spring season. Exponential GEVAC rates equaled 0.0115/h for slimy sculpin and 0.0147/h for deepwater sculpin, and did not vary between 2.7 °C and 5.1 °C for either species or between prey types (Mysis relicta and fish eggs) for slimy sculpin. Index of fullness varied with fish size, and averaged 1.93% and 1.85% for slimy and deepwater sculpins, respectively. Maximum index of fullness was generally higher (except for the smallest sizes) for both species in 2009–2010 than in 1976 despite reductions in a primary prey, Diporeia spp. Predictive daily ration equations were derived as a function of fish dry weight. Estimates of daily consumption ranged from 0.2 to 0.8% of their body weight, which was within the low range of estimates from other species at comparably low water temperatures. These results provide a tool to estimate the consumptive demand of sculpins which will improve our understanding of benthic offshore food webs and aid in management and restoration of these native species in the Great Lakes.

Population dynamics of mottled sculpin (PISCES) in a variable environment: information theoretic approaches

Treesearch

Gary D. Grossman; Robert E Ratajczak; J. Todd Petty; Mark D. Hunter; James T. Peterson; Gael Grenouillet

2006-01-01

We used strong inference with Akaike's Information Criterion (AIC) to assess the processes capable of explaining long-term (1984-1995) variation in the per capita rate of change of mottled sculpin (Cottus bairdi) populations in the Coweeta Creek drainage (USA). We sampled two fourth- and one fifth-order sites (BCA [uppermost], BCB, and CC [lowermost])...

Response of slimy sculpins to predation by juvenile lake trout in southern Lake Ontario

USGS Publications Warehouse

Owens, Randall W.; Bergstedt, Roger A.

1994-01-01

Abundance and biomass of slimy sculpin Cottus cognatus declined in Lake Ontario at depths most frequently occupied by juvenile lake trout Salvelinus namaycush (<70 m), but not at greater depths, during 1980–1987. The abundance of juvenile lake trout increased at depths less than 70 m between 1980 and 1987, and slimy sculpin abundance was negatively correlated with lake trout abundance. The size of slimy sculpins caught at depths less than 70 m decreased between 1980 and 1987, fish 50–99 mm becoming less common and fish 100 mm or longer becoming rare. The size of slimy sculpins at depths greater than 70 m did not change, Because slimy sculpins are the principal fish eaten by juvenile lake trout, and because juvenile lake trout were most abundant at depths where the greatest changes in the slimy sculpin population took place, we conclude that juvenile lake trout in Lake Ontario altered the slimy sculpin population. No significant negative correlations were found between abundance of slimy sculpins and those of the two most abundant fishes in Lake Ontario: Alewife Alosa pseudoharengus and rainbow smeltOsmerus mordax.

Complete Mitochondrial Genomes of the Cherskii's Sculpin Cottus czerskii and Siberian Taimen Hucho taimen Reveal GenBank Entry Errors: Incorrect Species Identification and Recombinant Mitochondrial Genome.

PubMed

Balakirev, Evgeniy S; Saveliev, Pavel A; Ayala, Francisco J

2017-01-01

The complete mitochondrial (mt) genome is sequenced in 2 individuals of the Cherskii's sculpin Cottus czerskii . A surprisingly high level of sequence divergence (10.3%) has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027). At the same time, a surprisingly low level of divergence (1.4%) has been detected between the GenBank C czerskii (KJ956027) and the Amur sculpin Cottus szanaga (KX762049, KX762050). We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii . Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1), bearing 2 introgressed fragments (≈0.9 kb [kilobase]) from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis , submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550). Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information.

Episodic acidification of small streams in the northeastern united states: Effects on fish populations

USGS Publications Warehouse

Baker, J.P.; Van Sickle, J.; Gagen, C.J.; DeWalle, David R.; Sharpe, W.E.; Carline, R.F.; Baldigo, Barry P.; Murdoch, Peter S.; Bath, D.W.; Kretser, W.A.; Simonin, H.A.; Wigington, P.J.

1996-01-01

As part of the Episodic Response Project (ERP), we studied the effects of episodic acidification on fish in 13 small streams in the northeastern United States: four streams in the Adirondack region of New York, four streams in the Catskills, New York, and five streams in the northern Appalachian Plateau, Pennsylvania. In situ bioassays with brook trout (Salvelinus fontinalis) and a forage fish species (blacknose dace (Rhinichthys atratulus], mottled sculpin (Cottus bairdi), or slimy sculpin (Cottus cognatus), depending on the region) measured direct toxicity. Movements of individual brook trout, in relation to stream chemistry, were monitored using radiotelemetry. Electrofishing surveys assessed fish community status and the density and biomass of brook trout in each stream. During low flow, all streams except one had chemical conditions considered suitable for the survival and reproduction of most fish species (median pH 6.0-7.2 during low flow; inorganic Al 100-200 ??g/L. We conclude that episodic acidification can have long-term effects on fish communities in small streams.

A short-term look at potential changes in Lake Michigan slimy sculpin diets

USGS Publications Warehouse

French, John R. P.; Stickel, Richard G.; Stockdale, Beth A.; Black, M. Glen

2010-01-01

Diporeia hoyi and Mysis relicta are the most important prey items of slimy sculpins (Cottus cognatus) in the Great Lakes. Slimy sculpins were collected from dreissenid-infested bottoms off seven Lake Michigan ports at depths of 27–73 m in fall 2003 to study their lake-wide diets. Relatively large dreissenid biomass occurred at depths of 37- and 46-m. Quagga mussels (Dreissena bugnesis) composed at least 50% of dreissenid biomass at Manistique, Saugatuck, and Sturgeon Bay. Mysis accounted for 82% of the sculpin diet by dry weight at eastern Lake Michigan while Diporeia composed 54–69% of the diet at western Lake Michigan and dominated the diets of slimy sculpins at all sites deeper than 46 m. In northern Lake Michigan, this diet study in new sites showed that slimy sculpin consumed more prey with low energy contents, especially chironomids, than Mysis and Diporeia in shallow sites (depth <55 m). We recommend diet studies on sedentary benthic fishes to be conducted along perimeters of the Great Lakes to observe changes in their diets that may be impacted by changing benthic macroinvertebrate communities.

Shifts in the diets of slimy sculpin (Cottus cognatus) and lake whitefish (Coregonus clupeaformis) in Lake Ontario following the collapse of the burrowing amphipod Diporeia

USGS Publications Warehouse

Owens, Randall W.; Dittman, Dawn E.

2003-01-01

In Lake Ontario, the diets of slimy sculpin Cottus cognatus and lake whitefish Coregonus clupeaformis shifted from a diet dominated by the burrowing amphipod, Diporeia, and to a lesser extent, Mysis, to a more diverse diet, after Diporeia collapsed, to one dominated by Mysis and prey that were formerly less important or uncommon such as Chironomidae, Oligochaeta, and Ostracoda. Additionally, lake whitefish still preyed on native mollusks like Sphaeriidae and Gastropoda, but also preyed on exotic mollusks, Dreissena spp., which are swallowed intact and subsequently crushed in its muscular stomach. Whether Diporeia was abundant (1992) or scarce (1999), selection indices for Diporeia by slimy sculpins was positive, suggesting that Diporeia was a preferred prey. Unlike lake whitefish, slimy sculpins avoided Dreissena; therefore, energy diverted to Dreissena production was a real loss for slimy sculpins. The shifts in the diet of these benthic fishes corresponded with drastic changes in the benthic community between 1992 and 1999. The collapse of Diporeia, formerly the most abundant macroinvertebrate in the benthic community, along with sharp declines in the abundance of Oligochaeta and Sphaeriidae, coincided with the establishment and rapid expansion of Dreissena bugensis, the quagga mussel, and to a lesser degree Dreissena polymorpha, the zebra mussel. It appears that the Diporeia population first collapsed at depths >70 m in southeastern Lake Ontario by autumn 1992, at shallower depths in the eastern Lake Ontario by 1995, and along the entire south shore line at depths <100 m, and perhaps in some areas >100 m by 1999. In response to the disappearance of Diporeia, populations of two native benthivores, slimy sculpin and lake whitefish, collapsed in eastern Lake Ontario, perhaps due in part to starvation, because Diporeia was their principal prey. Presently, alternative food resources do not appear sufficient to sustain these two benthivores at their former levels of abundance. We do not expect slimy sculpin and lake whitefish to recover unless Diporeia returns to earlier levels of abundance.

NATIVE AND INTRODUCED LARVAL FISHES IN SUISAN MARSH, CALIFORNIA,: THE EFFECTS OF FRESHWATER FLOW

EPA Science Inventory

We sampled ichthyoplankton weekly in Suisun Marsh in the San Francisco Estuary from February to June each year from 1994 to 1999. We collected approximately 227,900 fish, predominantly shimofuri goby Tridentiger bifasciatus (60%) and prickly sculpin Cottus asper (33%). Principal ...

Development and Application of a Thermistor Current Meter

DTIC Science & Technology

1994-01-01

experiment," Australian Journal of Marine and Freshwater Research 41, 557-573. Burky, A. J., Way, C. M., and Lee, M. T. (1991). "The relationship...relationship of the mottled sculpin , Cottus bairdi, in a central Ohio river," Bulletin of the North American Benthological Society 9, 165. Vogel, S

Adaptive genomic divergence under high gene flow between freshwater and brackish-water ecotypes of prickly sculpin (Cottus asper) revealed by Pool-Seq.

PubMed

Dennenmoser, Stefan; Vamosi, Steven M; Nolte, Arne W; Rogers, Sean M

2017-01-01

Understanding the genomic basis of adaptive divergence in the presence of gene flow remains a major challenge in evolutionary biology. In prickly sculpin (Cottus asper), an abundant euryhaline fish in northwestern North America, high genetic connectivity among brackish-water (estuarine) and freshwater (tributary) habitats of coastal rivers does not preclude the build-up of neutral genetic differentiation and emergence of different life history strategies. Because these two habitats present different osmotic niches, we predicted high genetic differentiation at known teleost candidate genes underlying salinity tolerance and osmoregulation. We applied whole-genome sequencing of pooled DNA samples (Pool-Seq) to explore adaptive divergence between two estuarine and two tributary habitats. Paired-end sequence reads were mapped against genomic contigs of European Cottus, and the gene content of candidate regions was explored based on comparisons with the threespine stickleback genome. Genes showing signals of repeated differentiation among brackish-water and freshwater habitats included functions such as ion transport and structural permeability in freshwater gills, which suggests that local adaptation to different osmotic niches might contribute to genomic divergence among habitats. Overall, the presence of both repeated and unique signatures of differentiation across many loci scattered throughout the genome is consistent with polygenic adaptation from standing genetic variation and locally variable selection pressures in the early stages of life history divergence. © 2016 John Wiley & Sons Ltd.

A narrow hybrid zone between two Cottus species in Wills Creek, Potomac drainage.

PubMed

Kinziger, A P; Raesly, R L

2001-01-01

We describe a narrow hybrid zone between the mottled sculpin (Cottus b. bairdi) and the Blue Ridge sculpin (C. caeruleomentum). Seven characters (dorsal fin rays, pectoral fin rays, caudal base band condition, male spawning coloration, and one frequency and two fixed allozyme differences) distinguish the two taxa in the hybrid zone. C. caeruleomentum and C. b. bairdi diverged in these characters in allopatry as indicated by their distribution on opposite sides of the Atlantic-Ohio divide. However, a stream capture placed these two taxa in secondary contact in Wills Creek, Potomac drainage (Atlantic slope). Allozyme data indicate the presence of post-F(1) hybrids in the zone of secondary contact. Changes in allozymes, morphology, and spawning coloration along a transect in Wills Creek reveal the hybrid zone is less than 20 river kilometers in length. Estimates of root mean square dispersal and gene flow tentatively suggest that selection is operating in the Wills Creek hybrid zone. C. b. bairdi and C. caeruleomentum are maintaining their identity in seven distinguishing characters on opposite ends of the hybrid zone revealing these two taxa are independent evolutionary lineages.

Interspecific interactions between brown trout and slimy sculpin in stream enclosures

USGS Publications Warehouse

Ruetz, C. R.; Hurford, A.L.; Vondracek, B.

2003-01-01

We conducted a 30-d manipulative experiment in Valley Creek, Minnesota, to examine interspecific interactions between juvenile brown trout Salmo trutta and adult slimy sculpin Cottus cognatus. We measured the instantaneous growth of each species in the presence and absence of the other in 1-m2 enclosures. We tested single-species (three slimy sculpins/m2 or three brown trout/m2) and combined-species (three sculpins/m2 and three trout/m2) combinations in each of six riffles. We placed a clay tile in each enclosure to evaluate the effects of fish combinations on benthic macroinvertebrates. Growth of brown trout was unaffected by the presence of slimy sculpins (P = 0.647, power [to detect 50% increase in growth] = 0.92), whereas slimy sculpin growth was less in the presence of brown trout (P = 0.038). Densities of total benthic macroinvertebrates, Chironomidae, Trichoptera, and Physa did not differ among fish combinations (P > 0.3). However, densities of Gammarus pseudolimnaeus were significantly less in the presence of brown trout irrespective of the presence of slimy sculpins (P = 0.024), which could be a causal factor underlying the interaction between brown trout and slimy sculpins. We found asymmetrical competition between brown trout and slimy sculpins in stream enclosures, with brown trout being the superior competitor. Nevertheless, the size of enclosures may have biased our results, making it more likely to detect an effect of brown trout on slimy sculpins than vice versa.

Diel feeding ecology of Slimy Sculpin in a tributary to Skaneateles Lake, New York

USGS Publications Warehouse

Chalupnicki, Marc A.; Johnson, James H.

2016-01-01

Interactions among the benthic community are typically overlooked but play an important role in fish community dynamics. We examined the diel feeding ecology of Slimy Sculpin (Cottus cognatus) from Grout Brook, a tributary to Skaneateles Lake. Of the six time periods examined, Slimy Sculpin consumed the least during the nighttime (2400 h and 0400 h). Chironomids were the major prey consumed during all time periods except for 2400 h when ephemeropterans were the major prey consumed. There was a moderate preference by Slimy Sculpin for food from the benthos (0.59 ± 0.06) with Diptera (Chironomids), Ephemeroptera (Baetidae), and Trichoptera (Brachycentridae) representing the major taxa. Slimy Sculpin appear to be opportunistic feeders selecting what is most available in the brook. Index of fullness was variable and averaged 1.15% across the diel cycle. Daily ration was measured as a function of fish dry body weight and ranged from 0.12 to 0.22. Estimates of daily consumption ranged from 0.007% to 4.0% of body weight, which corresponds to reports for other species. These findings have application in gauging the relative importance of Slimy Sculpin in streams where highly valued salmonid species also occur.

Variation in thermal tolerance and routine metabolism among spring- and stream-dwelling freshwater sculpins (Teleostei: Cottidae) of the southeastern United States

USGS Publications Warehouse

Walsh, S.J.; Haney, D.C.; Timmerman, C.M.

1997-01-01

Evolutionary theory predicts that some aquatic organisms may adapt by directional selection to limiting physical environmental conditions, yet empirical data are conflicting. We sought to test the assumption that sculpins (family Cottidae) inhabiting thermally stable springs of the southeastern United States differ in temperature tolerance and metabolism from populations inhabiting more thermally labile stream habitats. Spring populations of pygmy sculpins (Coitus pygmaeus) and Ozark sculpins (C. hypselurus) differed interspecifically in thermal tolerance from populations of stream-dwelling mottled (C. bairdi) and Tallapoosa sculpins (C. tallapoosae), and both stream and spring populations of banded sculpins (C. carolinae). No intra- or interspecific differences in thermal tolerance were found among populations of C. bairdi, C. tallapoosae, or C. carolinae. Coitus pygmaeus acclimated to 15??C differed intraspecifically in routine metabolism from fish acclimated to 20?? and 25??C. Cottus pygmaeus and stream-dwelling C. bairdi and C. carolinae acclimated to temperatures of 20?? and 25??C showed no interspecific differences in routine metabolism. Our results suggest that some spring-adapted populations or species may be more stenothermal than stream-dwelling congeners, but a greater understanding of the interactions of other physical and biological factors is required to better explain micro- and macrohabitat distributions of eastern North American sculpins.

Complete Mitochondrial Genomes of the Cherskii’s Sculpin Cottus czerskii and Siberian Taimen Hucho taimen Reveal GenBank Entry Errors: Incorrect Species Identification and Recombinant Mitochondrial Genome

PubMed Central

Balakirev, Evgeniy S; Saveliev, Pavel A; Ayala, Francisco J

2017-01-01

The complete mitochondrial (mt) genome is sequenced in 2 individuals of the Cherskii’s sculpin Cottus czerskii. A surprisingly high level of sequence divergence (10.3%) has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027). At the same time, a surprisingly low level of divergence (1.4%) has been detected between the GenBank C czerskii (KJ956027) and the Amur sculpin Cottus szanaga (KX762049, KX762050). We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii. Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1), bearing 2 introgressed fragments (≈0.9 kb [kilobase]) from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis, submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550). Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information. PMID:28890653

Population-level effects of egg predation on a native planktivore in a large freshwater lake

USGS Publications Warehouse

Bunnell, David B.; Mychek-Londer, Justin G.; Madenjian, Charles P.

2014-01-01

Using a 37-year recruitment time series, we uncovered a field pattern revealing a strong, inverse relationship between bloater Coregonus hoyi recruitment success and slimy sculpin Cottus cognatus biomass in Lake Michigan (United States), one of the largest freshwater lakes of the world. Given that slimy sculpins (and deepwater sculpin Myoxocephalus thompsonii) are known egg predators that spatiotemporally overlap with incubating bloater eggs, we used recently published data on sculpin diets and daily ration to model annual bloater egg consumption by sculpins for the 1973–2010 year-classes. Although several strong year-classes were produced in the late 1980s when the proportion of eggs consumed by slimy sculpins was extremely low (i.e., <0.001) and several weak year-classes were produced when the proportion of bloater eggs consumed was at its highest (i.e., >0.10–1.0), egg predation failed to explain why recruitment was weak for the 1995–2005 year-classes when the proportion consumed was also low (i.e., <0.02). We concluded that egg predation by slimy and deepwater sculpins could have limited bloater recruitment in some years, but that some undetermined factor was more important in many other years. Given that slimy sculpin densities are influenced by piscivorous lake trout Salvelinus namaycush, the restoration of which in Lake Michigan has lagged behind those in lakes Superior and Huron, our study highlights the importance of an ecosystem perspective when considering population dynamics of fishes.

Feeding ecology and niche overlap of Lake Ontario offshore forage fish assessed with stable isotopes

USGS Publications Warehouse

Mumby, James; Johson, Timothy; Stewart, Thomas; Halfyard, Edward; Walsh, Maureen; Weidel, Brian C.; Lantry, Jana; Fisk, Aarron

2017-01-01

The forage fish communities of the Laurentian Great Lakes continue to experience changes that have altered ecosystem structure, yet little is known about how they partition resources. Seasonal, spatial and body size variation in δ13C and δ15N was used to assess isotopic niche overlap and resource and habitat partitioning among the five common offshore Lake Ontario forage fish species (n = 2037) [Alewife (Alosa pseudoharengus), Rainbow Smelt (Osmerus mordax), Round Goby (Neogobius melanostomus), and Deepwater (Myoxocephalus thompsonii) and Slimy (Cottus cognatus) Sculpin]. Round Goby had the largest isotopic niche (6.1‰2, standard ellipse area (SEAC)), followed by Alewife (3.4‰2) while Rainbow Smelt, Slimy Sculpin and Deepwater Sculpin had the smallest and similar niche size (1.7-1.8‰2), with only the Sculpin species showing significant isotopic niche overlap (>63%). Stable isotopes in Alewife, Round Goby and Rainbow Smelt varied with location, season and size, but did not in the Sculpin spp. Lake Ontario forage fish species have partitioned food and habitat resources, and non-native Alewife and Round Goby have the largest isotopic niche, suggestive of a boarder ecological niche, and may contribute to their current high abundance.

Demographic characteristics of female mottled sculpin, Cottus bairdi, in the Coweeta Creek drainage, North Carolina

Treesearch

Gary D. Grossman; Kathleen McDaniel; Robert E. Ratajczak

2002-01-01

We quantified: (1) growth rate, (2) length-mass relationships, (3) size- and age-specific fecundity, (4) egg size-frequencies, and (5) size- and age-specific egg diameter relationships for reproductively active female C. bairdi from one of the southern-most extant populations of this species (Coweeta Creek drainage, North Carolina). Gravid females were collected during...

Life history and propagation of the endangered fanshell pearlymussel, Cyprogenia stegaria Rafinesque (Bivalvia: Unionidae)

USGS Publications Warehouse

Jones, J.W.; Neves, R.J.

2002-01-01

Aspects of the reproduction, age, growth, fish hosts, and culture of juveniles were determined for the endangered fanshell pearlymussel, Cyprogenia stegaria Rafinesque, 1820, in the Clinch River, Tennessee. Glochidia of C. stegaria are contained in red, worm-like conglutinates that resemble oligochaetes. Conglutinates are 20 to 80 mm long and are released through the excurrent aperture. Estimated fecundity was 22,357 to 63,459 glochidia/mussel. Eighty-four valves of C. stegaria were thin-sectioned for aging; ages ranged from 6 to 26 y. Of 16 fish species tested, 9 hosts were identified through induced infestations of glochidia: mottled sculpin (Cottus bairdi), banded sculpin (Cottus carolinae), greenside darter (Etheostoma blennioides), snubnose darter (Etheostoma simoterurn), banded darter (Etheostoma zonale), tangerine darter (Percina aurantiaca), blotchside logperch (Percina burtoni), logperch (Percina caprodes), and Roanoke darter (Percina roanoka). Newly metamorphosed juveniles were cultured in recirculating and nonrecirculating aquaculture systems within dishes containing sediments of 300 to 500 ??m diameter (sand) or <105 ??m diameter (silt), and fed either the green algae Neochloris oleoabundans or Scenedesrnus quadricauda daily. Growth and survival of juvenile mussels were highest in the nonrecirculating aquaculture system, with a mean survival of 72% after 2 wk and 38% after 4 wk.

Complex postglacial recolonization inferred from population genetic structure of mottled sculpin Cottus bairdii in tributaries of eastern Lake Michigan, U.S.A.

PubMed

Homola, J J; Ruetz, C R; Kohler, S L; Thum, R A

2016-11-01

This study used analyses of the genetic structure of a non-game fish species, the mottled sculpin Cottus bairdii to hypothesize probable recolonization routes used by cottids and possibly other Laurentian Great Lakes fishes following glacial recession. Based on samples from 16 small streams in five major Lake Michigan, U.S.A., tributary basins, significant interpopulation differentiation was documented (overall F ST = 0·235). Differentiation was complex, however, with unexpectedly high genetic similarity among basins as well as occasionally strong differentiation within basins, despite relatively close geographic proximity of populations. Genetic dissimilarities were identified between eastern and western populations within river basins, with similarities existing between eastern and western populations across basins. Given such patterns, recolonization is hypothesized to have occurred on three occasions from more than one glacial refugium, with a secondary vicariant event resulting from reduction in the water level of ancestral Lake Michigan. By studying the phylogeography of a small, non-game fish species, this study provides insight into recolonization dynamics of the region that could be difficult to infer from game species that are often broadly dispersed by humans. © 2016 The Fisheries Society of the British Isles.

Brown trout and food web interactions in a Minnesota stream

USGS Publications Warehouse

Zimmerman, J.K.H.; Vondracek, B.

2007-01-01

1. We examined indirect, community-level interactions in a stream that contained non-native brown trout (Salmo trutta Linnaeus), native brook trout (Salvelinus fontinalis Mitchill) and native slimy sculpin (Cottus cognatus Richardson). Our objectives were to examine benthic invertebrate composition and prey selection of fishes (measured by total invertebrate dry mass, dry mass of individual invertebrate taxa and relative proportion of invertebrate taxa in the benthos and diet) among treatments (no fish, juvenile brook trout alone, juvenile brown trout alone, sculpin with brook trout and sculpin with brown trout). 2. We assigned treatments to 1 m2 enclosures/exclosures placed in riffles in Valley Creek, Minnesota, and conducted six experimental trials. We used three designs of fish densities (addition of trout to a constant number of sculpin with unequal numbers of trout and sculpin; addition of trout to a constant number of sculpin with equal numbers of trout and sculpin; and replacement of half the sculpin with an equal number of trout) to investigate the relative strength of interspecific versus intraspecific interactions. 3. Presence of fish (all three species, alone or in combined-species treatments) was not associated with changes in total dry mass of benthic invertebrates or shifts in relative abundance of benthic invertebrate taxa, regardless of fish density design. 4. Brook trout and sculpin diets did not change when each species was alone compared with treatments of both species together. Likewise, we did not find evidence for shifts in brown trout or sculpin diets when each species was alone or together. 5. We suggest that native brook trout and non-native brown trout fill similar niches in Valley Creek. We did not find evidence that either species had an effect on stream communities, potentially due to high invertebrate productivity in Valley Creek. ?? 2007 Blackwell Publishing Ltd.

An Ecological Study on the Introduction of the Banded Sculpin Into a Coal Flyash Impacted Stream

DOE Office of Scientific and Technical Information (OSTI.GOV)

Carrico, B.A.; Ryon, M.G.

1996-02-01

A number of banded sculpins [Cottus carolinae (Gill)] were obtained from a population in a reference stream, marked with subcutaneous acrylic paint injections, and introduced into McCoy Branch, a small second-order stream located on the Oak Ridge Reservation in eastern Tennessee, which was inhabited by only a few banded sculpins prior to the study. McCoy Branch had received deposits of coal ash slurry for a prolonged period, however, there were some indications of recovery in the macroinvertebrate community due to improvements in water quality. Stream habitat characteristics and water chemistry parameters were monitored in McCoy Branch and a reference streammore » for a three-year period. Feeding patterns and reproductive activities of the banded sculpins were also monitored during the study. Sculpin population parameters including density, condition factor, and young-of-year (YOY) abundance and survival were studied. The results of the study show that the introduced fish have survived and appear to be in good condition. The sculpins have maintained a density of approximately 0.12 fish per square meter of stream, a figure similar to that found in other headwater streams located in the region. Colonization rates and sculpin densities in McCoy Branch were lower than expected, perhaps due to physical habitat degradation and reduced macroinvertebrate abundance. Evidence of sculpin reproduction in McCoy Branch was seen in the presence of gravid female sculpins (1994 and 1995) and YOY fish (1993 through 1995 year classes). This study indicates that McCoy Branch continues to recover from past perturbations to the point where it can now support a viable population of banded sculpins.« less

Lake Ontario benthic prey fish assessment, 2015

USGS Publications Warehouse

Weidel, Brian C.; Walsh, Maureen; Holden, Jeremy P.; Connerton, Michael J.

2016-01-01

Benthic prey fishes are a critical component of the Lake Ontario food web, serving as energy vectors from benthic invertebrates to native and introduced piscivores. Since the late 1970’s, Lake Ontario benthic prey fish status was primarily assessed using bottom trawl observations confined to the lake’s south shore, in waters from 8 – 150 m (26 – 492 ft). In 2015, the Benthic Prey Fish Survey was cooperatively adjusted and expanded to address resource management information needs including lake-wide benthic prey fish population dynamics. Effort increased from 55 bottom trawl sites to 135 trawl sites collected in depths from 8 - 225m (26 – 738 ft). The spatial coverage of sampling was also expanded and occurred in all major lake basins. The resulting distribution of tow depths more closely matched the available lake depth distribution. The additional effort illustrated how previous surveys were underestimating lake-wide Deepwater Sculpin, Myoxocephalus thompsonii, abundance by not sampling in areas of highest density. We also found species richness was greater in the new sampling sites relative to the historic sites with 11 new fish species caught in the new sites including juvenile Round Whitefish, Prosopium cylindraceum, and Mottled sculpin, Cottus bairdii. Species-specific assessments found Slimy Sculpin, Cottus cognatus abundance increased slightly in 2015 relative to 2014, while Deepwater Sculpin and Round Goby, Neogobius melanostomus, dramatically increased in 2015, relative to 2014. The cooperative, lake-wide Benthic Prey Fish Survey expanded our understanding of benthic fish population dynamics and habitat use in Lake Ontario. This survey’s data and interpretations influence international resource management decision making, such as informing the Deepwater Sculpin conservation status and assessing the balance between sport fish consumption and prey fish populations. Additionally a significant Lake Ontario event occurred in May 2015 when a single juvenile Bloater Coregonus hoyi, was captured during the spring bottom trawl survey at 95m (312 ft) near Oswego, NY. This native, deep-water prey fish, last captured in Lake Ontario survey trawls in 1983, is part of an international, collaborative coregonid restoration effort in the Great Lakes.

Estimating differential reproductive success from nests of related individuals, with application to a study of the Mottled Sculpin, Cottus bairdi

Treesearch

Beatrix Jones; Gary D. Grossman; Daniel C.I. Walsh; Brady A. Porter; John C. Avise; Anthony C. Flumera

2007-01-01

Understanding how variation in reproductive success is related to demography is a critical component in understanding the life history of an organism. Parentage analysis using molecular markers can be used to estimate the reproductive success of different groups of individuals in natural populations. Previous models have been developed for cases where offspring are...

Basin-scale patterns in the drift of embryonic and larval fishes and lamprey ammocoetes in two coastal rivers

Treesearch

Jason L. White; Bret C. Harvey

2003-01-01

We studied the distribution and abundance of drifting embryonic and larval fishes and lampreys in the Smith and Van Duzen rivers of northern California, U.S.A. We collected seven fish species in four families and at least one lamprey species in the drift. All taxa drifted almost exclusively at night. Sculpins, Cottus aleuticus and C. asper...

Comparative swimming and station-holding ability of the threatened Rocky Mountain Sculpin (Cottus sp.) from four hydrologically distinct rivers

PubMed Central

Veillard, Marie F.; Ruppert, Jonathan L.W.; Tierney, Keith; Watkinson, Douglas A.

2017-01-01

Abstract Hydrologic alterations, such as dams, culverts or diversions, can introduce new selection pressures on freshwater fishes, where they are required to adapt to novel environmental conditions. Our study investigated how species adapt to natural and altered stream flow, where we use the threatened Rocky Mountain Sculpin (Cottus sp.) as a model organism. We compared the swimming and station-holding performance of Rocky Mountain Sculpin from four different hydrologic regimes in Alberta and British Columbia, including the North Milk River, a system that experiences increased flows from a large-scale diversion. We measured the slip (Uslip) and failure (Uburst) velocities over three constant acceleration test trials. Uslip was defined as the point at which individuals required the addition of bursting or swimming to maintain position. Uburst was defined as the point at which individuals were unable to hold position in the swimming chamber through swimming, bursting or holding techniques without fully or partially resting on the electrified back plate. We found individuals from the Flathead River in British Columbia (with the highest natural flow) failed at significantly higher Uburst velocities than fish from the southern Albertan populations. However, there was no relationship between peak hydrologic flow from the natal river and Uburst or Uslip. Further, Uburst velocities decreased from 51.8 cm s−1 (7.2 BL s−1) to 45.6 cm s−1 (6.3 BL s−1) by the third consecutive test suggesting the use of anaerobic metabolism. Uslip was not different between trials suggesting the use of aerobic metabolism in station-holding behaviours (Uslip). Moreover, we found no significant differences in individuals from the altered North Milk River system. Finally, individual caudal morphological characteristics were related to both slip and failure velocities. Our study contributes to the conservation of Rocky Mountain Sculpin by providing the first documentation of swimming and station-holding abilities of this benthic fish. PMID:28480038

Comparative swimming and station-holding ability of the threatened Rocky Mountain Sculpin (Cottus sp.) from four hydrologically distinct rivers.

PubMed

Veillard, Marie F; Ruppert, Jonathan L W; Tierney, Keith; Watkinson, Douglas A; Poesch, Mark

2017-01-01

Hydrologic alterations, such as dams, culverts or diversions, can introduce new selection pressures on freshwater fishes, where they are required to adapt to novel environmental conditions. Our study investigated how species adapt to natural and altered stream flow, where we use the threatened Rocky Mountain Sculpin ( Cottus sp.) as a model organism. We compared the swimming and station-holding performance of Rocky Mountain Sculpin from four different hydrologic regimes in Alberta and British Columbia, including the North Milk River, a system that experiences increased flows from a large-scale diversion. We measured the slip ( U slip ) and failure ( U burst ) velocities over three constant acceleration test trials. U slip was defined as the point at which individuals required the addition of bursting or swimming to maintain position. U burst was defined as the point at which individuals were unable to hold position in the swimming chamber through swimming, bursting or holding techniques without fully or partially resting on the electrified back plate. We found individuals from the Flathead River in British Columbia (with the highest natural flow) failed at significantly higher U burst velocities than fish from the southern Albertan populations. However, there was no relationship between peak hydrologic flow from the natal river and U burst or U slip . Further, U burst velocities decreased from 51.8 cm s -1 (7.2 BL s -1 ) to 45.6 cm s -1 (6.3 BL s -1 ) by the third consecutive test suggesting the use of anaerobic metabolism. U slip was not different between trials suggesting the use of aerobic metabolism in station-holding behaviours ( U slip ). Moreover, we found no significant differences in individuals from the altered North Milk River system. Finally, individual caudal morphological characteristics were related to both slip and failure velocities. Our study contributes to the conservation of Rocky Mountain Sculpin by providing the first documentation of swimming and station-holding abilities of this benthic fish.

Diet niches of major forage fish in Lake Michigan

USGS Publications Warehouse

Hunter, R. Douglas; Savino, J.F.; Ogilvie, L.M.; ,

2007-01-01

A large complex of coregonine species historically dominated the fish community of Lake Michigan. The current species complex is simplified with one remaining coregonine, bloater (Coregonus hoyi), deepwater sculpin (Myoxocephalus thompsoni), slimy sculpin (Cottus cognatus), and two dominant invaders, alewife (Alosa pseudoharengus) and rainbow smelt (Osmerus mordax). To better understand the diet relationships of the major offshore forage fishes now in Lake Michigan, diets of bloater, alewife, rainbow smelt, deepwater sculpin, and slimy sculpin were compared. The three sites, chosen to represent northern, central, and southern components of the lake, were sampled during spring, summer, and fall in 1994, and spring and fall in 1995. Forage fishes had diverse and variable diets, with niches differentiated by prey type or location. Diporeia hoyi, Mysis relicta, and zooplankton were the major diet items. The index of relative importance showed benthic (slimy and deepwater sculpins) and pelagic (alewife, rainbow smelt) feeding strategies with opportunistic bloaters incorporating both feeding strategies. Highest diet overlaps were between species of sculpin, and between large and small bloaters; both groups partitioned food by size. Though competition for food may be minimized by spatial segregation of potential competitors, the forage fish in Lake Michigan apparently partition food resources. Fishery management models incorporating food habits of pelagic forage fish would need to take into account diet variation associated with location and season. ?? 2007 E. Schweizerbart'sche Verlagsbuchhandlung.

Using diets to reveal overlap and egg predation among benthivorous fishes in Lake Michigan

USGS Publications Warehouse

Mychek-Londer, Justin G.; Bunnell, David B.; Stott, Wendylee; Diana, James S.; French, John R. P.; Chriscinske, Margret

2013-01-01

Ecological stability in the Laurentian Great Lakes has been altered by nonindigenous species, such as the Round Goby Neogobius melanostomus and dreissenid mussels, and by declines in native amphipods Diporeia spp. We evaluated whether these changes could influence diet overlap between three benthivorous fishes (Slimy Sculpin Cottus cognatus, Deepwater Sculpin Myoxocephalus thompsonii, and Round Goby) and whether predation on eggs of native species was occurring. We examined diets of fish collected at depths of 69–128 m in Lake Michigan offshore of Frankfort and Muskegon, Michigan, and Two Rivers and Sturgeon Bay, Wisconsin, during January–May 2009 and 2010. Important prey (by dry weight proportion and by percent frequency of occurrence) for Slimy Sculpin were Mysis (0.34; 45%), Diporeia (0.16; 34%), and Limnocalanus macrurus (0.22; 68%); important prey for Deepwater Sculpin were Mysis (0.74; 92%) and Diporeia (0.16; 54%). Round Goby consumed mainly bivalves (i.e., dreissenids: 0.68; 95%) and Mysis (0.15; 37%). The two sculpin species consumed the eggs of Bloaters Coregonus hoyi (Slimy Sculpin: 0.04, 11%; Deepwater Sculpin: 0.02, 7%) and the eggs of Deepwater Sculpin (Slimy Sculpin: 0.03, 13%; Deepwater Sculpin: 0.05, 16%) during February–May at all sites. Round Goby also consumed eggs of these species but at lower levels (≤0.01; <1%). Diet overlap was identified between sculpin species at Frankfort and Sturgeon Bay, suggesting possible interspecific competition, but their diets did not overlap at Two Rivers; diet overlap was never observed between Round Goby and either sculpin species. Given that (1) diet overlap varied by site and (2) diet proportions varied spatially more than temporally, benthivores appear to be exhibiting localized responses to recent ecological changes. Overall, these results reveal that egg predation and interspecific competition could be important interactions to consider in future examinations of the population dynamics of these species or in ecosystem models that forecast how fisheries will respond to possible perturbations or management scenarios.

Lake Ontario benthic prey fish assessment, 2014

USGS Publications Warehouse

Weidel, Brian C.; Walsh, Maureen

2015-01-01

Benthic prey fishes are an important component of the Lake Ontario fish community and serve as vectors that move energy from benthic invertebrates into native and introduced sport fishes. Since the 1970’s, the USGS Lake Ontario Biological Station has assessed benthic fish populations and community dynamics with bottom trawls at depths ranging from 8 m out to depths of 150-225 m along the south and eastern shores of Lake Ontario. From the late 1970’s through the early 2000’s the benthic fish community was dominated by Slimy Sculpin Cottus cognatus, but in 2004 non-native Round Goby Neogobius melanostomus abundance increased and, since then Round Goby have generally been the dominant benthic species. Over the past 10 years the native Deepwater Sculpin Myoxocephalus thompsonii, once considered absent from the lake, have increased. Presently their lake-wide biomass density is equal to, or larger than, Slimy Sculpin. Species-specific assessments found Slimy and Deepwater Sculpin abundance increased slightly in 2014 relative to 2013, while changes in Round Goby abundance differed between spring and fall survey. Recent survey modifications have increased our understanding of benthic prey fish abundance and behavior in Lake Ontario. For instance, increasing the maximum tow depth to 225 m in 2014 improved our understanding of Deepwater Sculpin distribution in this rarely sampled lake habitat.

Food of alewives, yellow perch, spottail shiners, trout-perch, and slimy and fourhorn sculpins in southeastern Lake Michigan

USGS Publications Warehouse

Wells, LaRue

1980-01-01

Stomachs of 1,064 alewives (Alosa pseudoharengus), 1,103 yellow perch (Perca flavescens), 246 spottail shiners (Notropis hudsonius), 288 trout-perch (Percopsis omiscomaycus), 454 slimy sculpins (Cottus cognatus), and 562 fourhorn sculpins (Myoxocephalus quadricornis) from Lake Michigan were examined for food contents. Fish were sampled primarily from March to November and nearly all were caught at the bottom in the southeastern part of the lake near Saugatuck, Michigan. Depths of capture (m) were: alewives, 5 to 110; yellow perch, 5 to 26; spottail shiners, 5 to 31; trout-perch, 9 to 46; slimy sculpins, 31 to 91; and fourhorn sculpins, 73 to 110. Alewives, particularly those less than 140 mm long, fed chiefly on zooplankton; Pontoporeia usually constituted most of the rest of the food, although Mysis and immature midges were occasionally eaten in considerable quantity. Yellow perch ate primarily Pontoporeia, fish eggs, Mysis, and crayfish; Pontoporeia was consumed most heavily by perch less than 250 mm long and those in relatively deep water, fish (mainly slimy sculpins) by those 200 mm long or longer, Mysis by those in deep water, and crayfish by those on rocky bottom. Spottail shiners fed most commonly on immature midges, Pontoporeia, zooplankton, fingernail clams, and (in July only) fish eggs; immature midges were eaten mainly by shiners in shallow water; and Pontoporeia by those in deeper areas. The diet of trout-perch was strongly dominated by Pontoporeia and immature midges. Slimy sculpins ate Pontoporeia almost exclusively. Fourhorn sculpins fed almost entirely on Mysis and Pontoporeia; Pontoporeia was particularly important in the diet of the larger fish.

Seasonal bathymetric distributions of 16 fishes in Lake Superior, 1958-75

USGS Publications Warehouse

Selgeby, James H.; Hoff, Michael H.

1996-01-01

The bathymetric distributions of fishes in Lake Superior, which is one of the largest and deepest lakes in the world, has not been studied on a lakewide scale. Knowledge about the bathymetric distributions will aid in designing fish sampling programs, estimating absolute abundances, and modeling energy flow in the lake. Seasonal bathymetric distributions were determined , by 10-m depth intervals, for 16 fishes collected with bottom trawls and bottom-set gill nets within the upper 150 m of Lake Superior during 1958-75. In spring trawl catches, maximum abundance occurred at these depths: 15 m for round whitefish (Prosopium cylindraceum); 25m for longnose sucker (Catostomus catostomus); 35 m for lake whitefish (Coregonus clupeaformis) and rainbow smelt (Osmerus mordax); 45 m for lake trout (Salvelinus namaycush); 65 m for pygmy whitefish (Prospoium coulteri) and bloater (Coregonus hoyi); 75 m for trout- perch (Percopsis omiscomaycus); 105 m for shortjaw cisco (Coregonus zenithicus); and 115 m for ninespine stickleback (Pungitius pungitius), burbot (Lota lota), slimy sculpin (Cottus cogantus), spoonhead sculpin (Cottus ricei), and deepwater sculpin (Myoxcephalus thompsoni). Bathymetric distributions in spring gill nets were similar to those in trawls, except that depths of maximum abundances in gill nets were shallower than those in trawls for lake trout, rainbow smelt, longnose sucker, and burbot. Lake herring (Coregonus artedi) and kiyi (Coregonus kiyi) were rarely caught in trawls, and their maximum abundances in spring gill net collections were at depths of 25 and 145 m, respectively. In summer, pygmy whitefish, shortjaw cisco, lake herring, kiyi, longnose sucker, burbot, ninespine stickleback, trout-perch, slimy sculpin, and spponhead sculpin were at shallower depths than in spring, whereas rainbow smelt were found in deeper water; there was no change for other species. In fall, shortjaw cisco was at shallower depths than in summer, whereas the remaining species were found deeper, except for lake whitefish and lake trout whose modal depths did not change. Distributions of lake trout and lake whitefish were analyzed by age group, and the young (ages 1-3) of both species were often found in shallower water than were older fish. The shallow-water species exhibited little seasonal changes in bathymetric distributions, whereas the species that inhabited the middepths of deeper water generally moved shallower as the seasons progressed. Most of the more pronounced seasaonl changes in bathymetric distribution were associated with spawning movements.

Feeding rate of slimy sculpin and burbot on young lake charr in laboratory reefs

USGS Publications Warehouse

Savino, Jacqueline F.; Henry, Mary G.

1991-01-01

Predation and contaminants are two possible factors in the poor recruitment of young lake charr Salvelinus namaycush in the Great Lakes. We measured the feeding rate of slimy sculpins Cottus cognatus and burbot Lota lota on young lake charr (uncontaminated young from eggs of a hatchery brood stock and contaminated young from eggs of Lake Michigan lake charr) in laboratory test chambers with a cobble substrate. The median daily consumption rate of sculpins for all tests was 2 lake charr eggs (N = 22 tests; 95% confidence interval, O-13) and 2 lake charr free embryos (N = 31 tests; 95% confidence interval, O-10). Feeding rate did not differ between hatchery and contaminated prey. Slimy sculpins continued to feed on lake charr when another prey organism, the deepwater amphipod Pontoporeia hoyi, was present. Feeding by burbot on free embryos (4-36 d-l) increased as the mobility of young increased, but burbot consumed about 10% of their body weight weekly in free-swimming young (140-380 d-l). Predation on lake charr eggs by sculpins could beconsiderable over the 100 to 140 d incubation period, and burbot could eat large numbers of free-swimming lake charr as the young fish left the reef. Predation pressure on young lake charr may inhibit rehabilitation ofself-sustaining populations of lake charr on some reefs unless a critical egg density has been reached.

Strontium isotopes in otoliths of a non-migratory fish (slimy sculpin): Implications for provenance studies

USGS Publications Warehouse

Brennan, Sean R.; Fernandez, Diego P.; Zimmerman, Christian E.; Cerling, Thure E.; Brown, Randy J.; Wooller, Matthew J.

2015-01-01

Heterogeneity in 87Sr/86Sr ratios of river-dissolved strontium (Sr) across geologically diverse environments provides a useful tool for investigating provenance, connectivity and movement patterns of various organisms and materials. Evaluation of site-specific 87Sr/86Sr temporal variability throughout study regions is a prerequisite for provenance research, but the dynamics driving temporal variability are generally system-dependent and not accurately predictable. We used the time-keeping properties of otoliths from non-migratory slimy sculpin (Cottus cognatus) to evaluate multi-scale 87Sr/86Sr temporal variability of river waters throughout the Nushagak River, a large (34,700 km2) remote watershed in Alaska, USA. Slimy sculpin otoliths incorporated site-specific temporal variation at sub-annual resolution and were able to record on the order of 0.0001 changes in the 87Sr/86Sr ratio. 87Sr/86Sr profiles of slimy sculpin collected in tributaries and main-stem channels of the upper watershed indicated that these regions were temporally stable, whereas the Lower Nushagak River exhibited some spatio-teporal variability. This study illustrates how the behavioral ecology of a non-migratory organism can be used to evaluate sub-annual 87Sr/86Sr temporal variability and has broad implications for provenance studies employing this tracer.

Status of important prey fishes in the U.S. waters of Lake Ontario, 2013: Introduction and methods, alewife, rainbow smelt, sculpins, and round goby

USGS Publications Warehouse

Walsh, Maureen; Weidel, Brian C.; Connerton, Michael J.

2014-01-01

Lake Ontario has a mean depth of 86 m (282 ft) and a maximum depth of 244 m (801 ft) (Herdendorf 1982). The southern, New York portion of the lake has the deepest water (Figure 1). In New York waters, about 67% of the lake is <160 m (525 ft) deep and about 82% of the lake is <180 m (591 ft) deep. The U.S. Geological Survey (USGS) and New York State Department of Environmental Conservation (NYSDEC) have cooperatively assessed Lake Ontario prey fishes each year since 1978. Bottom trawl assessments were initially focused on Alewife Alosa pseudoharengus (April), Rainbow Smelt Osmerus mordax (June), and Slimy Sculpin Cottus cognatus (October). Seasonal survey timing corresponded to the peak catches in 1972 when collections were made every month May to October (Owens et al. 2003). Twelve transects were established at approximately 25-km intervals along the U.S. shoreline (Figure 2). Alewife assessment was conducted at all transects, Rainbow Smelt assessment at all transects except Fair Haven, and six transects representing eastern, southern, and western lake areas were sampled for Slimy Sculpin (Figure 2). Changes in the Lake Ontario ecosystem (species invasion, oligotrophication, native species rebound) require ongoing evaluation of current methods which sometimes necessitate redistribution of trawl effort, or changes in sampling designs and/or gear. For instance, the spring Alewife assessment is now used also to assess invasive Round Goby Neogobius melanostomus population dynamics. Likewise, the fall benthic fish assessment (formerly sculpin assessment) now also tracks dynamics of the rebounding native Deepwater Sculpin Myoxocephalus thompsonii population, the apparent declining population of Slimy Sculpin, and fall distribution of Round Goby.

Spatial patterns in PCB concentrations of Lake Michigan lake trout

USGS Publications Warehouse

Madenjian, Charles P.; DeSorcie, Timothy J.; Stedman, Ralph M.; Brown, Edward H.; Eck, Gary W.; Schmidt, Larry J.; Hesselberg, Robert J.; Chernyak, Sergei M.; Passino-Reader, Dora R.

1999-01-01

Most of the PCB body burden in lake trout (Salvelinus namaycush) of the Great Lakes is from their food. PCB concentrations were determined in lake trout from three different locations in Lake Michigan during 1994–1995, and lake trout diets were analyzed at all three locations. The PCB concentrations were also determined in alewife (Alosa pseudoharengus), rainbow smelt (Osmerus mordax), bloater (Coregonus hoyi), slimy sculpin (Cottus cognatus), and deepwater sculpin (Myoxocephalus thompsoni), five species of prey fish eaten by lake trout in Lake Michigan, at three nearshore sites in the lake. Despite the lack of significant differences in the PCB concentrations of alewife, rainbow smelt, bloater, slimy sculpin, and deepwater sculpin from the southeastern nearshore site near Saugatuck (Michigan) compared with the corresponding PCB concentrations from the northwestern nearshore site near Sturgeon Bay (Wisconsin), PCB concentrations in lake trout at Saugatuck were significantly higher than those at Sturgeon Bay. The difference in the lake trout PCB concentrations between Saugatuck and Sturgeon Bay could be explained by diet differences. The diet of lake trout at Saugatuck was more concentrated in PCBs than the diet of Sturgeon Bay lake trout, and therefore lake trout at Saugatuck were more contaminated in PCBs than Sturgeon Bay lake trout. These findings were useful in interpreting the long-term monitoring series for contaminants in lake trout at both Saugatuck and the Wisconsin side of the lake.

Life history and biogeographic diversification of an endemic western North American freshwater fish clade using a comparative species tree approach.

PubMed

Baumsteiger, Jason; Kinziger, Andrew P; Aguilar, Andres

2012-12-01

The west coast of North America contains a number of biogeographic freshwater provinces which reflect an ever-changing aquatic landscape. Clues to understanding this complex structure are often encapsulated genetically in the ichthyofauna, though frequently as unresolved evolutionary relationships and putative cryptic species. Advances in molecular phylogenetics through species tree analyses now allow for improved exploration of these relationships. Using a comprehensive approach, we analyzed two mitochondrial and nine nuclear loci for a group of endemic freshwater fish (sculpin-Cottus) known for a wide ranging distribution and complex species structure in this region. Species delimitation techniques identified three novel cryptic lineages, all well supported by phylogenetic analyses. Comparative phylogenetic analyses consistently found five distinct clades reflecting a number of unique biogeographic provinces. Some internal node relationships varied by species tree reconstruction method, and were associated with either Bayesian or maximum likelihood statistical approaches or between mitochondrial, nuclear, and combined datasets. Limited cases of mitochondrial capture were also evident, suggestive of putative ancestral hybridization between species. Biogeographic diversification was associated with four major regions and revealed historical faunal exchanges across regions. Mapping of an important life-history character (amphidromy) revealed two separate instances of trait evolution, a transition that has occurred repeatedly in Cottus. This study demonstrates the power of current phylogenetic methods, the need for a comprehensive phylogenetic approach, and the potential for sculpin to serve as an indicator of biogeographic history for native ichthyofauna in the region. Copyright © 2012 Elsevier Inc. All rights reserved.

Predation on larval suckers in the Williamson River Delta revealed by molecular genetic assays—A pilot study

USGS Publications Warehouse

Hereford, Danielle M.; Ostberg, Carl O.; Burdick, Summer M.

2016-06-13

Predation of endangered Lost River suckers (Deltistes luxatus) and shortnose suckers (Chasmistes brevirostris) during larval egress to Upper Klamath Lake from the Williamson River is poorly understood but may be an important factor limiting recruitment into adult spawning populations. Native and non-native piscivores are abundant in nursery wetland habitat, but larval predation has not been directly studied for all species. Larvae lack hard body structures and digest rapidly in predator digestive systems. Therefore, traditional visual methods for diet analysis may fail to identify the extent of predation on larvae. The goals of this study were to (1) use quantitative polymerase chain reaction (qPCR) and single nucleotide polymorphism (SNP) assays developed for Lost River and shortnose suckers to assay predator stomach contents for sucker DNA, and (2) to assess our ability to use this technique to study predation. Predators were captured opportunistically during larval sucker egress. Concurrent feeding trials indicate that most predators—yellow perch (Perca flaverscens), fathead minnow (Pimephales promelas), blue chub (Gila coerulea), Klamath tui chub (Siphatales bicolor bicolor), Klamath Lake sculpin (Cottus princeps), slender sculpin (Cottus tenuis)—preyed on sucker larvae in the laboratory. However, sucker DNA was not detected in fathead minnow stomachs. Of the stomachs screened from fish captured in the Williamson River Delta, 15.6 percent of yellow perch contained sucker DNA. This study has demonstrated that the application of qPCR and SNP assays is effective for studying predation on larval suckers. We suggest that techniques associated with dissection or detection of sucker DNA from fathead minnow stomachs need improvement.

Diel and distributional abundance patterns of fish embryos and larvae in the lower Columbia and Deschutes rivers

USGS Publications Warehouse

Gadomski, D.M.; Barfoot, C.A.

1998-01-01

Diel and distributional abundance patterns of free embryos and larvae of fishes in the lower Columbia River Basin were investigated. Ichthyoplankton samples were collected in 1993 during day and night in the main-channel and a backwater of the lower Columbia River, and in a tributary, the Deschutes River. Fish embryos and larvae collected in the main-channel Columbia River were primarily (85.6%) of native taxa (peamouth Mylocheilus caurinus, northern squawfish Ptychocheilus oregonensis, suckers Catostomus spp., and sculpins Cottus spp.), with two introduced species (American shad Alosa sapidissima and common carp Cyprinus carpio) comprising a smaller percentage of the catch (13.3%). Similarly, in the Deschutes River native taxa [lampreys (Petromyzontidae), minnows (Cyprinidae), and suckers Catostomus spp.] dominated collections (99.5% of the catch). In contrast, 83.5% of embryos and larvae in the Columbia River backwater were of introduced taxa [American shad, common carp, and sunfishes (Centrarchidae)]. In all locations, all dominant taxa except sculpins were collected in significantly greater proportions at night. Taxon-specific differences in proportions of embryos and larvae collected at night can in some instances be related to life history styles. In the main-channel Columbia River, northern squawfish and peamouth were strongly nocturnal and high proportions still had yolksacs, suggesting that they had recently hatched and were drifting downriver to rearing areas. In contrast, sculpin abundances were similar during day and night, and sculpins mostly had depleted yolksacs, indicating sculpins were feeding and rearing in offshore limnetic habitats. Taxon-specific diel abundance patterns and their causes must be considered when designing effective sampling programs for fish embryos and larvae.

Structural characterization of peptides derived from prosomatostatins I and II isolated from the pancreatic islets of two species of teleostean fish: the daddy sculpin and the flounder.

PubMed

Conlon, J M; Davis, M S; Falkmer, S; Thim, L

1987-11-02

The primary structures of three peptides from extracts from the pancreatic islets of the daddy sculpin (Cottus scorpius) and three analogous peptides from the islets of the flounder (Platichthys flesus), two species of teleostean fish, have been determined by automated Edman degradation. The structures of the flounder peptides were confirmed by fast-atom bombardment mass spectrometry. The peptides show strong homology to residues (49-60), (63-96) and (98-125) of the predicted sequence of preprosomatostatin II from the anglerfish (Lophius americanus). The amino acid sequences of the peptides suggest that, in the sculpin, prosomatostatin II is cleaved at a dibasic amino acid residue processing site (corresponding to Lys61-Arg62 in anglerfish preprosomatostatin II). The resulting fragments are further cleaved at monobasic residue processing sites (corresponding to Arg48 and Arg97 in anglerfish preprosomatostatin II). In the flounder the same dibasic residue processing site is utilised but cleavage at different monobasic sites takes place (corresponding to Arg50 and Arg97 in anglerfish preprosomatostatin II). A peptide identical to mammalian somatostatin-14 was also isolated from the islets of both species and is presumed to represent a cleavage product of prosomatostatin I.

Downstream movement of fish in a tributary of southern Lake Superior

DOE Office of Scientific and Technical Information (OSTI.GOV)

Manion, P.J.

1977-01-01

The influence of two environmental factors, stream flow and water temperature, on the downstream movement of four fish species in the Big Garlic River over a 12-yr period is described. Brook trout (Salvelinus fontinalis) migrated after floods had subsided in the spring and during rising water in the fall at temperatures of about 10/sup 0/C. Brook sticklebacks (Culaea inconstans) moved downstream chiefly in winter. Mottled sculpins (Cottus bairdi) moved primarily in the winter and during floods. Yellow perch (Perca flavescens) appeared to move generally in the fall as water levels increased and water temperatures decreased.

Geographic variation in host fish use and larval metamorphosis for the endangered dwarf wedgemussel

USGS Publications Warehouse

White, Barbara (St. John); Ferreri, C. Paola; Lellis, William A.; Wicklow, Barry J.; Cole, Jeffrey C.

2017-01-01

Host fishes play a crucial role in survival and dispersal of freshwater mussels (Unionoida), particularly rare unionids at conservation risk. Intraspecific variation in host use is not well understood for many mussels, including the endangered dwarf wedgemussel (Alasmidonta heterodon) in the USA.Host suitability of 33 fish species for dwarf wedgemussel glochidia (larvae) from the Delaware and Connecticut river basins was tested in laboratory experiments over 9 years. Relative suitability of three different populations of a single host fish, the tessellated darter (Etheostoma olmstedi), from locations in the Connecticut, Delaware, and Susquehanna river basins, was also tested.Connecticut River basin A. heterodon metamorphosed into juvenile mussels on tessellated darter, slimy sculpin (Cottus cognatus), and Atlantic salmon (Salmo salar) parr. Delaware River basin mussels metamorphosed using these three species, as well as brown trout (Salmo trutta), banded killifish (Fundulus diaphanus), mottled sculpin (Cottus bairdii), striped bass (Morone saxatilis), and shield darter (Percina peltata). Atlantic salmon, striped bass, and sculpins were highly effective hosts, frequently generating 5+ juveniles per fish (JPF) and metamorphosis success (MS; proportion of attaching larvae that successfully metamorphose) ≥ 0.4, and producing juveniles in repeated trials.In experiments on tessellated darters, mean JPF and MS values decreased as isolation between the mussel source (Connecticut River) and each fish source increased; mean JPF = 10.45, 6.85, 4.14, and mean MS = 0.50, 0.41, and 0.34 in Connecticut, Delaware, and Susquehanna river darters, respectively. Host suitability of individual darters was highly variable (JPF = 2–11; MS = 0.20–1.0).The results show that mussel–host fish compatibility in A. heterodon differs among Atlantic coastal rivers, and suggest that hosts including anadromous Atlantic salmon and striped bass may help sustain A. heterodon in parts of its range. Continued examination of host use variation, migratory host roles, and mussel–fish interactions in the wild is critical in conservation of A. heterodon and other vulnerable mussel species.

Novel Concordance Between Geographic, Environmental, and Genetic Structure in the Ecological Generalist Prickly Sculpin (Cottus asper) in California.

PubMed

Baumsteiger, Jason; Kinziger, Andrew P; Aguilar, Andres

2016-11-01

Ecological generalists may contain a wealth of information concerning diversity, ecology, and geographic connectivity throughout their range. We explored these ideas in prickly sculpin (Cottus asper), a small generalist freshwater fish species where coastal forms have potentially undergone radiations into inland lacustrine and riverine environments. Using a 962bp cytochrome b mtDNA marker and 11 microsatellites, we estimated diversity, divergence times, gene flow, and structure among populations at 43 locations throughout California. We then incorporated genetic and GIS data into ecological niche models to assess ecological conditions within identified groups. Though not reciprocally monophyletic, unique mtDNA haplotypes, microsatellite clustering, and measures of isolation by distance (Coastal: r = 0.960, P < 0.001; Inland: r = 0.277, P = 0.148) suggest 2 novel taxonomic groups, Coastal and Inland (constrained to Great Central Valley). Divergence estimates of 41-191 kya combined with the regional biogeographic history suggest geographic barriers are absent between groups since divergence, but ecological niche modeling revealed significant environmental differences (t = 10.84, P < 0.001). Introgressed individuals were also discovered between groups in an ecologically and geographically intermediate region. Population structure was limited, predominately found in tributaries of the San Joaquin basin in the Inland group. Overall, C. asper exhibited substantial genetic diversity, despite its ecological generality, reflecting California's historically unique and complex hydrology. More broadly, this study illustrates variable environments within the range of a generalist species may mask genetic divergences and should not be overlooked in biodiversity assessments. © The American Genetic Association 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Diets and diet overlap of nonindigenous gobies and small benthic native fishes co-inhabiting the St. Clair River, Michigan

USGS Publications Warehouse

French, John R. P.; Jude, David J.

2001-01-01

Round gobies (Neogobius melanostomus), after successfully reproducing in the early 1990s, decimated populations of mottled sculpins (Cottus bairdi) and possibly logperch (Percina caprodes) in the St. Clair River. Studies were conducted during 1994 to determine whether diets of round and tubenose (Proterorhinus marmoratus) gobies overlapped with those of native forage fishes. In the nearshore zone (depth ≤ 1 m), round and tubenose gobies, logperch, and rainbow darters (Etheostoma caeruleum) of similar sizes (total lengths < 75 mm) consumed mainly small-sized macroinvertebrates (dipterans, Caenis, and amphipods) during June 1994. Logperch and rainbow darters were present in the nearshore zone only during this month. At the crest of the channel slope (depth = 3 m), round gobies and northern madtoms (Noturus stigmosus) ate mostly ephemeropteran nymphs (Hexagenia and Baetisca), while predation on zebra mussels (Dreissena polymorpha) and other mollusks by round gobies was minimal. Northern madtoms did not feed on mollusks. Diet overlap between round gobies and native fishes was not observed at the channel slope (depth = 5 m and 7 m) due to heavy predation on mollusks by round gobies. Young-of-the-year (YOY) round gobies migrated to deeper water in autumn and became prey of mottled sculpins and northern madtoms. Eggs and YOY of mottled sculpins may have become vulnerable to predation by both round gobies and native fishes in deeper water, since adult mottled sculpins were apparently confined to the channel with limited home range because aggressive round gobies occupied preferred shallow habitat, including spawning sites.

Lipid concentrations in Lake Michigan fishes: Seasonal, spatial, ontogenetic, and long-term trends

USGS Publications Warehouse

Madenjian, Charles P.; Elliott, Robert F.; DeSorcie, Timothy J.; Stedman, Ralph M.; O'Connor, Daniel V.; Rottiers, Donald V.

2000-01-01

Lipid concentrations were measured in seven species of fish from several locations in Lake Michigan during spring, summer, and fall in 1994 to 1995. Adult alewife (Alosa pseudoharengus) and age-2 coho salmon (Oncorhynchus kisutch) exhibited pronounced seasonal changes in lipid content. Adult alewives averaged 7.4% lipid, on a wet weight basis, during spring (May), 2.6% in summer (July), and 12.2% in fall (late September through October). Spring lipid concentration was low in age-2 coho salmon, averaging only 1.9%, then increased to 7.8% during summer and decreased to 4.5% by fall. In contrast, lipid content in adult bloater (Coregonus hoyi) was relatively constant with respect to season, ranging between 10.6% and 12.4% during the year. Lipid concentration increased with fish size for all species except rainbow smelt (Osmerus mordax). Although deepwater sculpin (Myoxocephalus thompsoni) were considerably larger than slimy sculpin (Cottus cognatus) (mean total length of 117 mm vs 68 mm), mean lipid content of deepwater sculpin (7.6%) was only slightly higher than that for slimy sculpin (6.6%). Comparison of lipid concentrations from this study with previous studies indicated that lipid concentration in lake trout (Salvelinus namaycush) and alewives in Lake Michigan did not change significantly from 1969–1971 to 1994–1995. Lipid concentration in large (about 250 mm total length) adult bloaters near Saugatuck (along the southeastern shore of the lake) decreased from 23.3% in 1980 to 11.9% in 1986, but showed no significant change between 1986 and 1994–1995.

Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).

PubMed

Conlon, J M; Falkmer, S; Thim, L

1987-04-01

Three peptides isolated from the Brockmann bodies of the daddy sculpin, a teleostean fish, have been identified as fragments of one or more proglucagons. The peptide L Q D A E D S S R F D A D D T L A G E A R E L S T P K represents the NH2 terminus of proglucagon (residues 1-27), H S E G T F S N D Y S K Y L E T R R A Q D F V Q W L K N S represents glucagon and H A D G T F T S D V S S Y L N D Q A I K D F V A K L K S G K V represents the glucagon-like peptide at the COOH terminus of the precursor. The fast-atom bombardment mass spectra of the three peptides were consistent with the proposed structures and demonstrated that further posttranslational modifications of the peptides had not taken place. Sculpin glucagon is identical to anglerfish glucagon II but sculpin proglucagon(1-27) and glucagon-like peptide show stronger homology to the corresponding regions of anglerfish proglucagon I than to proglucagon II. The structures of the peptides are suggestive of the action of trypsin-like and carboxypeptidase-B-like enzymes at the site of pairs of basic amino acid residues in proglucagon. The presence of a COOH-terminal lysyl group in proglucagon(1-27) may indicate, however, that the penultimate prolyl residue partially inhibits the action of the carboxypeptidase-B-like activity.

Effects of stream enclosures on drifting invertebrates and fish growth

USGS Publications Warehouse

Zimmerman, J.K.H.; Vondracek, B.

2006-01-01

Stream ecologists often use enclosure experiments to investigate predator-prey interactions and competition within and among fish species. The design of enclosures, manipulation of species densities, and method of replication may influence experimental results. We designed an experiment with enclosure cages (1 m2, 6-mm mesh) to examine the relative influence of fish size, density, and prey availability on growth of brown trout (Salmo trutta), brook trout (Salvelinus fontinalis), and slimy sculpin (Cottus cognatus) within enclosures in Valley Creek, Minnesota. In addition, we examined water flow and invertebrate drift entering enclosures and in open riffles to investigate whether enclosures reduced the supply of invertebrate prey. Growth of small (age-0) brook and brown trout was not influenced by fish density, but growth of larger (age-1) trout generally decreased as density increased. Sculpin growth was not related to fish size or density, but increased with mean size of invertebrates in the drift. Enclosures reduced water flow and tended to reduce invertebrate drift rate, although total drift rate (ind./min), total drift density (ind./m3), and mean size of invertebrates were not significantly different inside enclosures compared to adjacent stream riffles. Enclosures had no effect on drift rate or size of Gammarus pseudolimnaeus, the main prey item for trout and sculpin in Valley Creek. Overall, our analyses indicated that reductions of prey availability by enclosures did not influence fish growth. Trout growth may have been limited at larger sizes and densities because of increased activity costs of establishing and defending territories, whereas sculpin growth was related to availability of large prey, a factor not influenced by enclosures. ?? 2006 by The North American Benthological Society.

Newly documented host fishes for the eastern elliptio mussel (Elliptio complanata)

USGS Publications Warehouse

Galbraith, Heather S.

2013-01-01

The eastern elliptio (Elliptio complanata) is a common, abundant and ecologically important freshwater mussel that occurs throughout the Atlantic Slope drainage in the United States and Canada. Previous research has shown E. complanata glochidia to be host fish generalists, parasitizing yellow perch (Perca flavescens), banded killifish (Fundulus diaphanus), banded sculpin (Cottus carolinae), and seven centrarchid species. Past laboratory studies have been conducted in the Midwest and glochidia sources typically included lakes the Great Lakes basin or were unreported. The objective of this study was to identify host fishes for E. complanata from streams in the Mid-Atlantic region. We used artificial laboratory infections to test host suitability of 38 fish and two amphibian species with E. complanata glochidia from the Chesapeake Bay drainage. Glochidia successfully metamorphosed into juvenile mussels on five fish species: American eel (Anguilla rostrata), brook trout (Salvelinus fontinalis), lake trout (S. namaycush), mottled sculpin (C. bairdii), and slimy sculpin (C. cognatus). American eel was the most effective host, yielding the highest overall metamorphosis success (percentage of attached glochidia that transformed into juvenile mussels;{greater than or equal to}0.90) and producing 13.2 juveniles per fish overall. No juvenile E. complanata metamorphosed on other fish species tested, including many previously identified host fishes reported in the literature. Reasons for discrepancies in published host fish could include geographic variation in host use across the species' range, differences in host use between lentic and lotic populations, or poorly resolved taxonomy within the genus Elliptio.

Proximate composition and caloric content of eight Lake Michigan fishes

USGS Publications Warehouse

Rottiers, Donald V.; Tucker, Robert M.

1982-01-01

We measured the proximate composition (percentage lipid, water, fat-free dry material, ash) and caloric content of eight species of Lake Michigan fish: lake trout (Salvelinus namaycush), coho salmon (Oncorhynchus kisutch), lake whitefish (Coregonus clupeaformis), bloater (Coregonus hoyi), alewife (Alosa pseudoharengus), rainbow smelt (Osmerus mordax), deepwater sculpin (Myoxocephalus quadricornis), and slimy sculpin (Cottus cognatus). Except for alewives, proximate composition and caloric content did not differ significantly between males and females. And, for coho salmon, there was no significant difference in composition between fish collected in different years. Lipid and caloric content of lake trout increased directly with age. In all species examined, lipids and caloric contents were significantly lower in small, presumably immature, fish than in larger, older fish. Lipid content of lake trout, lake whitefish, and bloaters (range of means, 16-22%) was nearly 3 times higher than that of coho salmon, sculpins, rainbow smelt, and alewives (range of means, 5.2-7.0%). The mean caloric content ranged from 6.9 to 7.1 kcal/g for species high in lipids and from 5.8 to 6.3 kcal/g for species low in lipids. Although the caloric content of all species varied directly with lipid content and inversely with water content, an increase in lipid content did not always coincide with a proportional increase in caloric content when other components of fish composition were essentially unchanged. This observation suggests that the energy content of fish estimated from the proximate composition by using universal conversion factors may not necessarily be accurate.

Survey of fishes and environmental conditions in Abbotts Lagoon, Point Reyes National Seashore, California

USGS Publications Warehouse

Saiki, M.K.; Martin, B.A.

2001-01-01

This study was conducted to gain a better understanding of fishery resources in Abbotts Lagoon, Point Reyes National Seashore. During February/March, May, August, and November 1999, fish were sampled with floating variable-mesh gill nets and small minnow traps from as many as 14 sites in the lagoon. Water temperature, dissolved oxygen, pH, total ammonia(NH3 + NH4+), salinity, turbidity, water depth, and bottom substrate composition were also measured at each site. A total of 2,656 fish represented by eight species was captured during the study. Gill nets captured Sacramento perch, Archoplites interruptus; largemouth bass, Micropterus salmoides; Pacific herring, Clupea pallasi; prickly sculpin, Cottus asper, silver surfperch, Hyperprosopon ellipticum; longfin smelt, Spirinchus thaleichthys; and striped bass, Morone saxatilis; whereas minnow traps captured Sacramento perch; prickly sculpin; and threespine stickleback, Gasterosteus aculeatus. Cluster analysis (Ward's minimum variance method of fish catch statistics identified two major species assemblages-the first dominated by Sacramento perch and, to a lesser extent, by largemouth bass, and the second dominated by Pacific herring and threespine stickleback. Simple discriminant analysis of environmental variables indicated that salinity contributed the most towards separating the two assemblages.

Effects of turbidity, light level, and cover on predation of white sturgeon larvae by prickly sculpins

USGS Publications Warehouse

Gadomski, D.M.; Parsley, M.J.

2005-01-01

White sturgeon Acipenser transmontanus occur in rivers of the western United States and southwestern Canada, but some populations are in decline because of recruitment failure. Many river systems in this area have been altered as a result of development that has caused major environmental changes. Our goal was to examine how three changes - lower turbidity levels, higher light levels, and altered substrates - might affect predation by prickly sculpin Cottus asper on white sturgeon larvae. We experimentally investigated predation at various turbidity levels and found that significantly more white sturgeon yolk sac larvae were eaten at lower turbidity levels. The effects of light level (1-4 and 7-15 1x), the presence or absence of rocks as cover, and prey size (14-17 mm and 20-24 mm total length) on the outcome of predator-prey interactions were also examined. Significantly fewer white sturgeon were eaten during trials that combined the lowest light level, cover, and the smallest larvae. Our results suggest that altered river conditions caused by impoundment and other factors have increased predation on white sturgeon larvae. ?? Copyright by the American Fisheries Society 2005.

Diet shifts by planktivorous and benthivorous fishes in northern Lake Michigan in response to ecosystem changes

USGS Publications Warehouse

Bunnell, David B.; Davis, Bruce M.; Chriscinske, Margret Ann; Keeler, Kevin M.; Mychek-Londer, Justin G.

2015-01-01

In Lake Michigan, diets of planktivorous and benthivorous fishes have varied over the past decades, in part owing to food web changes. To update diet information and compare them to a similar effort in 1994–1995, we analyzed the diets of seven benthivorous and planktivorous fish species collected along two northern Lake Michigan transects that spanned nearshore (18 m), intermediate (46 m), and offshore (91, 110, 128 m) bottom depths during spring, summer, and autumn of 2010. Calanoid copepods (e.g., Limnocalanus macrurus, Leptodiaptomus sicilis, and Senecella calanoides) comprised a majority of the diets in at least one season for all sizes of alewife (Alosa pseudoharengus), bloater (Coregonus hoyi), and rainbow smelt (Osmerus mordax). Similarly, Mysis diluviana was the highest proportion in at least one season for large sizes of alewife, bloater, and rainbow smelt, as well as slimy sculpin (Cottus cognatus) and deepwater sculpin (Myoxocephalus thompsonii). The diets of the remaining two species, ninespine stickleback (Pungitius pungitius) and round goby (Neogobius melanostomus), were dominated by herbivorous cladocerans or dreissenid mussels, respectively. Interspecific diet overlap was minimal at 18 and 46 m. In offshore waters, however, overlap was relatively high, driven by frequent consumption of Mysis. Relative to 1994–1995, 2010 diets revealed increased feeding on calanoid copepods and Mysis, with corresponding declining consumption of Diporeia spp. and herbivorous cladocerans. Relative diet weight was also higher in 1994–1995 than in 2010 for small and large bloater and both sculpin species. We hypothesize that the shifts in diets are reflective of community-level changes in invertebrate prey availability.

Acute toxicity of cadmium, lead, zinc, and their mixtures to stream-resident fish and invertebrates

USGS Publications Warehouse

Mebane, Christopher A.; Dillon, Frank S.; Hennessy, Daniel P.

2012-01-01

The authors conducted 150 tests of the acute toxicity of resident fish and invertebrates to Cd, Pb, and Zn, separately and in mixtures, in waters from the South Fork Coeur d'Alene River watershed, Idaho, USA. Field-collected shorthead sculpin (Cottus confusus), westslope cutthroat trout (Oncorhynchus clarkii lewisi), two mayflies (Baetis tricaudatus and Rhithrogena sp.), a stonefly (Sweltsa sp.), a caddisfly (Arctopsyche sp.), a snail (Gyraulus sp.), and hatchery rainbow trout (Oncorhynchus mykiss), were tested with all three metals. With Pb, the mayflies (Drunella sp., Epeorus sp., and Leptophlebiidae), a Simuliidae black fly, a Chironomidae midge, a Tipula sp. crane fly, a Dytiscidae beetle, and another snail (Physa sp.), were also tested. Adult westslope cutthroat trout were captured to establish a broodstock to provide fry of known ages for testing. With Cd, the range of 96-h median effect concentrations (EC50s) was 0.4 to >5,329μg/L, and the relative resistances of taxa were westslope cutthroat trout ≈ rainbow trout ≈ sculpin << other taxa; with Pb, EC50s ranged from 47 to 3,323μg/L, with westslope cutthroat trout < rainbow trout < other taxa; and with Zn, EC50s ranged from 21 to 3,704μg/L, with rainbow trout < westslope cutthroat trout ≈ sculpin << other taxa. With swim-up trout fry, a pattern of decreasing resistance with increasing fish size was observed. In metal mixtures, the toxicities of the three metals were less than additive on a concentration-addition basis.

Patterns of ancestry and genetic diversity in reintroduced populations of the slimy sculpin: Implications for conservation

USGS Publications Warehouse

Huff, David D.; Miller, Loren M.; Vondracek, Bruce C.

2010-01-01

Reintroductions are a common approach for preserving intraspecific biodiversity in fragmented landscapes. However, they may exacerbate the reduction in genetic diversity initially caused by population fragmentation because the effective population size of reintroduced populations is often smaller and reintroduced populations also tend to be more geographically isolated than native populations. Mixing genetically divergent sources for reintroduction purposes is a practice intended to increase genetic diversity. We documented the outcome of reintroductions from three mixed sources on the ancestral composition and genetic variation of a North American fish, the slimy sculpin (Cottus cognatus). We used microsatellite markers to evaluate allelic richness and heterozygosity in the reintroduced populations relative to computer simulated expectations. Sculpins in reintroduced populations exhibited higher levels of heterozygosity and allelic richness than any single source, but only slightly higher than the single most genetically diverse source population. Simulations intended to mimic an ideal scenario for maximizing genetic variation in the reintroduced populations also predicted increases, but they were only moderately greater than the most variable source population. We found that a single source contributed more than the other two sources at most reintroduction sites. We urge caution when choosing whether to mix source populations in reintroduction programs. Genetic characteristics of candidate source populations should be evaluated prior to reintroduction if feasible. When combined with knowledge of the degree of genetic distinction among sources, simulations may allow the genetic diversity benefits of mixing populations to be weighed against the risks of outbreeding depression in reintroduced and nearby populations.

Patterns of ancestry and genetic diversity in reintroduced populations of the slimy sculpin: Implications for conservation

USGS Publications Warehouse

Huff, D.D.; Miller, L.M.; Vondracek, B.

2010-01-01

Reintroductions are a common approach for preserving intraspecific biodiversity in fragmented landscapes. However, they may exacerbate the reduction in genetic diversity initially caused by population fragmentation because the effective population size of reintroduced populations is often smaller and reintroduced populations also tend to be more geographically isolated than native populations. Mixing genetically divergent sources for reintroduction purposes is a practice intended to increase genetic diversity. We documented the outcome of reintroductions from three mixed sources on the ancestral composition and genetic variation of a North American fish, the slimy sculpin (Cottus cognatus). We used microsatellite markers to evaluate allelic richness and heterozygosity in the reintroduced populations relative to computer simulated expectations. Sculpins in reintroduced populations exhibited higher levels of heterozygosity and allelic richness than any single source, but only slightly higher than the single most genetically diverse source population. Simulations intended to mimic an ideal scenario for maximizing genetic variation in the reintroduced populations also predicted increases, but they were only moderately greater than the most variable source population. We found that a single source contributed more than the other two sources at most reintroduction sites. We urge caution when choosing whether to mix source populations in reintroduction programs. Genetic characteristics of candidate source populations should be evaluated prior to reintroduction if feasible. When combined with knowledge of the degree of genetic distinction among sources, simulations may allow the genetic diversity benefits of mixing populations to be weighed against the risks of outbreeding depression in reintroduced and nearby populations. ?? 2010 US Government.

A multitrophic approach to monitoring the effects of metal mining in otherwise pristine and ecologically sensitive rivers in northern Canada.

PubMed

Spencer, Paula; Bowman, Michelle F; Dubé, Monique G

2008-07-01

It is not known if current chemical and biological monitoring methods are appropriate for assessing the impacts of growing industrial development on ecologically sensitive northern waters. We used a multitrophic level approach to evaluate current monitoring methods and to determine whether metal-mining activities had affected 2 otherwise pristine rivers that flow into the South Nahanni River, Northwest Territories, a World Heritage Site. We compared upstream reference conditions in the rivers to sites downstream and further downstream of mines. The endpoints we evaluated included concentrations of metals in river water, sediments, and liver and flesh of slimy sculpin (Cottus cognatus); benthic algal and macroinvertebrate abundance, richness, diversity, and community composition; and various slimy sculpin measures, our sentinel forage fish species. Elevated concentrations of copper and iron in liver tissue of sculpin from the Flat River were associated with high concentrations of mine-derived iron in river water and copper in sediments that were above national guidelines. In addition, sites downstream of the mine on the Flat River had increased algal abundances and altered benthic macroinvertebrate communities, whereas the sites downstream of the mine on Prairie Creek had increased benthic macroinvertebrate taxa richness and improved sculpin condition. Biological differences in both rivers were consistent with mild enrichment of the rivers downstream of current and historical mining activity. We recommend that monitoring in these northern rivers focus on indicators in epilithon and benthic macroinvertebrate communities due to their responsiveness and as alternatives to lethal fish sampling in habitats with low fish abundance. We also recommend monitoring of metal burdens in periphyton and benthic invertebrates for assessment of exposure to mine effluent and causal association. Although the effects of mining activities on riverine biota currently are limited, our results show that there is potential for effects to occur with proposed growth in mining activities.

Congener Patterns of Persistent Organic Pollutants Establish the Extent of Contaminant Biotransport by Pacific Salmon in the Great Lakes.

PubMed

Gerig, Brandon S; Chaloner, Dominic T; Janetski, David J; Rediske, Richard R; O'Keefe, James P; Moerke, Ashley H; Lamberti, Gary A

2016-01-19

In the Great Lakes, introduced Pacific salmon (Oncorhynchus spp.) can transport persistent organic pollutants (POPs), such as polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs), to new environments during their spawning migrations. To explore the nature and extent of POP biotransport by salmon, we compared 58 PCB and 6 PBDE congeners found in spawning salmon directly to those in resident stream fish. We hypothesized that stream fish exposed to salmon spawners would have congener patterns similar to those of salmon, the presumed contaminant source. Using permutational multivariate analysis of variance (PERMANOVA) and nonmetric multidimensional scaling (NMDS), we found that POP congener patterns of Pacific salmon varied among regions in the Great Lakes basin (i.e., Lake Huron, Lake Michigan, or Lake Superior), tissue type (whole fish or eggs), and contaminant type (PCB or PBDE). For stream-resident fish, POP congener pattern was influenced by the presence of salmon, location (i.e., Great Lakes Basin), and species identity (i.e., brook trout [Salvelinus fontinalis] or mottled sculpin [Cottus bairdii]). Similarity in congener patterns indicated that salmon are a source of POPs to brook trout in stream reaches receiving salmon spawners from Lake Michigan and Lake Huron but not from Lake Superior. Congener patterns of mottled sculpin differed from those of brook trout and salmon, suggesting that brook trout and mottled sculpin either use salmon tissue to differing degrees, acquire POPs from different dietary sources, or bioaccumulate or metabolize POPs differently. Overall, our analyses identified the important role of salmon in contaminant biotransport but also demonstrated that the extent of salmon-mediated POP transfer and uptake in Great Lakes tributaries is location- and species-specific.

Seasonal food of juvenile lake trout in U.S. waters of Lake Ontario

USGS Publications Warehouse

Elrod, Joseph H.

1983-01-01

Stomach contents of 3,554 lake trout (Salvelinus namaycush), 100 to 449 mm in total length, captured with bottom trawls during April through October 1978–81 along the south shore of Lake Ontario were examined. Invertebrates appeared to be an important food of lake trout less than 200 mm long but were only occasionally eaten by larger fish. For all seasons and size groups of juvenile lake trout combined, the slimy sculpin (Cottus cognatus) was the principal forage fish, making up 42% (by weight) of identifiable fish remains. Young-of-the-year slimy sculpins were a major food of recently stocked yearling lake trout during July through October. Alewives (Alosa pseudoharengus) were the principal forage during April and May, and made up 28% (by weight) of the identifiable fish remains. They were rarely eaten during July and August, however, when lake trout remained in the hypolimnion and alewives were above it. Over 99% of the alewives eaten from April through August were yearlings and over 99% eaten during October were young-of-the-year. Rainbow smelt (Osmerus mordax) were the primary forage during July and August, but contributed only a small part of the diet during other seasons; overall, they made up 25% of identifiable fish remains. Johnny darters (Etheostoma nigrum) made up 4% of identifiable fish remains and were most common in stomachs of small lake trout during October.

A fish survey of the White River, Nevada

USGS Publications Warehouse

Scoppettone, G. Gary; Rissler, Peter H.; Shea, Sean

2004-01-01

In spring and summer 1991 and 1992, we surveyed fishes of the White River system, Nye and White Pine Counties, Nevada, to determine the status of natives. There are 5 known native fishes to the White River: Lepidomeda albivallis (White River spinedace), Crenichthys baileyi albivallis (Preston White River springfish), Crenichthys baileyi thermophilus (Moorman White River springfish), Catostomus clarki intermedius (White River desert sucker), and Rhinichthys osculus ssp. (White River speckled dace). All 5 had declined in range. Lepidomeda albivallis had experienced the greatest decline, with less than 50 remaining, and these were restricted to a 70-m stream reach. Rhinichthys osculus spp. was most widespread, found in 18 spring systems. Cottus bairdi (mottled sculpin) was collected for the 1st time from the White River system, where it was probably native. Protective measures should be implemented to conserve all native White River fishes to include C. bairdi.

Variation in capture efficiency of a beach seine for small fishes

USGS Publications Warehouse

Parsley, M.J.; Palmer, D.E.; Burkhardt, R.W.

1989-01-01

We determined the capture efficiency of a beach seine as a means of improving abundance estimates of small fishes in littoral areas. Capture efficiency for 14 taxa (individual species or species groups) was determined by seining within an enclosure at night over fine and coarse substrates in the John Day Reservoir, Oregon–Washington. Mean efficiency ranged from 12% for prickly sculpin Cottus asper captured over coarse substrates to 96% for peamouth Mylocheilus caurinus captured over fine substrates. Mean capture efficiency for a taxon (genus or species) was generally higher over fine substrates than over coarse substrates, although mean capture efficiencies over fine substrates were significantly greater for only 3 of 10 taxa. Capture efficiency generally was not influenced by fish density or by water temperature (range, 8–26°C). Conclusions about the relative abundance of taxa captured by seining can change substantially after capture efficiencies are taken into account.

Vulnerability of young white sturgeon, Acipenser transmontanus, to predation in the presence of alternative prey

USGS Publications Warehouse

Gadomski, D.M.; Parsley, M.J.

2005-01-01

We conducted laboratory trials to test the vulnerability of young white sturgeon, Acipenser transmontanus, to predation when an alternative prey was available. In trials with two species of predators, we observed two feeding patterns. When equal numbers of white sturgeon and goldfish, Carassius auratus, were available, prickly sculpins, Cottus asper, ingested more white sturgeon. Conversely, northern pikeminnow, Ptychocheilus oregonensis, ate more juvenile coho salmon, Oncorhynchus kisutch, than white sturgeon in three out of four sets of trials, but ate more white sturgeon in one set of trials. White sturgeon size and the availability of cover did not affect the proportions of prey species ingested. Our results indicate that predation may be affecting survival of white sturgeon larvae and juveniles in the wild and could be one factor limiting recruitment of young-of-the-year white sturgeon in some locations. ?? Springer 2005.

Evidence of Lake Trout reproduction at Lake Michigan's mid-lake reef complex

USGS Publications Warehouse

Janssen, J.; Jude, D.J.; Edsall, T.A.; Paddock, R.W.; Wattrus, N.; Toneys, M.; McKee, P.

2006-01-01

The Mid-Lake Reef Complex (MLRC), a large area of deep (> 40 m) reefs, was a major site where indigenous lake trout (Salvelinus namaycush) in Lake Michigan aggregated during spawning. As part of an effort to restore Lake Michigan's lake trout, which were extirpated in the 1950s, yearling lake trout have been released over the MLRC since the mid-1980s and fall gill net censuses began to show large numbers of lake trout in spawning condition beginning about 1999. We report the first evidence of viable egg deposition and successful lake trout fry production at these deep reefs. Because the area's existing bathymetry and habitat were too poorly known for a priori selection of sampling sites, we used hydroacoustics to locate concentrations of large fish in the fall; fish were congregating around slopes and ridges. Subsequent observations via unmanned submersible confirmed the large fish to be lake trout. Our technological objectives were driven by biological objectives of locating where lake trout spawn, where lake trout fry were produced, and what fishes ate lake trout eggs and fry. The unmanned submersibles were equipped with a suction sampler and electroshocker to sample eggs deposited on the reef, draw out and occasionally catch emergent fry, and collect egg predators (slimy sculpin Cottus cognatus). We observed slimy sculpin to eat unusually high numbers of lake trout eggs. Our qualitative approaches are a first step toward quantitative assessments of the importance of lake trout spawning on the MLRC.

Feeding of predaceous fishes on out-migrating juvenile-salmonids in John Day Reservoir, Columbia River

USGS Publications Warehouse

Poe, Thomas P.; Hansel, Hal C.; Vigg, S.; Palmer, D.E.; Prendergast, L.A.

1991-01-01

Diets of northern squawfish Ptychocheilus oregonensis, smallmouth bass Micropterus dolomieu, walleye Stizostedion vitreum, and channel catfish Ictalurus punctatus from John Day Reservoir were examined to determine the extent of predation on juvenile salmonids during seaward migrations of the salmonids during April–August 1983–1986. Juvenile Pacific salmon Oncorhynchus spp. and steelhead O. mykiss were the most important food group (by weight) of northern squawfish – about 67% – but made up smaller proportions of the food of the other predators: channel catfish, 33%; walleyes, 14%; smallmouth bass, 4%. Seasonal changes in diets indicated that northern squawfish preferred juvenile salmonids in May and August (generally the peak period of salmonid out-migration), and switched to prickly sculpin Cottus asper when numbers of juvenile salmonids declined; walleyes and smallmouth bass showed a preference only for prickly sculpin among the prey fishes analyzed. As judged by dietary composition and prey selectivity, the northern squawfish was the major fish predator on juvenile salmonids in the reservoir; channel catfish also were important predators in the upper reservoir in spring. Walleyes and smallmouth bass were much less important predators on salmonids, and appeared to select subyearling chinook salmon only in August when the distribution of this prey overlapped with that of the predators. Size-selective predation by northern squawfish may also play an important role in reducing survival of the smaller individuals within each run of out-migrating juvenile salmonids.

Diet of juvenile lake trout in southern Lake Ontario in relation to abundance and size of prey fishes, 1979-1987

USGS Publications Warehouse

Elrod, Joseph H.; O'Gorman, Robert

1991-01-01

We examined the diet of juvenile lake trout Salvelinus namaycush (<450 mm, total length) in Lake Ontario during four sampling periods (April–May, June, July–August, and October 1979–1987) in relation to changes in prey fish abundance in the depth zone where we caught the lake trout. Over all years combined, slimy sculpins Cottus cognatus contributed the most (39–52%) by wet weight to the diet, followed by alewives Alosa pseudoharengus(3–38%), rainbow smelt Osmerus mordax (17–43%), and johnny darters Etheostoma nigrum(2–10%). Over 90% of alewives eaten during April–May and June were age 1, and 98% of those eaten during October were age 0 (few alewives were eaten in July–August). Mean lengths of rainbow smelt and slimy sculpins in stomachs increased with size of lake trout. Juvenile lake trout generally fed opportunistically—seasonal and annual changes in diet usually reflected seasonal and annual changes in abundance of prey fishes near bottom where we captured the lake trout. Furthermore, diet within a given season varied with depth of capture of lake trout, and changes with depth in proportions of prey species in lake trout stomachs mirrored changes in proportions of the prey species in trawl catches at the same depth. Alewives (ages 0 and 1) were the only prey fish eaten in substantial quantities by both juvenile lake trout and other salmonines, and thus are a potential focus of competition between these predators.

Comparison of thiaminase activity in fish using the radiometric and 4-nitrothiophenol colorimetric methods

USGS Publications Warehouse

Honeyfield, D.C.; Hanes, J.W.; Brown, L.; Kraft, C.E.; Begley, T.P.

2010-01-01

Thiaminase induced thiamine deficiency occurs in fish, humans, livestock and wild animals. A non-radioactive thiaminase assay was described in 2007, but a direct comparison with the radioactive 14C-thiamine method which has been in use for more than 30years has not been reported. The objective was to measure thiaminase activity in forage fish (alewife Alosa pseudoharengus, rainbow smelt Osmerus mordax, and slimy sculpin Cottus cognatus) consumed by predators that manifest thiamine deficiency using both methods. Modifications were made to the colorimetric assay to improve repeatability. Modification included a change in assay pH, enhanced sample clean-up, constant assay temperature (37??C), increase in the concentration of 4-nitrothiophenol (4NTP) and use of a spectrophotometer fitted with a 0.2cm cell. A strong relationship between the two assays was found for 51 alewife (R2=0.85), 36 smelt (R2=0.87) and 20 sculpin (R2=0.82). Thiaminase activity in the colorimetric assay was about 1000 times higher than activity measured by the radioactive method. Application of the assay to fish species from which no thiaminase activity has previously been reported resulted in no 4NTP thiaminase activity being found in bloater Coregonus hoyi, lake trout Salvelinus namaycusch, steelhead trout Oncorhynchus mykiss or Chinook salmon Oncorhynchus tshawytscha. In species previously reported to contain thiaminase, 4NTP thiaminase activity was measured in bacteria Paenibacillus thiaminolyticus, gizzard shad Dorosoma cepedianum, bracken fern Pteridium aquilinum, quagga mussel Dreissena bugensis and zebra mussels D. polymorpha. ?? 2010.

Regional reference variation provides ecologically meaningful protection criteria for northern world heritage site.

PubMed

Bowman, Michelle; Spencer, Paula; Dubé, Monique; West, David

2010-01-01

Unprecedented rates of resource development and climate change at northern latitudes coupled with a lack of baseline information limits our ability to set ecologically meaningful criteria needed to protect these inherently sensitive ecosystems. We surveyed water and sediment chemistry, community composition of benthic algae and invertebrates and fish, and condition of a sentinel fish species, slimy sculpin (Cottus cognatus), in 2 rivers adjacent to metal mines and in 20 reference rivers in the headwaters of a World Heritage Site, the South Nahanni River Basin, NWT, Canada. The normal range (i.e., mean ± 2 standard deviations) of biological conditions in regional reference sites (grouped by community type) were used to set ecologically meaningful effect sizes. These effect sizes were used in noncentral hypotheses tests to assess the ecological condition of potentially impaired sites. Significant impairments at sites influenced by current and historical mining activity were indicative of mild enrichment (e.g., increased benthic abundance and sculpin condition) and bioaccumulation of metals (e.g., increased concentrations of Cu and Fe in muscle tissue of sculpin). Comparisons between our regional reference study and a concurrent upstream–downstream study showed that the sensitivity of biological endpoints was typically related to the impairment criteria used and not to the type of study design. Concentrations of metals such as Al, Cu, and Fe in river water at reference sites were above federal and regional guidelines, suggesting that these guidelines are not appropriate for the metal-rich headwaters of the South Nahanni River. The ephemerellid mayflies Drunella spinifera and Ephemerella maculata were present in 4 of our study sites; their occurrence had not previously been documented in the Yukon or Northwest Territories. Our results confirmed that the lack of baseline information on the physiochemical and biological composition of northern rivers is hampering our ability to evaluate changes in these understudied ecosystems. However, the use of noncentral hypotheses tests based on empirically derived effect sizes enabled us to develop ecologically meaningful protection criteria, maintain statistical rigor, and provide probabilities of impairment that can be used directly in risk assessment.

Biotic and abiotic factors related to lake herring recruitment in the Wisconsin waters of Lake Superior, 1984-1998

USGS Publications Warehouse

Hoff, Michael H.

2004-01-01

Lake Superior lake herring (Coregonus artedi) recruitment to 13-14 months of age in the Wisconsin waters of Lake Superior varied by a factor of 5,233 during 1984-1998. Management agencies have sought models that accurately predict recruitment, but no satisfactory model had previously been developed. Lake herring recruitment was modeled to determine which factors most explained recruitment variability. The Ricker stock-recruitment model derived from only the paired stock and recruit data explained 35% of the variability in the recruitment data. The functional relationship that explained the greatest amount of recruitment variation (93%) included lake herring stock size, lake trout (Salvelinus namaycush) population size, slimy sculpin (Cottus cognatus) biomass, the interaction of mean daily wind speed in April (month of hatch) and lake herring stock size, and mean air temperature in April (when lake herring are 12-months old). Model results were interpreted to mean that lake herring recruitment was affected negatively by: slimy sculpin predation on lake herring ova; predation on age-0 lake herring by lake trout; and adult cannibalism on lake herring larvae, which was reduced by increased wind speed. April temperature was the variable that explained the least amount of variability in recruitment, but lake herring recruitment was positively affected by a warm April, which shortened winter and apparently reduced first-winter mortality. Stock size caused compensatory, density-dependent mortality on lake herring recruits. Management efforts appear best targeted at stock size protection, and empirical data implies that stock size in the Wisconsin waters of the lake should be maintained at 2.1-15.0 adults/ha in spring, bottom-trawl surveys.

Depth distribution, diet, and overwinter growth of lake trout (Salvelinus namaycush) in southeastern Lake Michigan sampled in December 1981 and March 1982

USGS Publications Warehouse

Eck, Gary W.; Wells, LaRue

1986-01-01

Lake trout were collected in graded-mesh gill nets and forage fishes were collected in trawls in mid December 1981 and late March 1982. The length ranges of 317 lake trout caught in December and 138 in March were 280-767 and 286-857 mm, and the age ranges I-XI and II-XIV, respectively. Three year classes (1977-79) made up almost 80% of the catches of lake trout in both sampling periods. Lake trout were most abundant at depth of 18 to 37 m in December (water temperatures, 5.5-6.8A?C) and at 2864 m in March (water temperatures, 1.0-1.3A?C). Fish of the 1977-79 year classes completed 9 to 24% of their annual growth in length, and 14 to 39% of their growth in weight, between mid December and late March. Lake trout ate mainly alewives (Alosa pseudoharengus), especially young-of-the-year, in December, but primarily slimy sculpins (Cottus cognatus) in March, when alewives were mainly at depths of greater than those occupied by most lake trout. Other important food items were rainbow smelt (Osmerus mordax) and, in deeper water, deepwater sculpins (Myoxocephalus thompsoni). Bloaters (Coregonus hoyi) were eaten only sparingly, although they were abundantly available in both sampling periods. Perhaps this species, which coevolved with the lake trout in Lake Michigan and was important in the native trout's diet, is better able to avoid capture by the trout than are the exotic alewife and rainbow smelt. It may not again become a major forage species unless the other food sources become scarce.

Biology, population structure, and estimated forage requirements of lake trout in Lake Michigan

USGS Publications Warehouse

Eck, Gary W.; Wells, LaRue

1983-01-01

Data collected during successive years (1971-79) of sampling lake trout (Salvelinus namaycush) in Lake Michigan were used to develop statistics on lake trout growth, maturity, and mortality, and to quantify seasonal lake trout food and food availability. These statistics were then combined with data on lake trout year-class strengths and age-specific food conversion efficiencies to compute production and forage fish consumption by lake trout in Lake Michigan during the 1979 growing season (i.e., 15 May-1 December). An estimated standing stock of 1,486 metric tons (t) at the beginning of the growing season produced an estimated 1,129 t of fish flesh during the period. The lake trout consumed an estimated 3,037 t of forage fish, to which alewives (Alosa pseudoharengus) contributed about 71%, rainbow smelt (Osmerus mordax) 18%, and slimy sculpins (Cottus cognatus) 11%. Seasonal changes in bathymetric distributions of lake trout with respect to those of forage fish of a suitable size for prey were major determinants of the size and species compositions of fish in the seasonal diet of lake trout.

Passive sampling of bioavailable organic chemicals in Perry County, Missouri cave streams.

PubMed

Fox, J Tyler; Adams, Ginny; Sharum, Martin; Steelman, Karen L

2010-12-01

Two types of passive samplers--semipermeable membrane devices (SPMDs) and polar organic chemical integrative samplers (POCIS)--were deployed in spring 2008 to assess bioavailable concentrations of aquatic contaminants in five cave streams and resurgences in Perry County, Missouri. Study sites represent areas of high cave biodiversity and the only known habitat for grotto sculpin (Cottus carolinae). Time-weighted average (TWA) water concentrations were calculated for 20 compounds (n = 9 SPMDs; n = 11 POCIS) originating primarily from agricultural sources, including two organochlorine insecticides, dieldrin and heptachlor epoxide, which were found at levels exceeding U.S. EPA criteria for the protection of aquatic life. GIS data were used to quantify and map sinkhole distribution and density within the study area. Infiltration of storm runoff and its influence on contaminant transport were also evaluated using land cover and hydrological data. This work provides evidence of cave stream contamination by a mix of organic chemicals and demonstrates the applicability of passive samplers for monitoring water quality in dynamic karst environments where rapid transmission of storm runoff makes instantaneous water sampling difficult.

Method- and species-specific detection probabilities of fish occupancy in Arctic lakes: Implications for design and management

USGS Publications Warehouse

Haynes, Trevor B.; Rosenberger, Amanda E.; Lindberg, Mark S.; Whitman, Matthew; Schmutz, Joel A.

2013-01-01

Studies examining species occurrence often fail to account for false absences in field sampling. We investigate detection probabilities of five gear types for six fish species in a sample of lakes on the North Slope, Alaska. We used an occupancy modeling approach to provide estimates of detection probabilities for each method. Variation in gear- and species-specific detection probability was considerable. For example, detection probabilities for the fyke net ranged from 0.82 (SE = 0.05) for least cisco (Coregonus sardinella) to 0.04 (SE = 0.01) for slimy sculpin (Cottus cognatus). Detection probabilities were also affected by site-specific variables such as depth of the lake, year, day of sampling, and lake connection to a stream. With the exception of the dip net and shore minnow traps, each gear type provided the highest detection probability of at least one species. Results suggest that a multimethod approach may be most effective when attempting to sample the entire fish community of Arctic lakes. Detection probability estimates will be useful for designing optimal fish sampling and monitoring protocols in Arctic lakes.

Identification of New Tools to Predict Surgical Performance of Novices using a Plastic Surgery Simulator.

PubMed

Kazan, Roy; Viezel-Mathieu, Alex; Cyr, Shantale; Hemmerling, Thomas M; Lin, Samuel J; Gilardino, Mirko S

2018-04-09

To identify new tools capable of predicting surgical performance of novices on an augmentation mammoplasty simulator. The pace of technical skills acquisition varies between residents and may necessitate more time than that allotted by residency training before reaching competence. Identifying applicants with superior innate technical abilities might shorten learning curves and the time to reach competence. The objective of this study is to identify new tools that could predict surgical performance of novices on a mammoplasty simulator. We recruited 14 medical students and recorded their performance in 2 skill-games: Mikado and Perplexus Epic, and in 2 video games: Star War Racer (Sony Playstation 3) and Super Monkey Ball 2 (Nintendo Wii). Then, each participant performed an augmentation mammoplasty procedure on a Mammoplasty Part-task Trainer, which allows the simulation of the essential steps of the procedure. The average age of participants was 25.4 years. Correlation studies showed significant association between Perplexus Epic, Star Wars Racer, Super Monkey Ball scores and the modified OSATS score with r s = 0.8491 (p < 0.001), r s = -0.6941 (p = 0.005), and r s = 0.7309 (p < 0.003), but not with the Mikado score r s = -0.0255 (p = 0.9). Linear regressions were strongest for Perplexus Epic and Super Monkey Ball scores with coefficients of determination of 0.59 and 0.55, respectively. A combined score (Perplexus/Super-Monkey-Ball) was computed and showed a significant correlation with the modified OSATS score having an r s = 0.8107 (p < 0.001) and R 2 = 0.75, respectively. This study identified a combination of skill games that correlated to better performance of novices on a surgical simulator. With refinement, such tools could serve to help screen plastic surgery applicants and identify those with higher surgical performance predictors. Copyright © 2018 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

Resolving the taxonomic conundrum in Graphoderus of the east Palearctic with a key to all species (Coleoptera, Dytiscidae)

PubMed Central

Holmgren, Sandra; Angus, Robert; Jia, Fenglong; Chen, Zhen-ning; Bergsten, Johannes

2016-01-01

Abstract The Holarctic diving beetle genus Graphoderus (Dytiscinae, Aciliini) contains relatively few and well-known species but these may still be difficult to identify based on external characters. A taxonomic problem in the eastern Palearctic was discovered that relates to the Palearctic Graphoderus zonatus (Hoppe, 1795) and the Nearctic Graphoderus perplexus Sharp, 1882. Based on qualitative and quantitative characters, especially on male genitalia which have been poorly studied in the past, it is shown that eastern Palearctic specimens identified by previous authors as either of the two species in fact belongs to a third species. The synonymized name Graphoderus elatus Sharp, 1882, is reinstated as a valid species (stat. n.) and a lectotype is designated from the mixed syntype series. The male genitalia of all known Graphoderus species have been examined and an illustrated identification key to the genus is provided. The three species in the complex of focus, Graphoderus elatus, Graphoderus zonatus and Graphoderus perplexus are found to have allopatric distributions; Graphoderus perplexus in the Nearctic region, Graphoderus zonatus in the west Palearctic region and eastwards to the Yenisei-Angara river and Graphoderus elatus east of the Yenisei-Angara river. All previous records of either Graphoderus zonatus or Graphoderus perplexus in the east Palearctic, east of the Yenisei-Angara river turned out to be misidentified Graphoderus elatus. This conclusion also brings with it that dimorphic females, thought only to be present in the single subspecies Graphoderus zonatus verrucifer (CR Sahlberg, 1824), proved to be present also in a second species, Graphoderus elatus. The dimorphic female forms is either with dorsally smooth elytra and pronotum or conspicuously granulated elytra and wrinkly pronotum. As has been shown in Graphoderus zonatus verrucifer there is a correlation between the occurrence of granulate female forms in a population and an increase in the number of adhesive discs on pro- and mesotarsus in males within Graphoderus elatus. PMID:27110182

Response of fish populations to natural channel design restoration in streams of the Catskill Mountains, New York

USGS Publications Warehouse

Baldigo, Barry P.; Warren, D.R.; Ernst, A.G.; Mulvihill, C.I.

2008-01-01

Many streams and rivers throughout North America have been extensively straightened, widened, and hardened since the middle 1800s, but related effects on aquatic ecosystems have seldom been monitored, described, or published. Beginning in the early 1990s, reach-level restoration efforts began to base projects on natural channel design (NCD) techniques and Rosgen's (1994b, 1996) river classification system in an effort to duplicate or mimic stable reference reach geomorphology. Four reaches in three streams of the Catskill Mountains, New York, were restored from 2000 to 2002 using NCD techniques to decrease bed and bank erosion rates, decrease sediment loads, and improve water quality. The effects of restoration on the health of fish assemblages were assessed through a before-after, control-impact (BACI) study design to quantify the net changes in population and community indices at treatment reaches relative to index changes at unaltered reference reaches from 1999 to 2004. After restoration, community richness and biomass at treatment reaches increased by more than one-third. Changes in fish communities were caused mainly by shifts in dominant species populations; fish community biomass and total fish abundance were generally dominated by daces or daces and sculpins before restoration and by one or more salmonid species after restoration. Density and biomass of eastern blacknose dace Rhinichthys atratulus, longnose dace R. cataractae, and slimy sculpin Cottus cognatus did not change appreciably, whereas net salmonid density and biomass increased substantially after restoration. These changes were driven primarily by large increases in populations of brown trout Salmo trutta. The findings demonstrate that the structure, function, and ultimately the health of resident fish populations and communities can be improved, at least over the short term, through NCD restoration in perturbed streams of the Catskill Mountains. ?? Copyright by the American Fisheries Society 2008.

Effects of introduced fishes on wild juvenile coho salmon in three shallow pacific northwest lakes

USGS Publications Warehouse

Bonar, Scott A.; Bolding, B.D.; Divens, M.; Meyer, W.

2005-01-01

Declines in Pacific salmon Oncorhynchus spp. have been blamed on hydropower, overfishing, ocean conditions, and land use practices; however, less is known about the impacts of introduced fish. Most of the hundreds of lakes and ponds in the Pacific Northwest contain introduced fishes, and many of these water bodies are also important for salmon production, especially of coho salmon O. kisutch. Over 2 years, we examined the predation impacts of 10 common introduced fishes (brown bullhead Ameiurus nebulosus, black crappie Pomoxis nigro-maculatus, bluegill Lepomis macrochirus, golden shiner Notemigonus crysoleucas, green sunfish L. cyanellus, largemouth bass Micropterus salmoides, pumpkinseed L. gibbosus, rainbow trout O. mykiss, warmouth L. gulosus, and yellow perch Perca flavescens) and two native fishes (cutthroat trout O. clarkii and prickly sculpin Cottus asper) on wild juvenile coho salmon in three shallow Pacific Northwest lakes, all located in different watersheds. Of these species, largemouth bass were responsible for an average of 98% of the predation on coho salmon in all lakes, but the total impact to each run varied among lakes and years. Very few coho salmon were eaten by black crappies, brown bullheads, cutthroat trout, prickly sculpin, or yellow perch, whereas other species were not observed to eat coho salmon. Juvenile coho salmon growth in all lakes was higher than in nearby streams. Therefore, food competition between coho salmon and introduced fishes in lakes was probably not limiting coho salmon populations. Largemouth bass are widespread and are present in 85% of lowland warmwater public-access lakes in Washington (n = 421), 84% of those in Oregon (n = 179), and 74% of those in the eight northwesternmost counties in California (n = 19). Future research would help to identify the impact of largemouth bass predation across the region and prioritize lakes where impacts are most severe. Nevertheless, attempts to transplant or increase largemouth bass numbers in lakes important to coho salmon would be counterproductive to coho salmon enhancement efforts. ?? Copyright by the American Fisheries Society 2005.

Habitat use by fishes of Lake Superior. I. Diel patterns of habitat use in nearshore and offshore waters of the Apostle Islands region

USGS Publications Warehouse

Gorman, O.T.; Yule, D.L.; Stockwell, J.D.

2012-01-01

Diel patterns of distribution of fishes in nearshore (15–80 m depth) and offshore (>80 m) waters of the Apostle Islands region of Lake Superior were described using bottom trawls, mid-water trawls, and acoustic gear during day and night sampling. These data revealed three types of diel migration: diel vertical migration (DVM), diel bank migration (DBM), and no migration. DVM was expressed by fishes migrating from benthopelagic to pelagic strata and DBM was expressed by fishes migrating horizontally from deeper waters in the day to shallower waters at night while remaining within the benthopelagic stratum. Most fishes that did not exhibit diel migration showed increased nighttime densities as a result of increased activity and movement from benthic to benthopelagic strata. Rainbow Smelt (Osmerus mordax), Cisco (Coregonus artedi), Bloater (C. hoyi), Kiyi (C. kiyi), juvenile Trout-Perch (Percopsis omiscomaycus), and adult siscowet (Salvelinus namaycush siscowet) exhibited DVM. Lake Whitefish (C. clupeaformis), lean Lake Trout (Salvelinus namaycush namaycush), and juvenile siscowet exhibited DBM. Adult Trout-Perch and adult Pygmy Whitefish (Prosopium coulteri) exhibited a mixture of DBM and DVM. Burbot (Lota lota), Slimy Sculpin (Cottus cognatus), Spoonhead Sculpin (C. ricei), and Deepwater Sculpin (Myoxocephalus thompsonii) did not exhibit diel migration, but showed evidence of increased nocturnal activity. Ninespine Stickleback (Pungitius pungitius) exhibited a mixture of DVM and non-migration. Juvenile Pygmy Whitefish did not show a diel change in density or depth distribution. Species showing ontogenetic shifts in depth distribution with larger, adult life stages occupying deeper waters included, Rainbow Smelt, lean and siscowet Lake Trout, Lake Whitefish, Pygmy Whitefish, Ninespine Stickleback and Trout-Perch. Of these species, siscowet also showed an ontogenetic shift from primarily DBM as juveniles to primarily DVM as adults. Across all depths, fishes expressing DVM accounted for 73% of the total estimated community areal biomass (kg ha−1) while those expressing DBM accounted for 25% and non-migratory species represented 2% of the biomass. The proportion of total community biomass exhibiting DVM increased with depth, from 59% to 95% across ≤30 m to >90 m depth zones. Along the same depth gradient, the proportion of total community biomass exhibiting DBM declined from 40% to 1%, while non-migrators increased from 1% to 4%. These results indicate that DVM and DBM behaviors are pervasive in the Lake Superior fish community and potentially provide strong linkages that effect coupling of benthic and pelagic and nearshore and offshore habitats.

Freshwater sculpins: phylogenetics to ecology

Treesearch

Susan B. Adams; David A. Schmetterling

2007-01-01

Freshwater sculpins (Cottidae) are a diverse and ecologically important component of cool- and coldwater ecosystems throughout the northern hemisphere. More than 60 sculpin species occur in a variety of habitats, and sculpin distributions range from highly localized to widespread. Despite the frequently high biomass of sculpins and their numerous ecosystem functions,...

Food habits of Arctic staghorn sculpin (Gymnocanthus tricuspis) and shorthorn sculpin (Myoxocephalus scorpius) in the northeastern Chukchi and western Beaufort Seas

NASA Astrophysics Data System (ADS)

Gray, Benjamin P.; Norcross, Brenda L.; Beaudreau, Anne H.; Blanchard, Arny L.; Seitz, Andrew C.

2017-01-01

Arctic staghorn sculpin (Gymnocanthus tricuspis) and shorthorn sculpin (Myoxocephalus scorpius) belong to Cottidae, the second most abundant fish family in the western Arctic. Although considered important in food webs, little is known about their food habits throughout this region. To address this knowledge gap, we examined and compared the diets of 515 Arctic staghorn sculpin and 422 shorthorn sculpin using stomachs collected over three summers in the northeastern Chukchi Sea (2010-2012) and one summer in the western Beaufort Sea (2011). We used permutational multivariate analysis of variance (PERMANOVA) and non-metric multidimensional scaling (nMDS) to compare sculpin diets between regions and selected size classes. Differences in mouth morphologies and predator size versus prey size relationships were examined using regression techniques. Arctic staghorn sculpin and shorthorn sculpin diet compositions differed greatly throughout the Chukchi and Beaufort Seas. Regardless of body size, the smaller-mouthed Arctic staghorn sculpin consumed mostly benthic amphipods and polychaetes, whereas the larger-mouthed shorthorn sculpin shifted from a diet composed of benthic and pelagic macroinvertebrates as smaller individuals to shrimps and fish prey as larger individuals. Within shared habitats, the sculpins appear to partition prey, either by taxa or size, in a manner that suggests no substantial overlap occurs between species. This study increases knowledge of sculpin feeding ecology in the western Arctic and offers regional, quantitative diet information that could support current and future food web modeling efforts.

Food of young-of-the-year lake trout (Salvelinus namaycush) in Presque Isle Harbor, Lake Superior

USGS Publications Warehouse

Swedberg, Donald V.; Peck, James W.

1984-01-01

The food habits of young lake trout (Salvelinus namaycush) were studied by examining the digestive tracts of 293 young-of-the-year collected in Presque Isle Harbor, Lake Superior. Lake trout in the 25 to 27-mm length range started to eat food organisms before all of their yolk material was absorbed. Organisms consumed by the 25 to 27-mm young-of-the-year included Chironomidae, Copepoda (Harpacticoida, Calanoida, Cyclopoida), and Cladocerea (Daphnia spp., Bosmina sp., Chydorus sp.). Chironomid pupae and chironomid larvae accounted for 74% and 5%, respectively, of the total volume of food eaten by the young lake trout in Presque Isle Harbor. Although copepods, cladocerans, and mysids were present in many stomachs, their contribution to the total volume of food was only 15%. Some lake trout in the 32 to 54-mm length range had consumed fry of sculpin (Cottus spp.) or rainbow smelt (Osmerus mordax), but the overall contribution of fish fry to the total volume of food was only 4% (frequency of occurrence, 10%). The lake trout in Presque Isle Harbor fed heavily on planktonic organisms, sparingly on benthic organisms, and were opportunistic feeders that appeared to prey on whatever forage organisms were available in the shallow nearshore waters.

Recovery of a mining-damaged stream ecosystem

USGS Publications Warehouse

Mebane, Christopher A.; Eakins, Robert J.; Fraser, Brian G.; Adams, William J.

2015-01-01

Efforts to restore water quality began in 1995, and by 2002 Cu levels had been reduced by about 90%, with incremental declines since. Rainbow Trout (Oncorhynchus mykiss) were early colonizers, quickly expanding their range as areas became habitable when Cu concentrations dropped below about 3X the U.S. Environmental Protection Agency's biotic ligand model (BLM) based chronic aquatic life criterion. Anadromous Chinook Salmon (O. tshawytscha) and steelhead (O. mykiss) have also reoccupied Panther Creek. Full recovery of salmonid populations occurred within about 12-years after the onset of restoration efforts and about 4-years after the Cu chronic criteria had mostly been met, with recovery interpreted as similarity in densities, biomass, year class strength, and condition factors between reference sites and mining-influenced sites. Shorthead Sculpin (Cottus confusus) were slower than salmonids to disperse and colonize. While benthic macroinvertebrate biomass has increased, species richness has plateaued at about 70 to 90% of reference despite the Cu criterion having been met for several years. Different invertebrate taxa had distinctly different recovery trajectories. Among the slowest taxa to recover were Ephemerella, Cinygmula and Rhithrogena mayflies, Enchytraeidae oligochaetes, and Heterlimnius aquatic beetles. Potential reasons for the failure of some invertebrate taxa to recover include competition, and high sensitivity to Co and Cu.

Acute toxicity of zinc to several aquatic species native to the Rocky Mountains.

PubMed

Brinkman, Stephen F; Johnston, Walter D

2012-02-01

National water-quality criteria for the protection of aquatic life are based on toxicity tests, often using organisms that are easy to culture in the laboratory. Species native to the Rocky Mountains are poorly represented in data sets used to derive national water-quality criteria. To provide additional data on the toxicity of zinc, several laboratory acute-toxicity tests were conducted with a diverse assortment of fish, benthic invertebrates, and an amphibian native to the Rocky Mountains. Tests with fish were conducted using three subspecies of cutthroat trout (Colorado River cutthroat trout Oncorhynchus clarkii pleuriticus, greenback cutthroat trout O. clarkii stomias, and Rio Grande cutthroat trout O. clarkii virginalis), mountain whitefish (Prosopium williamsoni), mottled sculpin (Cottus bairdi), longnose dace (Rhinichthys cataractae), and flathead chub (Platygobio gracilis). Aquatic invertebrate tests were conducted with mayflies (Baetis tricaudatus, Drunella doddsi, Cinygmula sp. and Ephemerella sp.), a stonefly (Chloroperlidae), and a caddis fly (Lepidostoma sp.). The amphibian test was conducted with tadpoles of the boreal toad (Bufo boreas). Median lethal concentrations (LC(50)s) ranged more than three orders of magnitude from 166 μg/L for Rio Grande cutthroat trout to >67,000 μg/L for several benthic invertebrates. Of the organisms tested, vertebrates were the most sensitive, and benthic invertebrates were the most tolerant.

Observations of the distributions of five fish species in a small Appalachian stream

USGS Publications Warehouse

Larson, Gary L.; Hoffman, Robert L.; Moore, S.E.

2002-01-01

The notion has been growing that resident stream fishes exhibit a greater capacity for movement than was previously thought. In this study, we recorded the distributions of four resident fish species (longnose dace Rhinichthys cataractae, blacknose dace R. atratulus, mottled sculpin Cottus bairdi, and rainbow trout Oncorhynchus mykiss) and one nonresident species (central stoneroller Campostoma anomalum) in Rock Creek, a small tributary of Cosby Creek in Great Smoky Mountains National Park, over the period 1979a??1995. During this study, 1,998 individuals of resident species were collected from stream sections considered to be within a common area of distribution for each species. Forty-five individuals of resident and nonresident species were captured upstream of these areas, and eight of these fish were considered to be larger than individuals considered typical for each species. Small mammal dispersal theory concepts were used to classify and describe fish movements outside of common areas of distribution. These movements were identified as important in maintaining population connectivity within stream drainages, contributing to reducing the potential for local extinctions of populations and to the recolonization of unoccupied habitats. This study highlights the need for continued study of fish movements in stream drainages and for development of appropriate resource management strategies based partly on the spatial dynamics of fish populations and communities.

Metal residues, histopathology and presence of parasites in the liver and gills of fourhorn sculpin (Myoxocephalus quadricornis) and shorthorn sculpin (Myoxocephalus scorpius) near a former lead-zinc mine in East Greenland

DOE Office of Scientific and Technical Information (OSTI.GOV)

Dang, Mai

Fourhorn sculpins (Myoxocephalus quadricornis) and shorthorn sculpins (Myoxocephalus scorpius) have been considered suitable local bioindicators for environmental monitoring studies in the Arctic. Because these species share many characteristics, data from the two species have previously been pooled when assessing marine metal contamination. A chemical and histological study was conducted on fourhorn and shorthorn sculpins collected around a contaminated lead-zinc mine at East Greenland to investigate whether there were any differences in the residues of metals, histopathology and parasites in liver and gills between the two sculpin species. The results demonstrated that concentrations of copper (Cu), zinc (Zn), mercury (Hg) andmore » lead (Pb) were significantly higher in the fourhorn sculpins (p<0.001) while there were no significant differences for arsenic (As) or cadmium (Cd). Furthermore, density of blood vessel fibrosis (p=0.028), prevalence and density of chondroplasia (p=0.002 and p=0.005, respectively), number of mucin-containing mucous cells (p<0.001) and chloride cells (p<0.001) and mean intensity of colonial Peritricha (p<0.001) were significantly higher in fourhorn sculpin. Based on these results we suggest that pooling the two species when conducting environmental assessments is not recommended as it can lead to incorrect conclusions. We propose that a larger study investigating the biological effects of zinc-lead mining in Greenland is needed. - Highlights: • Fourhorn sculpins (Myoxocephalus quadricornis) more sensitive to pollution than shorthorn sculpins (Myoxocephalus scorpius). • Metal residues, histological changes and presence of parasites were species-specific. • Different sculpin species should not be pooled together as pollution biomarkers.« less

A comparative analysis of experimental selection on the stickleback pelvis.

PubMed

Miller, S E; Barrueto, M; Schluter, D

2017-06-01

Mechanisms of natural selection can be identified using experimental approaches. However, such experiments often yield nonsignificant effects and imprecise estimates of selection due to low power and small sample sizes. Combining results from multiple experimental studies might produce an aggregate estimate of selection that is more revealing than individual studies. For example, bony pelvic armour varies conspicuously among stickleback populations, and predation by vertebrate and insect predators has been hypothesized to be the main driver of this variation. Yet experimental selection studies testing these hypotheses frequently fail to find a significant effect. We experimentally manipulated length of threespine stickleback (Gasterosteus aculeatus) pelvic spines in a mesocosm experiment to test whether prickly sculpin (Cottus asper), an intraguild predator of stickleback, favours longer spines. The probability of survival was greater for stickleback with unclipped pelvic spines, but this effect was noisy and not significant. We used meta-analysis to combine the results of our mesocosm experiment with previously published experimental studies of selection on pelvic armour. We found evidence that fish predation indeed favours increased pelvic armour, with a moderate effect size. The same approach found little evidence that insect predation favours reduced pelvic armour. The causes of reduced pelvic armour in many stickleback populations remain uncertain. © 2017 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2017 European Society For Evolutionary Biology.

Evaluating the negative effect of benthic egg predators on bloater recruitment in northern Lake Michigan

USGS Publications Warehouse

Bunnell, David B.; Mychek-Londer, Justin G.; Diana, James S.; Stott, Wendylee; Madenjian, Charles P.

2012-01-01

As the only extant deepwater cisco in Lake Michigan, bloater is currently at record low levels of abundance.  Several mechanisms to regulate their recruitment have been proposed, including skewed sex ratios, predation on their larvae by adult alewife, and climatic factors during early life history stages, but none has unequivocal support.  In this research, we evaluated an alternative mechanism of egg predation that was supported by an inverse relationship between bloater recruitment and biomass of slimy sculpin, which are known to be effective egg predators.  To that end, we used a combination of field sampling, laboratory experiments, and modeling to estimate the proportion of bloater eggs consumed by sculpins each year between 1973 and 2008.  Monthly field sampling between January through May 2009-2010 (when bloater eggs were incubating) offshore of Frankfort (Michigan), Sturgeon Bay (Wisconsin), Two Rivers (Wisconsin), and Muskegon (Michigan) provided benthivore diets for subsequent laboratory processing.  Identification and enumeration of stomach contents and subsequent genetic analyses of eggs revealed that the mean proportion of bloater eggs in slimy sculpin diets (N = 1016) equaled 0.04.  Bloater eggs also were consumed by deepwater sculpins (N = 699) at a slightly lower mean proportion (0.02), and only one round goby diet among 552 enumerated revealed a bloater egg.  Based on the diet results, we developed daily ration models to estimate consumption for both deepwater and slimy sculpins.  We conducted feeding experiments to estimate gastric evacuation (GEVAC) for water temperatures ranging 2-5 °C, similar to those observed during egg incubation.  GEVAC rates equaled 0.0115/ h for slimy sculpin and 0.0147/h for deepwater sculpin, and did not vary between 2.7 and 5.1 °C for either species or between prey types (Mysis relicta and fish eggs) for slimy sculpin.  Index of fullness [(g prey/g fish weight)100%] was estimated from sculpins sampled in bottom trawls in the same seasons and years as the diets, and varied with fish size (averaging 1.93% and 1.85% for slimy and deepwater sculpins, respectively).  Estimates of daily consumption ranged from 0.2-0.8% of sculpin body weight.  Annual estimates of bloater egg consumption predicted higher values for deepwater sculpin than slimy sculpin between 1973 and 2005.  This pattern was reversed in 2006, 2008, 2009, 2010 as slimy sculpin abundance increased while that of deepwater sculpin declined.  The sum of sculpin consumption of bloater eggs exceeded 25% of bloater population egg production early (1975-1980) and late (2008-2010) in the time series.  Despite the strong field pattern implicating egg predation by slimy sculpin, our consumption models failed to fully support this hypothesis.  In particular, our results were unable to explain why bloater recruitment was relatively poor during 1995-2005 when the proportion of bloater eggs consumed was very low (< 0.06).  The results did, however, demonstrate that bloater recruitment was consistently poor when the proportion of eggs consumed was relatively high.  In conclusion, consumption by native benthivores can be a contributing factor to poor recruitment of bloater, especially when slimy sculpin reach high levels of abundance.  This result exemplifies the importance of ecosystem-based fishery management, given that the maintenance of healthy lake trout populations in the Great Lakes should control the abundance of slimy sculpin egg predators.  In addition, future research will be required to fully understand the primary bottleneck to bloater recruitment in Lake Michigan so that efforts to stock and restore bloater in Lake Ontario have a greater probability of resulting in naturalized and sustainable populations.

Appearance and possible homing of two species of sculpins in Maine tidepools

USGS Publications Warehouse

Muring, J.R.

2001-01-01

Two species of sculpins (Cottidae), the grubby, Myoxocephalus aenaeus, and the shorthorn sculpin, M. scorpius, were studied in rocky tidepools along the coast of Maine. Fishes were captured and measured during 116 sampling trips between 1979 and 1996. Both of these species of sculpins are from the northwestern Atlantic Ocean and are present in tidepools nearly every month of the year and are the only fish species found in Maine tidepools during winter. Both sculpin species are important components of tidepool ecosystems and dominate the rocky tidepool fish communities from late autumn to early spring, a time when other fish species decline in abundance or are absent. There was no apparent relationship between sculpin abundance and salinity, but the two species of Myoxocephalus were encountered in water temperatures of 1.5 to 18.9??C, with 55.0% of the shorthorn sculpins and 57.3% of the grubbies encountered in tidepools where water temperatures ranged from 12 to 15??C. Between 1988 and 1996, 102 individuals from both species were marked. Of these, 21.3% were recaptured, some repeatedly in the same tidepools and even at specific locations within tidepools over successive tidal cycles - an indication of homing behavior.

AN INDIVIDUAL-BASED MODEL OF COTTUS POPULATION DYNAMICS

EPA Science Inventory

We explored population dynamics of a southern Appalachian population of Cottus bairdi using a spatially-explicit, individual-based model. The model follows daily growth, mortality, and spawning of individuals as a function of flow and temperature. We modeled movement of juveniles...

Aquaculture disturbance impacts the diet but not ecological linkages of a ubiquitous predatory fish

USGS Publications Warehouse

McPeek, Kathleen C.; McDonald, P. Sean; VanBlaricom, Glenn

2015-01-01

Aquaculture operations are a frequent and prominent cause of anthropogenic disturbance to marine and estuarine communities and may alter species composition and abundance. However, little is known about how such disturbances affect trophic linkages or ecosystem functions. In Puget Sound, Washington, aquaculture of the Pacific geoduck clam (Panopea generosa) is increasing and involves placing nets and polyvinyl chloride (PVC) tubes in intertidal areas to protect juvenile geoducks from predators. Initial studies of the structured phase of the farming cycle have documented limited impacts on the abundance of some species. To examine the effect of geoduck aquaculture on ecological linkages, the trophic relationships of a local ubiquitous consumer, Pacific staghorn sculpin (Leptocottus armatus), to its invertebrate prey were compared between geoduck aquaculture sites and nearby reference areas with no aquaculture. Mark-recapture data indicated that sculpin exhibit local site fidelity to cultured and reference areas. The stomach contents of sculpin and stable isotope signatures of sculpin and their prey were examined to study the trophic ecology of cultured and reference areas. Results showed that the structured phase of geoduck aquaculture initiated some changes to staghorn sculpin ecology, as reflected in sculpin diet through stomach content analysis. However, carbon and nitrogen stable isotopes revealed that the general food web function of sculpin remained unchanged. The source of carbon at the base of the food web and the trophic position of sculpin were not impacted by geoduck aquaculture. The study has important implications for geoduck aquaculture management and will inform regulatory decisions related to shellfish aquaculture policy.

Population demographics and life history of the round hickorynut (Obovaria subrotunda) in the Duck River, Tennessee

USGS Publications Warehouse

Ehlo, Chase A.; Layzer, James B.

2014-01-01

Population characteristics and life history aspects of healthy mussel populations are poorly understood. The reproductive cycle, age and growth, and population structure of Obovaria subrotunda were examined at four sites in the middle Duck River, Tennessee. Obovaria subrotunda was confirmed to be a bradytictic species, spawning in the late summer and holding glochidia in the gills for 11 mo until the following summer. Fecundity was positively related to mussel length (R2  =  0.75) and ranged from 7122 to 76,584 glochidia. Fourteen species of fish found in the Duck River, in the families Percidae, Cyprinidae, and Cottidae, were infested with glochidia in the laboratory to examine potential hosts. Juveniles transformed onEtheostoma blennioides (greenside darter), E. obama (spangled darter), E. flabellare (fantail darter), and Cottus carolinae (banded sculpin). Analyses of shell thin-sections indicated that males grew faster and obtained a larger size than females. Individuals live to at least 14 y old. Females became sexually mature at age one. Four sites were quantitatively sampled using a systematic design with three random starts. The observed ratio of adult males to females (0.9∶1) did not differ significantly from 1∶1. Results of the quantitative sampling showed an increase in density compared to earlier studies and a high proportion of 1 to 5 y old O. subrotunda.

Mixed-source reintroductions lead to outbreeding depression in second-generation descendents of a native North American fish

USGS Publications Warehouse

Huff, D.D.; Miller, L.M.; Chizinski, C.J.; Vondracek, B.

2011-01-01

Reintroductions are commonly employed to preserve intraspecific biodiversity in fragmented landscapes. However, reintroduced populations are frequently smaller and more geographically isolated than native populations. Mixing genetically, divergent sources are often proposed to attenuate potentially low genetic diversity in reintroduced populations that may result from small effective population sizes. However, a possible negative tradeoff for mixing sources is outbreeding depression in hybrid offspring. We examined the consequences of mixed-source reintroductions on several fitness surrogates at nine slimy sculpin (Cottus cognatus) reintroduction sites in south-east Minnesota. We inferred the relative fitness of each crosstype in the reintroduced populations by comparing their growth rate, length, weight, body condition and persistence in reintroduced populations. Pure strain descendents from a single source population persisted in a greater proportion than expected in the reintroduced populations, whereas all other crosstypes occurred in a lesser proportion. Length, weight and growth rate were lower for second-generation intra-population hybrid descendents than for pure strain and first-generation hybrids. In the predominant pure strain, young-of the-year size was significantly greater than any other crosstype. Our results suggested that differences in fitness surrogates among crosstypes were consistent with disrupted co-adapted gene complexes associated with beneficial adaptations in these reintroduced populations. Future reintroductions may be improved by evaluating the potential for local adaptation in source populations or by avoiding the use of mixed sources by default when information on local adaptations or other genetic characteristics is lacking. ?? 2011 Blackwell Publishing Ltd.

77 FR 59488 - Endangered and Threatened Wildlife and Plants; Endangered Status for Grotto Sculpin and...

Federal Register 2010, 2011, 2012, 2013, 2014

2012-09-27

... Resurgence. Grotto sculpin tend to be associated with a high availability of invertebrate prey, deeper cave... sculpin was assigned an LPN of 2 due to imminent threats of a high magnitude. On May 11, 2004, we received.... 5; Day 2008, p. 12). Overall recapture rates were highest in fall and winter (32 percent each) and...

Declines in deepwater sculpin Myoxocephalus thompsonii energy density associated with the disappearance of Diporeia spp. in lakes Huron and Michigan

USGS Publications Warehouse

Pothoven, S.A.; Hondorp, D.W.; Nalepa, T.F.

2011-01-01

The deepwater sculpin Myoxocephalus thompsonii is a glacial relict in the Laurentian Great Lakes that primarily consumes two glacial relict crustaceans, Mysis relicta and Diporeia spp. Deepwater sculpin were collected in Lake Michigan off Little Sable Point (in 2001) and Muskegon, Michigan (in 2001 and 2009), and in Lake Huron off Harbor Beach, Michigan (in 2007) for energy density and diet analyses. These sites and years represented differences in available prey. In Lake Michigan, energy densities of deepwater sculpin in 2001 were similar to those reported in 1969-1971. In contrast, energy content declined at least 26% at Muskegon between 2001 and 2009. Overall, energy density was 31-34% higher at a site with abundant Diporeia spp. compared with two sites without Diporeia spp. Deepwater sculpin diets consisted primarily of M. relicta at all sites, but included 10-17% (dry mass) Diporeia spp. at sites where this crustacean was still abundant. Food biomass in stomachs was higher at sites with abundant Diporeia spp. than at those without Diporeia spp. Deepwater sculpin energy density and food biomass in stomachs were similar between two sites without Diporeia spp. despite differences in abundance of remaining prey, M. relicta. Declines in deepwater sculpin energy density suggest the potential for further effects on other species and changes in the flow of energy through the food web of the Great Lakes. Published 2010. This article is a US Government work and is in the public domain in the USA.

Deepwater sculpin status and recovery in Lake Ontario

USGS Publications Warehouse

Weidel, Brian C.; Walsh, Maureen; Connerton, Michael J.; Lantry, Brian F.; Lantry, Jana R.; Holden, Jeremy P.; Yuille, Michael J.; Hoyle, James A.

2017-01-01

Deepwater sculpin are important in oligotrophic lakes as one of the few fishes that use deep profundal habitats and link invertebrates in those habitats to piscivores. In Lake Ontario the species was once abundant, however drastic declines in the mid-1900s led some to suggest the species had been extirpated and ultimately led Canadian and U.S. agencies to elevate the species' conservation status. Following two decades of surveys with no captures, deepwater sculpin were first caught in low numbers in 1996 and by the early 2000s there were indications of population recovery. We updated the status of Lake Ontario deepwater sculpin through 2016 to inform resource management and conservation. Our data set was comprised of 8431 bottom trawls sampled from 1996 to 2016, in U.S. and Canadian waters spanning depths from 5 to 225 m. Annual density estimates generally increased from 1996 through 2016, and an exponential model estimated the rate of population increase was ~ 59% per year. The mean total length and the proportion of fish greater than the estimated length at maturation (~ 116 mm) generally increased until a peak in 2013. In addition, the mean length of all deepwater sculpin captured in a trawl significantly increased with depth. Across all years examined, deepwater sculpin densities generally increased with depth, increasing sharply at depths > 150 m. Bottom trawl observations suggest the Lake Ontario deepwater sculpin population has recovered and current densities and biomass densities may now be similar to the other Great Lakes.

Benthic prey fish assessment, Lake Ontario 2013

USGS Publications Warehouse

Weidel, Brian C.; Walsh, Maureen; Connerton, Michael J.

2014-01-01

The 2013 benthic fish assessment was delayed and shortened as a result of the U.S. Government shutdown, however the assessment collected 51 of the 62 planned bottom trawls. Over the past 34 years, Slimy Sculpin abundance in Lake Ontario has fluctuated, but ultimately decreased by two orders of magnitude, with a substantial decline occurring in the past 10 years. The 2013 Slimy Sculpin mean bottom trawl catch density (0.001 ind.·m-2, s.d.= 0.0017, n = 52) and mean biomass density (0.015 g·m-2 , s.d.= 0.038, n = 52) were the lowest recorded in the 27 years of sampling using the original bottom trawl design. From 2011-2013, the Slimy Sculpin density and biomass density has decreased by approximately 50% each year. Spring bottom trawl catches illustrate Slimy Sculpin and Round Goby Neogobius melanostoma winter habitat overlaps for as much as 7 months out of a year, providing opportunities for competition and predation. Invasive species, salmonid piscivory, and declines in native benthic invertebrates are likely all important drivers of Slimy Sculpin population dynamics in Lake Ontario. Deepwater Sculpin Myoxocephalus thompsonii, considered rare or absent from Lake Ontario for 30 years, have generally increased over the past eight years. For the first time since they were caught in this assessment, Deepwater Sculpin density and biomass density estimates declined from the previous year. The 2013 abundance and density estimates for trawls covering the standard depths from 60m to 150m was 0.0001 fish per square meter and 0.0028 grams per square meter. In 2013, very few small (< 80 mm) Deepwater Sculpin were caught and most sculpin were at sites of 150 meters or greater, which is in contrast to previous years when juvenile fish were caught around 80-100 meters. The reduced effort and late seasonal timing of the 2013 assessment make it difficult to have high confidence in declines observed in 2013, however observed Alewife Alosa psuedoharengus abundance increases and reduced juvenile Deepwater Sculpin catches are consistent with the hypothesis that Alewife negatively influence Deepwater Sculpin recruitment. Nonnative Round Gobies were first detected in the USGS/NYSDEC Lake Ontario spring Alewife assessment in 2002. Since that assessment, observations indicate their population has expanded and they are now found along the entire south shore of Lake Ontario, with the highest densities in U.S. waters just east of the Niagara River confluence. In the 2013 spring-based assessment, both the abundance and weight indices increased slightly as compared to 2012. The number index value of 16.6 was 30% of the maximum number observed in 2008 when the number index was 95.2. Round Goby density estimates from the 2013 fall benthic prey fish survey were 33 times greater than fall Slimy Sculpin density, indicating Round Goby are now the dominant Lake Ontario benthic prey fish.

Fall diet and bathymetric distribution of deepwater sculpin (Myoxocephalus thompsonii) in Lake Huron

USGS Publications Warehouse

O'Brien, T. P.; Roseman, E.F.; Kiley, C.S.; Schaeffer, J.S.

2009-01-01

Deepwater sculpin Myoxocephalus thompsonii are an important component of Great Lake's offshore benthic food webs. Recent declines in deepwater sculpin abundance and changes in bathymetric distribution may be associated with changes in the deepwater food web of Lake Huron, particularly, decreased abundance of benthic invertebrates such as Diporeia. To assess how deepwater sculpins have responded to recent changes, we examined a fifteen-year time series of spatial and temporal patterns in abundance as well as the diets of fish collected in bottom trawls during fall of 2003, 2004, and 2005. During 1992-2007, deepwater sculpin abundance declined on a lake-wide scale but the decline in abundance at shallower depths and in the southern portion of Lake Huron was more pronounced. Of the 534 fish examined for diet analysis, 97% had food in the stomach. Mysis, Diporeia, and Chironomidae were consumed frequently, while sphaerid clams, ostracods, fish eggs, and small fish were found in only low numbers. We found an inverse relationship between prevalence of Mysis and Diporeia in diets that reflected geographic and temporal trends in abundance of these invertebrates in Lake Huron. Because deepwater sculpins are an important trophic link in offshore benthic food webs, declines in population abundance and changes in distribution may cascade throughout the food web and impede fish community restoration goals.

Lake Ontario benthic prey fish assessment, 2016

USGS Publications Warehouse

Weidel, Brian C.; Walsh, Maureen; Holden, Jeremy P.; Connerton, Michael J.

2017-01-01

Benthic prey fishes are a critical component of the Lake Ontario food web, serving as energy vectors from benthic invertebrates to native and introduced piscivores. Beginning in 1978, Lake Ontario benthic prey fishes were assessed using bottom trawls collected from the lake’s south shore (depth range: 8 – 150 m). Historically, the survey targeted the then dominant species, Slimy Sculpin, however in 2015, the Benthic Prey Fish Survey was cooperatively expanded to a whole-lake survey, to address resource management information needs related to Round Goby, Deepwater Sculpin, and nearshore native fishes. In 2016, 142 trawls were collected at 18 transects, and spanned depths from 6 – 225 m. Trawl catches indicated the benthic and demersal prey fish community was dominated by Round Goby, however the proportional importance of native Deepwater Sculpin is increasing. Species-specific assessments found lake-wide Round Goby density (~600 fish per hectare) was slightly lower in 2016 relative to 2015. Deepwater Sculpin density has generally increased since 2004. In 2016 their estimated density was greater than 100 fish per hectare. Slimy Sculpin density (15 fish/ha) was similar to the past 3 years. Catches of juvenile Slimy Sculpin continue to be low relative to historic catches and the timing of their decline coincides with the proliferation of Round Goby. Additionally, we found a strong negative relationship between trawl catches of Round Goby and near-shore native benthic and demersal fishes such as Trout-perch, Johnny Darter and Spottail Shiner. The introduction of Round Goby and the reappearance of native Deepwater Sculpin have shaped the Lake Ontario benthic prey fish community.

Life history and propagation of the endangered dromedary pearlymussel (Dromus dromas) (Bivalvia:Unionidae)

USGS Publications Warehouse

Jones, J.W.; Neves, R.J.; Ahlstedt, S.A.; Mair, R.A.

2004-01-01

The reproduction, demography, and propagation of the endangered dromedary pearlymussel (Dromus dromas) (Lea, 1834) were studied in the Clinch and Powell rivers, Tennessee. Viable populations of the dromedary pearlymussel now occur only in the Clinch and Powell rivers; the species has been extirpated from the remaining portions of its range in the Cumberland and Tennessee river drainages. Females are long-term winter brooders, and they are gravid from October to June. Glochidia are contained in conglutinates that are red to white and resemble freshwater leeches or flatworms. Conglutinates are 20 to 40 mm long and are released through the excurrent aperture. Estimates of fecundity based on 7 gravid females collected from the Clinch River were 55,110 to 253,050 glochidia/mussel. The ages of 66 valves of D. dromas were determined by thin-sectioning and ranged from 3 to 25 y. Annual growth averaged 5 mm/y until age 10 and decreased to ???1.2 mm/ y thereafter. Nineteen fish species were tested for suitability as hosts for glochidia. Ten were confirmed as hosts through induced infestations of glochidia: black sculpin (Cottus baileyi), greenside darter (Etheostoma blennioides), fantail darter (Etheostoma flabellare), snubnose darter (Etheostoma simoterum), tangerine darter (Percina aurantiaca), blotchside logperch (Percina burtoni), logperch (Percina caprodes), channel darter (Percina copelandi), gilt darter (Percina evides), and Roanoke darter (Percina roanoka). Juveniles produced from these hosts were cultured in dishes held in nonrecirculating aquaculture systems containing fine sediment (<105 ??m) and were fed the green alga Nannochloropsis oculata every 2 d. Survival of 2810 newly metamorphosed juveniles was 836 (29.7%) after 1 to 2 wk.

Introduced northern pike predation on salmonids in southcentral Alaska

USGS Publications Warehouse

Sepulveda, Adam J.; Rutz, David S.; Ivey, Sam S.; Dunker, Kristine J.; Gross, Jackson A.

2013-01-01

Northern pike (Esox lucius) are opportunistic predators that can switch to alternative prey species after preferred prey have declined. This trophic adaptability allows invasive pike to have negative effects on aquatic food webs. In Southcentral Alaska, invasive pike are a substantial concern because they have spread to important spawning and rearing habitat for salmonids and are hypothesised to be responsible for recent salmonid declines. We described the relative importance of salmonids and other prey species to pike diets in the Deshka River and Alexander Creek in Southcentral Alaska. Salmonids were once abundant in both rivers, but they are now rare in Alexander Creek. In the Deshka River, we found that juvenile Chinook salmon (Oncorhynchus tshawytscha) and coho salmon (O. kisutch) dominated pike diets and that small pike consumed more of these salmonids than large pike. In Alexander Creek, pike diets reflected the distribution of spawning salmonids, which decrease with distance upstream. Although salmonids dominated pike diets in the lowest reach of the stream, Arctic lamprey (Lampetra camtschatica) and slimy sculpin (Cottus cognatus) dominated pike diets in the middle and upper reaches. In both rivers, pike density did not influence diet and pike consumed smaller prey items than predicted by their gape-width. Our data suggest that (1) juvenile salmonids are a dominant prey item for pike, (2) small pike are the primary consumers of juvenile salmonids and (3) pike consume other native fish species when juvenile salmonids are less abundant. Implications of this trophic adaptability are that invasive pike can continue to increase while driving multiple species to low abundance.

Causes of acidification of four streams on Laurel Hilld in southwestern Pennsylvania

USGS Publications Warehouse

Sharpe, William E.; DeWalle, David R.; Leibfried, Robert T.; Dinicola, Richard S.; Kimmel, William G.; Sherwin, Lysle S.

1984-01-01

Atmospheric deposition, soils developed from bedrock, a natural bog, gas wells, and a ski area were all investigated as possible sources of water quality degradation for four streams on Laurel Hill in southwestern Pennsylvania where fish kills have been reported since 1960. An intensive study of the chemistry of atmospheric deposition, soil leachate, and stream water and fish populations was conducted on these basins during 1980–1981 with emphasis on dormant season periods with runoff from snowmelt and rain. Although bedrock geology was found to control the natural buffering capacity of these streams, only acid precipitation could be linked to sharp drops in pH and increases in total Al concentrations observed during stormflows in the poorly buffered streams. Three poorly buffered streams exhibited drops to pH 4.4 to 4.5 and increases in total Al concentrations up to 1.5 mg/L during observed peak flows. Mineral soil leachate from the three major soil series on the basins during this time exhibited a low pH of 4.3 and mean total Al concentrations of 3.6 mg/L, indicating stream response during storms was closely linked to chemistry of soil leachate. Poorly buffered streams did not support reproducing populations of trout (Salmonidae sp.) or other fishes. In contrast, one well-buffered stream (20 mg/L CaCO3) exhibited drops to pH 5.5 during peak flow and supported reproducing trout and sculpin (Cottus bairdi) populations. The acidification of the four streams studied was attributed to atmospheric deposition.

Laboratory studies on the vulnerability of young white sturgeon to predation

USGS Publications Warehouse

Gadomski, D.M.; Parsley, M.J.

2005-01-01

Despite evidence of annual spawning by white sturgeon Acipenser transmontanus in rivers of the northwestern United States and Canada, in some years and locations little or no recruitment of age-0 white sturgeon has been observed. We examined the vulnerability of white sturgeon larvae and juveniles to predation to further understand possible causes of mortality. We were particularly interested in the vulnerability of older larvae and juveniles because at about 25 mm total length (TL) white sturgeon develop sharp dorsal and lateral scutes that may act as a morphological defense. In the laboratory, white sturgeon ranging from newly hatched larvae to about 170-mm TL juveniles were exposed to predatory fishes they might encounter in the natural environment. We found that channel catfish Ictalurus punctatus (mean TL = 464 mm) and northern pikeminnow Ptychocheilus oregonensis (mean TL = 472 mm) ate white sturgeon up to mean sizes of 121 and 134 mm TL, respectively. Conversely, similarly sized walleyes Sander vitreus ingested almost no white sturgeon, although juvenile walleyes (mean TL = 184 mm) ate white sturgeon up to 59 mm TL. The smallest predator we tested, prickly sculpins Cottus asper (mean TL = 126 mm), ate white sturgeon up to a mean TL of 50 mm. Our study demonstrated that predation is a likely cause of mortality of age-0 white sturgeon and may be contributing to the year-class failures that have been observed. In addition, the results from this study could be used to reduce the predation risk of artificially propagated white sturgeon released to augment declining populations since fish could be reared to sizes where their vulnerability is low.

Development of a Procedure for the Selection of Candidate Vessels of Opportunity in Support of the Submarine Rescue Diving and Recompression System

DTIC Science & Technology

2005-06-01

ACRONYMS AHT Anchor Handling Tug AP After Perpendicular ASRV Australian Submarine Rescue Vehicle ASSET Advanced Surface Ship Evaluation Tool AUWS...Five hours after the Squalus sank, its sister ship, USS Sculpin began searching at the Squalus’ reported position prior to diving. Due to an error...ashore in recording that position, Sculpin was searching five miles from Squalus’ actual position. Finally, Ensign Ned Denby on 21 the bridge of Sculpin

Evaluation of the use of common sculpin (Myoxocephalus scorpius) organ histology as bioindicator for element exposure in the fjord of the mining area Maarmorilik, West Greenland

DOE Office of Scientific and Technical Information (OSTI.GOV)

Sonne, Christian, E-mail: csh@dmu.dk; Bach, Lis; Søndergaard, Jens

The former Black Angel lead–zinc mine in Maarmorilik, West Greenland, is a historic example of how mining activity may result in a significant impact on the surrounding fjord system in terms of elevated concentrations of especially lead (Pb) and zinc (Zn) in seawater, sediments and surrounding biota. In order to shed light on the present contamination and possible effects in the fjord we initiated a range of studies including a pilot study on gill and liver morphology of common sculpins (Myoxocephalus scorpius) around Maarmorilik. Sculpins were caught and sampled at five different stations known to represent a gradient of Pbmore » concentrations. Fish livers from all specimens were analyzed for relevant elements in the area: Fe, Zn, As, Cu, Se, Cd, Pb, Ag, Hg, Co and Ni. Lead, As and Hg showed significant differences among the five stations. For 20% of the sculpins, Hg concentrations were in the range of lowest observed effect dose (LOED) of 0.1–0.5 μg/g ww for toxic threshold on reproduction and subclinical endpoints. Likewise LOEDs for tissue lesions, LOEDs for biochemistry, growth, survival and reproduction were exceeded for Cd (0.42–1.8 μg/g ww) and for As (11.6 μg/g ww) in 28% and 85% of the sculpins, respectively. Similar to this, the no observed effect dose (NOED) for biochemistry was exceeded for Pb (0.32 μg/g ww) and for growth, mortality and reproduction for Zn (60–68 μg/g ww) in 33% and 24% of the sculpins, respectively. For all sculpins, females were significantly larger than males and for five of the elements (Fe, Co, Ni, Cu, Se) females had higher concentrations. The chronic lesions observed in liver (mononuclear cell infiltrates, necrosis, vacuolar hepatocytes, portal fibrosis, bile duct hyperplasia, active melanomacrophage centers) and gills (fusion and edema of secondary lamellae, laminar telangiectasis, mononuclear cell infiltrates, blebs) were similar to those in the literature studies for both wild and laboratory exposed sculpins and other fish species carrying similar or higher Hg concentrations. Ignoring sex and size, specimens with hepatic cell infiltrates had the highest concentrations of most elements, a relation that was also found for gill telangiectasis and Hg (all p<0.05). When controlling for sex and size, the prevalence of vacuolar hepatocytes and endoparasites was significantly highest at the three most contaminated stations and similar differences were found for liver necrosis. We suggest that beside exposure to mining-related elements, other environmental factors, such as parasites, might be co-factors in the development of the observed liver and gill lesions. Therefore, sculpin liver and gill pathology are likely to be suitable health indicators when biomonitoring gradients of mining and other element related activity effects; while a larger study is required to fully evaluate the relationships. - Highlights: • Black Angel Pb–Zn mine in West Greenland has led to significant metal pollution. • Gill and liver morphology of common sculpins was evaluated as bioindicators. • Significant pathologies were found and were related to metal concentrations. • Sculpin pathology may be suitable health indicators for mining activity effects. • These should be enrolled in EIAs of raw material industrialization in the Arctic.« less

Metal levels in flathead sole (Hippoglossoides elassodon) and great sculpin (Myoxocephalus polyacanthocephalus) from Adak Island, Alaska: Potential risk to predators and fishermen

DOE Office of Scientific and Technical Information (OSTI.GOV)

Burger, Joanna; Gochfeld, Michael; Environmental and Occupational Medicine, UMDNJ-Robert Wood Johnson Medical School, Piscataway, NJ 08854

2007-01-15

Increasingly there is a need to assess the contaminant levels in fish as indicators of the health and well-being of both the fish and their consumers, including humans. This paper examines the levels of arsenic, cadmium, chromium, lead, manganese, mercury, and selenium in the kidney, liver, and muscle of great sculpin and flathead sole from Adak Island in the Aleutian Islands, Alaska. Both species are consumed by the local Aleuts and others. There were significant differences in the levels of heavy metals as a function of tissue for both fish species; the liver of sculpin and sole generally had themore » highest levels of most metals, except for arsenic, lead, and selenium. Sole had significantly higher mean levels of arsenic in kidney (32,384 vs. 531 ppb, wet weight), liver (18,954 vs. 2532 ppb), and muscle (19,452 vs. 1343 ppb) than did sculpin. Sole also had higher mean levels of cadmium (230 vs. 63 ppb), lead (1236 vs. 48 ppb), mercury (150 vs. 107 ppb), and selenium (5215 vs. 1861 ppb) in kidney than did sculpin. There were significant correlations among weight and length measurements for both species. However, except for mercury, there were few significant correlations among tissue types for most metals. Only mercury and manganese levels were significantly correlated with size for sculpin (but not for sole). Levels of arsenic, lead, and mercury may pose a risk to predators that consume them, and arsenic and mercury may pose a risk to human consumers.« less

Bottom trawl assessment of Lake Ontario prey fishes

USGS Publications Warehouse

Weidel, Brian C.; Connerton, Michael J.; Holden, Jeremy

2018-01-01

Managing Lake Ontario fisheries in an ecosystem-context requires prey fish community and population data. Since 1978, multiple annual bottom trawl surveys have quantified prey fish dynamics to inform management relative to published Fish Community Objectives. In 2017, two whole-lake surveys collected 341 bottom trawls (spring: 204, fall: 137), at depths from 8-225m, and captured 751,350 fish from 29 species. Alewife were 90% of the total fish catch while Deepwater Sculpin, Round Goby, and Rainbow Smelt comprised the majority of the remaining total catch (3.8, 3.1, and 1.1% respectively). The adult Alewife abundance index for US waters increased in 2017 relative to 2016, however the index for Canadian waters declined. Adult Alewife condition, assessed by the predicted weight of a 165 mm fish (6.5 inches), declined in 2017 from record high values observed in spring 2016. Spring 2017 Alewife condition was slightly less than the 10-year average, but the fall value was well below the 10-year average, likely due to increased Age-1 Alewife abundance. The Age-1 Alewife abundance index was the highest observed in 40 years, and 8-times higher than the previous year. The Age-1 index estimates Alewife reproductive success the preceding year. The warm summer and winter of 2016 likely contributed to the large year class. In contrast the relatively cool 2017 spring and cold winter may result in a lower than average 2017 year class. Abundance indices for Rainbow Smelt, Cisco, and Emerald Shiner either declined or remained at low levels in 2017. Pelagic prey fish diversity continues to be low since a single species, Alewife, dominates the catch. Deepwater Sculpin were the most abundant benthic prey fish in 2017 because Round Goby abundance declined sharply from 2016. Slimy Sculpin density continued to decline and the 2017 biomass index for US waters was the lowest ever observed. Prior to Round Goby proliferation, juvenile Slimy Sculpin comprised ~10% of the Slimy Sculpin catch, but since 2004, the percent of juveniles within the total catch is less than 0.5%, suggesting Round Goby are limiting Slimy Sculpin reproduction. Despite Slimy Sculpin declines, benthic prey fish community diversity has increased as Deepwater Sculpin and Round Goby comprise more of the community.

A population on the rise: The origin of deepwater sculpin in Lake Ontario

USGS Publications Warehouse

Welsh, Amy B.; Scribner, Kim T.; Stott, Wendylee; Walsh, Maureen

2017-01-01

Deepwater sculpin, Myoxocephalus thompsonii, were thought to have been extirpated from Lake Ontario. However, in recent years, abundance has increased and recruitment has been documented. There are two hypotheses concerning the origin of the current Lake Ontario deepwater sculpin population. First, individuals from the upper Great Lakes may have recolonized Lake Ontario. Alternatively, the Lake Ontario population may have not been extirpated, and the remnant population has recovered naturally. To test these hypotheses, eight microsatellite loci were used to analyze samples from the current Lake Ontario population, museum specimens from the historic Lake Ontario population, and current upper Great Lakes populations. The genetic data suggest that historically throughout the Great Lakes, deepwater sculpin exhibited low levels of spatial genetic structure. Approximate Bayesian Computation analyses support the hypothesis that the current Lake Ontario population is more closely related to populations in the upper Great Lakes than to the historic Lake Ontario samples, indicating that the current Lake Ontario population likely resulted from recolonization from the Upper Great Lakes. The current Lake Ontario population has reduced allelic diversity relative to upper Great Lakes populations, indicating a possible founder effect. This study demonstrates the role life history variation can play in recolonization success. The pelagic larval phase of the deepwater sculpin allowed recolonization of Lake Ontario via passive larval drift.

Expansion of tubenose gobies Proterorhinus semilunaris into western Lake Erie and potential effects on native species

USGS Publications Warehouse

Kocovsky, P.M.; Tallman, J.A.; Jude, D.J.; Murphy, D.M.; Brown, J.E.; Stepien, C.A.

2011-01-01

The Eurasian freshwater tubenose goby Proterorhinus semilunaris (formerly Proterorhinus marmoratus) invaded the Laurentian Great Lakes in the 1990s, presumably via ballast water from transoceanic cargo ships. Tubenose gobies spread throughout Lake St. Clair, its tributaries, and the Detroit River system, and also are present in the Duluth-Superior harbor of Lake Superior. Using seines and bottom trawls, we collected 113 tubenose gobies between July 2007 and August 2009 at several locations in western Lake Erie. The number and range of sizes of specimens collected suggest that that tubenose gobies have become established and self-sustaining in the western basin of Lake Erie. Tubenose gobies reached maximum densities in sheltered areas with abundant macrophyte growth, which also is their common habitat in native northern Black Sea populations. The diet of tubenose gobies was almost exclusively invertebrates, suggesting dietary overlap with other benthic fishes, such as darters (Etheostoma spp. and Percina sp.), madtoms (Noturus spp.), and sculpins (Cottus spp.). A single mitochondrial DNA haplotype was identified, which is the most common haplotype found in the original colonization area in the Lake St. Clair region, suggesting a founder effect. Tubenose gobies, like round gobies Neogobius melanostomus, have early life stages that drift owing to vertical migration, which probably allowed them to spread from areas of colonization. The Lake St. Clair-Lake Erie corridor appears to have served as an avenue for them to spread to the western basin of Lake Erie, and abundance of shallow macrophyte-rich habitats may be a key factor facilitating their further expansion within Lake Erie and the remainder of the Laurentian Great Lakes.

Ecology of Siberian Taimen Hucho taimen in the Lake Baikal Basin

USGS Publications Warehouse

Matveyev, Arcadi N.; Pronin, Nikolai M.; Samusenok, Vitali P.; Bronte, Charles R.

1998-01-01

Taimen Hucho taimen historically inhabited most tributaries and littoral areas of Lake Baikal, in south central Siberia, where they supported subsistence and commercial fisheries. Logging, pollution, and overfishing have caused dramatic population declines or local extinction of most stocks. Most of what is known about this species has been published in eastern journals and therefore is not readily available to western scientists. New data collected during the 1980s and 1990s have been combined with other reports to provide an overview of the biology and life history of this species. Taimen are long-lived fish and can reach ages of 29 years and sizes up to 60 kg. Populations can either be strictly riverine or anadromous. Adults from both life histories ascend rivers in spring to spawn and feed, and less extensive migrations occur in fall to prey on spawning omul (Coregonus autumnalis migratorius). Principal food items for age 1 and 2 taimen are macroinvertebrates, but young taimen quickly become piscivorous at age 2 when they consume mainly black Baikal grayling (Thymallus arcticus baicalensis), and sculpins (Taracottus kneri, Cottus kesslerij). Males reach sexual maturity at ages 7 to 8 and later for females at ages 8 to 9. Average egg production per female was about 22,000 eggs. Parasite burdens are heavy but composed of few species and mediated by prey items consumed. This fish is a highly-specialized predator and plays an indispensable role in the structure of fish communities in mountains and foothills. Taimen conservation in the Baikal region is impossible without adoption and implementation of a dedicated rehabilitation program that includes the protection of remaining populations and habitat, and possibly introduction of hatchery-reared fish in selected areas where habitat remains, but parental stocks are low.

Ichthyoplankton use of a thermally influenced macrophyte bed in the New River, Virginia

DOE Office of Scientific and Technical Information (OSTI.GOV)

Yeager, M.M.; Cherry, D.S.; Yeager, J.L.

The ichthyoplankton community of an extensive macrophyte bed in a thermally influenced reach of the New River, Virginia was compared with the ichthyoplankton communities in smaller macrophyte beds located upstream and downstream of the thermal effluent. Ichthyoplankton trapping was carried out biweekly between April and September, 1994, using wire mesh traps baited with bread and cylume light sticks. Qualitative dipnetting was conducted monthly in the macrophyte bed to check for trap bias. Temperature ranged from 16.1 C to 28 C in the reference areas and from 20.5 C to 34 C in the thermally influenced macrophyte bed. The lowest dissolvedmore » oxygen value (4.6 mg/L) was recorded in the effluent influenced area where the D.O. ranged from 4.6 to 8.8 mg/L. The D.O. in the reference macrophyte beds ranged from 5.8 to 12.3 mg/L. The smaller reference macrophyte beds had higher abundance and taxa richness than the thermally influenced macrophyte bed on 8 of the 10 trapping dates. In late May, the thermally influenced macrophyte bed had significantly higher ichthyoplankton abundance and richness (p < 0.05) than the reference areas. Significant differences occurred once more on September 21, 1994 when no fish were collected in the thermally influenced area resulting in significantly higher richness and abundance in the upstream reference area (p < 0.05). The communities were dominated by Centrarchidae of the genera Ambloplites, Micropterus and Lepomis. Catostomids and Cyprinids were collected at both the thermally influenced and reference stations. The sculpin, Cottus, was the only genus collected in a reference area that was not collected in the thermally influenced area. It appears that the macrophyte bed below the industrial facility was being utilized as a refugia for ichthyoplankton.« less

Reproductive strategies and seasonal changes in the somatic indices of seven small-bodied fishes in Atlantic Canada in relation to study design for environmental effects monitoring.

PubMed

Barrett, Timothy J; Brasfield, Sandra M; Carroll, Leslie C; Doyle, Meghan A; van den Heuvel, Michael R; Munkittrick, Kelly R

2015-05-01

Small-bodied fishes are more commonly being used in environmental effects monitoring (EEM) studies. There is a lack of understanding of the biological characteristics of many small-bodied species, which hinders study designs for monitoring studies. For example, 72% of fish population surveys in Canada's EEM program for pulp and paper mills that used small-bodied fishes were conducted outside of the reproductive period of the species. This resulted in an inadequate assessment of the EEM program's primary effect endpoint (reproduction) for these studies. The present study examined seasonal changes in liver size, gonad size, and condition in seven freshwater and estuarine small-bodied fishes in Atlantic Canada. These data were used to examine differences in reproductive strategies and patterns of energy storage among species. Female gonadal recrudescence in all seven species began primarily in the 2-month period in the spring before spawning. Male gonadal development was concurrent with females in five species; however, gonadal recrudescence began in the fall in male three-spined stickleback (Gasterosteus aculeatus) and slimy sculpin (Cottus cognatus). The spawning period for each species was estimated from the decline in relative ovary size after its seasonal maximum value in spring. The duration of the spawning period reflected the reproductive strategy (single vs multiple spawning) of the species. Optimal sampling periods to assess reproductive impacts in each species were determined based on seasonal changes in ovary size and were identified to be during the prespawning period when gonads are developing and variability in relative gonad size is at a minimum.

An index of biological integrity (IBI) for Pacific Northwest rivers

USGS Publications Warehouse

Mebane, C.A.; Maret, T.R.; Hughes, R.M.

2003-01-01

The index of biotic integrity (IBI) is a commonly used measure of relative aquatic ecosystem condition; however, its application to coldwater rivers over large geographic areas has been limited. A seven-step process was used to construct and test an IBI applicable to fish assemblages in coldwater rivers throughout the U.S. portion of the Pacific Northwest. First, fish data from the region were compiled from previous studies and candidate metrics were selected. Second, reference conditions were estimated from historical reports and minimally disturbed reference sites in the region. Third, data from the upper Snake River basin were used to test metrics and develop the initial index. Fourth, candidate metrics were evaluated for their redundancy, variability, precision, and ability to reflect a wide range of conditions while distinguishing reference sites from disturbed sites. Fifth, the selected metrics were standardized by being scored continuously from 0 to 1 and then weighted as necessary to produce an IBI ranging from 0 to 100. The resulting index included 10 metrics: number of native coldwater species, number of age-classes of sculpins Cottus spp., percentage of sensitive native individuals, percentage of coldwater individuals, percentage of tolerant individuals, number of alien species, percentage of common carp Cyprinus carpio individuals, number of selected salmonid age-classes, catch per unit effort of coldwater individuals, and percentage of individuals with selected anomalies. Sixth, the IBI responses were tested with additional data sets from throughout the Pacific Northwest. Last, scores from two minimally disturbed reference rivers were evaluated for longitudinal gradients along the river continuum. The IBI responded to environmental disturbances and was spatially and temporally stable at over 150 sites in the Pacific Northwest. The results support its use across a large geographic area to describe the relative biological condition of coolwater and coldwater rivers with low species richness.

Effects of depletion sampling by standard three-pass pulsed DC electrofishing on blood chemistry parameters of fishes from Appalachian streams

USGS Publications Warehouse

Densmore, Christine L.; Panek, Frank M.

2013-01-01

Adverse effects on fishes captured by electrofishing techniques have long been recognized, although the extent of associated physical injury and behavioral alterations are highly variable and dependent on a number of factors. We examined the effects of three-pass pulsed DC (PDC) electrofishing on two salmonid species (Rainbow Trout Oncorhynchus mykiss and Brook Trout Salvelinus fontinalis) and five other genera (Green Sunfish Lepomis cyanellus, Potomac Sculpin Cottus girardi, Fathead Minnow Pimephales promelas, Largemouth Bass Micropterus salmoides, and Channel Catfish Ictalurus punctatus) common to Appalachian streams. We examined the corresponding effects of PDC electroshock on the following physiological indicators of stress and trauma: blood glucose and serum lactate, as well as on other blood chemistry, namely, enzymes, electrolytes, minerals, and proteins. All species demonstrated physiological responses to PDC electroshock, indicated by the biochemical differences in blood parameters in unshocked and shocked groups of fish with or without gross evidence of hemorrhagic trauma. Serum lactate was the most consistent indicator of these effects. Significant differences in whole blood glucose levels were also noted in treatment groups in all species except Green Sunfish, although the patterns observed were not as consistent as for serum lactate. Elevations in the serum enzymes, aspartate aminotransferase and creatine kinase, in the electroshocked fish occurred only in the two salmonid species. In many instances, although blood parameters were elevated in electroshocked fish compared with the unshocked controls for a given species, there were no differences in those levels in electroshocked fish based on the presence of gross hemorrhagic trauma to axial musculature. While some of the blood parameters examined correlated with both the occurrence of electroshock and the resultant tissue injury, there was no apparent link between the altered blood chemistry and increased mortality 30 d after electrofishing.

Summer spawning in the fourhorn sculpin, Myoxocephalus quadricornis, from Alaska

USGS Publications Warehouse

Goldberg, S.R.; Yasutake, W.T.; West, R.L.

1987-01-01

Histological ovarian analysis indicates summer spawning occurs in Myoxocephalus quadricornis (Fourhorn Sculpin) from Alaska. Previous studies have shown this species spawns during winter in the Baltic Sea; the data presented herein suggests that geographical variation may occur in the timing of spawning of this species.

Extracellular glucose can fuel metabolism in red blood cells from high glycemic Atlantic cod (Gadus morhua) but not low glycemic short-horned sculpin (Myoxocephalus scorpius).

PubMed

Driedzic, William R; Clow, Kathy A; Short, Connie E

2014-11-01

Energy metabolism was assessed in red blood cells (RBCs) from Atlantic cod and short-horned sculpin, two species that have markedly different levels of blood glucose. The objective was to determine whether the level of extracellular glucose has an impact on rates of glucose metabolism. The blood glucose level was 2.5 mmol l(-1) in Atlantic cod and 0.2 mmol l(-1) in short-horned sculpin, respectively. Oxygen consumption, lactate production and glucose utilization were measured in whole blood and related to grams of RBCs. Glucose utilization was assessed by measuring both glucose disappearance and the production of (3)H2O from [2-(3)H]-glucose. RBCs from both species have an aerobic-based metabolism. In Atlantic cod, extracellular glucose is sufficient to provide the sum of glucosyl equivalents to support both oxidative metabolism and lactate production. In contrast, extracellular glucose can account for only 10% of the metabolic rate in short-horned sculpin RBCs. In both species, about 70% of glucose enters the RBCs via facilitated transport. The difference in rates of extracellular glucose utilization is related to the extremely low levels of blood glucose in short-horned sculpin. In this species energy metabolism by RBCs must be supported by alternative fuels. © 2014. Published by The Company of Biologists Ltd.

Mad River Sculpins: Just Another Fish Story?

ERIC Educational Resources Information Center

Downhower, Jerry F.; Brown, Luther

1983-01-01

Discusses findings that suggest that mating preferences of female mottled sculpins (small North American fish) are influenced by at least four major factors, and that the relative importance of these factors changes through time. The type of choice that a female makes thus depends on time of breeding. (JN)

Prevalence of the parasitic copepod Haemobaphes intermedius on juvenile buffalo sculpins from Washington State

USGS Publications Warehouse

Halpenny, C.M.; Kocan, R.M.; Hershberger, P.K.

2004-01-01

The parasitic copepod, Haemobaphes intermedius, was detected in 62% of juvenile buffalo sculpins Enophrys bison, a previously unreported host, from the San Juan Islands archipelago in Washington State. Most infestations were characterized by the presence of a single female copepod infestations with multiple H. intermedius occurred either unilaterally or bilaterally in 29% of parasitized individuals. Impaired condition of parasitized hosts was indicated by significantly lower total lengths and weights (34.9 mm; 1.6 g) than in unparasitized cohorts (38.9 mm; 2.1 g). Host specificity was indicated by the failure to detect H. intermedius in 43 sympatric great sculpins Myoxocephalus polyacanthocephalus from the same location.

75 FR 61639 - Fisheries of the Exclusive Economic Zone Off Alaska; Skate Management in the Groundfish Fisheries...

Federal Register 2010, 2011, 2012, 2013, 2014

2010-10-06

... and GOA sharks, sculpins, and octopuses, and GOA squids as a group for purposes of prohibited species.../npfmc/default.htm . One alternative previously adopted for a Tier 6 stock (squid and octopus in the GOA... groups (sharks, skates, sculpins, octopus, or squid) approaches overfishing. Response: See the response...

76 FR 76902 - Fisheries of the Exclusive Economic Zone Off Alaska; Sculpins in the Bering Sea Subarea of the...

Federal Register 2010, 2011, 2012, 2013, 2014

2011-12-09

... Bering Sea Subarea of the Bering Sea and Aleutian Islands Management Area AGENCY: National Marine...-specified reserve to the initial total allowable catch of sculpins in the Bering Sea subarea of the Bering Sea and Aleutian Islands management area. This action is necessary to allow fishing operations to...

75 FR 41424 - Fisheries of the Exclusive Economic Zone Off Alaska; Skates Management in the Groundfish...

Federal Register 2010, 2011, 2012, 2013, 2014

2010-07-16

... and AMs must be implemented by January 1, 2011. Skate, shark, sculpin, and octopus groups are currently managed as a complex in the ``other species'' category in the BSAI. In the GOA, shark, sculpin...'' category combines the management of short-lived invertebrates (squids and octopuses) with long-lived fish...

76 FR 3044 - Fisheries of the Exclusive Economic Zone Off Alaska; Sculpins, Sharks, Squid, and Octopus in the...

Federal Register 2010, 2011, 2012, 2013, 2014

2011-01-19

..., Squid, and Octopus in the Gulf of Alaska AGENCY: National Marine Fisheries Service (NMFS), National... prohibiting directed fishing for sculpins, sharks, squid, and octopus in the Gulf of Alaska (GOA). This action..., and octopus in the GOA. DATES: Effective 1200 hrs, Alaska local time (A.l.t.), January 13, 2011...

Biochemical indicators of pollution exposure in shorthorn sculpin (Myoxocephalus scorpius), caught in four harbours on the southwest coast of Iceland.

PubMed

Stephensen; Svavarsson; Sturve; Ericson; Adolfsson-Erici; Förlin

2000-04-01

Shorthorn sculpins (Myoxocephalus scorpius) were caught in four Icelandic harbours, differing in size, use and traffic. Biochemical responses in liver were measured and chemicals analysed in bile. Eyrarbakki harbour, which has not been in use for many years was chosen as a control site. Njar partial differentialvík harbour is a small fishing harbour and a marina, Sandger partial differentiali harbour is a large fishing harbour, and Reykjavík harbour is a large fishing harbour and an international transport harbour. Higher levels of DNA-adducts and cytochrome P4501A (CYP1A) in the fish from the harbours in Sandger partial differentiali, Njar partial differentialvík and Reykjavík, compared to Eyrarbakki harbour, indicate PAH exposure. This was confirmed by PAH analysis in bile. The higher activities of the antioxidant enzymes catalase (CAT), glutathione peroxidase (GPx) and glutathione reductase (GR) in fish caught in Sandger partial differentiali, than in fish caught in the other harbours, indicate exposure of sculpin to prooxidative compounds in Sandger partial differentiali harbour. Shorthorn sculpin seems to be a convenient species for monitoring pollution in northern coastal areas.

Functional convergence among pelagic sculpins of Lake Baikal and deepwater ciscoes of the Great Lakes

USGS Publications Warehouse

Eshenroder, Randy L.; Sideleva, Valentina G.; Todd, Thomas N.

1999-01-01

The vast, well-oxygenated hypolimnia of Lake Baikal and the Great Lakes were both dominated by endemic planktivorous fishes. These dominants, two species of sculpins (Comephorus, Comephoridae) in Lake Baikal and six species of deepwater ciscoes (Coregonus, Salmonidae) in the Great Lakes, although distant taxonomically, have morphologies suggesting a surprising degree of functional convergence. Here it is proposed that the same two buoyancy-regulation strategies observed in Baikal sculpins also arose in the deepwater ciscoes of the Great Lakes. One strategy favors hydrostatic lift (generated by low specific gravity) and is characterized by fatter, larger-bodied fish with smaller paired fins; the second strategy favors hydrodynamic lift (generated by swimming) and is characterized by leaner, smaller-bodied fish with larger paired fins. Both types likely evolved to feed on a single species of ecologically analogous, vertically migrating macrozooplankter: Macrohectopus branickii in Lake Baikal and Mysis relicta in the Great Lakes. It is suggested that Coregonus did not diversify and proliferate in Lake Baikal as they did in the Great Lakes because by the time Coregonus colonized Lake Baikal, pelagic sculpins were already dominant.

Diet and habitat use by age-0 deepwater sculpins in northern Lake Huron, Michigan and the Detroit River

USGS Publications Warehouse

Roseman, Edward F.

2014-01-01

Deepwater sculpins (Myoxocephalus thompsonii) are an important link in deepwater benthic foodwebs of the Great Lakes. Little information exists about deepwater sculpin spawning habits and early life history ecology due to difficulty in sampling deep offshore habitats. Larval and age-0 deepwater sculpins collected in northern Lake Huron and the Detroit River during 2007 were used to improve our understanding of their habitat use, diet, age, and growth. Peak larval density reached 8.4/1000 m3 in the Detroit River during April and was higher than that in Lake Huron. Offshore bottom trawls at DeTour and Hammond Bay first collected benthic age-0 deepwater sculpins in early September when fish were ≥ 25 mm TL. Otolith analysis revealed that hatch dates for pelagic larvae occurred during late March and larvae remained pelagic for 40 to 60 days. Diet of pelagic larvae (10–21 mm TL) was dominated by calanoid copepods at all sample locations. Diets of benthic age-0 fish varied by location and depth: Mysis and chironomids were prevalent in fish from Hammond Bay and the 91 m site at DeTour, but only chironomids were found in fish from the 37 m DeTour site. This work showed that nearshore epilimnetic sites were important for pelagic larvae and an ontogenetic shift from pelagic planktivore to benthivore occurred at about 25 mm TL in late summer. Age analysis showed that larvae remained pelagic long enough to be transported through the St. Clair–Detroit River system, Lake Erie, and the Niagara River, potentially contributing to populations in Lake Ontario.

Juvenile groundfish habitat in Kachemak Bay, Alaska, during late summer

USGS Publications Warehouse

Abookire, Alisa A.; Piatt, John F.; Norcross, Brenda L.

2001-01-01

We investigated the habitat of juvenile groundfishes in relation to depth, water temperature, and salinity in Kachemak Bay, Alaska. Stations ranging in depth from 10 to 70 m and with sand or mud-sand substrates were sampled with a small-meshed beam trawl in August-September of 1994 to 1999. A total of 8,201 fishes were captured, comprising at least 52 species. Most fishes (91%) had a total length 5% of the total catch) were flathead sole Hippoglossoides elassodon, slim sculpin Radulinus asprellus, Pacific halibut Hippoglossus stenolepis, and arrowtooth flounder Atheresthes stomias. Depth accounted for most of the spatial variability in juvenile groundfish abundance, and neither temperature nor salinity was correlated with fish abundance. Juvenile groundfishes concentrated in either shallow (less than or equal to 20 m) or deep (50-70 m) water, with co-occurrence of some species between 30-40 m. Shallow fishes were the rock soles, Pacific halibut, and great sculpin Myoxocephalus polyacanthocephalus. Deep species were flathead sole, slim sculpin, spinycheek starsnout Bathyagonus infraspinatus, rex sole Glyptocephalus zachirus, tadpole sculpin Psychrolutes paradoxus, and whitebarred prickleback Poroclinus rothrocki. This 6-year study provides baseline data on relative abundance and distribution of juvenile groundfishes in Kachemak Bay and may provide a useful tool for predicting the presence of species in similar habitats in other areas of Alaska.

Cumberlandian Mollusk Conservation Program. Activity 3: identification of fish hosts. [Conradilla caelata; Quadrula intermedia; Epioblasma brevidens; Epioblasma capsaeformis; Epioblasma triquetra; Quadrula cylindrica; Carunculina moesta

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hill, D.M.

A key element of the Cumberlandian Mollusk Conservation Program undertaken by TVA in 1979 was the determination of fish hosts of Cumberlandian mussel species unique to the Tennessee River drainage and especially the species whose habitat would be inundated by completion of Columbia Dam on the Duck River, Tennessee. Principal emphasis was placed on the birdwing pearly mussel, Conradilla caelata and the Cumberland monkeyface, Quadrula intermedia - two federally listed endangered species with limited distributions outside the proposed inundation zone of the Duck River. Additional species studied included three species of the genus Epioblasma (E. brevidens, E. capsaeformis, and E.more » triquetra), Quadrula cylindrica, Villosa iris, and Carunculina moesta. Experimental glochidial infection of 55 fish species resulted in the establishment of the following mussel-fish host relationships: Conradilla caelata - Etheostoma zonale; Quadrule intermedia - Hybopsis dissimilis, Hybopsis insignis; Epioblasma brevidens - Etheostoma blennioides, Etheostoma maculatum, Etheostoma rufilineatum, Etheostoma simoterum, Percina caprodes, Cottus carolinae; Epioblasma capsaeformis - Etheostoma maculatum, Etheostoma rufilineatum, Percina sciera, Cottus carolinae; Epioblasma triquetra - Percina caprodes, Cottus carolinae; Quadrula cylindrica - Notropis galacturus, Notropis spilopterus, Hybopsis amblops; and Carunculina moesta - Lepomis cyanellus, Lepomis megalotis.« less

Predation on juvenile pacific salmon oncorhynchus spp. in downstream migrant traps in prairie creek, california

USGS Publications Warehouse

Duffy, W.G.; Bjorkstedt, E.P.; Ellings, C.S.

2011-01-01

Downstream migrant traps are a widely applied fishery management tool for sampling anadromous Pacific salmon Oncorhynchus spp. and steelhead O. mykiss smolts along theWest Coast of North America and elsewhere, yet predation on juvenile salmonids in traps has not been studied quantitatively.We assessed the frequency of occurrence and abundance of juvenile salmonids in the stomachs of coastal cutthroat trout O. clarkii clarkii, coho salmon O. kisutch, steelhead, and prickly sculpin Cottus asper (>70 mm fork length) captured in traps and in nearby stream habitats. All four predator species took juvenile salmonids with much greater frequency in traps than in stream habitats. Among free-swimming predators, only coastal cutthroat trout were observed with salmonid fry in their stomachs, but they took fewer salmonid prey and appeared to rely more heavily on insect prey than did coastal cutthroat trout captured in traps. Predators consumed up to 25% of the available prey over a broad range of prey abundances. Over the course of the study, predators consumed 2.5% of all salmonid fry captured in traps, but this fraction ranged from less than 1% to more than 10% in any given year. The number of prey taken in traps increased with predator length and with prey abundance in traps, and predation in traps peaked during the period of most intense downstream migration by salmon fry. In contrast, live-box design and trap location had little or no effect on the total number of prey taken by individual predators.We estimated that the predation mortality of juvenile salmon increased by 0.5-1.0% due to in-trap predation (i.e., a 9-10% relative increase over natural predation rates). We found no evidence that predators selected for prey on the basis of species. These results should motivate additional research on methods that reduce or eliminate predation in trap live-boxes and protocols for efficiently measuring predation associated with the trapping of downstream migrants. ?? American Fisheries Society 2011.

Frequency and Severity of Trauma in Fishes Subjected to Multiple-pass Depletion Electrofishing

USGS Publications Warehouse

Panek, Frank; Densmore, Christine L.

2013-01-01

The incidence and severity of trauma associated with multiple-pass electrofishing and the effects on short-term (30-d) survival and growth of Rainbow Trout Oncorhynchus mykiss, Brook Trout Salvelinus fontinalis, and five representative co-inhabiting nontarget or bycatch species were examined. Fish were held in four rectangular fiberglass tanks (190 × 66 cm) equipped with electrodes, a gravel–cobble stream substrate, and continuous water flow. Fish were exposed to one, two, or three electroshocks (100-V, 60-Hz pulsed DC) spaced 1 h apart or were held as a control. The heterogeneous field produced a mean (±SD) voltage gradient of 0.23 ± 0.024 V/cm (range = 0.20–0.30 V/cm) with a duty cycle of 30% and a 5-s exposure. Radiographs of 355 fish were examined for evidence of spinal injuries, and necropsies were performed on 303 fish to assess hemorrhagic trauma in soft tissue. Using linear regression, we demonstrated significant relationships between the number of electrical shocks and the frequency and severity of hemorrhagic and spinal trauma in each of the nontarget species (Potomac Sculpin Cottus girardi, Channel Catfish Ictalurus punctatus, Fathead Minnow Pimephales promelas, Green Sunfish Lepomis cyanellus, and Largemouth Bass Micropterus salmoides). Most of the injuries in these species were either minor or moderate. Rainbow Trout and Brook Trout generally sustained the highest incidence and severity of injuries, but those injuries were generally independent of the number of treatments. The 30-d postshock survival for the trout species was greater than 94%; survival for the bycatch species ranged from 80% (Fathead Minnow) to 100% (Green Sunfish and Channel Catfish). There were no significant differences in 30-d postshock condition factors despite observations of altered feeding behavior lasting several days to 1 week posttreatment in several of the study species.

Bioaccumulation of toxaphene congeners in the lake superior food web

USGS Publications Warehouse

Muir, D.C.G.; Whittle, D.M.; De Vault, D. S.; Bronte, C.R.; Karlsson, H.; Backus, S.; Teixeira, C.

2004-01-01

The bioaccumulation and biotransformation of toxaphene was examined in the food webs of Lake Superior and Siskiwit Lake (Isle Royale) using congener specific analysis as well as stable isotope ratios of carbon and nitrogen to characterize food webs. Toxaphene concentrations (calculated using technical toxaphene) in lake trout (Salvelinus namaycush) from the western basin of Lake Superior (N = 95) averaged (±SD) 889 ± 896 ng/g wet wt and 60 ± 34 ng/g wet wt in Siskiwit Lake. Major congeners in lake trout were B8-789 (P38), B8-2226 (P44), B9-1679 (P50), and B9-1025 (P62). Toxaphene concentrations were found to vary seasonally, especially in lower food web organisms in Lake Superior and to a lesser extent in Siskiwit Lake. Toxaphene concentrations declined significantly in lake herring (Coregonus artedii), rainbow smelt (Omerus mordax), and slimy sculpin (Cottus cognatus) as well as in zooplankton (> 102 &mn;m) and Mysis (Mysis relicta) between May and October. The seasonal variation may reflect seasonal shifts in the species abundance within the zooplankton community. Trophic magnification factors (TMF) derived from regressions of toxaphene congener concentrations versus δ15N were > 1 for most octa- and nonachlorobornanes in Lake Superior except B8-1413 (P26) and B9-715. Log bioaccumulation factors (BAFs) for toxaphene congeners in lake trout (ng/g lipid/ng/L dissolved) ranged from 4.54 to 9.7 and were significantly correlated with log octanol-water partition coefficients. TMFs observed for total toxaphene and congener B9-1679 in Lake Superior were similar to those in Arctic lakes, as well as to previous studies in the Great Lakes, which suggests that the bioaccumulation behavior of toxaphene is similar in pelagic food webs of large, cold water systems. However, toxaphene concentrations were lower in lake trout from Siskiwit Lake and lakes in northwestern Ontario than in Lake Superior possibly because of shorter food chains and greater reliance on zooplankton or other pelagic invertebrates.

Direct and indirect responses of a freshwater food web to a potent synthetic oestrogen

PubMed Central

Kidd, Karen A.; Paterson, Michael J.; Rennie, Michael D.; Podemski, Cheryl L.; Findlay, Dave L.; Blanchfield, Paul J.; Liber, Karsten

2014-01-01

Endocrine-disrupting chemicals (EDCs) in municipal effluents directly affect the sexual development and reproductive success of fishes, but indirect effects on invertebrate prey or fish predators through reduced predation or prey availability, respectively, are unknown. At the Experimental Lakes Area in northwestern Ontario, Canada, a long-term, whole-lake experiment was conducted using a before-after-control-impact design to determine both direct and indirect effects of the synthetic oestrogen used in the birth control pill, 17α-ethynyloestradiol (EE2). Algal, microbial, zooplankton and benthic invertebrate communities showed no declines in abundance during three summers of EE2 additions (5–6 ng l−1), indicating no direct toxic effects. Recruitment of fathead minnow (Pimephales promelas) failed, leading to a near-extirpation of this species both 2 years during (young-of-year, YOY) and 2 years following (adults and YOY) EE2 additions. Body condition of male lake trout (Salvelinus namaycush) and male and female white sucker (Catostomus commersonii) declined before changes in prey abundance, suggesting direct effects of EE2 on this endpoint. Evidence of indirect effects of EE2 was also observed. Increases in zooplankton, Chaoborus, and emerging insects were observed after 2 or 3 years of EE2 additions, strongly suggesting indirect effects mediated through the reduced abundance of several small-bodied fishes. Biomass of top predator lake trout declined by 23–42% during and after EE2 additions, most probably an indirect effect from the loss of its prey species, the fathead minnow and slimy sculpin (Cottus cognatus). Our results demonstrate that small-scale studies focusing solely on direct effects are likely to underestimate the true environmental impacts of oestrogens in municipal wastewaters and provide further evidence of the value of whole-ecosystem experiments for understanding indirect effects of EDCs and other aquatic stressors. PMID:25405967

Prey selection by the Lake Superior fish community

USGS Publications Warehouse

Isaac, Edmund J.; Hrabik, Thomas R.; Stockwell, Jason D.; Gamble, Allison E.

2012-01-01

Mysis diluviana is an important prey item to the Lake Superior fish community as found through a recent diet study. We further evaluated this by relating the quantity of prey found in fish diets to the quantity of prey available to fish, providing insight into feeding behavior and prey preferences. We describe the seasonal prey selection of major fish species collected across 18 stations in Lake Superior in spring, summer, and fall of 2005. Of the major nearshore fish species, bloater (Coregonus hoyi), rainbow smelt (Osmerus mordax), and lake whitefish (Coregonus clupeaformis) consumed Mysis, and strongly selected Mysis over other prey items each season. However, lake whitefish also selected Bythotrephes in the fall when Bythotrephes were numerous. Cisco (Coregonus artedi), a major nearshore and offshore species, fed largely on calanoid copepods, and selected calanoid copepods (spring) and Bythotrephes (summer and fall). Cisco also targeted prey similarly across bathymetric depths. Other major offshore fish species such as kiyi (Coregonus kiyi) and deepwater sculpin (Myoxocephalus thompsoni) fed largely on Mysis, with kiyi targeting Mysis exclusively while deepwater sculpin did not prefer any single prey organism. The major offshore predator siscowet lake trout (Salvelinus namaycush siscowet) consumed deepwater sculpin and coregonines, but selected deepwater sculpin and Mysis each season, with juveniles having a higher selection for Mysis than adults. Our results suggest that Mysis is not only a commonly consumed prey item, but a highly preferred prey item for pelagic, benthic, and piscivorous fishes in nearshore and offshore waters of Lake Superior.

Trophic connections in Lake Superior Part I: the offshore fish community

USGS Publications Warehouse

Gamble, A.E.; Hrabik, T.R.; Stockwell, J.D.; Yule, D.L.

2011-01-01

Detailed diet linkages within the offshore (> 80 m bathymetric depth) food web of Lake Superior are currently not well identified. We used analyses of fish stomach contents to create an empirically based food web model of the Lake Superior offshore fish community. Stomachs were collected seasonally (spring, summer, and fall) from nine offshore locations in 2005, using bottom and midwater trawls. In total, 2643 stomachs representing 12 fish species were examined. The predominant fish species collected were deepwater sculpin (Myoxocephalus thompsonii), siscowet (Salvelinus namaycush siscowet), kiyi (Coregonus kiyi), and cisco (Coregonus artedi). Mysis diluviana was the most common prey item, indicating that changes in Mysis abundance could have a profound impact on the entire offshore food web. Mysis was the primary diet item of deepwater sculpin (≥ 53% by mass) and kiyi (≥ 96% by mass) regardless of depth or season. The invasive Bythotrephes was an important diet component of the pelagic cisco in summer and fall. Deepwater sculpin were the primary diet item of siscowet (≥ 52% by mass), with coregonines appearing in the diet of larger (> 400 mm) siscowet. Non-metric multidimensional scaling analysis indicated that there were no statistically significant seasonal or site-specific differences in diets of deepwater sculpin, cisco, or kiyi. Site was the primary structuring factor in siscowet diets. Generally, in Lake Superior, the diet items of the dominant offshore species did not appear to be in danger from those types of major ecological shifts occurring in the lower Laurentian Great Lakes.

Continued feeding on Diporeia by deepwater sculpin in Lake Huron

USGS Publications Warehouse

Thompson, Patricia A.; Roseman, Edward F.; Keeler, Kevin M.; O'Brien, Timothy P.; Bowser, Dustin

2017-01-01

Monitoring changes in diets of fish is essential to understanding how food web dynamics respond to changes in native prey abundances. In the Great Lakes, Diporeia, a benthic macroinvertebrate and primary food of native benthivores, declined following the introduction of invasive Dreissena mussels and these changes were reflected in fish diets. We examined the diets of deepwater sculpin Myoxocephalus thompsonii collected in bottom trawls during 2010–2014 in the main basin of Lake Huron, and compared these results to an earlier diet study (2003–2005) to assess if their diets have continued to change after a prolonged period of Dreissena mussel invasion and declined Diporeia densities. Diporeia, Mysis, Bythotrephes, and Chironomidae were consumed regularly and other diet items included ostracods, copepods, sphaerid clams, and fish eggs. The prey-specific index of relative importance calculated for each prey group indicated that Mysis importance increased at shallow (≤55 m) and mid (64–73 m) depths, while Diporeia importance increased offshore (≥82 m). The average number of Diporeia consumed per fish increased by 10.0% and Mysis decreased by 7.5%, while the frequency of occurrence of Diporeia and Mysis remained comparable between time periods. The weight of adult deepwater sculpin (80 mm and 100 mm TL bins) increased between time periods; however, the change in weight was only significant for the 80 mm TL group (p < 0.01). Given the historical importance of Diporeia in the Great Lakes, the examination of deepwater sculpin diets provides unique insight into the trophic dynamics of the benthic community in Lake Huron.

Metabolic scope and interspecific competition in sculpins of Greenland are influenced by increased temperatures due to climate change.

PubMed

Seth, Henrik; Gräns, Albin; Sandblom, Erik; Olsson, Catharina; Wiklander, Kerstin; Johnsson, Jörgen I; Axelsson, Michael

2013-01-01

Ongoing climate change has led to an increase in sea surface temperatures of 2-4°C on the west coast of Greenland. Since fish are ectothermic, metabolic rate increases with ambient temperature. This makes these animals particularly sensitive to changes in temperature; subsequently any change may influence their metabolic scope, i.e. the physiological capacity to undertake aerobically challenging activities. Any temperature increase may thus disrupt species-specific temperature adaptations, at both the molecular level as well as in behavior, and concomitant species differences in the temperature sensitivity may shift the competitive balance among coexisting species. We investigated the influence of temperature on metabolic scope and competitive ability in three species of marine sculpin that coexist in Greenland coastal waters. Since these species have different distribution ranges, we hypothesized that there should be a difference in their physiological response to temperature; hence we compared their metabolic scope at three temperatures (4, 9 and 14°C). Their competitive ability at the ambient temperature of 9°C was also tested in an attempt to link physiological capacity with behaviour. The Arctic staghorn sculpin, the species with the northernmost distribution range, had a lower metabolic scope in the higher temperature range compared to the other two species, which had similar metabolic scope at the three temperatures. The Arctic staghorn sculpin also had reduced competitive ability at 9°C and may thus already be negatively affected by the current ocean warming. Our results suggest that climate change can have effects on fish physiology and interspecific competition, which may alter the species composition of the Arctic fish fauna.

Episodic acidification of small streams in the northeastern united states: Fish mortality in field bioassays

USGS Publications Warehouse

Van Sickle, J.; Baker, J.P.; Simonin, H.A.; Baldigo, Barry P.; Kretser, W.A.; Sharpe, W.E.

1996-01-01

In situ bioassays were performed as part of the Episodic Response Project, to evaluate the effects of episodic stream acidification on mortality of brook trout (Salvelinus fontinalis) and forage fish species. We report the results of 122 bioassays in 13 streams of the three study regions: the Adirondack mountains of New York, the Catskill mountains of New York, and the Northern Appalachian Plateau of Pennsylvania. Bioassays during acidic episodes had significantly higher mortality than did bioassays conducted under nonacidic conditions, but there was little difference in mortality rates in bioassays experiencing acidic episodes and those experiencing acidic conditions throughout the test period. Multiple logistic regression models were used to relate bioassay mortality rates to summary statistics of time-varying stream chemistry (inorganic monomeric aluminum, calcium, pH, and dissolved organic carbon) estimated for the 20-d bioassay periods. The large suite of candidate regressors also included biological, regional, and seasonal factors, as well as several statistics summarizing various features of aluminum exposure duration and magnitude. Regressor variable selection and model assessment were complicated by multicol-linearity and overdispersion. For the target fish species, brook trout, bioassay mortality was most closely related to time-weighted median inorganic aluminum. Median Ca and minimum pH offered additional explanatory power, as did stream-specific aluminum responses. Due to high multicollinearity, the relative importance of different aluminum exposure duration and magnitude variables was difficult to assess, but these variables taken together added no significant explanatory power to models already containing median aluminum. Between 59 and 79% of the variation in brook trout mortality was explained by models employing between one and five regressors. Simpler models were developed for smaller sets of bioassays that tested slimy and mottled sculpin (Cottus cognatus and C. bairdi) as well as blacknose dace (Rhinichthys atratulus). For these forage species a single inorganic aluminum exposure variable successfully accounted for 86-98% of the observed mortality. Even though field bioassays showed evidence of multiple toxicity factors, model results suggest that adequate mortality predictions can be obtained from a single index of inorganic Al concentrations during exposure periods.

Nearshore habitat and fish community associations of coaster brook trout in Isle Royale, Lake Superior

USGS Publications Warehouse

Gorman, O.T.; Moore, S.A.; Carlson, A.J.; Quinlan, H.R.

2008-01-01

We characterized the nearshore habitat and fish community composition of approximately 300 km of shoreline within and adjacent to the major embayments of Isle Royale, Lake Superior. Sampling yielded 17 species, of which 12 were widespread and represented a common element of the Lake Superior fish community, including cisco Coregonus artedi, lake whitefish C. clupeaformis, round whitefish Prosopium cylindraceum, lake trout Salvelinus namaycush, rainbow smelt Osmerus mordax, lake chub Couesius plumbeus, longnose sucker Catostomus catostomus, white sucker C. commersonii, trout-perch Percopsis omiscomaycus, ninespine stickleback Pungitius pungitius, burbot Lota lota, and slimy sculpin Cottus cognatus. The presence of brook trout S. fontinalis in an embayment was associated with the common species of the Isle Royale nearshore fish community, particularly cisco, longnose sucker, and round whitefish. However, brook trout were present in only five embayments and were common only in Tobin Harbor. Most Isle Royale embayments had broadly overlapping ranges of nearshore habitats. Within embayments, fish were distributed along a habitat gradient from less-protected rocky habitat near the mouth to highly protected habitat with mixed and finer substrates at the head. Embayments with brook trout had greater mean protection from the open lake, greater variation in depth, greater mean cover, and higher mean frequencies of large substrates (cobble, boulder, and bedrock). Within those embayments, brook trout were associated with habitat patches with higher mean frequencies of small substrates (particularly sand and coarse gravel). Within Tobin Harbor, brook trout were associated with midembayment habitat and species assemblages, especially those locations with a mixture of sand, gravel, and cobble substrates, an absence of bedrock, and the presence of round whitefish, white sucker, and trout-perch. Comparison of embayments with the model, Tobin Harbor, showed that six embayments without brook trout had very similar arrays of habitat. However, four embayments with brook trout had relatively different arrays of habitat from Tobin Harbor. These results suggest that there is potential for further recovery of brook trout populations across Isle Royale nearshore habitats. ?? Copyright by the American Fisheries Society 2008.

Cadmium risks to freshwater life: derivation and validation of low-effect criteria values using laboratory and field studies

USGS Publications Warehouse

Mebane, Christopher A.

2006-01-01

In 2001, the U.S. Environmental Protection Agency (EPA) released updated aquatic life criteria for cadmium. Since then, additional data on the effects of cadmium to aquatic life have become available from studies supported by the EPA, Idaho Department of Environmental Quality (IDEQ), and the U.S. Geological Survey, among other sources. Updated data on the effects of cadmium to aquatic life were compiled and reviewed and low-effect concentrations were estimated. Low-effect values were calculated using EPA's guidelines for deriving numerical national water-quality criteria for the protection of aquatic organisms and their uses. Data on the short-term (acute) effects of cadmium on North American freshwater species that were suitable for criteria derivation were located for 69 species representing 57 genera and 33 families. For longer-term (chronic) effects of cadmium on North American freshwater species, suitable data were located for 28 species representing 21 genera and 17 families. Both the acute and chronic toxicity of cadmium were dependent on the hardness of the test water. Hardness-toxicity regressions were developed for both acute and chronic datasets so that effects data from different tests could be adjusted to a common water hardness. Hardness-adjusted effects values were pooled to obtain species and genus mean acute and chronic values, which then were ranked by their sensitivity to cadmium. The four most sensitive genera to acute exposures were, in order of increasing cadmium resistance, Oncorhynchus (Pacific trout and salmon), Salvelinus ('char' trout), Salmo (Atlantic trout and salmon), and Cottus (sculpin). The four most sensitive genera to chronic exposures were Hyalella (amphipod), Cottus, Gammarus (amphipod), and Salvelinus. Using the updated datasets, hardness dependent criteria equations were calculated for acute and chronic exposures to cadmium. At a hardness of 50 mg/L as calcium carbonate, the criterion maximum concentration (CMC, or 'acute' criterion) was calculated as 0.75 mug/L cadmium using the hardness-dependent equation CMC = e(0.8403 ? ln(hardness)-3.572) where the 'ln hardness' is the natural logarithm of the water hardness. Likewise, the criterion continuous concentration (CCC, or 'chronic' criterion) was calculated as 0.37 mug/L cadmium using the hardness-dependent equation CCC = (e(0.6247 ? ln(hardness)-3.384)) ? (1.101672 - ((ln hardness) ? 0.041838))). Using data that were independent of those used to derive the criteria, the criteria concentrations were evaluated to estimate whether adverse effects were expected to the biological integrity of natural waters or to selected species listed as threatened or endangered. One species was identified that would not be fully protected by the derived CCC, the amphipod Hyalella azteca. Exposure to CCC conditions likely would lead to population decreases in Hyalella azteca, the food web consequences of which probably would be slight if macroinvertebrate communities were otherwise diverse. Some data also suggested adverse behavioral changes are possible in fish following long-term exposures to low levels of cadmium, particularly in char (genus Salvelinus). Although ambiguous, these data indicate a need to periodically review the literature on behavioral changes in fish following metals exposure as more information becomes available. Most data reviewed indicated that criteria conditions were unlikely to contribute to overt adverse effects to either biological integrity or listed species. If elevated cadmium concentrations that approach the chronic criterion values occur in ambient waters, careful biological monitoring of invertebrate and fish assemblages would be prudent to validate the prediction that the assemblages would not be adversely affected by cadmium at criterion concentrations.

The effect of bloom of filamentous green algae on the reproduction of yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottoidae) during ecological crisis in Lake Baikal.

PubMed

Khanaev, I V; Dzyuba, E V; Kravtsova, L S; Grachev, M A

2016-03-01

In shallow water areas of open Lake Baikal, filamentous green alga of the genus Spirogyra grows abundantly. Together with alga of the genus Ulothrix, it forms algal mats. According to our observations from 2010 to 2013, the spawning habitat conditions for the yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottidae) proved to be significantly disturbed in the littoral zone of Listvennichnyi Bay (southern Baikal), which, in turn, reduced the number of egg layings. With a 100% projective cover of the floor and a high density of green filamentous algae, the shallow-water stony substrate becomes completely inaccessible for spawning of the August population.

A new species of Malmiana (Oligochaeta: Hirudinida: Piscicolidae) from tidepool fishes in northern California.

PubMed

Burreson, Eugene M; Kalman, Julianne E

2006-02-01

Malmiana buthi n. sp. is described from the body and fins of the fluffy sculpin, Oligocottus snyderi, the tidepool sculpin, Oligocottus maculosus, and the woolly sculpin, Clinocottus analis, collected from tidepools at Horseshoe Cove on the Bodega Marine Reserve in Sonoma County, California. Prevalence of the leech was 32.6% on live-caught O. snyderi; mean intensity on O. snyderi was 3.3 leeches per fish, with a range from 1 to 7. The leech is not known to exceed 8 mm total length. The body is smooth, lacking papillae, tubercles, or pulsatile vesicles. Two pairs of crescentiform eyes are present on the oral sucker, and 1 pair of punctiform eyes occurs on the second annulus of the trachelosome. The caudal sucker has 14 small punctiform ocelli spaced evenly around the margin. The last 9 segments of the urosome have pairs of large punctiform ocelli both dorsally and ventrally. Body and caudal sucker pigmentation is uniformly reddish brown dorsally and ventrally with segental, lateral, unpigmented areas on both the urosome and trachelosome; pigmentation on the oral sucker is in the form of a cross. There are 5 pairs of testisacs; accessory gland cells on the atrial cornua and vector tissue are absent.

Visual Sensitivity of Deepwater Fishes in Lake Superior

PubMed Central

Harrington, Kelly A.; Hrabik, Thomas R.; Mensinger, Allen F.

2015-01-01

The predator-prey interactions in the offshore food web of Lake Superior have been well documented, but the sensory systems mediating these interactions remain unknown. The deepwater sculpin, (Myoxocephalus thompsoni), siscowet (Salvelinus namaycush siscowet), and kiyi (Coregonus kiyi) inhabit low light level environments. To investigate the potential role of vision in predator-prey interactions, electroretinography was used to determine visual sensitivity for each species. Spectral sensitivity curves revealed peak sensitivity at 525 nm for each species which closely corresponds to the prevalent downwelling light spectrum at depth. To determine if sufficient light was available to mediate predator-prey interactions, visual sensitivity was correlated with the intensity of downwelling light in Lake Superior to construct visual depth profiles for each species. Sufficient daytime irradiance exists for visual interactions to approximately 325 m for siscowet and kiyi and 355 m for the deepwater sculpin during summer months. Under full moon conditions, sufficient irradiance exists to elicit ERG response to light available at approximately 30 m for the siscowet and kiyi and 45 m for the deepwater sculpin. Visual interactions are therefore possible at the depths and times when these organisms overlap in the water column indicating that vision may play a far greater role at depth in deep freshwater lakes than had been previously documented. PMID:25646781

Spatial distribution of pelagic fish larvae in the northern main basin of Lake Huron

USGS Publications Warehouse

Roseman, Edward F.; O'Brien, Timothy P.

2013-01-01

Larval fish occurrence in inshore and offshore zones in the northern main basin of Lake Huron was assessed during 2007 as part of a larger ecological examination of Lake Huron foodwebs and habitats. Day and night collections using neuston and conical nets at inshore (1.5–15 m depths) and offshore (37 and 91 m depths) locations at De Tour and Hammond Bay to assess the abundance, phenology, and spatial distribution of pelagic ichthyoplankton during spring and early summer were made. In general, densities of larval fishes were higher at De Tour than Hammond Bay during daytime neuston net collections, with the exception of Longnose Sucker, which were only collected at Hammond Bay. Lake Whitefish, Burbot, and Rainbow Smelt dominated inshore catches in early spring with Cisco, Deepwater Sculpin, Emerald Shiner, Bloater, Slimy Sculpin, Ninespine Stickleback, and Yellow Perch larvae also collected.Nighttime nearshore and offshore sampling revealed that Rainbow Smelt and Burbot larvae were present in relatively high abundances compared to inshore densities. Concentrations of larvae of deepwater demersal fishes such as Lake Whitefish and Deepwater Sculpin suggest that inshore zones in northern Lake Huron are important nursery habitats emphasizing a critical production and recruitment linkage between inshore and deepwater zones.

Structures and ice-binding faces of the alanine-rich type I antifreeze proteins.

PubMed

Patel, Shruti N; Graether, Steffen P

2010-04-01

Antifreeze proteins (AFPs) protect cold-blooded organisms from the damage caused by freezing through their ability to inhibit ice growth. The type I AFP family, found in several fish species, contains proteins that have a high alanine content (>60% of the sequence) and structures that are almost all alpha-helical. We examine the structure of the type I AFP isoforms HPLC6 from winter flounder, shorthorn sculpin 3, and the winter flounder hyperactive type I AFP. The HPLC6 isoform structure consists of a single alpha-helix that is 37 residues long, whereas the shorthorn sculpin 3 isoform consists of two helical regions separated by a kink. The high-resolution structure of the hyperactive type I AFP has yet to be determined, but circular dichroism data and analytical ultracentrifugation suggest that the 195 residue protein is a side-by-side dimer of two alpha-helices. The alanine-rich ice-binding faces of HPLC6 and hyperactive type I AFP are discussed, and we propose that the ice-binding face of the shorthorn sculpin 3 AFP contains Ala14, Ala19, and Ala25. We also propose that the denaturation of hyperactive type I AFP at room temperature is explained by the stabilization of the dimerization interface through hydrogen bonds.

Patch occupancy of stream fauna across a land cover gradient in the southern Appalachians, USA

Treesearch

John R. Frisch; James T. Peterson; Kristen K. Cecala; John C. Maerz; C. Rhett Jackson; Ted Gragson; Catherine M. Pringle

2016-01-01

We modeled patch occupancy to examine factors that best predicted the prevalence of four functionally important focal stream consumers (Tallaperla spp., Cambarus spp., Pleurocera proxima, and Cottus bairdi) among 37 reaches within the Little Tennessee River basin of the...

Temporal changes in the prevalence of parasites in two Oregon estuary-dwelling fishes.

PubMed

Olson, Robert E; Pierce, Jack R; Jacobson, Kym C; Burreson, Eugene M

2004-06-01

The parasite faunas of juvenile English sole (Parophrys vetulus) in 1971-1972 and staghorn sculpin (Leptocottus armatus) in 1971 from Yaquina Bay, Oregon, were compared with faunas found in the same estuary in 1997-2000 (English sole) and 1999-2000 (staghorn sculpin). The 7 most commonly occurring parasites in 1971 were compared with the same species observed during the same month and sampling sites in 1997-2000. Multivariate community analysis of juvenile English sole parasites supported the suggestion that the 1971 parasite data were representative of the early-1970s time period. Four of the parasite species infecting English sole and 6 of those infecting staghorn sculpins had significantly lower prevalences in 1997-2000. Parasite species with significantly lower prevalences also had reduced intensity levels. One parasite (Glugea stephani) of English sole increased in prevalence in the 1997-2000 samples in association with the warm estuarine temperatures during the 1997 El Niño year. Although the causes for the changes in occurrence of other parasites were not determined, ecological changes in Yaquina Bay that may have influenced parasite ecology include apparent changes in the estuary ichthyofauna that occurred between the sampling periods. Such changes could be associated with increases in the number of California sea lions (Zalophus californianus) subsequent to establishment of the Marine Mammal Protection Act in 1972.

Astrochronology of the Late Turonian: implications for the behavior of the carbon cycle at the demise of peak greenhouse

NASA Astrophysics Data System (ADS)

Laurin, Jiří; Čech, Stanislav; Uličný, David; Štaffen, Zdeněk; Svobodová, Marcela

2014-05-01

A series of prominent carbon-cycle perturbations, indicated by carbon-isotope excursions of up to 2‰, marked climatic and oceanographic changes that followed the peak mid-Cretaceous greenhouse. The nature and forcing mechanisms of these changes remain poorly understood, partly due to the lack of a detailed temporal control in this interval. Here we present an orbitally calibrated time scale, which is based on hemipelagic rhythmites in the Bohemian Cretaceous Basin, and which can be linked to the established chronostratigraphic framework using inoceramid biostratigraphy and carbon-isotope signature. In the new age model, the Late Turonian, defined by the first occurrence of I. perplexus below and the first occurrence of C. deformis erectus above, spans 1.56(±0.07) Myr. When anchored to the newly refined age of the Turonian-Coniacian boundary (Sageman et al., in press), the onset of the Late Turonian is 91.31(±0.45) Ma. Inoceramid zones I. perplexus and M. scupini span 0.76(±0.05) Myr and 0.80(±0.05) Myr, respectively. A time-domain record of carbon-isotope variations was obtained by pinning published δ13Ccarb data to the orbital time scale using 9 biostratigraphic and carbon-isotope markers. The timing of major carbon-isotope excursions suggests a link to 405-kyr eccentricity changes and, in the early Late Turonian, to ˜100 kyr eccentricity variations. However, over 80% of the variance in the Late Turonian δ13C occurs at longer (million-year) scales. The key features of the δ13Ccarb signature, including the amplified long-term variance, can be reproduced with simple models of orbitally driven isotopic mass balance. At a constant carbon-isotope fractionation, the best fit to the δ13Ccarb signature is obtained with enhanced organic burial at high eccentricity (in accordance with monsoonal forcing of organic accumulation in the low-latitude Atlantic and/or buildup of low-latitude, terrestrial carbon reservoirs). Alternative solutions should consider changing carbon-isotope fractionation due to pCO2 and/or nutrient-flux changes.

Status and trends of prey fish populations in Lake Michigan, 2012

USGS Publications Warehouse

Bunnell, David B.; Madenjian, Charles P.; Desorcie, Timothy J.; Kostich, Melissa Jean; Smith, Kelley R.; Adams, Jean V.

2012-01-01

The U.S. Geological Survey Great Lakes Science Center has conducted lake-wide surveys of the fish community in Lake Michigan each fall since 1973 using standard 12-m bottom trawls towed along contour at depths of 9 to 110 m at each of seven index transects. The resulting data on relative abundance, size and age structure, and condition of individual fishes are used to estimate various population parameters that are in turn used by state and tribal agencies in managing Lake Michigan fish stocks. All seven established index transects of the survey were completed in 2012. The survey provides relative abundance and biomass estimates between the 5-m and 114-m depth contours of the lake (herein, lake-wide) for prey fish populations, as well as burbot, yellow perch, and the introduced dreissenid mussels. Lake-wide biomass of alewives in 2012 was estimated at 9 kilotonnes (kt, 1 kt = 1000 metric tonnes), which continues the trend of unusually low alewife biomass since 2004 but represented a 20% increase from the 2011 estimate. The age distribution of alewives larger than 100 mm was dominated (i.e., 84%) by age-2. Record low biomass was observed for several species, including bloater (0.4 kt), rainbow smelt (0.1 kt), deepwater sculpin (1.5 kt), and ninespine stickleback (0.01 kt). Slimy sculpin lake-wide biomass was 0.73 kt in 2012, which was the third consecutive year revealing a decline. Estimated biomass of round goby increased by 79% to 3 kt. Burbot lake-wide biomass (0.5 kt in 2012) has remained below 3 kt since 2001. Numeric density of age-0 yellow perch (i.e., < 100 mm) was only 2 fish per ha, which is indicative of a relatively poor year-class. Lake-wide biomass estimates of dreissenid mussels have continued to increase from 2010, from 12 to 95 kt in 2012. Overall, the total lake-wide prey fish biomass estimate (sum of alewife, bloater, rainbow smelt, deepwater sculpin, slimy sculpin, round goby, and ninespine stickleback) in 2012 was 15 kt, which represented the lowest total biomass of the time series.

Stream inflow and predation risk affect littoral habitat selection by benthic fish

Treesearch

Karl M. Polivka; Lisa M. Friedli; Elizabeth C. Green

2013-01-01

We examined small, fishless headwater streams to determine whether transport of macroinvertebrates into the littoral zone of an oligotrophic lake augmented food availability for Cottus asper, an abundant predatory fish in our study system. We sampled fish and macroinvertebrates during the recruitment and growth season of 2 years, either monthly (2004...

50 CFR Table 2a to Part 679 - Species Codes: FMP Groundfish

Code of Federal Regulations, 2010 CFR

2010-10-01

...) 710 Sculpins 160 SHARKS: Other (if salmon, spiny dogfish or Pacific sleeper shark—use specific species code) 689 Pacific sleeper 692 Salmon 690 Spiny dogfish 691 SKATES: Big 702 Longnose 701 Other (If...

50 CFR Table 2a to Part 679 - Species Codes: FMP Groundfish

Code of Federal Regulations, 2011 CFR

2011-10-01

...) 710 Sculpins 160 SHARKS Other (if salmon, spiny dogfish or Pacific sleeper shark—use specific species code) 689 Pacific sleeper 692 Salmon 690 Spiny dogfish 691 SKATES Big 702 Longnose 701 Other (If...

Viability and infectivity of Ichthyophonus sp. in post-mortem Pacific herring, Clupea pallasii

USGS Publications Warehouse

Kocan, Richard M.; Hart, Lucas M.; Lewandowski, Naomi; Hershberger, Paul

2014-01-01

Ichthyophonus-infected Pacific herring, Clupea pallasii, were allowed to decompose in ambient seawater then serially sampled for 29 days to evaluate parasite viability and infectivity for Pacific staghorn sculpin, Leptocottus armatus. Ichthyophonus sp. was viable in decomposing herring tissues for at least 29 days post-mortem and could be transmitted via ingestion to sculpin for up to 5 days. The parasite underwent morphologic changes during the first 48 hr following death of the host that were similar to those previously reported, but as host tissue decomposition progressed, several previously un-described forms of the parasite were observed. The significance of long-term survival and continued morphologic transformation in the post-mortem host is unknown, but it could represent a saprozoic phase of the parasite life cycle that has survival value for Ichthyophonus sp.

Fishery survey of U. S. waters of Lake Ontario

USGS Publications Warehouse

Wells, LaRue

1969-01-01

Gill nets and trawls were fished by the Bureau of Commercial Fisheries R/V Cisco during September 19-23, 1964, at several locations and depths in the offshore United States waters of Lake Ontario. Water temperatures were low (3.7-8.3 A?C) at all fishing stations except one (16.4 A?C). Supplementary data were provided by the Bureau's R/V Kaho in 1966. Alewives and smelt were common. Ciscoes were extremely scarce, but large; most of those caught were bloaters. Slimy sculpins were abundant, but no deepwater sculpins were caught. Yellow perch were scarce. Although the warm water species were inadequately sampled, trout-perch seemed to be abundant. Other species, all caught in small numbers, were lake trout, spottail shiners, burbot, threespine sticklebacks, and johnny darters from cold water and northern pike, lake chubs, white suckers, white bass, white perch, and rock bass from warm water.

Status and trends of prey fish populations in Lake Michigan, 2013

USGS Publications Warehouse

Madenjian, Charles P.; Bunnell, David B.; Desorcie, Timothy J.; Kostich, Melissa Jean; Armenio, Patricia M.; Adams, Jean V.

2015-01-01

The U.S. Geological Survey Great Lakes Science Center has conducted lake-wide surveys of the fish community in Lake Michigan each fall since 1973 using standard 12-m bottom trawls towed along contour at depths of 9 to 110 m at each of seven index transects. The resulting data on relative abundance, size and age structure, and condition of individual fishes are used to estimate various population parameters that are in turn used by state and tribal agencies in managing Lake Michigan fish stocks. All seven established index transects of the survey were completed in 2013. The survey provides relative abundance and biomass estimates between the 5-m and 114-m depth contours of the lake (herein, lake-wide) for prey fish populations, as well as burbot, yellow perch, and the introduced dreissenid mussels. Lake-wide biomass of alewives in 2013 was estimated at 29 kilotonnes (kt, 1 kt = 1000 metric tonnes), which was more than three times the 2012 estimate. However, the unusually high standard error associated with the 2013 estimate indicated no significant increase in lake-wide biomass between 2012 and 2013. Moreover, the age distribution of alewives remained truncated with no alewife exceeding an age of 5. The population of age-1 and older alewives was dominated (i.e., 88%) by the 2010 and 2012 year-classes. Record low biomass was observed for deepwater sculpin (1.3 kt) and ninespine stickleback (0.004 kt) in 2013, while bloater (1.6 kt) and rainbow smelt (0.2 kt) biomasses remained at low levels. Slimy sculpin lake-wide biomass was 0.32 kt in 2013, marking the fourth consecutive year of a decline. The 2013 biomass of round goby was estimated at 10.9 kt, which represented the peak estimate to date. Burbot lake-wide biomass (0.4 kt in 2013) has remained below 3 kt since 2001. Numeric density of age-0 yellow perch (i.e., < 100 mm) was only 1 fish per ha, which is indicative of a relatively poor year-class. Lake-wide biomass estimate of dreissenid mussels in 2013 was 23.2 kt. Overall, the total lake-wide prey fish biomass estimate (sum of alewife, bloater, rainbow smelt, deepwater sculpin, slimy sculpin, round goby, and ninespine stickleback) in 2013 was 43 kt, with alewives and round gobies constituting 92% of this total.

DNA barcoding at riverscape scales: Assessing biodiversity among fishes of the genus Cottus (Teleostei) in northern Rocky Mountain streams

Treesearch

Michael K. Young; Kevin S. McKelvey; Kristine L. Pilgrim; Michael K. Schwartz

2013-01-01

There is growing interest in broad-scale biodiversity assessments that can serve as benchmarks for identifying ecological change. Genetic tools have been used for such assessments for decades, but spatial sampling considerations have largely been ignored. Here, we demonstrate how intensive sampling efforts across a large geographical scale can influence identification...

Offshore Fish Community: Ecological Interactions

EPA Science Inventory

The offshore (>80 m) fish community of Lake Superior is made up of predominately native species. The most prominent species are deepwater sculpin, kiyi, cisco, siscowet lake trout, burbot, and the exotic sea lamprey. Bloater and shortjaw cisco are also found in the offshore zone...

Calbindin-immunoreactive cells in the fish enteric nervous system.

PubMed

Olsson, Catharina

2011-01-20

Calbindin is present in a large proportion of the intrinsic primary afferent neurons (IPANs) in the mammalian gut. Little is known about either calbindin or IPANs in fish. In the present study, calbindin immunoreactivity was investigated in the enteric nervous system of the teleost shorthorn sculpin (Myoxocephalus scorpius). Calbindin-immunoreactive nerve cell bodies and nerve fibres were present in all the gut regions except the cardiac stomach. The highest proportion was found in the proximal intestine where calbindin-immunoreactive cells constituted 59±6% (N=3) of the total Hu C/D-immunoreactive myenteric nerve cell population. In other regions, calbindin-immunoreactive cells constituted around 30% of the total population. The cells were generally multipolar with one long axon. The size distribution differed significantly between calbindin-positive and calbindin-negative cells in each of the three animals examined. Calbindin-positive neurons in the proximal intestine had a mean cross-sectional soma area of 163±73μm(2) (n=183 cells) while calbindin-negative cells were 348±221μm(2) (n=127 cells). Calbindin immunoreactivity colocalised to a large extent with serotonin immunoreactivity, but not with choline acetyltransferase (ChAT)-immunoreactivity. Thus, the calbindin-immunoreactive nerve cell population in the shorthorn sculpin gut seems to constitute a homogenous subpopulation of the enteric neurons, at least when considering the size and content of some transmitters. Whether markers other than serotonin and ChAT would differentiate the population remains to be tested. In conclusion, the calbindin-immunoreactive cells in the sculpin differ from mammalian IPANs with regard to several parameters and future functional studies could hopefully add information about the role of this large group of cells in the fish enteric nervous system. Copyright © 2010 Elsevier B.V. All rights reserved.

Fish communities and related environmental conditions of the lower Boise River, southwestern Idaho, 1974-2004

USGS Publications Warehouse

MacCoy, Dorene E.

2006-01-01

Within the last century, the lower Boise River has been transformed from a meandering, braided, gravel-bed river that supported large runs of salmon to a channelized, regulated, urban river that provides flood control and irrigation water to more than 1,200 square miles of land. An understanding of the current status of the river's fish communities and related environmental conditions is important to support the ongoing management of the Boise River. Therefore, fish community data from the U.S. Geological Survey and the Idaho Department of Fish and Game collected since 1974 were analyzed to describe the status of fish communities in the lower Boise River. Each set of data was collected to address different study objectives, but is combined here to provide an overall distribution of fish in the lower Boise River over the last 30 years. Twenty-two species of fish in 7 families have been identified in the lower Boise River-3 salmonidae, trout and whitefish; 2 cottidae, sculpins; 3 catostomidae, suckers; 7 cyprinidae, minnows; 4 centrarchidae, sunfish; 2 ictaluridae, catfish; and 1 cobitidae, loach. Analysis of fish community data using an Index of Biotic Integrity (IBI) for Northwest rivers shows a decrease in the biotic integrity in a downstream direction, with the lowest IBI near the mouth of the Boise River. The number of tolerant and introduced fish were greater in the lower reaches of the river. Changes in land use, habitat, and water quality, as well as regulated streamflow have affected the lower Boise River fish community. IBI scores were negatively correlated with maximum instantaneous water temperature, specific conductance, and suspended sediment; as well as the basin land-use metrics, area of developed land, impervious surface area, and the number of major diversions upstream of a site. Fish communities in the upstream reaches were dominated by piscivorous fish, whereas the downstream reaches were dominated by tolerant, omnivorous fish. The percentage of sculpin in the river decreased in a downstream direction, and sculpin disappear completely at sites downstream of Glenwood Bridge. The sculpin population increased downstream of the Lander wastewater-treatment facility within the last decade, possibly as a result of improved wastewater treatment. The condition of the mountain whitefish (Prosopium williamsoni) throughout the lower Boise River was good and was similar both to the condition of mountain whitefish from least-disturbed rivers in southern Idaho and to the North American standard weight for mountain whitefish.

Effects of discharge fluctuation and the addition of fine sediment on stream fish and macroinvertebrates below a water-filtration facility

NASA Astrophysics Data System (ADS)

Erman, Don C.; Ligon, Franklin K.

1988-01-01

A small, coastal stream in the San Francisco Bay area of California, USA, received the discharges from a drinking-water filtration plant. Two types of discharges were present. Discharges from filter backwashing were 3 4 times base stream flow, occurred 10 60 times per day, contained fine sediments, and each lasted about 10 min. The other discharge was a large, steady flow of relatively sediment-free water from occasional overflow of the delivery aqueduct which generally lasted several hours a day. Samples of invertebrates from natural substrates had significantly fewer taxa and lower density at the two stations below the backwash than at the two above. However, when stable artificial substrates were used, there were no significant differences among all four stations. The aqueduct apparently had no effect because the. invertebrate community at the station upstream of the backwash but downstream of the aqueduct was statistically similar to the station above the aqueduct. To test for acute toxicity, we exposed additional artificial substrates to short-term simulated backwash conditions. These exposures had no effect on invertebrate density or drift. Three-spine stickleback ( Gasterosteus aculeatus) populations were also significantly reduced at the two downstream stations and were made up mostly of larger, adult fish. Prickly sculpins ( Cottus asper), restricted to the most downstream station, were emaciated and had poor growth, probably as a result of scarce benthic food organisms. Artificial redds with eggs of rainbow trout ( Salmo gairdneri) had significantly lower survival at two stations below the plant backwash (30.7% and 41.8%) than at the one above it (61.4%). Hatchery rainbow trout held in cages below the treatment plant from 7 to 37 days survived and continued to feed. Thus, the major effect of the water treatment plant on fish and invertebrates probably was not from acute toxicity in the discharges or the occasionally large discharge of clean water from the aqueduct, but was from the fluctuating backwash flows containing fine sediment that displaced small fish downstream and created unstable benthic substrates for invertebrates. The filter plant that we studied is a direct-feed type (that is, no sedimentation before filtration). These generally require greater frequencies of backwashing than do conventional plants and may therefore have greater biological impacts. Direct-feed plants are becoming increasingly popular throughout the world, for the most part because they are cheaper to build and operate. But if the associated biological problems are mitigated, then the cost savings of direct-feed compared to conventional plants may be lost.

Proteomic response to sublethal cadmium exposure in a sentinel fish species, Cottus gobio.

PubMed

Dorts, Jennifer; Kestemont, Patrick; Dieu, Marc; Raes, Martine; Silvestre, Frédéric

2011-02-04

The present study aimed at evaluating the toxicity of short-term cadmium (Cd) exposure in the European bullhead Cottus gobio, a candidate sentinel species. Several enzymatic activity assays (citrate synthase, cytochrome c oxidase, and lactate dehydrogenase) were carried out in liver and gills of fish exposed to 0.01, 0.05, 0.25, and 1 mg Cd/L for 4 days. Exposure to high Cd concentrations significantly altered the activity of these enzymes either in liver and/or in gills. Second, 2D-DIGE technique was used to identify proteins differentially expressed in tissues of fish exposed to either 0.01 or 1 mg Cd/L. Fifty-four hepatic protein spots and 37 branchial protein spots displayed significant changes in abundance in response to Cd exposure. A total of 26 and 12 different proteins were identified using nano LC-MS/MS in liver and gills, respectively. The identified differentially expressed proteins can be categorized into diverse functional classes, related to metabolic process, general stress response, protein fate, and cell structure for instance. This work provides new insights into the biochemical and molecular events in Cd-induced toxicity in fish and suggests that further studies on the identified proteins could provide crucial information to better understand the mechanisms of Cd toxicity in fish.

Habitat segregation mediates predation by the benthic fish Cottus gobio on the exotic amphipod species Gammarus roeseli

NASA Astrophysics Data System (ADS)

Kaldonski, Nicolas; Lagrue, Clément; Motreuil, Sébastien; Rigaud, Thierry; Bollache, Loïc

2008-09-01

Predation is often considered as one of the most important biotic factor determining the success of exotic species. The freshwater amphipod Gammarus roeseli has widely colonized Western Europe, where it is frequently found in sympatry with the native species ( Gammarus pulex). Previous laboratory experiments revealed that G. roeseli may have an advantage over G. pulex through differential predation by native fish (brown trout). Morphological anti-predator defences (spines) were found responsible for lower rates of predation on the invasive G. roeseli. Here, using both field surveys and laboratory experiments, we tested if a differential of predation exists with other fish predators naturally encountered by gammarids. The main predators present in our field site were nocturnal benthic feeders (mainly bullheads, Cottus gobio). Fish diet analysis showed that, compared to its global availability in the river, G. roeseli was less consumed than G. pulex. In the field, however, G. roeseli was found mainly in the aquatic vegetation whereas G. pulex was found in all habitat types. Laboratory experiments in microcosms revealed that G. roeseli was less prone to predation by C. gobio only when vegetation was present. Depending on the type of predator, the differential of predation could therefore be mediated by antipredator behaviour, and a better usage of refuges, rather than by morphological defences.

Native bee diversity and pollen foraging specificity in cultivated highbush blueberry (Ericaceae: Vaccinium corymbosum) in Rhode Island

USGS Publications Warehouse

Scott, Zachary; Ginsberg, Howard; Alm, Steven R.

2016-01-01

We identified 41 species of native bees from a total of 1,083 specimens collected at cultivated highbush blueberry plantings throughout Rhode Island in 2014 and 2015. Andrena spp., Bombus spp., and Xylocopa virginica (L.) were collected most often. Bombus griseocollis (DeGeer), B. impatiens Cresson, B. bimaculatus Cresson, B. perplexus Cresson, and Andrena vicina Smith collected the largest mean numbers of blueberry pollen tetrads. The largest mean percent blueberry pollen loads were carried by the miner bees Andrena bradleyi Viereck (91%), A. carolina Viereck (90%), and Colletes validus Cresson (87%). The largest mean total pollen grain loads were carried by B. griseocollis (549,844), B. impatiens (389,558), X. virginica (233,500), and B. bimaculatus (193,132). Xylocopa virginica was the fourth and fifth most commonly collected bee species in 2014 and 2015, respectively. They exhibit nectar robbing and females carried relatively low blueberry pollen loads (mean 33%). Overall, we found 10 species of bees to be the primary pollinators of blueberries in Rhode Island.

76 FR 80782 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands; Proposed...

Federal Register 2010, 2011, 2012, 2013, 2014

2011-12-27

... information collected during 2011, such as revised stock assessments and catch data. The Plan Team compiled... and socioeconomic data, including projected biomass trends, information on assumed distribution of..., skates, sculpins, and octopuses. Section 679.20(a)(5)(iii)(B)(1) requires the Aleutian Islands (AI...

50 CFR Table 2a to Part 679 - Species Codes: FMP Groundfish

Code of Federal Regulations, 2014 CFR

2014-10-01

.... polyspinis) 136 Pacific Ocean Perch (S. alutus) 141 Pygmy (S. wilsoni) 179 Quillback (S. maliger) 147... Alaska plaice 133 Arrowtooth 121 Bering 116 Kamchatka 117 Starry 129 Octopus, North Pacific 870 Pacific...) 710 Sculpins 160 SHARKS Other (if salmon, spiny dogfish or Pacific sleeper shark—use specific species...

50 CFR Table 2a to Part 679 - Species Codes: FMP Groundfish

Code of Federal Regulations, 2013 CFR

2013-10-01

.... polyspinis) 136 Pacific Ocean Perch (S. alutus) 141 Pygmy (S. wilsoni) 179 Quillback (S. maliger) 147... Alaska plaice 133 Arrowtooth 121 Bering 116 Kamchatka 117 Starry 129 Octopus, North Pacific 870 Pacific...) 710 Sculpins 160 SHARKS Other (if salmon, spiny dogfish or Pacific sleeper shark—use specific species...

50 CFR Table 2a to Part 679 - Species Codes: FMP Groundfish

Code of Federal Regulations, 2012 CFR

2012-10-01

.... polyspinis) 136 Pacific Ocean Perch (S. alutus) 141 Pygmy (S. wilsoni) 179 Quillback (S. maliger) 147... Alaska plaice 133 Arrowtooth 121 Bering 116 Kamchatka 117 Starry 129 Octopus, North Pacific 870 Pacific...) 710 Sculpins 160 SHARKS Other (if salmon, spiny dogfish or Pacific sleeper shark—use specific species...

Status and trends of prey fish populations in Lake Michigan, 2008

USGS Publications Warehouse

Bunnell, David B.; Madenjian, Charles P.; Holuszko, Jeffrey D.; Desorcie, Timothy J.; Adams, Jean V.

2009-01-01

The Great Lakes Science Center (GLSC) has conducted lake-wide surveys of the fish community in Lake Michigan each fall since 1973 using standard 12-m bottom trawls towed along contour at depths of 9 to 110 m at each of seven index transects. The resulting data on relative abundance, size structure, and condition of individual fishes are used to estimate various population parameters that are in turn used by state and tribal agencies in managing Lake Michigan fish stocks. All seven established index transects of the survey were completed in 2008. The survey provides relative abundance and biomass estimates between the 5-m and 114-m depth contours of the lake (herein, lake-wide) for prey fish populations, as well as burbot, yellow perch, and the introduced dreissenid mussels. Lake-wide biomass of alewives in 2008 was estimated at 8.27 kilotonnes (kt) (1 kt = 1000 metric tons), which was the smallest biomass estimate in the entire time series and 29% lower than the 2007 estimate. Lake-wide biomass of bloater in 2008 was estimated at 3.33 kt, which was the lowest estimate since 1977 and 38% lower than the 2007 estimate. Rainbow smelt lake-wide biomass equaled 0.89 kt, which was only 0.01 kt higher than 2007, which is the lowest estimate in the time series. Deepwater sculpin lake-wide biomass equaled 5.23 kt, which is the fourth straight year of declining biomass. The 2008 estimate is the second smallest in the time series, and 39% lower than the 2007 estimate. Slimy sculpin lake-wide biomass remained relatively high in 2008 (2.75 kt), increasing 25% over 2007. Ninespine stickleback lake-wide biomass equaled only 0.50 kt in 2008, which was 79% lower than the 2007 estimate. The final prey fish, exotic round goby, increased two orders of magnitude between 2007 and 2008, from 0.02 to 4.65 kt. Round gobies now represent 18% of the prey fish biomass. Burbot lake-wide biomass (0.91 kt in 2008) has remained fairly constant since 2002. Numeric density of age-0 yellow perch (i.e., < 100 mm) equaled 0.7 fish per ha, which is indicative of a relatively poor year-class. Lake-wide biomass of dreissenid mussels dropped precipitously in 2008, down to 9.47 kt, and a 96% decline from the 2007 biomass estimate. Overall, the total lake-wide prey fish biomass estimate (sum of alewife, bloater, rainbow smelt, deepwater sculpin, slimy sculpin, round goby, and ninespine stickleback) in 2008 was 25.62 kt, which was the lowest observed since the survey began in 1973.

75 FR 76372 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands; Proposed...

Federal Register 2010, 2011, 2012, 2013, 2014

2010-12-08

... intends to have the information available for the assessment cycle in the fall of 2011. At the October... sole, rock sole, Kamchatka flounder, sharks, squid, sculpins, and octopus to be included in the final... flounder, Greenland turbot, rock sole, Alaska plaice, other flatfish, and rougheye rockfish. The biomass...

Assessment System for Aircraft Noise (ASAN) Citation Database. Volume 2

DTIC Science & Technology

1989-12-01

Key Largo cotton 01.01.10.06.04.04 * Mouse, Perdido Key beach 01.01.10.06.05.01 * Mouse, Salt marsh harvest 01.07.22.09.00.00 Mugilidae ...01.07.22.09.00.00 ... Mugilidae .. Mullets 01.07.22.10.00.00 ... Gobies ..Gobiidae 01.07.22.11.00.00 ... Cottidae ... Sculpins 01.07.22.12.00.00 ... Damacifishes

75 FR 38454 - Fisheries of the Exclusive Economic Zone Off Alaska; Skates Management in the Bering Sea and...

Federal Register 2010, 2011, 2012, 2013, 2014

2010-07-02

... short- lived invertebrates (squids and octopuses) with long-lived fish (sharks and skates). If approved... occurring, and therefore the groundfish ACLs and AMs must be implemented by January 1, 2011. Skate, shark... BSAI. In the GOA, shark, sculpin, octopus, and squid groups are currently managed as a complex in the...

Patterns of d18O in fish tissues in two Oregon Coast range streams

EPA Science Inventory

We are using stable isotopes of C, N, O and S (H planned) to study the ecology of coho salmon in streams of the Oregon Coast Range. As part of this work we have examined changes in d18O in coho salmon juveniles (from eggs to smolting) and sculpin (from 0.5 to 20 gm.). For fish...

White sturgeon mitigation and restoration in the Columbia and Snake rivers upstream from Bonneville Dam, Annual progress report April 2002 - March 2003. Report C

USGS Publications Warehouse

Gadomski, D.M.; Parsley, M.J.; Kofoot, P.

2004-01-01

During 1 April 2002 through 31 March 2003, the U.S. Geological Survey (USGS) continued work on several tasks, including quantifying habitat suitable for white sturgeon Acipenser transmontanus spawning, a long-term survey of young-of-the-year (YOY) white sturgeon recruitment in the lower Columbia River, and a laboratory study investigating predation on larval and juvenile white sturgeon. River discharge and water temperatures that occurred during April through July 2002 provided relatively good conditions for spawning by white sturgeon downstream from Bonneville, The Dalles, John Day, and McNary dams. Optimal spawning temperatures in the four tailraces occurred for approximately three weeks and during a period of relatively high river discharge. Our monthly estimates of the index of spawning habitat showed that the availability of habitat for spawning peaked in June at levels higher than the average of past years. However, indices for the month of May were less than average in all four tailraces. YOY white sturgeon were collected during bottom trawling in Bonneville and The Dalles reservoirs, but none were captured in the John Day Reservoir. In an ongoing comparison of indices of abundance derived from bottom trawls and gill nets, the Oregon Department of Fish and Wildlife also caught YOY white sturgeon in gill nets set in The Dalles Reservoir, but none in the John Day Reservoir. The third year of a three-year laboratory predation study was completed. Adult channel catfish ingested white sturgeon up to a mean total length of about 120 mm, and juvenile walleye ate white sturgeon up to a mean length of 53 mm. When white sturgeon and coho salmon were both available as prey, northern pikeminnow continued to ingest white sturgeon, but in most cases preferred salmon. Conversely, prickly sculpins preferred white sturgeon over goldfish as prey. The presence of cover and also lower light levels reduced predation by sculpins on white sturgeon larvae, but cover did not reduce predation on white sturgeon juveniles. Similar to the past two years, turbidity affected predation of white sturgeon larvae by prickly sculpins, with less sturgeon ingested at higher turbidities.

Stable Isotopic Shifts in Fish Bones from Multiple Archeological Coastal Middens in Penobscot Bay, Maine

NASA Astrophysics Data System (ADS)

Harris, C.; Johnson, B.; Ambrose, W. G.; Bourque, B.; Dostie, P.; Crowley, E.

2010-12-01

The carbon and nitrogen stable isotope compositions of collagen extracted from well-preserved archeological fish bones has the potential to provide useful information on fish diets and food web dynamics over time. Previous work on the Turner Farm archaeological site in Penobscot Bay, Gulf of Maine, reveals significant shifts in fish diets have occurred since European colonization (post 1620’s). The objective of the present study was to analyze samples from other archaeological sites within Penobscot Bay to characterize the spatial extent of the isotopic shift measured at Turner Farm. Stratified cod, flounder, and sculpin bones were analyzed from eight coastal middens located approximately 50km apart from one another within Penobscot Bay. The bones were sampled from three time horizons (0kya, 0.5-1kya, and 2.2-2.4kya). All bone samples were demineralized in 0.2M HCl at 4°C for 2 to 7 days and then extracted in 0.25M NaOH at 4°C for 1 to 2 hours. After freeze-drying, the bulk isotopic composition of each sample was analyzed using the EA-IRMS. In all stratigraphic horizons analyzed, cod were more enriched in δ13C and δ15N than sculpin, and flounder were the most depleted in δ13C and δ15N . However, the isotopic offsets between the fish species decreased from 2.4kya to the present. The nitrogen isotope composition was relatively constant over time and space for all species, implying that trophic levels for the fishes analyzed have not changed significantly in Penobscot Bay for the last 2,400 years. The carbon isotope composition also appears to be constant spatially in Penobscot Bay, however, the modern signal was more depleted than the paleo signal in all three species. The difference between the modern and paleo δ13C is ~5‰ for cod and flounder, and ~9‰ for sculpin. These shifts may, in part, be explained by decreases in both primary producer and prey species diversity, as kelp forests replace eelgrass beds in the Gulf of Maine.

Thermal dependence of cardiac function in arctic fish: implications of a warming world.

PubMed

Franklin, Craig E; Farrell, Anthony P; Altimiras, Jordi; Axelsson, Michael

2013-11-15

With the Arctic experiencing one of the greatest and most rapid increases in sea temperatures in modern time, predicting how Arctic marine organisms will respond to elevated temperatures has become crucial for conservation biology. Here, we examined the thermal sensitivity of cardiorespiratory performance for three closely related species of sculpins that inhabit the Arctic waters, two of which, Gymnocanthus tricuspis and Myoxocephalus scorpioides, have adapted to a restricted range within the Arctic, whereas the third species, Myoxocephalus scorpius, has a wider distribution. We tested the hypothesis that the fish restricted to Arctic cold waters would show reduced cardiorespiratory scope in response to an increase in temperature, as compared with the more eurythermal M. scorpius. As expected from their biogeography, M. scorpioides and G. tricuspis maximised cardiorespiratory performance at temperatures between 1 and 4°C, whereas M. scorpius maximised performance over a wider range of temperatures (1-10°C). Furthermore, factorial scope for cardiac output collapsed at elevated temperature for the two high-latitude species, negatively impacting their ability to support aerobically driven metabolic processes. Consequently, these results concurred with our hypothesis, suggesting that the sculpin species restricted to the Arctic are likely to be negatively impacted by increases in ocean temperatures.

Studies of evolutionary temperature adaptation: muscle function and locomotor performance in Antarctic fish.

PubMed

Franklin, C E

1998-09-01

1. Studies of evolutionary temperature adaptation of muscle and locomotor performance in fish are reviewed with a focus on the Antarctic fauna living at subzero temperatures. 2. Only limited data are available to compare the sustained and burst swimming kinematics and performance of Antarctic, temperate and tropical species. Available data indicate that low temperatures limit maximum swimming performance and this is especially evident in fish larvae. 3. In a recent study, muscle performance in the Antarctic rock cod Notothenia coriiceps at 0 degree C was found to be sufficient to produce maximum velocities during burst swimming that were similar to those seen in the sculpin Myoxocephalus scorpius at 10 degrees C, indicating temperature compensation of muscle and locomotor performance in the Antarctic fish. However, at 15 degrees C, sculpin produce maximum swimming velocities greater than N. coriiceps at 0 degree C. 4. It is recommended that strict hypothesis-driven investigations using ecologically relevant measures of performance are undertaken to study temperature adaptation in Antarctic fish. Recent detailed phylogenetic analyses of the Antarctic fish fauna and their temperate relatives will allow a stronger experimental approach by helping to separate what is due to adaptation to the cold and what is due to phylogeny alone.

Mechanisms and evolution of hypoxia tolerance in fish

PubMed Central

Mandic, Milica; Todgham, Anne E.; Richards, Jeffrey G.

2008-01-01

The ability of an organism to acquire O2 from its environment is key to survival and can play an important role in dictating a species' ecological distribution. This study is the first, to our knowledge, to show a tight, phylogenetically independent correlation between hypoxia tolerance, traits involved in dictating O2 extraction capacity and the distribution of a group of closely related fish species, sculpins from the family Cottidae, along the nearshore marine environment. Sculpins with higher hypoxia tolerance, measured as low critical O2 tensions (Pcrit), inhabit the O2 variable intertidal zones, while species with lower hypoxia tolerance inhabit the more O2 stable subtidal zone or freshwater. Hypoxia tolerance is phylogenetically independently associated with an enhanced O2 extraction capacity, with three principal components accounting for 75 per cent of the variation in Pcrit: routine O2 consumption rate; mass-specific gill surface area; and whole blood haemoglobin (Hb)–O2-binding affinity (P50). Variation in whole blood Hb–O2 P50 is strongly correlated with the intrinsic O2-binding properties of the purified Hb while the differences in the concentration of the allosteric Hb modulators, ATP and GTP, provide a Hb system with substantial plasticity for survival in a highly O2 variable environment. PMID:18996831

Genetic analysis of potential postglacial watershed crossings in Central Europe by the bullhead (Cottus gobio L.).

PubMed

Vonlanthen, P; Excoffier, L; Bittner, D; Persat, H; Neuenschwander, S; Largiadèr, C R

2007-11-01

Natural colonizations across watersheds have been frequently proposed to explain the present distributions of many freshwater fish species. However, detailed studies of such potential watershed crossings are still missing. Here, we investigated potential postglacial watershed crossings of the widely distributed European bullhead (Cottus gobio L.) in two different areas along the Rhine-Rhône watershed using detailed genetic analysis. The main advantage of studying bullheads vs. other freshwater fish species is that their distribution has been lightly influenced by human activities and as such, interpretations of colonization history are not confounded by artificial transplantations. The genetic analyses of eight microsatellite loci revealed strong genetic similarities between populations of both sides of the Rhine-Rhône watershed in the Lake Geneva area, giving strong evidence for a natural watershed crossing of bullheads from the upper Rhine drainage into the Rhône drainage in the Lake Geneva area likely facilitated by the retreat of the glaciers after the last glacial maximum some 20,000 years ago. Populations from the Lake Geneva basin were genetically more similar to populations from across the watershed in the upper Rhine drainage than to populations further downstream in the lower Rhône. In contrast, populations from Belfort, an area, which was not covered by ice during the last glacial maximum, showed strong genetic differentiation between populations of the upper Rhine and Rhône drainages. Based on our results on the bullhead, we propose that glacial retreat may have eased the dispersal of numerous European freshwater fish species across several geological boundaries.

Habitat Utilization by Juvenile Pink and Chum Salmon in Upper Resurrection Bay, Alaska

DTIC Science & Technology

1989-11-01

salmon Oncorhynchus kotez Chum salmon Untcorhynchua kisutch Coho salmon Orncorhynchus nerka Sockeye salmon Oncorhynchus tohawytacha Kink salmon...coho salmon, 40 Dolly Varden, 31 sculpin, 8 tomcod (Microgadus proxins), 17 starry flounder, and 10 sockeye salmon (0. nerka ) stomachs from Cliff and...AK. Godin, J. G. J. 1981. "Daily Patterns of Feeding Behavior, Daily Rations, and Diets of Juvenile Pink Salmon ( Oncorhynchus go’buscha) in Two

Native Bee Diversity and Pollen Foraging Specificity in Cultivated Highbush Blueberry (Ericaceae: Vaccinium corymbosum) in Rhode Island.

PubMed

Scott, Zachary; Ginsberg, Howard S; Alm, Steven R

2016-12-01

We identified 41 species of native bees from a total of 1,083 specimens collected at cultivated highbush blueberry plantings throughout Rhode Island in 2014 and 2015. Andrena spp., Bombus spp., and Xylocopa virginica (L.) were collected most often. Bombus griseocollis (DeGeer), B. impatiens Cresson, B. bimaculatus Cresson, B. perplexus Cresson, and Andrena vicina Smith collected the largest mean numbers of blueberry pollen tetrads. The largest mean percent blueberry pollen loads were carried by the miner bees Andrena bradleyi Viereck (91%), A. carolina Viereck (90%), and Colletes validus Cresson (87%). The largest mean total pollen grain loads were carried by B. griseocollis (549,844), B. impatiens (389,558), X. virginica (233,500), and B. bimaculatus (193,132). Xylocopa virginica was the fourth and fifth most commonly collected bee species in 2014 and 2015, respectively. They exhibit nectar robbing and females carried relatively low blueberry pollen loads (mean 33%). Overall, we found 10 species of bees to be the primary pollinators of blueberries in Rhode Island. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Contaminants of emerging concern in a large temperate estuary.

PubMed

Meador, James P; Yeh, Andrew; Young, Graham; Gallagher, Evan P

2016-06-01

This study was designed to assess the occurrence and concentrations of a broad range of contaminants of emerging concern (CECs) from three local estuaries within a large estuarine ecosystem. In addition to effluent from two wastewater treatment plants (WWTP), we sampled water and whole-body juvenile Chinook salmon (Oncorhynchus tshawytscha) and Pacific staghorn sculpin (Leptocottus armatus) in estuaries receiving effluent. We analyzed these matrices for 150 compounds, which included pharmaceuticals, personal care products (PPCPs), and several industrial compounds. Collectively, we detected 81 analytes in effluent, 25 analytes in estuary water, and 42 analytes in fish tissue. A number of compounds, including sertraline, triclosan, estrone, fluoxetine, metformin, and nonylphenol were detected in water and tissue at concentrations that may cause adverse effects in fish. Interestingly, 29 CEC analytes were detected in effluent and fish tissue, but not in estuarine waters, indicating a high potential for bioaccumulation for these compounds. Although concentrations of most detected analytes were present at relatively low concentrations, our analysis revealed that overall CEC inputs to each estuary amount to several kilograms of these compounds per day. This study is unique because we report on CEC concentrations in estuarine waters and whole-body fish, which are both uncommon in the literature. A noteworthy finding was the preferential bioaccumulation of CECs in free-ranging juvenile Chinook salmon relative to staghorn sculpin, a benthic species with relatively high site fidelity. Published by Elsevier Ltd.

Relative growth of fins in the fourhorn sculpin, Myoxocephalus quadricornis, from the upper Great Lakes

USGS Publications Warehouse

Jacoby, Carl

1961-01-01

Livers of 445 wild bobwhites taken in Iowa, Wisconsin, and Illinois in late fall and winter of 1947-48 were assayed for vitamin A. All contained vitamin A; but the amount in many was so low that it is estimated that 4% of the birds would have died directly from lack of vitamin A within 3 weeks or that as much as 42% might have been affected enough to make them die from predation and severe weather.

Impact of ocean acidification on the hypoxia tolerance of the woolly sculpin, Clinocottus analis.

PubMed

Hancock, Joshua R; Place, Sean P

2016-01-01

As we move into the Anthropocene, organisms inhabiting marine environments will continue to face growing challenges associated with changes in ocean pH (ocean acidification), dissolved oxygen (dead zones) and temperature. These factors, in combination with naturally variable environments such as the rocky intertidal zone, may create extreme physiological challenges for organisms that are already performing near their biological limits. Although numerous studies have examined the impacts of climate-related stressors on intertidal animals, little is known about the underlying physiological mechanisms driving adaptation to ocean acidification and how this may alter organism interactions, particularly in marine vertebrates. Therefore, we have investigated the effects of decreased ocean pH on the hypoxia response of an intertidal sculpin, Clinocottus analis . We used both whole-animal and biochemistry-based analyses to examine how the energetic demands associated with acclimation to low-pH environments may impact the fish's reliance on facultative air breathing in low-oxygen environments. Our study demonstrated that acclimation to ocean acidification resulted in elevated routine metabolic rates and acid-base regulatory capacity (Na + ,K + -ATPase activity). These, in turn, had downstream effects that resulted in decreased hypoxia tolerance (i.e. elevated critical oxygen tension). Furthermore, we present evidence that these fish may be living near their physiological capacity when challenged by ocean acidification. This serves as a reminder that the susceptibility of teleost fish to changes in ocean pH may be underestimated, particularly when considering the multiple stressors that many experience in their natural environments.

Changes in fish diets and food web mercury bioaccumulation induced by an invasive planktivorous fish

USGS Publications Warehouse

Eagles-Smith, Collin A.; Suchanek, Thomas H.; Colwell, Arthur E.; Anderson, Norman L.; Moyle, Peter B.

2008-01-01

The invasion, boom, collapse, and reestablishment of a population of the planktivorous threadfin shad in Clear Lake, California, USA, were documented over a 20-year period, as were the effects of changing shad populations on diet and mercury (Hg) bioaccumulation in nearshore fishes. Threadfin shad competitively displaced other planktivorous fish in the lake, such as inland silversides, young-of-year (YOY) largemouth bass, and YOY bluegill, by reducing zooplankton abundance. As a result, all three species shifted from a diet that was dominated by zooplankton to one that was almost entirely zoobenthos. Stable carbon isotopes corroborated this pattern with each species becoming enriched in δ13C, which is elevated in benthic vs. pelagic organisms. Concomitant with these changes, Hg concentrations increased by ∼50% in all three species. In contrast, obligate benthivores such as prickly sculpin showed no relationship between diet or δ13C and the presence of threadfin shad, suggesting that effects of the shad were not strongly linked to the benthic fish community. There were also no changes in Hg concentrations of prickly sculpin. The temporary extirpation of threadfin shad from the lake resulted in zooplankton densities, foraging patterns, isotope ratios, and Hg concentrations in pelagic fishes returning to pre-shad values. These results indicate that even transient perturbations of the structure of freshwater food webs can result in significant alterations in the bioaccumulation of Hg and that food webs in lakes can be highly resilient.

Proceedings of the NUWC Division Newport Seminar Series on Swimming and Flying in Nature

DTIC Science & Technology

1994-08-16

fish bodv (1 - eel, 2 - trout, 3 - sculpin ) 1.1-21 "" [ 6 2 0 ’It:, 0 t 0 t 0 t 6 3 v/L Velocity of bending wave along the body vs speed of...1959. Previously he was Lecturer in Aeronautics at Cambridge University and before that he undertook flight research with both the Royal Australian ...8217’ ’· l .. ~ ·~·· Photo: The Australian Information Service. London. Aboriginal Boomerangs There are three main types of Australian boomerang

Organochlorine compounds in Lake Superior: Chiral polychlorinated biphenyls and biotransformation in the aquatic food web

USGS Publications Warehouse

Wong, Charles S.; Mabury, Scott A.; Whittle, D. Michael; Backus, Sean M.; Teixeira, Camilla; DeVault, David S.; Bronte, Charles R.; Muir, Derek C.G.

2004-01-01

The enantiomeric composition of seven chiral PCB congeners was measured in the Lake Superior aquatic food web sampled in 1998, to determine the extent of enantioselective biotransformation in aquatic biota. All chiral PCB congeners studied (CBs 91, 95, 136, 149, 174, 176, and 183) biomagnified in the Lake Superior aquatic food web, based on biomagnification and food web magnification factors greater than unity. PCB atropisomers were racemic in phytoplankton and zooplankton, suggesting no biotransformation potential toward PCBs for these low trophic level organisms. However, Diporeia and mysids had significantly nonracemic residues for most chiral congeners studied. This observation suggests that these macrozooplankton can stereoselectively metabolize chiral congeners. Alternatively, macrozooplankton obtained nonracemic residues from feeding on organic-rich suspended particles and sediments, which would imply that stereoselective microbial PCB biotransformation may be occurring in Lake Superior sediments at PCB concentrations far lower than that previously associated with such activity. Widely nonracemic PCB residues in forage fish (lake herring, rainbow smelt, and slimy sculpin) and lake trout suggest a combination of both in vivo biotransformation and uptake of nonracemic residues from prey for these species. Minimum biotransformation rates, calculated from enantiomer mass balances between predators and prey, suggest metabolic half-lives on the order of 8 yr for CB 136 in lake trout and 2.6 yr for CB 95 in sculpins. This result suggests that significant biotransformation may occur for metaboliz able PCB congeners over the lifespan of these biota. This study highlights the potential of chiral analysis to study biotransformation processes in food webs.

Nearshore Fish Distributions in an Alaskan Estuary in Relation to Stratification, Temperature and Salinity

NASA Astrophysics Data System (ADS)

Abookire, A. A.; Piatt, J. F.; Robards, M. D.

2000-07-01

Fish were sampled with beach seines and small-meshed beam trawls in nearshore (<1 km) and shallow (<25 m) habitats on the southern coast of Kachemak Bay, Cook Inlet, Alaska, from June to August, 1996-1998. Fish distributions among habitats were analysed for species composition, catch-per-unit-effort (CPUE) and frequency of occurrence. Two oceanographically distinct areas of Kachemak Bay were sampled and compared: the Outer Bay and the Inner Bay. Outer Kachemak Bay is exposed and receives oceanic, upwelled water from the Gulf of Alaska, whereas the Inner Bay is more estuarine. Thermohaline properties of bottom water in the Outer and Inner Bay were essentially the same, whereas the Inner Bay water-column was stratified with warmer, less saline waters near the surface. Distribution and abundance of pelagic schooling fish corresponded with area differences in stratification, temperature and salinity. The Inner Bay supported more species and higher densities of schooling and demersal fish than the Outer Bay. Schooling fish communities sampled by beach seine differed between the Outer and Inner Bays. Juvenile and adult Pacific sand lance ( Ammodytes hexapterus), Pacific herring ( Clupea harengus pallasi), osmerids (Osmeridae) and sculpins (Cottidae) were all more abundant in the Inner Bay. Gadids (Gadidae) were the only schooling fish taxa more abundant in the Outer Bay. Thermohaline characteristics of bottom water were similar throughout Kachemak Bay. Correspondingly, bottom fish communities were similar in all areas. Relative abundances (CPUE) were not significantly different between areas for any of the five demersal fish groups: flatfishes (Pleuronectidae), ronquils (Bathymasteridae), sculpins (Cottidae), gadids (Gadidae) and pricklebacks (Stichaeidae).

The Relationship Between Environment and Nutritional Condition of Arctic Forage Fish

NASA Astrophysics Data System (ADS)

Vollenweider, J.; Heintz, R.; Callahan, M.; Barton, M. B.; Sousa, L.; Danielson, S. L.; Meuter, F.; Moran, J.; Boswell, K. M.

2016-02-01

We describe how marine environmental conditions influence the body condition of forage fish in the Alaskan Arctic. Body condition of fish is a sensitive predictor of fish productivity, with consequences particularly for juvenile survival as well as adult reproduction. For example, body condition of juvenile walleye pollock (Theragra chalcogramma) in the Bering Sea is a significant predictor of survival to recruitment, and a better index than sheer abundance of juveniles. Body condition of fish generally varies with interannual fluctuations in oceanographic conditions such as temperature and wind mixing, which may have cascading effects on food quality and availability, and ultimately fish survival. We use these underlying principles to examine how interannual and spatial variation in environmental conditions affect fish condition of various Arctic species. Specifically, we measured the energy content of some of the most abundant Arctic forage species including Arctic cod (Boreogadus saida), capelin (Mallotus villosus), fourhorn sculpin (Myoxocephalus quadricornis), and saffron cod (Eleginus gracilis) over multiple years and habitats. Fish were sampled from multiple projects (ACES, SHELFZ, Arctic Eis) from three physically distinct waterbodies: the Chukchi and Beaufort Seas, and Elson Lagoon, an extensive, shallow estuary characteristic of the Arctic coastline. Fish condition of the various species responded differently to interannual changes and amongst water bodies. For example, Arctic Cod had energy density in 2014 compared with other years while fourhorn sculpin were unperturbed. These findings will help identify favorable habitats for Arctic species, identify locations and condition contributing the most to fish productivity, and will help predict how Arctic fish and their predators may fare in the face of climate change.

Impact of ocean acidification on the hypoxia tolerance of the woolly sculpin, Clinocottus analis

PubMed Central

Hancock, Joshua R.; Place, Sean P.

2016-01-01

As we move into the Anthropocene, organisms inhabiting marine environments will continue to face growing challenges associated with changes in ocean pH (ocean acidification), dissolved oxygen (dead zones) and temperature. These factors, in combination with naturally variable environments such as the rocky intertidal zone, may create extreme physiological challenges for organisms that are already performing near their biological limits. Although numerous studies have examined the impacts of climate-related stressors on intertidal animals, little is known about the underlying physiological mechanisms driving adaptation to ocean acidification and how this may alter organism interactions, particularly in marine vertebrates. Therefore, we have investigated the effects of decreased ocean pH on the hypoxia response of an intertidal sculpin, Clinocottus analis. We used both whole-animal and biochemistry-based analyses to examine how the energetic demands associated with acclimation to low-pH environments may impact the fish's reliance on facultative air breathing in low-oxygen environments. Our study demonstrated that acclimation to ocean acidification resulted in elevated routine metabolic rates and acid–base regulatory capacity (Na+,K+-ATPase activity). These, in turn, had downstream effects that resulted in decreased hypoxia tolerance (i.e. elevated critical oxygen tension). Furthermore, we present evidence that these fish may be living near their physiological capacity when challenged by ocean acidification. This serves as a reminder that the susceptibility of teleost fish to changes in ocean pH may be underestimated, particularly when considering the multiple stressors that many experience in their natural environments. PMID:27729981

Nearshore fish distributions in an Alaskan estuary in relation to stratification, temperature, and salinity

USGS Publications Warehouse

Abookire, Alisa A.; Piatt, John F.; Robards, Martin D.

2000-01-01

Fish were sampled with beach seines and small-meshed beam trawls in nearshore ( < 1 km) and shallow ( < 25 m) habitats on the southern coast of Kachemak Bay, Cook Inlet, Alaska, from June to August, 1996-1998. Fish distributions among habitats were analysed for species composition, catch-per-unit-effort (CPUE) and frequency of occurrence. Two oceanographically distinct areas of Kachemak Bay were sampled and compared: the Outer Bay and the Inner Bay. Outer Kachemak Bay is exposed and receives oceanic, upwelled water from the Gulf of Alaska, whereas the Inner Bay is more estuarine. Thermohaline properties of bottom water in the Outer and Inner Bay were essentially the same, whereas the Inner Bay water-column was stratified with warmer, less saline waters near the surface. Distribution and abundance of pelagic schooling fish corresponded with area differences in stratification, temperature and salinity. The Inner Bay supported more species and higher densities of schooling and demersal fish than the Outer Bay. Schooling fish communities sampled by beach seine differed between the Outer and Inner Bays. Juvenile and adult Pacific sand lance (Ammodytes hexapterus), Pacific herring (Clupea harengus pallasi), osmerids (Osmeridae) and sculpins (Cottidae) were all more abundant in the Inner Bay. Gadids (Gadidae) were the only schooling fish taxa more abundant in the Outer Bay. Thermohaline characteristics of bottom water were similar throughout Kachemak Bay. Correspondingly, bottom fish communities were similar in all areas. Relative abundances (CPUE) were not significantly different between areas for any of the five demersal fish groups: flatfishes (Pleuronectidae), ronquils (Bathymasteridae), sculpins (Cottidae), gadids (Gadidae) and pricklebacks (Stichaeidae).

Functional feeding traits as predictors of invasive success of alien freshwater fish species using a food-fish model.

PubMed

Nagelkerke, Leopold A J; van Onselen, Eline; van Kessel, Nils; Leuven, Rob S E W

2018-01-01

Invasions of Ponto-Caspian fish species into north-western European river basins accelerated since the opening of the Rhine-Main-Danube Canal in 1992. Since 2002, at least five Ponto-Caspian alien fish species have arrived in The Netherlands. Four species belong to the Gobiidae family (Neogobius fluviatilis, Neogobius melanostomus, Ponticola kessleri, and Proterorhinus semilunaris) and one to the Cyprinidae family (Romanogobio belingi). These species are expected to be potentially deleterious for the populations of four native benthic fish species: Gobio gobio (Cyprinidae), Barbatula barbatula (Nemacheilidae), Cottus perifretum, and C. rhenanus (Cottidae). Invasion success may be dependent on competitive trophic interactions with native species, which are enabled and/or constrained by feeding-related morphological traits. Twenty-two functional feeding traits were measured in nine species (in total 90 specimens). These traits were quantitatively linked to the mechanical, chemical and behavioral properties of a range of aquatic resource categories, using a previously developed food-fish model (FFM). The FFM was used to predict the trophic profile (TP) of each fish: the combined capacities to feed on each of the resource types. The most extreme TPs belonged to three alien species, indicating that they were most specialized among the studied species. Of these three, only P. kessleri overlapped with the two native Cottus species, indicating potential trophic competition. N. fluviatilis and R. belingi did not show any overlap, indicating that there is low trophic competition. The two remaining alien goby species (N. melanostomus and P. semilunaris) had average TPs and could be considered generalist feeders. They overlapped with each other and with G. gobio and B. barbatula, indicating potential trophic competition. This study suggests that both generalist and specialist species can be successful invaders. Since the FFM predicts potential interactions between species, it provides a tool to support horizon scanning and rapid risk assessments of alien species.

Littorally adaptive? Testing the link between habitat, morphology, and reproduction in the intertidal sculpin subfamily Oligocottinae (Pisces: Cottoidea).

PubMed

Buser, Thaddaeus J; Burns, Michael D; López, J Andrés

2017-01-01

While intertidal habitats are often productive, species-rich environments, they are also harsh and highly dynamic. Organisms that live in these habitats must possess morphological and physiological adaptations that enable them to do so. Intertidal fishes are generally small, often lack scales, and the diverse families represented in intertidal habitats often show convergence into a few general body shapes. However, few studies have quantified the relationship between phenotypes and intertidal living. Likewise, the diversity of reproductive traits and parental care in intertidal fishes has yet to be compared quantitatively with habitat. We examine the relationship of these characters in the sculpin subfamily Oligocottinae using a phylogenetic hypothesis, geometric morphometrics, and phylogenetic comparative methods to provide the first formal test of associations between fish phenotypes and reproductive characters with intertidal habitats. We show that the ability to live in intertidal habitats, particularly in tide pools, is likely a primitive state for Oligocottinae, with a single species that has secondarily come to occupy only subtidal habitats. Contrary to previous hypotheses, maximum size and presence of scales do not show a statistically significant correlation with depth. However, the maximum size for all species is generally small (250 mm or less) and all show a reduction in scales, as would be expected for an intertidal group. Also contrary to previous hypotheses, we show that copulation and associated characters are the ancestral condition in Oligocottinae, with copulation most likely being lost in a single lineage within the genus Artedius . Lastly, we show that body shape appears to be constrained among species with broader depth ranges, but lineages that occupy only a narrow range of intertidal habitats display novel body shapes, and this may be associated with habitat partitioning, particularly as it relates to the degree of wave exposure.

Selected organic compounds and trace elements in streambed sediments and fish tissues, Cook Inlet Basin, Alaska

USGS Publications Warehouse

Frenzel, Steven A.

2000-01-01

Organochlorines, semivolatile organic compounds (SVOCs), and trace elements were investigated in streambed sediments and fish tissues at selected sites in the Cook Inlet Basin, Alaska, during 1998. At most sites, SVOCs and organochlorine compounds were either not detected or detected at very low concentrations. Chester Creek at Arctic Boulevard at Anchorage, which was the only site sampled with a significant degree of development in the watershed, had elevated levels of many SVOCs in streambed sediment. Coring of sediments from two ponds on Chester Creek confirmed the presence of elevated concentrations of a variety of organic compounds. Moose Creek, a stream with extensive coal deposits in its watershed, had low concentrations of numerous SVOCs in streambed sediment. Three sites located in national parks or in a national wildlife refuge had no detectable concentrations of SVOCs. Trace elements were analyzed in both streambed sediments and tissues of slimy sculpin. The two media provided similar evidence for elevated concentrations of cadmium, lead, and zinc at Chester Creek. In this study, 'probable effect levels '(PELs) were determined from sediments finer than 0.063 millimeters, where concentrations tend to be greatest. Arsenic and chromium concentrations exceeded the PEL at eight and six sites respectively. Zinc exceeded the PEL at one site. Cadmium and copper concentrations were smaller than the PEL at all sites. Mercury concentrations in streambed sediments from the Deshka River were near the PEL, and selenium concentrations at that site also appear to be elevated above background levels. At half the sites where slimy sculpin were sampled, selenium concentrations were at levels that may cause adverse effects in some species.

Effects of gastric distension and feeding on cardiovascular variables in the shorthorn sculpin (Myoxocephalus scorpius).

PubMed

Seth, Henrik; Axelsson, Michael

2009-01-01

We have previously shown in rainbow trout (Oncorhynchus mykiss) that gastric distension induces an instantaneous alpha-adrenoceptor-mediated increase in the dorsal aortic blood pressure (P(da)), with no change in cardiac output (CO), gut blood flow (Q(cma)), or heart rate. To investigate if feeding habits affect these patterns and to compare the differences between gastric distension alone and feeding in the same experimental setting, we used the short-horn sculpin (Myoxocephalus scorpius), an inactive ambush predator with a capacity to eat large meals. An inflatable balloon was placed in the stomach of one group while another group was fed fish meat. When distending the stomach with a volume corresponding to a meal of 8-10% body weight, there is a profound and long-lasting increase in systemic (123 +/- 27%) and gastrointestinal (R(cma); 82 +/- 24%) vascular resistance, leading to an increase in P(da) (19%) without any change in CO or Q(cma). After force-feeding, there is a rapid transient increase in R(cma) (24 +/- 4%) and an even larger P(da) response (53%). There is also a subsequent increase in both CO (28 +/- 8%) and Q(cma) (27 +/- 9%) after 30 min. By 15 h, CO and Q(cma) increase further (41 +/- 11 and 63 +/- 14%, respectively), and this increase persists for up to 60 h. The increase in Q(cma) is mediated via both an increase in CO and a shunting of blood from the systemic circulation via a decrease in R(cma) (34 +/- 7%). In conclusion, the response to mechanical distension of the stomach is similar to what we have described in rainbow trout, and the postprandial gastrointestinal hyperemia is most likely chemically induced.

Mercury and selenium concentrations in biofilm, macroinvertebrates, and fish collected in the Yankee Fork of the Salmon River, Idaho, USA, and their potential effects on fish health.

PubMed

Rhea, Darren T; Farag, Aïda M; Harper, David D; McConnell, Elizabeth; Brumbaugh, William G

2013-01-01

The Yankee Fork is a large tributary of the Salmon River located in central Idaho, USA, with an extensive history of placer and dredge-mining activities. Concentrations of selenium (Se) and mercury (Hg) in various aquatic trophic levels were measured in the Yankee Fork during 2001 and 2002. Various measurements of fish health were also performed. Sites included four on the mainstem of the Yankee Fork and two off-channel sites in partially reclaimed dredge pools used as rearing habitat for cultured salmonid eggs and fry. Hg concentrations in whole mountain whitefish and shorthead sculpin ranged from 0.28 to 0.56 μg/g dry weight (dw), concentrations that are generally less than those reported to have significant impacts on fish. Biofilm and invertebrates ranged from 0.05 to 0.43 μg Hg/g dw. Se concentrations measured in biota samples from the Yankee Fork were greater than many representative samples collected in the Snake and Columbia watersheds and often exceeded literature-based toxic thresholds. Biofilm and invertebrates ranged from 0.58 to 4.66 μg Se/g dw. Whole fish ranged from 3.92 to 7.10 μg Se/g dw, and gonads ranged from 6.91 to 31.84 μg Se/g dw. Whole-body Se concentrations exceeded reported toxicological thresholds at three of four sites and concentrations in liver samples were mostly greater than concentrations shown to have negative impacts on fish health. Histological examinations performed during this study noted liver abnormalities, especially in shorthead sculpin, a bottom-dwelling species.

Higher mass-independent isotope fractionation of methylmercury in the pelagic food web of Lake Baikal (Russia).

PubMed

Perrot, Vincent; Pastukhov, Mikhail V; Epov, Vladimir N; Husted, Søren; Donard, Olivier F X; Amouroux, David

2012-06-05

Mercury undergoes several transformations that influence its stable isotope composition during a number of environmental and biological processes. Measurements of Hg isotopic mass-dependent (MDF) and mass-independent fractionation (MIF) in food webs may therefore help to identify major sources and processes leading to significant bioaccumulation of methylmercury (MeHg). In this work, δ(13)C, δ(15)N, concentration of Hg species (MeHg, inorganic Hg), and stable isotopic composition of Hg were determined at different trophic levels of the remote and pristine Lake Baikal ecosystem. Muscle of seals and different fish as well as amphipods, zooplankton, and phytoplankton were specifically investigated. MDF during trophic transfer of MeHg leading to enrichment of heavier isotopes in the predators was clearly established by δ(202)Hg measurements in the pelagic prey-predator system (carnivorous sculpins and top-predator seals). Despite the low concentrations of Hg in the ecosystem, the pelagic food web reveals very high MIF Δ(199)Hg (3.15-6.65‰) in comparison to coastal fish (0.26-1.65‰) and most previous studies in aquatic organisms. Trophic transfer does not influence MIF signature since similar Δ(199)Hg was observed in sculpins (4.59 ± 0.55‰) and seal muscles (4.62 ± 0.60‰). The MIF is suggested to be mainly controlled by specific physical and biogeochemical characteristics of the water column. The higher level of MIF in pelagic fish of Lake Baikal is mainly due to the bioaccumulation of residual MeHg that is efficiently turned over and photodemethylated in deep oligotrophic and stationary (i.e., long residence time) freshwater columns.

Status and trends of the Lake Huron offshore demersal fish community, 1976-2012

USGS Publications Warehouse

Roseman, Edward F.; Riley, Stephen C.; Farha, Steve A.; Maitland, Bryan M.; Tucker, Taaja R.; Provo, Stacy A.; McLean, Matthew W.

2015-01-01

The USGS Great Lakes Science Center has conducted trawl surveys to assess annual changes in the offshore demersal fish community of Lake Huron since 1973. Sample sites include five ports in U.S. waters with less frequent sampling near Goderich, Ontario. The 2012 fall bottom trawl survey was carried out between 20 October – 5 November 2012 and included all U.S. ports as well as Goderich, ON. The 2012 main basin prey fish biomass estimate for Lake Huron was 97 kilotonnes, higher than the estimate in 2011 (63.2 Kt), approximately one third of the maximum estimate in the time series, and nearly 6 times higher than the minimum estimate in 2009. The biomass estimates for adult alewife in 2012 were higher than 2011, but remained much lower than observed before the crash in 2004, and populations were dominated by small fish. Estimated biomass of rainbow smelt also increased and was the highest observed since 2005. Estimated adult bloater biomass in Lake Huron has been increasing in recent years, and the 2012 biomass estimate was the third highest ever observed in the survey. Biomass estimates for trout-perch and ninespine stickleback were higher than in 2011 but still remained low compared to historic estimates. The estimated biomass of deepwater and slimy sculpins increased over 2011, and slimy sculpin in particular seem to be increasing in abundance. The 2012 biomass estimate for round goby was similar to that in 2011 and was the highest observed in the survey. Substantial numbers of wild juvenile lake trout were captured again in 2012, suggesting that natural reproduction by lake trout continues to occur. The 2012 Lake Huron bottom trawl survey results suggest that several species of offshore demersal fish are beginning to increase in abundance.

Mercury and selenium concentrations in biofilm, macroinvertebrates, and fish collected in the Yankee Fork of the Salmon River, Idaho, USA, and their potential effects on fish health

USGS Publications Warehouse

Rhea, Darren T.; Farag, Aïda M.; Harper, David D.; McConnell, Elizabeth; Brumbaugh, William G.

2013-01-01

The Yankee Fork is a large tributary of the Salmon River located in central Idaho, USA, with an extensive history of placer and dredge-mining activities. Concentrations of selenium (Se) and mercury (Hg) in various aquatic trophic levels were measured in the Yankee Fork during 2001 and 2002. Various measurements of fish health were also performed. Sites included four on the mainstem of the Yankee Fork and two off-channel sites in partially reclaimed dredge pools used as rearing habitat for cultured salmonid eggs and fry. Hg concentrations in whole mountain whitefish and shorthead sculpin ranged from 0.28 to 0.56 μg/g dry weight (dw), concentrations that are generally less than those reported to have significant impacts on fish. Biofilm and invertebrates ranged from 0.05 to 0.43 μg Hg/g dw. Se concentrations measured in biota samples from the Yankee Fork were greater than many representative samples collected in the Snake and Columbia watersheds and often exceeded literature-based toxic thresholds. Biofilm and invertebrates ranged from 0.58 to 4.66 μg Se/g dw. Whole fish ranged from 3.92 to 7.10 μg Se/g dw, and gonads ranged from 6.91 to 31.84 μg Se/g dw. Whole-body Se concentrations exceeded reported toxicological thresholds at three of four sites and concentrations in liver samples were mostly greater than concentrations shown to have negative impacts on fish health. Histological examinations performed during this study noted liver abnormalities, especially in shorthead sculpin, a bottom-dwelling species.

Physiological, behavioral and biochemical adaptations of intertidal fishes to hypoxia.

PubMed

Richards, Jeffrey G

2011-01-15

Hypoxia survival in fish requires a well-coordinated response to either secure more O(2) from the hypoxic environment or to limit the metabolic consequences of an O(2) restriction at the mitochondria. Although there is a considerable amount of information available on the physiological, behavioral, biochemical and molecular responses of fish to hypoxia, very little research has attempted to determine the adaptive value of these responses. This article will review current attempts to use the phylogenetically corrected comparative method to define physiological and behavioral adaptations to hypoxia in intertidal fish and further identify putatively adaptive biochemical traits that should be investigated in the future. In a group of marine fishes known as sculpins, from the family Cottidae, variation in hypoxia tolerance, measured as a critical O(2) tension (P(crit)), is primarily explained by variation in mass-specific gill surface area, red blood cell hemoglobin-O(2) binding affinity, and to a lesser extent variation in routine O(2) consumption rate (M(O(2))). The most hypoxia-tolerant sculpins consistently show aquatic surface respiration (ASR) and aerial emergence behavior during hypoxia exposure, but no phylogenetically independent relationship has been found between the thresholds for initiating these behaviors and P(crit). At O(2) levels below P(crit), hypoxia survival requires a rapid reorganization of cellular metabolism to suppress ATP consumption to match the limited capacity for O(2)-independent ATP production. Thus, it is reasonable to speculate that the degree of metabolic rate suppression and the quantity of stored fermentable fuel is strongly selected for in hypoxia-tolerant fishes; however, these assertions have not been tested in a phylogenetic comparative model.

Operations Charioteer, Musketeer, Touchstone, Cornerstone, Aqueduct, Sculpin and Julin. Tests Mill Yard, Diamond Beech, Mighty Oak, Middle Note Mission Ghost, Mission Cyber, Misty Echo, Disko Elm, Mineral Quarry, Distant Zenith, Diamond Fortune, and Hunters Trophy

DTIC Science & Technology

1999-05-01

2l.SU -Wf6e:uJfr-02tSU -V 69E ;W 9-2l IS« 0VS9 v 6se :w e"g(HSH ttWS:uJB-86SU ¥0l-8:uJ9"fr6SUOVW WW2 :lug-98SU U68l-:ujg-,£SSH — —VZL-VU61ZSU...and JAYCOR conducted infrared window material optical properties experiments; Lawrence Livermore National Laboratory (LLNL) conducted 146 device

Water-Quality Conditions of Chester Creek, Anchorage, Alaska, 1998-2001

USGS Publications Warehouse

Glass, Roy L.; Ourso, Robert T.

2006-01-01

Between October 1998 and September 2001, the U.S. Geological Survey's National Water-Quality Assessment Program evaluated the water-quality conditions of Chester Creek, a stream draining forest and urban settings in Anchorage, Alaska. Data collection included water, streambed sediments, lakebed sediments, and aquatic organisms samples from urban sites along the stream. Urban land use ranged from less than 1 percent of the basin above the furthest upstream site to 46 percent above the most downstream site. Findings suggest that water quality of Chester Creek declines in the downstream direction and as urbanization in the watershed increases. Water samples were collected monthly and during storms at a site near the stream's mouth (Chester Creek at Arctic Boulevard) and analyzed for major ions and nutrients. Water samples collected during water year 1999 were analyzed for selected pesticides and volatile organic compounds. Concentrations of fecal-indicator bacteria were determined monthly during calendar year 2000. During winter, spring, and summer, four water samples were collected at a site upstream of urban development (South Branch of South Fork Chester Creek at Tank Trail) and five from an intermediate site (South Branch of South Fork Chester Creek at Boniface Parkway). Concentrations of calcium, magnesium, sodium, chloride, and sulfate in water increased in the downstream direction. Nitrate concentrations were similar at the three sites and all were less than the drinking-water standard. About one-quarter of the samples from the Arctic Boulevard site had concentrations of phosphorus that exceeded the U.S. Environmental Protection Agency (USEPA) guideline for preventing nuisance plant growth. Water samples collected at the Arctic Boulevard site contained concentrations of the insecticide carbaryl that exceeded the guideline for protecting aquatic life. Every water sample revealed a low concentration of volatile organic compounds, including benzene, toluene, tetrachloroethylene, methyl tert-butyl ether, and chloroform. No water samples contained volatile organic compounds concentrations that exceeded any USEPA drinking-water standard or guideline. Fecal-indicator bacteria concentrations in water from the Arctic Boulevard site commonly exceeded Federal and State guidelines for water-contact recreation. Concentrations of cadmium, copper, lead, and zinc in streambed sediments increased in the downstream direction. Some concentrations of arsenic, chromium, lead, and zinc in sediments were at levels that can adversely affect aquatic organisms. Analysis of sediment chemistry in successive lakebed-sediment layers from Westchester Lagoon near the stream's mouth provided a record of water-quality trends since about 1970. Concentrations of lead have decreased from peak levels in the mid-1970s, most likely because of removing lead from gasoline and lower lead content in other products. However, concen-trations in recently-deposited lakebed sediments are still about 10 times greater than measured in streambed sediments at the upstream Tank Trail site. Zinc concentrations in lakebed sediments also increased in the early 1970s to levels that exceeded guidelines to protect aquatic life and have remained at elevated but variable levels. Pyrene, benz[a]anthracene, and phenanthrene in lakebed sediments also have varied in concentrations and have exceeded protection guidelines for aquatic life since the 1970s. Concentrations of dichloro-diphenyl-trichloroethane, polychlorinated biphenyls (PCBs), or their by-products generally were highest in lakebed sediments deposited in the 1970s. More recent sediments have concentrations that vary widely and do not show distinct temporal trends. Tissue samples of whole slimy sculpin (Cottus cognatus), a non-migratory species of fish, showed con-centrations of trace elements and organic contaminants. Of the constituents analyzed, only selenium concentra-tions showed levels of potential concern for

Littorally adaptive? Testing the link between habitat, morphology, and reproduction in the intertidal sculpin subfamily Oligocottinae (Pisces: Cottoidea)

PubMed Central

Burns, Michael D.; López, J. Andrés

2017-01-01

While intertidal habitats are often productive, species-rich environments, they are also harsh and highly dynamic. Organisms that live in these habitats must possess morphological and physiological adaptations that enable them to do so. Intertidal fishes are generally small, often lack scales, and the diverse families represented in intertidal habitats often show convergence into a few general body shapes. However, few studies have quantified the relationship between phenotypes and intertidal living. Likewise, the diversity of reproductive traits and parental care in intertidal fishes has yet to be compared quantitatively with habitat. We examine the relationship of these characters in the sculpin subfamily Oligocottinae using a phylogenetic hypothesis, geometric morphometrics, and phylogenetic comparative methods to provide the first formal test of associations between fish phenotypes and reproductive characters with intertidal habitats. We show that the ability to live in intertidal habitats, particularly in tide pools, is likely a primitive state for Oligocottinae, with a single species that has secondarily come to occupy only subtidal habitats. Contrary to previous hypotheses, maximum size and presence of scales do not show a statistically significant correlation with depth. However, the maximum size for all species is generally small (250 mm or less) and all show a reduction in scales, as would be expected for an intertidal group. Also contrary to previous hypotheses, we show that copulation and associated characters are the ancestral condition in Oligocottinae, with copulation most likely being lost in a single lineage within the genus Artedius. Lastly, we show that body shape appears to be constrained among species with broader depth ranges, but lineages that occupy only a narrow range of intertidal habitats display novel body shapes, and this may be associated with habitat partitioning, particularly as it relates to the degree of wave exposure. PMID:28828246

System-Wide Significance of Predation on Juvenile Salmonids in Columbia and Snake River Reservoirs : Annual Report 1992.

DOE Office of Scientific and Technical Information (OSTI.GOV)

Petersen, James H.; Poe, Thomas P.

1993-12-01

Northern squawfish (Ptychocheilus oregonensis) predation on juvenile salmonids was characterized during 1992 at ten locations in the Columbia River below Bonneville Dam and at three locations in John Day Reservoir. During the spring and summer, 1,487 northern squawfish were collected in the lower Columbia River and 202 squawfish were sampled in John Day Reservoir. Gut content data, predator weight, and water temperature were used to compute a consumption index (CI) for northern squawfish, and overall diet was also described. In the Columbia River below Bonneville Dam, northern squawfish diet was primarily fish (spring 69%; summer 53%), most of which weremore » salmonids. Salmonids were also the primary diet component in the Bonneville Dam tailrace, John Day Dam forebay, and the McNary Dam tailrace. Crustaceans were the dominant diet item at the John Day mid-reservoir location, although sample sizes were small. About half of the non-salmonid preyfish were sculpins. The consumption index (CI) of northern squawfish was generally higher during summer than during spring. The highest CI`s were observed during summer in the tailrace boat restricted zones of Bonneville Dam (CI = 7.8) and McNary Dam (CI = 4.6). At locations below Bonneville Dam, CI`s were relatively low near Covert`s Landing and Rooster Rock, higher at four locations between Blue Lake and St. Helens, and low again at three downriver sites (Kalama, Ranier, and Jones Beach). Northern squawfish catches and CI`s were noticeably higher throughout the lower Columbia compared to mid-reservoir sites further upriver sampled during 1990--92. Predation may be especially intense in the free-flowing section of the Columbia River below Bonneville Dam. Smallmouth bass (Micropterus dolomieui; N = 198) ate mostly fish -- 25% salmonids, 29% sculpins, and 46% other fish. Highest catches of smallmouth bass were in the John Day Dam forebay.« less

Determining Timing and Magnitude of Dietary Shifts in Black Guillemots (Cepphus grylle) Using Stable Isotope Analysis of Flight Feathers

NASA Astrophysics Data System (ADS)

Kleese, M. C.; Boswell, K. M.; Divoky, G.; Barton, M. B.

2016-02-01

Recent decreases in Artic summer sea and increases in SST have caused changes in the marine ecosystems associated with ice-covered waters. A four-decade study of Black Guillemots (Cepphus grylle) on Cooper Island near Point Barrow, AK has shown that nestling quality and survival is linked to proximity to sea ice and SST. In recent years when sea ice retreats from the foraging area and SST increases to >4°C during the nestling period, parent guillemots have switched from their preferred prey, Arctic cod (Boreogadus saida), to less desirable fourhorn sculpin (Myoxocephalus quadricornis). The guillemots' shift from a cryopelagic fish to a nearshore demersal is hard to monitor through direct observation and we suggest a new method to assess the timing and magnitude of this dietary shift using stable isotope analysis of nestling flight feathers. Flight feathers (primaries, secondaries and tail feathers) provide a linear record of material incorporated into the body of the chick from the start of feather growth to fledging, a period of approximately 30 days. Arctic cod and fourhorn sculpin have distinctive diets and are reliant on different basal resources and should produce distinct isotopic signatures in guillemot tissues. We extracted vane tissues from sections of 30 black guillemot feathers grown in a breeding season that experienced an observed prey shift, and conducted stable carbon and nitrogen isotope analyses to determine whether such analyses could be used to assess the dietary shift linked with loss of sea ice and increasing SST. Most seabird populations are not as easily accessible as the guillemots of Cooper Island and thus observations of dietary composition are difficult to obtain. Development of a technique using nestling feathers to examine timing and magnitude of seasonal shifts in prey would preclude the need for daily observations and have great utility for monitoring the ecological effects of the continuing annual decrease in Arctic summer ice.

Molecular cloning and characterization of a C-type lectin in roughskin sculpin (Trachidermus fasciatus).

PubMed

Yu, Shanshan; Yang, Hui; Chai, Yingmei; Liu, Yingying; Zhang, Qiuxia; Ding, Xinbiao; Zhu, Qian

2013-02-01

C-type lectins, as the members of pattern-recognition receptors (PRRs), play significant roles in innate immunity responses through binding to the pathogen-associated molecular patterns (PAMPs) presented on surfaces of microorganisms. In our study, a C-type lectin gene (TfCTL1) was cloned from the roughskin sculpin using expression sequence tag (EST) and rapid amplification of cDNA ends (RACE) techniques. The full-length of TfCTL1 was 696 bp, consisting of a 95 bp 5' untranslated region (UTR), a 498 bp open reading frame (ORF) encoding a 165 amino acid protein, and a 103 bp 3' UTR with a polyadenylation signal sequence AATAAA and a poly(A) tail. The deduced amino acid sequence of TfCTL1 contained a signal peptide and a single carbohydrate recognition domain (CRD) which had four conserved disulfide-bonded cysteine residues (Cys(61)-Cys(158), Cys(134)-Cys(150)) and a Ca(2+)/carbohydrate-binding site (QPD motif). Results from the qRT-PCR indicated that TfCTL1 mRNA was predominately expressed in the liver. The temporal expression of TfCTL1 was obviously up-regulated in the skin, blood, spleen and heart in time dependent manners by lipopolysaccharide (LPS) challenge, whereas in the liver, TfCTL1 was initially down-regulated from 2 h to 48 h followed by an abrupt up-regulation at 72 h. Recombinant TfCTL1 CRD purified from Escherichia coli BL21 was able to agglutinate some Gram-positive bacteria, Gram-negative bacteria and a yeast in a Ca(2+)-dependent manner. Further analysis showed that TfCTL1 can bind to several kinds of microorganisms selectively in a Ca(2+)-independent manner. These results suggested that TfCTL1 might be involved in the innate response as a PRR. Copyright © 2012 Elsevier Ltd. All rights reserved.

Elevated temperature exacerbates Ichthyophonus infections in buffalo sculpin

USGS Publications Warehouse

Halpenny, C.M.; Kocan, R.M.; Winton, J.R.; Perry, J.A.; Hershberger, P.K.

2002-01-01

High incidences of Ichthyophonus hoferi, a parasite primarily of marine and estuarine fishes, have recently been reported in rockfishes and Pacific herring from the eastern North Pacific (Kent et al 2001, Hershberger et al 2002). Taxonomic position of I. hoferi remains unresolved, but recent phylogenetic studies have grouped the organism with Dermocystidium, Psorospermium, the rosette agent of salmonids, and Rhinosporidium in the Mesomycetozoa, a novel clade of protists near the animal-fungal divergence (Herr et al 1999). Genetic differences among isolates from the east coast of North America indicate that more than one species of Ichthyophonus exist (Rand et al 2000), and different species have likely been assigned the same name based on morphological characteristics. Therefore, hereafter in this manuscript, the organism will be referred to as Ichthyophonus .

Physical, chemical, and biological data for two sites on the upper Kenai River, Alaska, 1998

USGS Publications Warehouse

Dorava, Joseph M.; Ness, Lee

1999-01-01

Water-quality data were collected and stream characteristics were documented from two sites along the upper Kenai River in the Kenai National Wildlife Refuge, Alaska. These data were collected to describe the current status of the sites and to provide baseline information from which changes in the future could be evaluated. Physical characteristics included channel geometry surveys, and measurements of channel widths and water discharge at each site. Chemical data included stream water temperature, dissolved-oxygen concentration, pH, specific conductance, E. coli and fecal coliform counts, and nutrient concentration. Data on concentrations of trace elements and various organic compounds in bed sediments and the tissue of slimy sculpin were also collected. Biological characteristics were evaluated using measurements of the bacteria, benthic macroinvertebrate, and fish communities.

Tracing organophosphorus and brominated flame retardants and plasticizers in an estuarine food web.

PubMed

Brandsma, Sicco H; Leonards, Pim E G; Leslie, Heather A; de Boer, Jacob

2015-02-01

Nine organophosphorus flame retardants (PFRs) were detected in a pelagic and benthic food web of the Western Scheldt estuary, The Netherlands. Concentrations of several PFRs were an order of magnitude higher than those of the brominated flame retardants (BFRs). However, the detection frequency of the PFRs (6-56%) was lower than that of the BFRs (50-97%). Tris(2-butoxyethyl) phosphate (TBOEP), tris(isobutyl) phosphate (TIBP) and tris(2-chloroisopropyl) phosphate (TCIPP) were the dominant PFRs in sediment with median concentrations of 7.0, 8.1 and 1.8 ng/g dry weight (dw), respectively. PFR levels in the suspended particular matter (SPM) were 2-12 times higher than that in sediment. TBOEP, TCIPP, TIBP, tris(2-chloroethyl) phosphate (TCEP) and tris(phenyl) phosphate (TPHP) were found in organisms higher in the estuarine food web. The highest PFR concentrations in the benthic food web were found in sculpin, goby and lugworm with median concentrations of 17, 7.4, 4.6 and 2.0 ng/g wet weight (ww) for TBOEP, TIBP, TCIPP and TPHP, respectively. Comparable levels were observed in the pelagic food web, BDE209 was the predominant PBDE in sediment and SPM with median concentrations up to 9.7 and 385 ng/g dw, respectively. BDE47 was predominant in the biotic compartment of the food web with highest median levels observed in sculpin and common tern eggs of 79 ng/g lipid weight (lw) (2.5 ng/g ww) and 80 ng/g lw (11 ng/g ww), respectively. Trophic magnification was observed for all PBDEs with the exception of BDE209. Indications of trophic magnification of PFRs were observed in the benthic food web for TBOEP, TCIPP and TCEP with tentative trophic magnification factors of 3.5, 2.2 and 2.6, respectively (p<0.05). Most of the other PFRs showed trophic dilution in both food webs. The relative high PFR levels in several fish species suggest high emissions and substantial exposure of organisms to PFRs in the Western Scheldt. Copyright © 2014 Elsevier B.V. All rights reserved.

Forestry practices and aquatic biodiversity: Fish

USGS Publications Warehouse

Gresswell, Robert E.

2005-01-01

In the Pacific Northwest, fish communities are found in a diverse array of aquatic habitats ranging from the large coastal rivers of the temperate rainforests, to the fragmented and sometimes ephemeral streams of the xeric interior basins, and high-elevation streams and lakes in the mountainous areas (Rieman et al. 2003). Only high-elevation lakes and streams isolated above barriers to fish passage remained historically devoid of fish because they were never invaded following Pleistocene glaciation (Smith 1981). Despite this widespread distribution and once great population abundances, taxonomic diversity of fishes in these forested systems is naturally lower than in aquatic habitats in the eastern U.S. (Reeves, Bisson, and Dambacher 1998). Interactions among factors that influence species richness in aquatic systems (e.g., basin size, long-term stability of habitat, and barriers to colonization; Smith 1981) continue to influence the occurrence and persistence of fishes in these systems today. Consequently, the larger low-elevation rivers and estuaries support the greatest variety of fish species. In the high-elevation tributary streams, fish communities are less complex because these aquatic systems were less climatically and geologically stable, and fish populations were smaller and more prone to local extirpation. Furthermore, barriers to fish passage inhibited dispersal and colonization (Smith 1981). Streams in forested landscapes generally support salmon and trout, Oncorhynchus spp., whitefish Prosopium spp., sculpins Cottus spp., suckers Catostomus spp., and minnows (Cyprinidae), but in some of the colder streams, chars (e.g., Salvelinus confluentus and Salvelinus malma) and lampreys (Petromyzontidae)may also occur (Rieman et al. 2003).Although biodiversity defined in terms of fish species richness is low in the Pacific Northwest, intraspecific variability is high, and polytypic fish species are common in the diverse aquatic habitats of the region. For example, the salmonids in the coastal rivers and streams, and the larger interconnected streams, rivers, and lakes of the interior exhibit a variety of ecotypes and migratory life histories (Healey 1986; Trotter 1989; Larson and McIntire 1993; Northcote 1997). This life-history variation appears to be associated with adaptation to spatial and temporal variation in environment (e.g., Schaffer and Elson 1975; Carl and Healey 1984; Beacham and Murray 1987), and there is some evidence of the genetic heritability of life-history traits (Carl and Healey 1984; Gharrett and Smoker 1993; Hankin, Nicholas, and Downey 1993). Persistence of any level of biological organization (e.g., life-history type, population, metapopulation, subspecies, species, community) is related to the interaction of environmental and biological components, and intraspecific diversity is a means of spreading risk (sensu den Boer 1968) of extirpation in dynamic environments (Gresswell 1999). Unfortunately, despite the broad distribution and extensive intraspecific diversity, persistence of native fishes is uncertain in the Pacific Northwest. Many populations of anadromous salmonids, once synonymous with vigorous biological communities throughout the region, are threatened with extinction (Nehlsen, Williams, and Lichatowich 1991; Frissell 1993; Thurow, Lee, and Rieman 1997). Furthermore, over half of the native taxa in the Columbia River Basin are either listed under the Endangered Species Act, are being considered for listing, or are deemed sensitive by the management agencies (Lee et al. 1997; Thurow, Lee, and Rieman 1997). Potamodromous species like bull trout Salvelinus confluentus are estimated to occur as strong populations in less than 5% of their potential range (Rieman, Lee, and Thurow 1997). Although not currently listed under the endangered species list, the coastal cutthroat trout Oncorhynchus clarki is managed as a sensitive species in Oregon and California (Hall, Bisson, and Gresswell 1997). Native non-game fishes have rarely been monitored, but populations of species such as large-scale suckers (Catostomus macrocheilus), squawfish (Ptychocheilus umpquae), and Pacific lamprey (Lampetra tridentata) also are declining in some drainages (Oregon Department of Fish and Wildlife, unpublished data).

Fish communities of benchmark streams in agricultural areas of eastern Wisconsin

USGS Publications Warehouse

Sullivan, D.J.; Peterson, E.M.

1997-01-01

Fish communities were surveyed at 20 stream sites in agricultural areas in eastern Wisconsin in 1993 and 1995 as part of the National Water-Quality Assessment (NAWQA) Program. These streams, designated "benchmark streams," were selected for study because of their potential use as regional references for healthy streams in agricultural areas, based on aquatic communities, habitat, and water chemistry. The agricultural benchmark streams were selected from four physical settings, or relatively homogeneous units (RHU's), that differ in bedrock type, texture of surficial deposits, and land use. Additional data were collected along with the fish-community data, including measures of habitat, water chemistry, and population surveys of algae and benthic invertebrates. Of the 20 sites, 19 are classified as trout (salmonid) streams. Fish species that require cold or cool water were the most commonly collected. At least one species of trout was collected at 18 sites, and trout were the most abundant species at 13 sites. The species with the greatest collective abundance, and collected at 18 of the 20 sites, were mottled sculpin (Cottus bairdi), a coldwater species. The next most abundant species were brown trout (Salmo trutta), followed by brook trout (Salvelinusfontinalis), creek chub (Semotilus atromaculatus), and longnose dace (Rhinichthys cataractae). In all, 31 species of fish were collected. The number of species per stream ranged from 2 to 14, and the number of individuals collected ranged from 19 to 264. According to Index of Biotic Integrity (IBI) scores, 5 sites were rated excellent, 10 sites rated good, 4 rated fair, and 1 rated poor. The ratings of the five sites in the fair to poor range were low for various reasons. Two sites appeared to have more warmwater species than was ideal for a high-quality coldwater stream. One was sampled during high flow and the results may not be valid for periods of normal flow; the other may have been populated by migrating warmwater species. Two sites had insufficient deep-water habitat to support large numbers offish, especially top carnivores. Finally, one stream may be too cool to support enough warmwater species and too warm to support trout. In general, two methods of evaluating site habitat indicate that habitat is not a limiting factor for fish communities. However, two sites were rated as fair according to both habitat evaluation methods due to low base flow. Two sites rated below good according to one habitat evaluation method but rated good or excellent according to the other. Detrended correspondence analysis (DCA) of data for 17 sites showed three station groupings. These groupings fell along RHU divisions and each group was associated with one of three trout species. A species-richness gradient was evident on the station-ordination diagram. Intolerant species were associated with each grouping, a reflection of the generally high water quality at the sites. However, no significant differences were found between IBI scores or habitat indices among the site groupings. The DCA axis 1 and 2 scores correlated with average velocity and percent pool as well as RHU factors percent sandy surficial deposits, percent wetland, percent agriculture, and bedrock. Average velocity was highest at three sites which also had among the highest measured flow and largest drainage areas. Percent pool was generally lower at sites with smaller percentages of sandy surficial deposits, with one exception. The usefulness of ordination methods in conjunction with more traditional methods of defining biotic integrity (IB I) has been noted in previous studies. In this study, however, perhaps because of the relative homogeneity of the benchmark streams, the IBI did not correlate with the same kinds of factors as the DCA axis scores did. 

Mercury and persistent organic pollutants in native and invading forage species of the Canadian Arctic: Consequences for food web dynamics.

PubMed

Pedro, Sara; Fisk, Aaron T; Tomy, Gregg T; Ferguson, Steven H; Hussey, Nigel E; Kessel, Steven T; McKinney, Melissa A

2017-10-01

Contaminant dynamics within Arctic marine food webs may be altered through the climate-driven northward invasions of temperate/boreal species. Here, we compare tissue concentrations of total mercury (THg) and legacy and emerging persistent organic pollutants (POPs) in native versus invading forage species sampled from 2012 to 2014 near Arviat, Clyde River, and Resolute Bay, NU, representing, low, mid- and high eastern Canadian Arctic regions, respectively. Concentrations of THg, legacy Σ-polychlorinated biphenyls (ΣPCB) and Σ-organochlorine (ΣOC) pesticides were detected in all forage species, whereas emerging halogenated flame retardants were detected in only a few individuals. Concentrations of major contaminant groups among regions did not vary for Arctic cod (Boreogadus saida), while for sculpin (Cottoidea) there was no clear latitudinal trend. Thus, considering interspecific variation, native sculpin and northern shrimp (Pandalus borealis) had the highest overall concentrations of THg (0.17 ± 0.02 and 0.21 ± 0.01 μg g -1 wet weight, respectively), ΣPCB (322 ± 35 and 245 ± 25 ng g -1 lipid weight (lw), respectively), and ΣOC (413 ± 38 and 734 ± 64 ng g -1 lw, respectively). Comparing the keystone native species, Arctic cod, to its 'replacement' species, capelin (Mallotus villosus) and sandlance (Ammodytes spp.), THg concentrations were higher in Arctic cod compared to capelin (p < 0.001), which was partly explained by differences in fish length. Conversely, capelin and sandlance had higher concentrations of most POPs than Arctic cod (p < 0.02). Neither feeding habitat (based on δ 13 C), trophic position (based on δ 15 N), nor fish length significantly explained these differences in POPs between Arctic cod, capelin and sandlance. Higher POPs concentrations, as well as variation in congener/compound patterns, in capelin and sandlance relative to Arctic cod seem, therefore, more likely related to a more "temperate"-type contaminant signature in the invaders. Nevertheless, the relatively small (up to two-fold) magnitude of these differences suggested limited effects of these ecological changes on contaminant uptake by Arctic piscivores. Copyright © 2017 Elsevier Ltd. All rights reserved.

Water-quality data for the Talkeetna River and four streams in National Parks, Cook Inlet basin, Alaska, 1998

USGS Publications Warehouse

Frenzel, Steven A.; Dorava, Joseph M.

1999-01-01

Five streams in the Cook Inlet Basin, Alaska, were sampled in 1998 to provide the National Park Service with baseline information on water quality. Four of these streams drain National Park Service land: Costello and Colorado Creeks in Denali National Park and Preserve, Johnson River in Lake Clark National Park and Preserve, and Kamishak River in Katmai National Park and Preserve. The fifth site was on the Talkeetna River, outside of national park boundaries. Samples of stream water, streambed sediments, and fish tissues were collected for chemical analyses. Biological and geomorphic information was also collected at each site. Nutrient concentrations in stream water were low and commonly were less than analytical detection limits. Analyses of fish tissues for 28 organochlorine compounds at Talkeetna River and Costello Creek produced just one detection. Hexachlorobenzene was detected at a concentration of 5.70 micrograms per kilogram in slimy sculpin from the Talkeetna River. Streambed sediment samples from the Talkeetna River had three organochlorine compounds at detectable levels; hexachlorobenzene was measured at 13 micrograms per kilogram and two other compounds were below the minimum reporting levels. At Colorado Creek, Johnson River, and Kamishak River, where fish samples were not collected, no organochlorine compounds were detected in streambed sediment samples. Several semivolatile organic compounds were detected at Colorado Creek and Costello Creek. Only one compound, dibenzothiophene, detected at Costello Creek at a concentration of 85 micrograms per kilogram was above the minimum reporting limit. No semivolatile organic compounds were detected at the Talkeetna, Kamishak, or Johnson Rivers. Trace elements were detected in both fish tissues and streambed sediments. Macroinvertebrate and fish samples contained few taxa at all sites. Total numbers of macroinvertebrate taxa ranged from 19 at the Johnson River to 38 at the Talkeetna River. Diptera were the most abundant and diverse order of macroinvertebrates at all sites. Total numbers of diptera taxa ranged from 8 at the Kamishak River to 19 at the Talkeetna River. Fish communities were represented by a maximum of nine taxa at the Talkeetna River and were absent at Colorado Creek. The Johnson River sampling site produced small numbers of juvenile Dolly Varden, and Costello Creek produced small numbers of both juvenile Dolly Varden and slimy sculpin.

Ichthyofauna of the Kubo, Tochikura, and Ichinono river systems (Kitakami River drainage, northern Japan), with a comparison of predicted and surveyed species richness

PubMed Central

Nakae, Masanori; Senou, Hiroshi

2014-01-01

Abstract The potential fish species pool of the Kubo, Tochikura, and Ichinono river systems (tributaries of the Iwai River, Kitakami River drainage), Iwate Prefecture, northern Japan, was compared with the observed ichthyofauna by using historical records and new field surveys. Based on the literature survey, the potential species pool comprised 24 species/subspecies but only 20, including 7 non-native taxa, were recorded during the fieldwork. The absence during the survey of 11 species/subspecies from the potential species pool suggested either that sampling effort was insufficient, or that accurate determination of the potential species pool was hindered by lack of biogeographic data and ecological data related to the habitat use of the species. With respect to freshwater fish conservation in the area, Lethenteron reissneri, Carassius auratus buergeri, Pseudorasbora pumila, Tachysurus tokiensis, Oryzias latipes, and Cottus nozawae are regarded as priority species, and Cyprinus rubrofuscus, Pseudorasbora parva, and Micropterus salmoides as targets for removal. PMID:25425932

Macroinvertebrate instream flow studies after 20 years: A role in stream management and restoration

USGS Publications Warehouse

Gore, James A.; Layzer, James B.; Mead, Jim

2001-01-01

Over the past two decades of refinement and application of instream flow evaluations, we have examined the hydraulic habitat of aquatic macroinvertebrates in a variety of conditions, along with the role of these macroinvertebrates in sustaining ecosystem integrity. Instream flow analyses assume that predictable changes in channel flow characteristics can, in turn, be used to predict the change in the density or distribution of lotic species or, more appropriately, the availability of useable habitat for those species. Five major hydraulic conditions most affect the distribution and ecological success of lotic biota: suspended load, bedload movement, and water column effects, such as turbulence, velocity profile, and substratum interactions (near-bed hydraulics). The interactions of these hydraulic conditions upon the morphology and behavior of the individual organisms govern the distribution of aquatic biota. Historically, management decisions employing the Physical Habitat Simulation (PHABSIM) have focused upon prediction of available habitat for life stages of target fish species. Regulatory agencies have rarely included evaluation of benthos for flow reservations. Although ‘taxonomic discomfort’ may be cited for the reluctant use or creation of benthic criteria, we suggest that a basic misunderstanding of the links between benthic macroinvertebrate and the fish communities is still a problem. This is derived from the lack of a perceived ‘value’ that can be assigned to macroinvertebrate species. With the exception of endangered mussel species (for which PHABSIM analysis is probably inappropriate), this is understandable. However, it appears that there is a greater ability to predict macroinvertebrate distribution (that is, a response to the change in habitat quality or location) and diversity without complex population models. Also, habitat suitability criteria for water quality indicator taxa (Ephemeroptera, Plecoptera, and Trichoptera; the so-called ‘EPTs’) may also provide additional management options to stream regulators. The greatest application for macroinvertebrate criteria will be in low-order streams where a more immediate link to fish communities can be established. We present an example from Queens Creek, in North Carolina, USA, in which monthly allocations required to preserve the integrity of the benthic macroinvertebrate community were significantly higher than for the target benthic fish species, Cottus bairdi. In the months when both Cottus and community diversity of macroinvertebrates were the ‘bottleneck’ life stages, preservation of only fish species could result in an additional 5–25% loss in macroinvertebrate habitat. We suggest that, as there becomes an increased emphasis on maintaining macroinvertebrates as monitors of stream health, there will be a concurrent emphasis on incorporating hydraulic habitat conditions as a part of bioassessment.

Redescription of Testudotaenia testudo (Magath, 1924) (Eucestoda: Proteocephalidea), a parasite of Apalone spinifera (Le Sueur) (Reptilia: Trionychidae) and Amia calva L. (Pisces: Amiidae) in North America and erection of the Testudotaeniinae n. subfam.

PubMed

de Chambrier, Alain; Coquille, Sandrine C; Mariaux, Jean; Tkach, Vasyl

2009-05-01

Testudotaenia testudo (Magath, 1924) is redescribed from the intestine of the softshell turtle Apalone spinifera (Le Sueur) (Trionychidae) and the bowfin Amia calva Linnaeus (Amiidae) from Reelfoot Lake, Tennessee, United States. A new subfamily, the Testudotaeniinae, is erected. The new taxon differs from all proteocephalidean subfamilies in the position of the genital organs in relation to the longitudinal internal musculature, i.e. the testes are cortical, rarely medullary; the ovary is partly medullary, with cortical lobes; the vitelline follicles are mainly medullary, with some follicles in the cortex; and the uterus is cortical. A key to the subfamilies of the order Proteocephalidea Mola, 1928 is provided. The most characteristic features of T. testudo are the precocious uterine aperture, the presence of internal uterine pores (as previously described for Proteocephalus paraguayensis (Rudin, 1917)), the eggs laid unripe, the very long strobila (up to 970 mm), and the presence of an anterior circular musculature in the suckers, which is considered as a good differential character. Three other species were found in Amia calva: Proteocephalus perplexus La Rue, 1911, P. ambloplitis (Leidy, 1887) and a new, undescribed form. Sequences of the partial nuclear 28S rRNA gene of specimens of T. testudo from Apalone spinulifera and Amia calva confirm the conspecificity of samples from these two very distinct hosts, which may represent a capture phenomenon. As the subfamily Adenobrechmoinae Bursey, Goldberg & Kraus, 2006 and the genus Adenobrechmos Bursey, Goldberg & Kraus, 2006 are based on the presence of an apical organ, a character which reflects a rather common convergence, we consider the Adenobrechmoinae to be a junior synonym of the Proteocephalinae La Rue, 1911 and Adenobrechmos a junior synonym of Ophiotaenia La Rue, 1911. Adenobrechmos greeri Bursey, Goldberg & Kraus, 2006 thus becomes Ophiotaenia greeri (Bursey, Goldberg & Kraus, 2006) n. comb.

Dietary mercury exposure to endangered California Clapper Rails in San Francisco Bay.

PubMed

Casazza, Michael L; Ricca, Mark A; Overton, Cory T; Takekawa, John Y; Merritt, Angela M; Ackerman, Joshua T

2014-09-15

California Clapper Rails (Rallus longirostris obsoletus) are an endangered waterbird that forage in tidal-marsh habitats that pose risks from mercury exposure. We analyzed total mercury (Hg) in six macro-invertebrate and one fish species representing Clapper Rail diets from four tidal-marshes in San Francisco Bay, California. Mercury concentrations among individual taxa ranged from lowest at Colma Creek (mean range: 0.09-0.2 μg/g dw) to highest at Cogswell (0.2-0.7), Laumeister (0.2-0.9) and Arrowhead Marshes (0.3-1.9). These spatial patterns for Hg matched patterns reported previously in Clapper Rail blood from the same four marshes. Over 25% of eastern mudsnails (Ilyanassa obsolete) and staghorn sculpin (Leptocottus armatus) exceeded dietary Hg concentrations (ww) often associated with avian reproductive impairment. Our results indicate that Hg concentrations vary considerably among tidal-marshes and diet taxa, and Hg concentrations of prey may provide an appropriate proxy for relative exposure risk for Clapper Rails. Copyright © 2014. Published by Elsevier Ltd.

Dietary mercury exposure to endangered California Clapper Rails in San Francisco Bay

USGS Publications Warehouse

Casazza, Michael L.; Ricca, Mark A.; Overton, Cory T.; Takekawa, John Y.; Merritt, Angela M.; Ackerman, Joshua T.

2015-01-01

California Clapper Rails (Rallus longirostris obsoletus) are an endangered waterbird that forage in tidal-marsh habitats that pose risks from mercury exposure. We analyzed total mercury (Hg) in six macro-invertebrate and one fish species representing Clapper Rail diets from four tidal-marshes in San Francisco Bay, California. Mercury concentrations among individual taxa ranged from lowest at Colma Creek (mean range: 0.09–0.2 μg/g dw) to highest at Cogswell (0.2–0.7), Laumeister (0.2–0.9) and Arrowhead Marshes (0.3–1.9). These spatial patterns for Hg matched patterns reported previously in Clapper Rail blood from the same four marshes. Over 25% of eastern mudsnails (Ilyanassa obsolete) and staghorn sculpin (Leptocottus armatus) exceeded dietary Hg concentrations (ww) often associated with avian reproductive impairment. Our results indicate that Hg concentrations vary considerably among tidal-marshes and diet taxa, and Hg concentrations of prey may provide an appropriate proxy for relative exposure risk for Clapper Rails.

Patch occupancy of stream fauna across a land cover gradient in the southern Appalachians, USA

USGS Publications Warehouse

Frisch, John R.; Peterson, James T.; Cecala, Kristen K.; Maerz, John C.; Jackson, C. Rhett; Gragson, Ted L.; Pringle, Catherine M.

2016-01-01

We modeled patch occupancy to examine factors that best predicted the prevalence of four functionally important focal stream consumers (Tallaperla spp., Cambarus spp.,Pleurocera proxima, and Cottus bairdi) among 37 reaches within the Little Tennessee River basin of the southern Appalachian Mountains, USA. We compared 34 models of patch occupancy to examine the association of catchment and reach scale factors that varied as a result of converting forest to agricultural or urban land use. Occupancy of our taxa was linked to parameters reflecting both catchment and reach extent characteristics. At the catchment level, forest cover or its conversion to agriculture was a major determinant of occupancy for all four taxa. Patch occupancies of Tallaperla, Cambarus, and C. bairdi were positively, and Pleurocera negatively, correlated with forest cover. Secondarily at the reach level, local availability of large woody debris was important forCambarus, availability of large cobble substrate was important for C. bairdi, and stream calcium concentration was important for P. proxima. Our results show the abundance of stream organisms was determined by the taxon-dependent interplay between catchment- and reach-level factors.

Temperament in bullheads: do laboratory and field explorative behaviour variables correlate?

NASA Astrophysics Data System (ADS)

Kobler, Alexander; Engelen, Brecht; Knaepkens, Guy; Eens, Marcel

2009-10-01

The relevance of temperament traits for life history strategy or productivity is increasingly acknowledged. Temperament traits are often either observed in captivity or in the wild, but studies combining both observations are very rare. We examine whether exploratory behaviour in the bullhead ( Cottus perifretum), assayed under laboratory conditions, predicts this behaviour under field conditions. Forty-three PIT-tagged individuals were first assayed for exploration of a novel environment in the aquarium and then released into an unfamiliar stream stretch, where they were later relocated using a mobile antenna. Explorative behaviour assayed in the laboratory was significantly positively related to the exploration in the field, thus predicting distance moved in the field release. Both in the laboratory and in the field, explorative behaviour was not related to individual body length. When bullheads that did not leave the refuge in the aquarium (laboratory assay) and, therefore, did not explore the new environment were excluded from the analysis, the correlation between laboratory and field explorative behaviour variables became weaker. However, overall, our results illustrate that exploration rate of bullheads in isolated single-individual experiments can be used to predict this behaviour in the natural ecosystem.

Trophic connections in Lake Superior Part II: the nearshore fish community

USGS Publications Warehouse

Gamble, A.E.; Hrabik, T.R.; Yule, D.L.; Stockwell, J.D.

2011-01-01

We use detailed diet analyses of the predominant planktivorous, benthivorous and piscivorous fish species from Lake Superior to create a nearshore (bathymetric depths Mysis diluviana and Diporeia spp). Although the piscivorous fishes like lean lake trout (Salvelinus namaycush) fed to a lesser extent on Diporeia and Mysis, they were still strongly connected to these macroinvertebrates, which were consumed by their primary prey species (sculpin spp., rainbow smelt Osmerus mordax, and coregonines). The addition of Bythotrephes to summer/fall cisco and lake whitefish diets, and the decrease in rainbow smelt in lean lake trout diets (replaced by coregonines) were the largest observed differences relative to historic Lake Superior diet studies. Although the offshore food web of Lake Superior was simpler than nearshore in terms of number of fish species present, the two areas had remarkably similar food web structures, and both fish communities were primarily supported by Mysis and Diporeia. We conclude that declines in Mysis or Diporeia populations would have a significant impact on energy flow in Lake Superior. The food web information we generated can be used to better identify management strategies for Lake Superior.

Heterologous expression of type I antifreeze peptide GS-5 in baker's yeast increases freeze tolerance and provides enhanced gas production in frozen dough.

PubMed

Panadero, Joaquin; Randez-Gil, Francisca; Prieto, Jose Antonio

2005-12-28

The demand for frozen-dough products has increased notably in the baking industry. Nowadays, no appropriate industrial baker's yeast with optimal gassing capacity in frozen dough is, however, available, and it is unlikely that classical breeding programs could provide significant improvements of this trait. Antifreeze proteins, found in diverse organisms, display the ability to inhibit the growth of ice, allowing them to survive at temperatures below 0 degrees C. In this study a recombinant antifreeze peptide GS-5 was expressed from the polar fish grubby sculpin (Myoxocephalus aenaeus) in laboratory and industrial baker's yeast strains of Saccharomyces cerevisiae. Production of the recombinant protein increased freezing tolerance in both strains tested. Furthermore, expression of the GS-5 encoding gene enhanced notably the gassing rate and total gas production in frozen and frozen sweet doughs. These effects are unlikely to be due to reduced osmotic damage during freezing/thawing, because recombinant cells showed growth behavior similar to that of the parent under hypermosmotic stress conditions.

Organochlorine compounds in the Gulf of Bothnia: sediment and benthic species.

PubMed

Strandberg, B; Bandh, C; van Bavel, B; Bergqvist, P A; Broman, D; Ishaq, R; Näf, C; Rappe, C

2000-01-01

Surface sediment, amphipods (Monoporeia affinis), isopods (Saduria entomon) and fourhorn sculpins (Oncocottus quadricornis) were collected at two coastal stations in the Gulf of Bothnia, one in the Bothnian Bay and the other in the Bothnian Sea. The objective was to study the concentrations, composition profiles, bioaccumulation features and spatial differences of organochlorine compounds such as hexachlorocyclohexanes (HCHs), DDTs, hexachlorobenzene (HCBz), chlordanes (CHLs), dieldrin, Mirex and polychlorinated biphenyls (PCBs). All groups of compounds were found in every sample investigated, with the exception of Mirex that was not detected in the sediment samples. The concentrations for e.g. PCBs and CHLs ranged from 700 to 2400 and 70 to 400 ng/g lipid in the specimens. For the corresponding sediments the results were 9.0-9.3 ng/g dw for PCBs and 0.54-0.57 ng/g dw for CHLs, respectively. Bioaccumulation differences between the species with regard to both degree of and type of compound were observed. The highest accumulation potential was found for the cyclodiene compounds including CHLs and Mirex in isopod. Finally, there were only small concentration and bioaccumulation differences between the two stations.

Offshore Fish Community: Ecological Interactions | Science ...

EPA Pesticide Factsheets

The offshore (>80 m) fish community of Lake Superior is made up of predominately native species. The most prominent species are deepwater sculpin, kiyi, cisco, siscowet lake trout, burbot, and the exotic sea lamprey. Bloater and shortjaw cisco are also found in the offshore zone. Bloater is abundant in the offshore zone but appears restricted to depths shallower than 150 m (Selgeby and Hoff 1996; Stockwell et al. 2010), although it occuppied greater depths several decades ago (Dryer 1966; Peck 1977). Shortjaw is relatively rare in the offshore zone (Hoff and Todd 2004; Gorman and Hoff 2009; Gorman and Todd 2007). Lake whitefish is also known to frequent bathymetric depths >100 m (Yule et al. 2008b). In this chapter, we develop a conceptual model of the offshore food web based on data collected during 2001-2005 and on inferences from species interactions known for the nearshore fish community. We then develop a framework for examination of energy and nutrient movements within the pelagic and benthic habitats of the offshore zone and across the offshore and nearshore zones. To document research results.

The response of the tidepool sculpin, Oligocottus maculosus, to hypoxia in laboratory, mesocosm and field environments.

PubMed

Sloman, Katherine A; Mandic, Milica; Todgham, Anne E; Fangue, Nann A; Subrt, Peter; Richards, Jeffrey G

2008-03-01

Animals living in the intertidal zone experience regular, predictable fluctuations in physical parameters including temperature, oxygen and salinity and rely on behavioural, physiological and biochemical mechanisms to cope with environmental variation. In the present study, behavioural strategies induced by aquatic hypoxia (e.g. emergence) were performed at similar oxygen tensions across laboratory, mesocosm and field environments; the number of individuals performing these behaviours at any one time was similar in mesocosms and the field. The use of aquatic surface respiration (ASR) was more plastic than emergence behaviour, occurring at a lower oxygen tension in juveniles than adults and being influenced by the addition of alarm substance. Oxygen uptake was lower in air than in water in adults but, in contrast, oxygen uptake was not influenced by the respiratory medium in juveniles. In the laboratory, 72 h of forced emergence did not affect whole body concentrations of lactate but when ASR and emergence were prevented within mesocosm environments there was a significant elevation of lactate. The present study highlights the benefits of transcending traditional laboratory/field boundaries allowing the responses of laboratory-held animals to environmental fluctuation to be integrated with how these animals perform in their natural environment.

Healing of corneal epithelial wounds in marine and freshwater fish.

PubMed

Ubels, J L; Edelhauser, H F

The corneal epithelium of a fish is in direct contact with the aquatic environment and is a barrier to movement of ions and water into and through the cornea. This tissue layer is thus important in maintenance of corneal transparency. When the epithelium is wounded, its protective function is lost and corneal transparency remains compromised until the epithelial barrier is re-established. This study was undertaken to investigate the healing response of the fish cornea to epithelial abrasion. Wounds were stained with fluorescein and photographed during healing. Wound areas were measured by planimetry. The cornea of the sculpin, a marine teleost, becomes edematous after wounding and heals at 2.54 to 3.42 mm2/hr. Nonswelling corneas of the elasmobranchs--dogfish shark and skate--heal at 1.29 mm2/hr, respectively. The wounded eye of the rainbow trout, a freshwater teleost, is stressed by the low osmolality of the environment. Severe corneal edema and cataracts develop following epithelial wounding, and the cornea heals at 0.64 mm2/hr. Although the healing rates in teleosts differ from those in mammals, histology shows that the corneal healing mechanism is essentially the same in fish and mammals.

Manipulative parasites may not alter intermediate host distribution but still enhance their transmission: field evidence for increased vulnerability to definitive hosts and non-host predator avoidance.

PubMed

Lagrue, C; Güvenatam, A; Bollache, L

2013-02-01

Behavioural alterations induced by parasites in their intermediate hosts can spatially structure host populations, possibly resulting in enhanced trophic transmission to definitive hosts. However, such alterations may also increase intermediate host vulnerability to non-host predators. Parasite-induced behavioural alterations may thus vary between parasite species and depend on each parasite definitive host species. We studied the influence of infection with 2 acanthocephalan parasites (Echinorhynchus truttae and Polymorphus minutus) on the distribution of the amphipod Gammarus pulex in the field. Predator presence or absence and predator species, whether suitable definitive host or dead-end predator, had no effect on the micro-distribution of infected or uninfected G. pulex amphipods. Although neither parasite species seem to influence intermediate host distribution, E. truttae infected G. pulex were still significantly more vulnerable to predation by fish (Cottus gobio), the parasite's definitive hosts. In contrast, G. pulex infected with P. minutus, a bird acanthocephalan, did not suffer from increased predation by C. gobio, a predator unsuitable as host for P. minutus. These results suggest that effects of behavioural changes associated with parasite infections might not be detectable until intermediate hosts actually come in contact with predators. However, parasite-induced changes in host spatial distribution may still be adaptive if they drive hosts into areas of high transmission probabilities.

Temperature acclimation rate of aerobic scope and feeding metabolism in fishes: implications in a thermally extreme future

PubMed Central

Sandblom, Erik; Gräns, Albin; Axelsson, Michael; Seth, Henrik

2014-01-01

Temperature acclimation may offset the increased energy expenditure (standard metabolic rate, SMR) and reduced scope for activity (aerobic scope, AS) predicted to occur with local and global warming in fishes and other ectotherms. Yet, the time course and mechanisms of this process is little understood. Acclimation dynamics of SMR, maximum metabolic rate, AS and the specific dynamic action of feeding (SDA) were determined in shorthorn sculpin (Myoxocephalus scorpius) after transfer from 10°C to 16°C. SMR increased in the first week by 82% reducing AS to 55% of initial values, while peak postprandial metabolism was initially greater. This meant that the estimated AS during peak SDA approached zero, constraining digestion and leaving little room for additional aerobic processes. After eight weeks at 16°C, SMR was restored, while AS and the estimated AS during peak SDA recovered partly. Collectively, this demonstrated a considerable capacity for metabolic thermal compensation, which should be better incorporated into future models on organismal responses to climate change. A mathematical model based on the empirical data suggested that phenotypes with fast acclimation rates may be favoured by natural selection as the accumulated energetic cost of a slow acclimation rate increases in a warmer future with exacerbated thermal variations. PMID:25232133

Limnology and fish ecology of sockeye salmon nursery lakes of the world

USGS Publications Warehouse

Hartman, Wilbur L.; Burgner, R.L.

1972-01-01

Many important, recently glaciated oligotrophic lakes that lie in coastal regions around the northern rim of the Pacific Ocean produce anadromous populations of sockeye salmon, Oncorhynchus nerka. This paper describes the limnology and fish ecology of two such lakes in British Columbia, five in Alaska, and one in Kamchatka. Then we discuss the following general topics: the biogenic eutrophication of nursery lakes from the nutrients released from salmon carcasses wherein during years of highest numbers of spawners, lake phosphate balances in Lakes Babine, Iliamna, and Dalnee are significantly affected; the use of nursery lakes by young sockeye that reveals five patterns related to size and configuration of lake basins and the distribution of spawning areas; the interactions between various life history stages of sockeye salmon and such resident predators, competitors, and prey as Arctic char, lake trout, Dolly Varden, cutthroat trout, lake whitefish, pygmy whitefish, pond smelt, sticklebacks, and sculpins; the self-regulation of sockeye salmon abundance in these nursery lakes as controlled by density-dependent processes; the interrelations between young sockeye salmon biomass and growth rates, and zooplankton abundance in Babine Lake; and finally, the diel, vertical, pelagial migratory behavior of young sockeye in Babine Lake and the new hypothesis dealing with bioenergetic conservation.

Cumulative Industrial Activity Alters Lotic Fish Assemblages in Two Boreal Forest Watersheds of Alberta, Canada

NASA Astrophysics Data System (ADS)

Scrimgeour, Garry J.; Hvenegaard, Paul J.; Tchir, John

2008-12-01

We evaluated the cumulative effects of land use disturbance resulting from forest harvesting, and exploration and extraction of oil and gas resources on the occurrence and structure of stream fish assemblages in the Kakwa and Simonette watersheds in Alberta, Canada. Logistic regression models showed that the occurrence of numerically dominant species in both watersheds was related to two metrics defining industrial activity (i.e., percent disturbance and road density), in addition to stream wetted width, elevation, reach slope, and percent fines. Occurrences of bull trout, slimy sculpin, and white sucker were negatively related to percent disturbance and that of Arctic grayling, and mountain whitefish were positively related to percent disturbance and road density. Assessments of individual sites showed that 76% of the 74 and 46 test sites in the Kakwa and Simonette watersheds were possibly impaired or impaired. Impaired sites in the Kakwa Watershed supported lower densities of bull trout, mountain whitefish, and rainbow trout, but higher densities of Arctic grayling compared to appropriate reference sites. Impaired sites in the Simonette Watershed supported lower densities of bull trout, but higher densities of lake chub compared to reference sites. Our data suggest that current levels of land use disturbance alters the occurrence and structure of stream fish assemblages.

Predation on walleye eggs by fish on reefs in western Lake Erie

USGS Publications Warehouse

Roseman, E.F.; Taylor, W.W.; Hayes, D.B.; Jones, A.L.; Francis, J.T.

2006-01-01

We examined diets of fishes from gillnet and egg pump collections conducted on reefs in western Lake Erie during walleye (Sander vitreus) egg incubation periods from 1994–1999 and 2004 to assess incidence of walleye eggs in fish diets. We collected no potential egg predators in samples taken in 1994 but from 1995–1999 and in 2004 we caught 22 different species of fish on reefs in addition to spawning walleye. In most years, white perch (Morone americana) stomachs contained more walleye eggs than any other species on the reefs averaging 253 eggs per stomach. We also found lower numbers of walleye eggs in the stomachs of channel catfish (Ictalurus punctatus; 53 eggs/stomach), johnny darter (Etheostoma nigrum; 2 eggs/stomach), logperch (Percina caprodes; 10 eggs/stomach), quillback (Carpiodes cyprinus; 184 eggs/stomach), rock bass (Ambloplites rupestris; 3 eggs/stomach), round goby (Neogobius melanostomus; 4 eggs/stomach), sculpin (Cottidae; 21 eggs/stomach), silver chub (Macrhybopsis storeriana; 3 eggs/stomach), spottail shiner (Notropis hudsonius; 14 eggs/stomach), trout-perch (Percopsis omiscomaycus; 30 eggs/stomach), white sucker (Catastomus commersonii; 20 eggs/stomach), and yellow perch (Perca flavescens; 181 eggs/stomach). Similar to other studies of predation on walleye eggs, our results indicate that prolonged incubation periods increase the potential for egg loss due to predation.

Long-term changes of the Lake Michigan fish community following the reduction of exotic alewife (Alosa pseudoharengus)

USGS Publications Warehouse

Bunnell, D.B.; Madenjian, C.P.; Claramunt, R.M.

2006-01-01

We used our long-term annual bottom trawl survey (1973–2004) in Lake Michigan to reveal the response of the native fish community to the biological control of a dominant exotic fish, alewife (Alosa pseudoharengus), as well as to changes in total phosphorus and salmonine biomass. Through nonmetric multidimensional scaling, we documented a 1970s community largely dominated by alewife, and then a shift to a community dominated by several native species during the 1980s through 1990s, when alewife remained at relatively low levels. We argue that the recovery of burbot (Lota lota), deepwater sculpin (Myoxocephalus thompsonii), and yellow perch (Perca flavescens) was partially or fully aided by the alewife reduction. We argue that changes in phosphorus or salmonines were not directly related to abundance increases of native species. An additional community shift occurred during 1999–2004, which coincided with a reduction in species richness and total fish biomass in our trawl. The mechanisms underlying this latest shift may be related to reductions in nutrients, but further research is required. The restoration of the native fish community has been incomplete, however, as emerald shiner (Notropis atherinioides), cisco (Coregonus artedii), and lake trout (Salvelinus namaycush) have yet to demonstrate recovery.

Dynamics of the Lake Michigan food web, 1970-2000

USGS Publications Warehouse

Madenjian, Charles P.; Fahnenstiel, Gary L.; Johengen, Thomas H.; Nalepa, Thomas F.; Vanderploeg, Henry A.; Fleischer, Guy W.; Schneeberger, Philip J.; Benjamin, Darren M.; Smith, Emily B.; Bence, James R.; Rutherford, Edward S.; Lavis, Dennis S.; Robertson, Dale M.; Jude, David J.; Ebener, Mark P.

2002-01-01

Herein, we document changes in the Lake Michigan food web between 1970 and 2000 and identify the factors responsible for these changes. Control of sea lamprey (Petromyzon marinus) and alewife (Alosa pseudoharengus) populations in Lake Michigan, beginning in the 1950s and 1960s, had profound effects on the food web. Recoveries of lake whitefish (Coregonus clupeaformis) and burbot (Lota lota) populations, as well as the buildup of salmonine populations, were attributable, at least in part, to sea lamprey control. Based on our analyses, predation by salmonines was primarily responsible for the reduction in alewife abundance during the 1970s and early 1980s. In turn, the decrease in alewife abundance likely contributed to recoveries of deepwater sculpin (Myoxocephalus thompsoni), yellow perch (Perca flavescens), and burbot populations during the 1970s and 1980s. Decrease in the abundance of all three dominant benthic macroinvertebrate groups, including Diporeia, oligochaetes, and sphaeriids, during the 1980s in nearshore waters (50 m deep) of Lake Michigan, was attributable to a decrease in primary production linked to a decline in phosphorus loadings. Continued decrease in Diporeia abundance during the 1990s was associated with the zebra mussel (Dreissena polymorpha) invasion, but specific mechanisms for zebra mussels affecting Diporeia abundance remain unidentified.

Jumping genes: Genomic ballast or powerhouse of biological diversification.

PubMed

Choudhury, Rimjhim Roy; Parisod, Christian

2017-09-01

Studying hybridization has the potential to elucidate challenging questions in evolutionary biology such as the nature of adaptive genetic variation and reproductive isolation. A growing body of work highlights that the merging of divergent genomes goes beyond the reshuffling of standing variation from related species and promotes mutations (Abbott et al., ). However, to what extent such genome instability generates evolutionary significant variation remains largely elusive. In this issue of Molecular Ecology, Dennenmoser et al. () report considerable dynamics of transposable elements (TEs) in a recent invasive fish species of hybrid origin (Cottus; Figure ). It adds to the recent examples from plants to support TE-specific genome variation following hybridization. Insights from early, as well as established, hybrids are largely coherent with increased TE activity, and this fish system thus represents an inspiring opportunity to further address the possible association between genome dynamics and "rapid evolution of hybrid species." This work based on genome (re)sequencing contrasts with prior transcriptomics or PCR-based studies of TEs and illustrates how unprecedented amount of information promises a better understanding of the multiple patterns of variation across eukaryotic genomes; provided that we get the better of methodological advances. As discussed here, unbiased assessment of TE variation from genome surveys indeed remains a challenge precluding firm conclusions to be reached about the evolutionary significance of TEs. Despite methodological and conceptual developments that appear necessary to unambiguously uncover the unexplored iceberg below the known tip, the role of coding genes vs. TEs in promoting adaptation and speciation might be clarified in a not so remote future. © 2017 John Wiley & Sons Ltd.

Invasion strategy and abiotic activity triggers for non-native gobiids of the River Rhine

PubMed Central

Hartmann, Frank; Brinker, Alexander

2017-01-01

The 24 hour activity patterns of three non-native gobiids (round goby Neogobius melanostomus, Western tubenose goby Proterorhinus semilunaris and bighead goby Ponticola kessleri) were assessed over 46 consecutive months between 2011 and 2014 from their occurrence in the cooling water intake of a nuclear power plant on the River Rhine, Germany. In total, 117717 gobiids were identified and classified. The occurrence of all three species varied strongly between sampling years, and species-specific activity triggers were identified. The activity of juveniles of all three gobiids species was positively temperature dependent while adult tubenose goby activity appeared to be negatively temperature dependent. Increasing fluvial discharge in the adjoining main river stimulated the activity of juvenile round goby but inhibited activity of adult tubenose goby. Except for adult bighead goby, activity was also structured by time of day, but with no uniform mean. Meteorological factors such as precipitation, air pressure and duration of sunshine hours had little or no influence on gobiid activity. On selected rare occasions, mainly at night, all three species exhibited pulsed swarming behaviour, with thousands of individuals recorded in the intake water. Round goby swarms exhibited both the highest intensity and the largest swarming individuals, suggesting a potential competitive advantage over tubenose and bighead goby. Electric fishing surveys in natural river stretches corroborated this observation. Negative effects on the native fish fauna were apparent only for the bullhead, Cottus gobio. The activity triggers identified offer a unique insight into the invasion mechanisms of these ecosystem-changing non-native gobiids. PMID:28915248

Measurement error associated with surveys of fish abundance in Lake Michigan

USGS Publications Warehouse

Krause, Ann E.; Hayes, Daniel B.; Bence, James R.; Madenjian, Charles P.; Stedman, Ralph M.

2002-01-01

In fisheries, imprecise measurements in catch data from surveys adds uncertainty to the results of fishery stock assessments. The USGS Great Lakes Science Center (GLSC) began to survey the fall fish community of Lake Michigan in 1962 with bottom trawls. The measurement error was evaluated at the level of individual tows for nine fish species collected in this survey by applying a measurement-error regression model to replicated trawl data. It was found that the estimates of measurement-error variance ranged from 0.37 (deepwater sculpin, Myoxocephalus thompsoni) to 1.23 (alewife, Alosa pseudoharengus) on a logarithmic scale corresponding to a coefficient of variation = 66% to 156%. The estimates appeared to increase with the range of temperature occupied by the fish species. This association may be a result of the variability in the fall thermal structure of the lake. The estimates may also be influenced by other factors, such as pelagic behavior and schooling. Measurement error might be reduced by surveying the fish community during other seasons and/or by using additional technologies, such as acoustics. Measurement-error estimates should be considered when interpreting results of assessments that use abundance information from USGS-GLSC surveys of Lake Michigan and could be used if the survey design was altered. This study is the first to report estimates of measurement-error variance associated with this survey.

Temperature acclimation rate of aerobic scope and feeding metabolism in fishes: implications in a thermally extreme future.

PubMed

Sandblom, Erik; Gräns, Albin; Axelsson, Michael; Seth, Henrik

2014-11-07

Temperature acclimation may offset the increased energy expenditure (standard metabolic rate, SMR) and reduced scope for activity (aerobic scope, AS) predicted to occur with local and global warming in fishes and other ectotherms. Yet, the time course and mechanisms of this process is little understood. Acclimation dynamics of SMR, maximum metabolic rate, AS and the specific dynamic action of feeding (SDA) were determined in shorthorn sculpin (Myoxocephalus scorpius) after transfer from 10°C to 16°C. SMR increased in the first week by 82% reducing AS to 55% of initial values, while peak postprandial metabolism was initially greater. This meant that the estimated AS during peak SDA approached zero, constraining digestion and leaving little room for additional aerobic processes. After eight weeks at 16°C, SMR was restored, while AS and the estimated AS during peak SDA recovered partly. Collectively, this demonstrated a considerable capacity for metabolic thermal compensation, which should be better incorporated into future models on organismal responses to climate change. A mathematical model based on the empirical data suggested that phenotypes with fast acclimation rates may be favoured by natural selection as the accumulated energetic cost of a slow acclimation rate increases in a warmer future with exacerbated thermal variations. © 2014 The Author(s) Published by the Royal Society. All rights reserved.

Bumble Bees (Hymenoptera: Apidae: Bombus spp.) of Interior Alaska: Species Composition, Distribution, Seasonal Biology, and Parasites

PubMed Central

Pampell, Rehanon; Pantoja, Alberto; Holloway, Patricia; Knight, Charles; Ranft, Richard

2015-01-01

Abstract Background Despite the ecological and agricultural significance of bumble bees in Alaska, very little is known and published about this important group at the regional level. The objectives of this study were to provide baseline data on species composition, distribution, seasonal biology, and parasites of the genus Bombus at three major agricultural locations within Alaska: Fairbanks, Delta Junction, and Palmer, to lay the groundwork for future research on bumble bee pollination in Alaska. New information A total of 8,250 bumble bees representing 18 species was collected from agricultural settings near Delta Junction, Fairbanks, and Palmer, Alaska in 2009 and 2010. Of the 8,250 specimens, 51% were queens, 32.7% were workers, and 16.2% were males. The species composition and relative abundances varied among sites and years. Delta Junction had the highest relative abundance of bumble bees, representing 51.6% of the specimens collected; the other two locations, Fairbanks and Palmer represented 26.5% and 21.8% of the overall catch respectively. The species collected were: Bombus bohemicus Seidl 1837 (= B. ashtoni (Cresson 1864)), B. balteatus Dahlbom 1832, B. bifarius Cresson 1878, B. centralis Cresson 1864, B. cryptarum (Fabricius 1775) (=B. moderatus Cresson 1863), B. distinguendus Morawitz 1869, B. flavidus Eversmann 1852 (=B. fernaldae Franklin 1911), B. flavifrons Cresson 1863, B. frigidus Smith 1854, B. insularis (Smith 1861), B. jonellus (Kirby 1802), B. melanopygus Nylander 1848, B. mixtus Cresson 1878, B. neoboreus Sladen 1919, B. occidentalis Greene 1858, B. perplexus Cresson 1863, B. rufocinctus Cresson 1863, and B. sylvicola Kirby 1837. Overall, the most common bumble bees near agricultural lands were B. centralis, B. frigidus, B. jonellus, B. melanopygus, B. mixtus, and B. occidentalis. Species' relative population densities and local diversity were highly variable from year to year. Bombus occidentalis, believed to be in decline in the Pacific Northwest states, represented 10.4% of the overall specimens collected from the three sites studied. Bumble bees were found to be infected by Nosema and nematodes with infection rates up to 2.1% and 16.7% respectively. Of the eight species infected by parasites, B. occidentalis displayed the highest Nosema infection, while B. centralis was the species with the highest infection of nematodes. To our knowledge this represents the first multi-year study on bumble bees from the main agricultural areas of Alaska to provide baseline data on species composition, distribution, seasonal biology, and parasites of the genus Bombus. PMID:25977613

Aquatic biological communities and associated habitats at selected sites in the Big Wood River Watershed, south-central Idaho, 2014

USGS Publications Warehouse

MacCoy, Dorene E.; Short, Terry M.

2016-09-28

Assessments of streamflow (discharge) parameters, water quality, physical habitat, and biological communities were completed between May and September 2014 as part of a monitoring program in the Big Wood River watershed of south-central Idaho. The sampling was conducted by the U.S. Geological Survey in cooperation with Blaine County, Trout Unlimited, the Nature Conservancy, and the Wood River Land Trust to help identify the status of aquatic resources at selected locations in the watershed. Information in this report provides a basis with which to evaluate and monitor the long-term health of the Big Wood River and its major tributaries. Sampling sites were co-located with existing U.S. Geological Survey streamgaging stations: three on the main stem Big Wood River and four on the North Fork Big Wood River (North Fork), Warm Springs Creek (Warm Sp), Trail Creek (Trail Ck), and East Fork Big Wood River (East Fork) tributaries.The analytical results and quality-assurance information for water quality, physical habitat, and biological community samples collected at study sites during 2 weeks in September 2014 are summarized. Water-quality data include concentrations of major nutrients, suspended sediment, dissolved oxygen, and fecal-coliform bacteria. To assess the potential effects of nutrient enrichment on algal growth, concentrations of periphyton biomass (chlorophyll-a and ash free dry weight) in riffle habitats were determined at each site. Physical habitat parameters include stream channel morphology, habitat volume, instream structure, substrate composition, and riparian vegetative cover. Biological data include taxa richness, abundance, and stream-health indicator metrics for macroinvertebrate and fish communities. Statistical summaries of the water-quality, habitat, and biological data are provided along with discussion of how these findings relate to the health of aquatic resources in the Big Wood River watershed.Seasonal discharge patterns using statistical summaries of daily discharge from selected sites are reported for water years 2012–15. Results showed that annual average daily mean discharge increased from the Big Wood River near Ketchum, ID (BW Ketchum) downstream to the Big Wood River at Hailey, ID (BW Hailey), but decreased by nearly 50 percent from BW Hailey downstream to Big Wood River at Stanton Crossing near Bellevue, ID (BW Stanton). Annual variability in daily mean discharge among main-stem sites was highest at BW Stanton, suggesting that this part of the river may be subject to some level of flow alteration.Hydrologic alterations resulting in flow reduction can contribute to higher water temperature, especially during the summer months when conditions are often most stressful to fish and other stream organisms. Daily water temperature and water temperature trends from June to September 2014 are reported for select tributary and main-stem sites on the Big Wood River and can be used to assess the potential for biological impairment based on aquatic life temperature criteria for cold-water streams. The State of Idaho maximum temperature criteria for protection of cold-water aquatic life of 22 °C was exceeded at Warm Sp and BW Stanton during summer 2014, but at none of the other main-stem or tributary sites. The 13 °C critical temperature criterion for salmonid spawning was exceeded in early July 2014 at BW Ketchum and BW Hailey near the end of the rainbow trout critical spawning and rearing period. Temperature exceedances were most frequent at BW Stanton, where exceedances for rainbow trout and brown trout occurred from May through early July 2014 during most of the critical spawning and rearing period.Water quality and habitat availability did not seem to be limiting for fish or other aquatic organisms at most sites in the Big Wood River watershed. Water quality assessments in September 2014 determined no exceedances of total maximum daily load target levels. The availability and quality of habitat was limited at BW Stanton, where shallow-water habitat conditions prevailed.Macroinvertebrate community diversity was high at all sites except for BW Stanton, where low community diversity was attributed to low species richness and high abundances of a few tolerant taxa. Presence of low species diversity and high macroinvertebrate tolerance values at BW Stanton indicates that benthic community condition and stream health were reduced at that location.Fish surveys done in September 2014 did not indicate any significant reductions in native fish communities in the Big Wood River or its tributaries. Native rainbow trout (Oncorhynchus mykiss) and Wood River sculpin (Cottus leiopomus) were the dominant fish species in the drainage and were found at all tributary and main-stem sites. Non-native brown (Salmo trutta) and brook trout (Salvelinus fontinalis) were limited to lower drainage sites on the Big Wood River (BW Hailey and BW Stanton), and occurred in relatively low numbers.

Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.

PubMed

Miller, Robert J; Hocevar, John; Stone, Robert P; Fedorov, Dmitry V

2012-01-01

Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.

Structure-Forming Corals and Sponges and Their Use as Fish Habitat in Bering Sea Submarine Canyons

PubMed Central

Miller, Robert J.; Hocevar, John; Stone, Robert P.; Fedorov, Dmitry V.

2012-01-01

Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide. PMID:22470486

Diet of lake trout and burbot in northern Lake Michigan during spring: Evidence of ecological interaction

USGS Publications Warehouse

Jacobs, Gregory R.; Madenjian, Charles P.; Bunnell, David B.; Holuszko, Jeffrey D.

2010-01-01

We used analyses of burbot (Lota lota) and lake trout (Salvelinus namaycush) diets taken during spring gill-net surveys in northern Lake Michigan in 2006-2008 to investigate the potential for competition and predator-prey interactions between these two species. We also compared our results to historical data from 1932. During 2006-2008, lake trout diet consisted mainly of alewives (Alosa pseudoharengus) and rainbow smelt (Osmerus mordax), whereas burbot utilized a much wider prey base including round goby (Neogobius melanostomus), rainbow smelt, alewives, and sculpins. Using the Schoener's diet overlap index, we found a higher potential for interspecific competition in 1932 than in 2006-2008, though diet overlap was not significant in either time period. No evidence of cannibalism by lake trout or lake trout predation on burbot was found in either time period. In 2006-2008, however, lake trout composed 5.4% (by weight) of burbot diet. To determine whether this predation could be having an impact on lake trout rehabilitation efforts in northern Lake Michigan, we developed a bioenergetic-based consumption estimate for burbot on Boulder Reef (a representative reef within the Northern Refuge) and found that burbot alone can consume a considerable proportion of the yearling lake trout stocked annually, depending on burbot density. Overall, we conclude that predation, rather than competition, is the more important ecological interaction between burbot and lake trout, and burbot predation may be contributing to the failed lake trout rehabilitation efforts in Lake Michigan.

Effects of stream acidification and habitat on fish populations of a North American river

USGS Publications Warehouse

Baldigo, Barry P.; Lawrence, G.B.

2001-01-01

Water quality, physical habitat, and fisheries at sixteen reaches in the Neversink River Basin were studied during 1991-95 to identify the effects of acidic precipitation on stream-water chemistry and on selected fish-species populations, and to test the hypothesis that the degree of stream acidification affected the spatial distribution of each fish-species population. Most sites on the East Branch Neversink were strongly to severely acidified, whereas most sites on the West Branch were minimally to moderately acidified. Mean density of fish populations ranged from 0 to 2.15 fish/m2; biomass ranged from 0 to 17.5 g/m2. Where brook trout were present, their population density ranged from 0.04 to 1.09 fish/m2, biomass ranged from 0.76 to 12.2 g/m2, and condition (K) ranged from 0.94 to 1.07. Regression analyses revealed strong relations (r2 ?? 0.41 to 0.99; p ??? 0.05) between characteristics of the two most common species (brook trout and slimy sculpin) populations and mean concentrations of inorganic monomeric aluminum (Alim), pH, Si, K+, NO3/-, NH4/+, DOC, Ca2+, and Na+; acid neutralizing capacity (ANC); and water temperature. Stream acidification may have adversely affected fish populations at most East Branch sites, but in other parts of the Neversink River Basin these effects were masked or mitigated by other physical habitat, geochemical, and biological factors.

Energy Content of Arctic Forage Fish

NASA Astrophysics Data System (ADS)

Vollenweider, J.; Heintz, R.; Callahan, M.; Robertson, A.; Barton, M. B.; Sousa, L.; Mueter, F. J.; Mosher, S.; Moran, J.; Logerwell, E.; Boswell, K. M.; Sformo, T.; Farley, E.

2016-02-01

Global changes in climate conditions are most extreme in high latitudes and have the potential to restructure Arctic marine fish assemblages. Of concern is the ability for fish to adapt to changing habitats, the potential for range expansion from lower latitudes, and resultant introduction of competitors and/or predators. Bioenergetic models are useful tools to understand potential cascading trophic effects, and fish energy density is a key parameter in these models. We present energy density (kJ/g dry mass) values for 28 Arctic fish species collected in the Chukchi and Beaufort Seas between 2005 and 2014. Pacific herring (Clupea pallasii) was the most energy-rich species (25.0 kJ/g), followed by two species of primary importance to subsistence people, Arctic cisco (Coregonus autumnalis) and Bering cisco (Coregonus laurettae) (24.9 kJ/g and 23.5 kJ/g, respectively). The abundant and ecologically important Arctic cod (Boreogadus saida) was the most energy-rich gadid, averaging 22.7 kJ/g and having 6% more energy than walleye pollock (Theragra chalcogramma) (21.5 kJ/g) and 11% more energy than saffron cod (Eleginus gracilis) (20.5 kJ/g). In general, pelagic species such as juvenile Pacific salmon (Oncorhynchus sp) had the highest energy content, whereas benthic species such as sculpin (Cottidae), flatfish (Pleuronectidae), eelblennies (Stichaeidae) and eelpouts (Zoarcidae) were amongst the lowest. The high energy content of Arctic cod and their ubiquitous distribution in the water column makes them valuable prey for both demersal and pelagic predators.

Helical Antifreeze Proteins Have Independently Evolved in Fishes on Four Occasions

PubMed Central

Graham, Laurie A.; Hobbs, Rod S.; Fletcher, Garth L.; Davies, Peter L.

2013-01-01

Alanine-rich α-helical (type I) antifreeze proteins (AFPs) are produced by a variety of fish species from three different orders to protect against freezing in icy seawater. Interspersed amongst and within these orders are fishes making AFPs that are completely different in both sequence and structure. The origin of this variety of types I, II, III and antifreeze glycoproteins (AFGPs) has been attributed to adaptation following sea-level glaciations that occurred after the divergence of most of the extant families of fish. The presence of similar types of AFPs in distantly related fishes has been ascribed to lateral gene transfer in the case of the structurally complex globular type II lectin-like AFPs and to convergent evolution for the AFGPs, which consist of a well-conserved tripeptide repeat. In this paper, we examine the genesis of the type I AFPs, which are intermediate in complexity. These predominantly α-helical peptides share many features, such as putative capping structures, Ala-richness and amphipathic character. We have added to the type I repertoire by cloning additional sequences from sculpin and have found that the similarities between the type I AFPs of the four distinct groups of fishes are not borne out at the nucleotide level. Both the non-coding sequences and the codon usage patterns are strikingly different. We propose that these AFPs arose via convergence from different progenitor helices with a weak affinity for ice and that their similarity is dictated by the propensity of specific amino acids to form helices and to align water on one side of the helix into an ice-like pattern. PMID:24324684

Fish assemblage, density, and growth in lateral habitats within natural and regulated sections of Washington's Elwha River prior to dam removal

USGS Publications Warehouse

Connolly, P.J.; Brenkman, S.J.

2008-01-01

We characterized seasonal fish assemblage, relative density, and growth in river margins above and between two Elwha River dams scheduled for removal. Fish assemblage and relative density differed in the lateral habitats of the middle-regulated and upper-unregulated sections of the Elwha River. Rainbow trout was the numerically dominant salmonid in both sections, with bull trout present in low numbers. Sculpin were common in the middle section, but not detected in the upper section. In 2004, mean length and biomass of age-0 rainbow trout were significantly smaller in the middle section than in the upper section by the end of the growing season (September). In 2005, an earlier emergence of rainbow trout in the middle section (July) compared to the upper section (August) corresponded with warmer water temperatures in the middle section. Despite lower growth, the margins of mainstem units in the middle section supported higher mean areal densities and biomass of age-0 rainbow trout than the up-per section. These results suggest that growth performance of age-0 rainbow trout was lower in the middle section than in the upper section, which could have been a density-dependent response, or a result of poor food production in the sediment-starved regulated section, or both. Based on our findings, we believe that seasonal sampling of river margins within reference reaches is a cost effective and repeatable method for detection of biologically important short- and long-term changes in emergence timing, density, and growth of rainbow trout before and after dam removals in the Elwha River.

Distribution and relative abundance of fishes in littoral areas of Chief Joseph Reservoir, Columbia River

USGS Publications Warehouse

Gadomski, Dena M.; Venditti, David A.; Robinson, T. Craig; Beeman, John W.; Maule, Alec G.

2004-01-01

We surveyed fish assemblages in littoral areas of Chief Joseph Reservoir of the upper Columbia River to aid in understanding this ecosystem. Fish distributions and abundances were examined during April-July 1999 in relation to environmental conditions in the reservoir. We also compared the fish assemblages in Chief Joseph reservoir in 1999 to a past study conducted during 1974-1975, and to assemblages in other areas of the Columbia River. During 67 hr of electrofishing and 78 beach seine hauls in Chief Joseph Reservoir, 7460 fishes representing 8 families were collected. The majority of the catch was native – northern pikeminnow; redside shiners; longnose, bridgelip, and largescale suckers; and sculpins. The most abundant introduced species was walleye, and one species, rainbow trout, was mostly of net-pen origin. Larger sizes of suckers and northern pikeminnow were most abundant in the upper reservoir, likely due to upstream spawning migrations. The lower reservoir contained greater abundances of smaller fishes, and this area had lower flows, smaller substrates, and more complex shorelines that offered these fishes refugia. Only adult suckers displayed significant differences in abundances related to substrate. The relative abundances of species appeared to have changed since the 1970s, when the dominant fishes were northern pikeminnow, peamouth, largescale suckers, and walleye. Fish assemblage differences between Chief Joseph Reservoir and lower Columbia River reservoirs were also evident due to the morphology of the reservoir, its more northerly location, and the lack of fish passage facilities at Chief Joseph Dam. Our study is one of the few descriptions of fishes in the upper Columbia Rivers.

Status and trends of the Lake Huron offshore demersal fish community, 1976-2015

USGS Publications Warehouse

Roseman, Edward; Chriscinske, Margret Ann; Castle, Dana Kristina; Prichard, Carson G.

2016-01-01

The USGS Great Lakes Science Center has conducted trawl surveys to assess annual changes in the offshore demersal fish community of Lake Huron since 1973. Sample sites include five ports in U.S. waters with less frequent sampling near Goderich, Ontario. The 2015 fall bottom trawl survey was carried out between 14 and 28 October and included all U.S. ports, as well as Goderich, ON. The 2015 main basin prey fish biomass estimate for Lake Huron was 19.4 kilotonnes, a decline of about 50 percent from 2014. This estimate is the second lowest in the time series, and is approximately 5 percent of the maximum estimate in the time series observed in 1987. No adult alewife were collected in 2015 and YOY alewife was the second lowest in the time series, up slightly from the record low in 2014. The estimated biomass of yearling and older rainbow smelt also decreased and was the lowest observed in the time series. Estimated adult bloater biomass in Lake Huron declined to about half of the 2014 estimate. YOY alewife, rainbow smelt, and bloater abundance and biomass decreased over 2014. Biomass estimates for deepwater sculpins declined while trout-perch and ninespine stickleback increased over 2014 values, but all remained low compared to historic estimates. The 2014 biomass estimate for round goby increased from 2014 but remains at only 7 percent of the maximum observed in 2003. Wild juvenile lake trout were captured again in 2015, suggesting that natural reproduction by lake trout continues to occur.

The acute toxicity of chemically and physically dispersed crude oil to key arctic species under arctic conditions during the open water season

PubMed Central

Gardiner, William W; Word, Jack Q; Word, Jack D; Perkins, Robert A; McFarlin, Kelly M; Hester, Brian W; Word, Lucinda S; Ray, Collin M

2013-01-01

The acute toxicity of physically and chemically dispersed crude oil and the dispersant Corexit 9500 were evaluated for key Arctic species. The copepod Calanus glacialis, juvenile Arctic cod (Boreogadus saida), and larval sculpin (Myoxocephalus sp.) were tested under conditions representative of the Beaufort and Chukchi Seas during the ice-free season. The toxicity of 3 water-accommodated fractions (WAF) of Alaska North Slope crude oil was examined with spiked, declining exposures. A dispersant-only test was conducted with the copepod C. glacialis. Each preparation with oil (WAF, breaking wave WAF [BWWAF], and chemically enhanced WAF [CEWAF]) produced distinct suites of hydrocarbon constituents; the total concentrations of oil were lowest in WAF and highest in CEWAF preparations. The relative sensitivity for the different species and age classes was similar within each WAF type. Median lethal concentration values based on total petroleum hydrocarbons ranged from 1.6 mg/L to 4.0 mg/L for WAF and BWWAF treatments and from 22 mg/L to 62 mg/L for CEWAF. For Corexit 9500 exposures, median lethal concentration values ranged from 17 mg/L to 50 mg/L. The differences in the relative toxicity among the accommodated fractions indicated that the majority of petroleum hydrocarbons in the CEWAF are in less acutely toxic forms than the components that dominate the WAF or BWWAF. Further evaluation showed that the parent polycyclic aromatic hydrocarbon compounds, specifically naphthalene, were highly correlated to acute toxicity. Environ Toxicol Chem 2013;32:2284–2300. PMID:23765555

Changes in the Lake Michigan food web following dreissenid mussel invasions: A synthesis

USGS Publications Warehouse

Madenjian, Charles P.; Bunnell, David B.; Warner, David M.; Pothoven, Steven A.; Fahnenstiel, Gary L.; Nalepa, Thomas F.; Vanderploeg, Henry A.; Tsehaye, Iyob; Claramunt, Randall M.; Clark, Richard D

2015-01-01

Using various available time series for Lake Michigan, we examined changes in the Lake Michigan food web following the dreissenid mussel invasions and identified those changes most likely attributable to these invasions, thereby providing a synthesis. Expansion of the quagga mussel (Dreissena rostriformis bugensis) population into deeper waters, which began around 2004, appeared to have a substantial predatory effect on both phytoplankton abundance and primary production, with annual primary production in offshore (> 50 m deep) waters being reduced by about 35% by 2007. Primary production likely decreased in nearshore waters as well, primarily due to predatory effects exerted by the quagga mussel expansion. The drastic decline inDiporeia abundance in Lake Michigan during the 1990s and 2000s has been attributed to dreissenid mussel effects, but the exact mechanism by which the mussels were negatively affecting Diporeia abundance remains unknown. In turn, decreased Diporeiaabundance was associated with reduced condition, growth, and/or energy density in alewife (Alosa pseudoharengus), lake whitefish (Coregonus clupeaformis), deepwater sculpin (Myoxocephalus thompsonii), and bloater (Coregonus hoyi). However, lake-wide biomass of salmonines, top predators in the food web, remained high during the 2000s, and consumption of alewives by salmonines actually increased between the 1980–1995 and 1996–2011 time periods. Moreover, abundance of the lake whitefish population, which supports Lake Michigan's most valuable commercial fishery, remained at historically high levels during the 2000s. Apparently, counterbalancing mechanisms operating within the complex Lake Michigan food web have enabled salmonines and lake whitefish to retain relatively high abundances despite reduced primary production.

Distribution of fish, benthic invertebrate, and algal communities in relation to physical and chemical conditions, Yakima River basin, Washington, 1990

USGS Publications Warehouse

Cuffney, T.F.; Meador, M.R.; Porter, S.D.; Gurtz, M.E.

1997-01-01

Biological investigations were conducted in the Yakima River Basin, Washington, in conjunction with a pilot study for the U.S. Geological Survey's National Water-Quality Assessment Program. Ecological surveys were conducted at 25 sites in 1990 to (1) assess water-quality conditions based on fish, benthic invertebrate, and algal communities; (2) determine the hydrologic, habitat, and chemical factors that affect the distributions of these organisms; and (3) relate physical and chemical conditions to water quality. Results of these investigations showed that land uses and other associated human activities influenced the biological characteristics of streams and rivers and overall water-quality conditions. Fish communities of headwater streams in the Cascades and Eastern Cascades ecoregions of the Yakima River Basin were primarily composed of salmonids and sculpins, with cyprinids dominating in the rest of the basin. The most common of the 33 fish taxa collected were speckled dace, rainbow trout, and Paiute sculpin. The highest number of taxa (193) was found among the inverte- brates. Insects, particularly sensitive forms such as mayflies, stoneflies, and caddisflies (EPT--Ephemeroptera, Plecoptera, and Trichoptera fauna), formed the majority of the invertebrate communities of the Cascades and Eastern Cascades ecoregions. Diatoms dominated algal communities throughout the basin; 134 algal taxa were found on submerged rocks, but other stream microhabitats were not sampled as part of the study. Sensitive red algae and diatoms were predominant in the Cascades and Eastern Cascades ecoregions, whereas the abundance of eutrophic diatoms and green algae was large in the Columbia Basin ecoregion of the Yakima River Basin. Ordination of physical, chemical, and biological site characteristics indicated that elevation was the dominant factor accounting for the distribution of biota in the Yakima River Basin; agricultural intensity and stream size were of secondary importance. Ordination identified three site groups and three community types. Site groups consisted of (1) small streams of the Cascades and Eastern Cascades ecoregions, (2) small streams of the Columbia Basin ecoregions, and (3) large rivers of the Cascades and Columbia Basin ecoregions. The small streams of the Columbia Basin could be further subdivided into two groups--one where agricultural intensity was low and one where agricultural intensity was moderate to high. Dividing the basin into these three groups removed much of the influence of elevation and facilitated the analysis of land-use effects. Community types identified by ordination were (1) high elevation, cold-water communities associated with low agricultural intensity; (2) lower elevation, warm-water communities associated with low agricultural intensity, and (3) lower elevation, warm-water communities associated with moderate to high agricultural intensity. Multimetric community condition indices indicated that sites in the Cascades and Eastern Cascades site group were largely unimpaired. In contrast, all but two sites in the Columbia Basin site group were impaired, some severely. Agriculture (nutrients and pesticides) was the primary factor responsible for this impairment, and all impaired sites were characterized by multiple indicators of impairment. Three sites (Granger Drain, Moxee Drain, and Spring Creek) had high levels of impairment. Sites in the large-river site group were moderately to severely impaired downstream from the city of Yakima. High levels of impairment at large-river sites corresponded with high levels of pesticides in fish tissues and the occurrence of external anomalies. The response exhibited by invertebrates and algae to a gradient of agricultural intensity suggested a threshold response for sites in the Columbia Basin site group. Community condition declined precipitously at agricultural intensities above 50 (non-pesticide agricultural intensity index) and showed little respon

Periodic habitat loss alters the competitive coexistence between brown trout and bullheads in a small stream over 34 years.

PubMed

Elliott, J M

2006-01-01

1. Changes in the population density of juvenile sea trout Salmo trutta L. and bullheads Cottus gobio L. were compared in a small stream over 34 years. Both species have a similar diet and obviously live in the same general habitat. Habitat loss was most marked in seven summer droughts: severest in 1976, 1983, 1984, 1995, and less severe but followed by autumn droughts in 1969, 1989 and 1993. The contrasting effects of habitat loss on the two species were examined. 2. For both species, the Ricker curvilinear model significantly fit (P < 0.001) the relationship between initial egg density and survivor density for successive life stages, even though egg densities were much lower for bullheads than trout. These analyses provided evidence for density-dependent population regulation and also identified extreme outliers, most being for year-classes affected by summer droughts. 3. The variable effects of changes in habitable area (= % wettable area in sampling section) were quantified by using the residuals, each residual being the absolute value expressed as a percentage of the expected value from the Ricker curve. Significant relationships between the residuals and habitable area showed that habitat loss had a marked effect on survivor density, this being negative for 0+ and 1+ trout, and positive for 0+, 1+ and 2+/3+ bullheads. 4. Therefore, during periods of habitat loss in the summer months, bullhead density increased at the expense of trout density. Low flows and a decrease in wettable area were associated with a marked reduction in habitat quality for drift-feeding trout and an increase in habitat quality, and perhaps also quantity, for benthic-feeding bullheads. This case study shows that, during a major perturbation, the relationship between the densities of two species can change markedly in favour of the less numerous species. The competitive coexistence between the two species is therefore a dynamic process that changes through time with periodic changes in the environment.

Prey fish returned to Forster's tern colonies suggest spatial and temporal differences in fish composition and availability.

PubMed

Peterson, Sarah H; Ackerman, Joshua T; Eagles-Smith, Collin A; Herzog, Mark P; Hartman, C Alex

2018-01-01

Predators sample the available prey community when foraging; thus, changes in the environment may be reflected by changes in predator diet and foraging preferences. We examined Forster's tern (Sterna forsteri) prey species over an 11-year period by sampling approximately 10,000 prey fish returned to 17 breeding colonies in south San Francisco Bay, California. We compared the species composition among repeatedly-sampled colonies (≥ 4 years), using both relative species abundance and the composition of total dry mass by species. Overall, the relative abundances of prey species at seven repeatedly-sampled tern colonies were more different than would be expected by chance, with the most notable differences in relative abundance observed between geographically distant colonies. In general, Mississippi silverside (Menidia audens) and topsmelt silverside (Atherinops affinis) comprised 42% of individuals and 40% of dry fish mass over the study period. Three-spined stickleback (Gasterosteus aculeatus) comprised the next largest proportion of prey species by individuals (19%) but not by dry mass (6%). Five additional species each contributed ≥ 4% of total individuals collected over the study period: yellowfin goby (Acanthogobius flavimanus; 10%), longjaw mudsucker (Gillichthys mirabilis; 8%), Pacific herring (Clupea pallasii; 6%), northern anchovy (Engraulis mordax; 4%), and staghorn sculpin (Leptocottus armatus; 4%). At some colonies, the relative abundance and biomass of specific prey species changed over time. In general, the abundance and dry mass of silversides increased, whereas the abundance and dry mass of three-spined stickleback and longjaw mudsucker decreased. As central place foragers, Forster's terns are limited in the distance they forage; thus, changes in the prey species returned to Forster's tern colonies suggest that the relative availability of some fish species in the environment has changed, possibly in response to alteration of the available habitat.

2D or Not 2D? Testing the Utility of 2D Vs. 3D Landmark Data in Geometric Morphometrics of the Sculpin Subfamily Oligocottinae (Pisces; Cottoidea).

PubMed

Buser, Thaddaeus J; Sidlauskas, Brian L; Summers, Adam P

2018-05-01

We contrast 2D vs. 3D landmark-based geometric morphometrics in the fish subfamily Oligocottinae by using 3D landmarks from CT-generated models and comparing the morphospace of the 3D landmarks to one based on 2D landmarks from images. The 2D and 3D shape variables capture common patterns across taxa, such that the pairwise Procrustes distances among taxa correspond and the trends captured by principal component analysis are similar in the xy plane. We use the two sets of landmarks to test several ecomorphological hypotheses from the literature. Both 2D and 3D data reject the hypothesis that head shape correlates significantly with the depth at which a species is commonly found. However, in taxa where shape variation in the z-axis is high, the 2D shape variables show sufficiently strong distortion to influence the outcome of the hypothesis tests regarding the relationship between mouth size and feeding ecology. Only the 3D data support previous studies which showed that large mouth sizes correlate positively with high percentages of elusive prey in the diet. When used to test for morphological divergence, 3D data show no evidence of divergence, while 2D data show that one clade of oligocottines has diverged from all others. This clade shows the greatest degree of z-axis body depth within Oligocottinae, and we conclude that the inability of the 2D approach to capture this lateral body depth causes the incongruence between 2D and 3D analyses. Anat Rec, 301:806-818, 2018. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

Cyclopoid and harpacticoid copepods of the Laurentian Great Lakes

USGS Publications Warehouse

Hudson, Patrick L.; Reid, Janet W.; Lesko, Lynn T.; Selgeby, James H.

1998-01-01

Historical collections of cyclopoid and harpacticoid copepod crustaceans in the Great Lakes have mainly been based on samples taken with plankton nets in deeper waters (>5 m). Of the non-calanoid copepod species known from the Great Lakes, 58 or 64 live primarily on or in the sediments and rarely are collected in plankton samples. Because of their small size, they are rarely retained in the coarse sieves used to concentrate samples of benthic invertebrates. Thus, the abundance and distribution of most species of these two groups of copepods have never been adequately documented in the Great Lakes. We examined the stomach contents of small, bottom-feeding fishes such as slimy sculpin which feed on benthic copepods that live in deep, inaccessible rocky areas of the Great Lakes to collect some of the material. We also collected in shallow nearshore habitats, including wetlands. We present an annotated checklist of cyclopoid and harpacticoid copepods based on published records and our recent collections in the Great Lakes. We have added 14 species of cyclopoid copepods to the Great Lakes record, increasing the total to 30. Because we probably have accounted for most of the cyclopoid species, we provide a key to the identification of this group. We have added 19 species of harpacticoid copepods to the 15 previously known to the Great Lakes, and suspect that additional species remain to be discovered. In individual lakes, there were approximately as many species of cyclopoids as harpacticoids; the total number of species per lake ranged from 35 to 57. The most speciose genera were Bryocamptus (7), Canthocamptus (5), and Moraria (5) in the Harpacticoida, and Diacyclops (6) and Acanthocyclops (5) in the Cyclopoida. The origin of introduced species, our ability to classify copepod habitat, and the ecological significance of copepods are discussed.

Local contamination, and not feeding preferences, explains elevated PCB concentrations in Labrador ringed seals (Pusa hispida).

PubMed

Brown, Tanya M; Iverson, Sara J; Fisk, Aaron T; Macdonald, Robie W; Helbing, Caren C; Reimer, Ken J

2015-05-15

Polychlorinated biphenyls (PCBs) in high trophic level species typically reflect the contributions of myriad sources, such that source apportionment is rarely possible. The release of PCBs by a military radar station into Saglek Bay, Labrador contaminated the local marine food web. For instance, while heavier (higher chlorinated) PCB profiles in some ringed seals (Pusa hispida) were previously attributed to this local source, differences in feeding preferences among seals could not be ruled out as a contributing factor. Herein, similar fatty acid profiles between those seals with 'local' PCB profiles and those with 'long-range' or background profiles indicate little support for the possibility that differential feeding ecologies underlay the divergent PCB profiles. Ringed seals appeared to feed predominantly on zooplankton (Mysis oculata and Themisto libellula), followed by the dusky snailfish (Liparis gibbus), arctic cod (Boreogadus saida), and shorthorn sculpin (Myoxocephalus scorpius). Principal components analysis (PCA) and PCB homolog profiles illustrated the extent of contamination of the Saglek food web, which had very different (and much heavier) PCB profiles than those food web members contaminated by 'long-range' sources. Locally contaminated prey had PCB levels that were higher (2- to 544-fold) than prey contaminated by 'long-range' sources and exceeded wildlife consumption guidelines for PCBs. The application of multivariate analyses to two distinct datasets, including PCB congeners (n=50) and fatty acids (n=65), afforded the opportunity to clearly distinguish the contribution of locally-released PCBs to a ringed seal food web from those delivered via long-ranged transport. Results from the present study strongly suggest that habitat use rather than differences in prey selection is the primary mechanism explaining the divergent PCB patterns in Labrador ringed seals. Copyright © 2015 Elsevier B.V. All rights reserved.

Physiological (antioxidant) responses of estuarine fishes to variability in dissolved oxygen.

PubMed

Ross, S W; Dalton, D A; Kramer, S; Christensen, B L

2001-11-01

Cycles of dissolved oxygen (DO) in estuaries can range from anoxia to various levels of supersaturation (200-300%) over short time periods. Aerobic metabolism causes formation of damaging reactive oxygen species (ROS), a process exacerbated by high or low DO. Fish can generate physiological defenses (e.g. antioxidant enzymes) against ROS, however, there are little data tying this to environmental conditions. We investigated physiological defenses generated by estuarine fishes in response to high DO and various DO cycles. We hypothesized that chemical defenses and/or oxidative damage are related to patterns of DO supersaturation. Specific activities of antioxidants in fish tissues should be positively correlated with increasing levels of DO, if high DO levels are physiologically stressful. We caged common benthic fishes (longjaw mudsucker, Gillichthys mirabilis, and staghorn sculpin, Leptocottus armatus, in CA and spot, Leiostomus xanthurus and pinfish, Lagodon rhomboides, in NC) during summer 1998 in two estuarine sites in southern North Carolina and two in central California. At each site a water quality meter measured bottom DO, salinity, temperature, depth, pH and turbidity at 30 min intervals throughout the study. These sites exhibited a wide variety of dissolved oxygen patterns. After 2 weeks in the cages, fish gills and livers were analyzed for antioxidant enzymes (glutathione peroxidase, catalase and superoxide dismutase) and the metabolite glutathione. All fish exhibited antioxidant enzyme activity. There was a significant site-dependent effect on all enzyme activities at the NC sites, with the most activity at the site with the highest DO cycling and the most DO supersaturation. There was a trend towards higher enzyme activities under high DO levels at the CA sites.

Persistent organic pollutants and related biological responses measured in coastal fish using chemical and biological screening methods.

PubMed

Tairova, Zhanna; Strand, Jakob; Bossi, Rossana; Larsen, Martin M; Förlin, Lars; Bignert, Anders; Hedman, Jenny; Gercken, Jens; Lang, Thomas; Fricke, Nicolai F; Asmund, Gert; Long, Manhai; Bonefeld-Jørgensen, Eva C

2017-01-01

The aim of this study was to investigate the spatial distribution, levels of dioxin-like compounds (DLC), and biological responses in two fish species. The viviparous eelpout (Zoarces viviparus) was collected from various locations in the Baltic Sea and in fjords of Kattegat and Skagerrak, while shorthorn sculpin (Myoxocephalus scorpius) was obtained at the polychlorinated biphenyl (PCB) polluted site in North West Greenland. Significant differences were detected both in contaminant levels and relative contributions from either polychlorinated dibenzodioxins (PCDD) or polychlorinated dibenzofurans (PCDF or furans) and mono-ortho- and non-ortho (coplanar) polychlorinated biphenyls (dl-PCB). Fish from the eastern Baltic Sea generally displayed higher contributions from PCDD/F compared to dl-PCB, whereas dl-PCB were generally predominated in fish from Danish, Swedish, and German sites. Levels of dl-PCB in muscle tissues were above OSPAR environmental assessment criteria (EAC) for PCB118, indicating a potential risk of adverse biological effects in the ecosystem, whereas levels of the total WHO-TEQs were below threshold for sea food suggesting limited risks for humans. No significant relationships between levels of DLC (expressed as WHO-TEQ), and biological responses such as the induction of CYP1A enzymatic activity and fry reproductive disorders were observed in eelpout. No marked relationship between WHO-TEQ and combined biological aryl hydrocarbon receptor-mediated transactivity (expressed as AhR-TEQ) was noted. However, there was a positive correlation between polycyclic aromatic hydrocarbon (PAH) metabolites and induction of CYP1A activity, suggesting that PAH exhibited greater potential than DLC to produce biological effects in eelpout from the Baltic Sea.

Prey fish returned to Forster’s tern colonies suggest spatial and temporal differences in fish composition and availability

USGS Publications Warehouse

Peterson, Sarah; Ackerman, Joshua T.; Eagles-Smith, Collin A.; Herzog, Mark; Hartman, C. Alex

2018-01-01

Predators sample the available prey community when foraging; thus, changes in the environment may be reflected by changes in predator diet and foraging preferences. We examined Forster’s tern (Sterna forsteri) prey species over an 11-year period by sampling approximately 10,000 prey fish returned to 17 breeding colonies in south San Francisco Bay, California. We compared the species composition among repeatedly-sampled colonies (≥ 4 years), using both relative species abundance and the composition of total dry mass by species. Overall, the relative abundances of prey species at seven repeatedly-sampled tern colonies were more different than would be expected by chance, with the most notable differences in relative abundance observed between geographically distant colonies. In general, Mississippi silverside (Menidia audens) and topsmelt silverside (Atherinops affinis) comprised 42% of individuals and 40% of dry fish mass over the study period. Three-spined stickleback (Gasterosteus aculeatus) comprised the next largest proportion of prey species by individuals (19%) but not by dry mass (6%). Five additional species each contributed ≥ 4% of total individuals collected over the study period: yellowfin goby (Acanthogobius flavimanus; 10%), longjaw mudsucker (Gillichthys mirabilis; 8%), Pacific herring (Clupea pallasii; 6%), northern anchovy (Engraulis mordax; 4%), and staghorn sculpin (Leptocottus armatus; 4%). At some colonies, the relative abundance and biomass of specific prey species changed over time. In general, the abundance and dry mass of silversides increased, whereas the abundance and dry mass of three-spined stickleback and longjaw mudsucker decreased. As central place foragers, Forster’s terns are limited in the distance they forage; thus, changes in the prey species returned to Forster’s tern colonies suggest that the relative availability of some fish species in the environment has changed, possibly in response to alteration of the available habitat.

Evidence for an amoeba-like infectious stage of ichthyophonus sp. and description of a circulating blood stage: a probable mechanism for dispersal within the fish host

USGS Publications Warehouse

Kocan, Richard; LaPatra, Scott; Hershberger, Paul

2013-01-01

Small amoeboid cells, believed to be the infectious stage of Ichthyophonus sp., were observed in the bolus (stomach contents) and tunica propria (stomach wall) of Pacific staghorn sculpins and rainbow trout shortly after they ingested Ichthyophonus sp.–infected tissues. By 24–48 hr post-exposure (PE) the parasite morphed from the classically reported multinucleate thick walled schizonts to 2 distinct cell types, i.e., a larger multinucleate amoeboid cell surrounded by a narrow translucent zone and a smaller spherical cell surrounded by a “halo” and resembling a small schizont. Both cell types also appeared in the tunica propria, indicating that they had recently penetrated the columnar epithelium of the stomach. No Ichthyophonus sp. pseudo-hyphae (“germination tubes”) were observed in the bolus or penetrating the stomach wall. Simultaneously, Ichthyophonus sp. was isolated in vitro from aortic blood, which was consistently positive from 6 to 144 hr PE, then only intermittently for the next 4 wk. Small PAS-positive cells observed in blood cultures grew into colonies consisting of non-septate tubules (pseudo-hyphae) terminating in multinucleated knob-like apices similar to those seen in organ explant cultures. Organ explants were culture positive every day; however, typical Ichthyophonus sp. schizonts were not observed histologically until 20–25 days PE. From 20 to 60 days PE, schizont diameter increased from ≤25 μm to ≥82 μm. Based on the data presented herein, we are confident that we have resolved the life cycle of Ichthyophonus sp. within the piscivorous host.

Urbanization effects on fishes and habitat quality in a southern Piedmont river basin

USGS Publications Warehouse

Walters, D.M.; Freeman, Mary C.; Leigh, D.S.; Freeman, B.J.; Pringle, C.P.; Brown, Larry R.; Gray, Robert H.; Hughes, Robert H.; Meador, Michael

2005-01-01

We quantified the relationships among urban land cover, fishes, and habitat quality to determine how fish assemblages respond to urbanization and if a habitat index can be used as an indirect measure of urban effects on stream ecosystems. We sampled 30 wadeable streams along an urban gradient (5?37% urban land cover) in the Etowah River basin, Georgia. Fish assemblages, sampled by electrofishing standardized stream reaches, were assessed using species richness, density, and species composition metrics. Habitat quality was scored using the Rapid Habitat Assessment Protocol (RHAP) of the U.S. Environmental Protection Agency. Urban land cover (including total, high-, and low-density urban) was estimated for the drainage basin above each reach. A previous study of these sites indicated that stream slope and basin area were strongly related to local variation in assemblage structure. We used multiple linear regression (MLR) analysis to account for this variation and isolate the urban effect on fishes. The MLR models indicated that urbanization lowered species richness and density and led to predictable changes in species composition. Darters and sculpin, cyprinids, and endemics declined along the urban gradient whereas centrarchids persisted and became the dominant group. The RHAP was not a suitable indicator of urban effects because RHAP-urban relationships were confounded by an overriding influence of stream slope on RHAP scores, and urban-related changes in fish assemblage structure preceded gross changes in stream habitat quality. Regression analysis indicated that urban effects on fishes accrue rapidly (<10 years) and are detectable at low levels (~5?10% urbanization). We predict that the decline of endemics and other species will continue and centrarchid-dominated streams will become more common as development proceeds within the Etowah basin.

Evaluating the effectiveness of restoring longitudinal connectivity for stream fish communities: towards a more holistic approach.

PubMed

Tummers, Jeroen S; Hudson, Steve; Lucas, Martyn C

2016-11-01

A more holistic approach towards testing longitudinal connectivity restoration is needed in order to establish that intended ecological functions of such restoration are achieved. We illustrate the use of a multi-method scheme to evaluate the effectiveness of 'nature-like' connectivity restoration for stream fish communities in the River Deerness, NE England. Electric-fishing, capture-mark-recapture, PIT telemetry and radio-telemetry were used to measure fish community composition, dispersal, fishway efficiency and upstream migration respectively. For measuring passage and dispersal, our rationale was to evaluate a wide size range of strong swimmers (exemplified by brown trout Salmo trutta) and weak swimmers (exemplified by bullhead Cottus perifretum) in situ in the stream ecosystem. Radio-tracking of adult trout during the spawning migration showed that passage efficiency at each of five connectivity-restored sites was 81.3-100%. Unaltered (experimental control) structures on the migration route had a bottle-neck effect on upstream migration, especially during low flows. However, even during low flows, displaced PIT tagged juvenile trout (total n=153) exhibited a passage efficiency of 70.1-93.1% at two nature-like passes. In mark-recapture experiments juvenile brown trout and bullhead tagged (total n=5303) succeeded in dispersing upstream more often at most structures following obstacle modification, but not at the two control sites, based on a Laplace kernel modelling approach of observed dispersal distance and barrier traverses. Medium-term post-restoration data (2-3years) showed that the fish assemblage remained similar at five of six connectivity-restored sites and two control sites, but at one connectivity-restored headwater site previously inhabited by trout only, three native non-salmonid species colonized. We conclude that stream habitat reconnection should support free movement of a wide range of species and life stages, wherever retention of such obstacles is not needed to manage non-native invasive species. Evaluation of the effectiveness of fish community restoration in degraded streams benefits from a similarly holistic approach. Copyright © 2016 Elsevier B.V. All rights reserved.

Temporal and geographic variation in fish communities of lower Cook Inlet, Alaska

USGS Publications Warehouse

Robards, Martin D.; Piatt, John F.; Kettle, Arthur B.; Abookire, Alisa A.

1999-01-01

Nearshore and shelf fish communities were studied in three areas of lower Cook Inlet, Alaska: the Barren Islands (oceanic and well-mixed waters), Kachemak Bay (mixed oceanic waters with significant freshwater runoff), and Chisik Island (estuarine waters). Fish were sampled with beach seines (n=413 sets) and midwater trawls (n=39 sets). We found that lower Cook Inlet supported a diverse nearshore fish community of at least 52 species. Fifty of these species were caught in Kachemak Bay, 24 at Chisik Island, and 12 at the Barren Islands. Pacific sand lance dominated Barren Islands and Kachemak Bay nearshore habitats, comprising 99% and 71% of total individuals, respectively. The nearshore Chisik Island fish community was not dominated by any one species; instead it exhibited higher diversity. These spatial differences appeared linked to local oceanographic regimes and sediment influx. Analysis of historical data revealed that the nearshore Kachemak Bay fish community changed significantly between 1976 and 1996, showing increased diversity and abundance in several taxa, notably gadids, salmonids, pleuronectids, and sculpins. Decadal differences appeared to be related to large-scale climate changes in the North Pacific. Catches of most taxa peaked in May-August, and were low during other months of the year. Several species were present for only part of the summer. Species composition of seine catches differed significantly between consecutive high and low tides, but not between consecutive sets or years. Midwater trawls took 26 species, 14 of which were present in Kachemak Bay, 19 near Chisik Island, and 7 at the Barren Islands. Community structures in shelf and nearshore waters were similar: diversity was high and abundance low at Chisik Island, whereas a few abundant species dominated at both Kachemak Bay and the Barren Islands. In addition, the low fish abundance near Chisik Island appeared to be related to declining seabird numbers at this colony.

The distribution of 4-nonylphenol in marine organisms of North American Pacific Coast estuaries.

PubMed

Diehl, Jennifer; Johnson, Sarah E; Xia, Kang; West, Amy; Tomanek, Lars

2012-04-01

One of the chemical breakdown products of nonylphenol ethoxylates, 4-nonylphenol (4-NP), accumulates in organisms and is of concern as an environmental pollutant due to its endocrine disrupting effects. We measured 4-NP levels in the seawater, sediment, and twelve organisms within the California estuary, Morro Bay, and examined biomagnification of 4-NP using stable isotope abundances (δ(15)N and δ(13)C) to quantify trophic position. 4-NP concentrations in organisms from Morro Bay included 25000±8600 ng g(-1) lw in liver of California sea lion, 14000±5600 ng g(-1) lw in liver of harbor porpoise, 138000±55000 ng g(-1) lw in liver of sea otters, 15700±3600 ng g(-1) lw in liver of seabirds, 36100±6100 ng g(-1) lw in arrow goby fish, 62800±28400 ng g(-1) lw in oysters, and 12700±1300 ng g(-1) lw in mussels. 4-NP levels generally showed a pattern of trophic dilution among organisms in Morro Bay, with exceptions of biomagnification observed between three trophic links: mussel to sea otter (BMF 10.9), oyster to sea otter (BMF 2.2), and arrow goby to staghorn sculpin (BMF 2.7). Our examination of other west coast estuaries of USA and Canada revealed that mean 4-NP concentrations in gobies and mussels from Morro Bay were significantly higher than those from a more urbanized estuary, San Francisco Bay (goby: 11100±3800 ng g(-1) lw) and from a remote estuary, Bamfield Inlet, Canada (goby: 9000±900 ng g(-1) lw, mussel: 6100±700 ng g(-1) lw). Relative to other estuaries worldwide, 4-NP levels in seawater (0.42±0.16 μg L(-1)) and sediment (53±14 ng g(-1) dw) of Morro Bay are low, but gobies and oysters have higher 4-NP levels than comparable fauna. Copyright © 2012 Elsevier Ltd. All rights reserved.

Using Streamflow and Stream Temperature to Assess the Potential Responses of Freshwater Fish to Climate Change

NASA Astrophysics Data System (ADS)

VanCompernolle, M.; Ficklin, D. L.; Knouft, J.

2017-12-01

Streamflow and stream temperature are key variables influencing growth, reproduction, and mortality of freshwater fish. Climate-induced changes in these variables are expected to alter the structure and function of aquatic ecosystems. Using Maxent, a species distribution model (SDM) based on the principal of maximum entropy, we predicted potential distributional responses of 100 fish species in the Mobile River Basin (MRB) to changes in climate based on contemporary and future streamflow and stream temperature estimates. Geologic, topographic, and landcover data were also included in each SDM to determine the contribution of these physical variables in defining areas of suitable habitat for each species. Using an ensemble of Global Climate Model (GCM) projections under a high emissions scenario, predicted distributions for each species across the MRB were produced for both a historical time period, 1975-1994, and a future time period, 2060-2079, and changes in total area and the percent change in historical suitable habitat for each species were calculated. Results indicate that flow (28%), temperature (29%), and geology (29%), on average, contribute evenly to determining areas of suitable habitat for fish species in the MRB, with landcover and slope playing more limited roles. Temperature contributed slightly more predictive ability to SDMs (31%) for the 77 species experiencing overall declines in areas of suitable habitat, but only 21% for the 23 species gaining habitat across all GCMs. Species are expected to lose between 15-24% of their historical suitable habitat, with threatened and endangered species losing 22-30% and those endemic to the MRB losing 19-28%. Sculpins (Cottidae) are expected to lose the largest amount of historical habitat (up to 84%), while pygmy sunfish (Elassomatidae) are expected to lose less than 1% of historical habitat. Understanding which species may be at risk of habitat loss under future projections of climate change can help fisheries managers better prepare for potential alterations in species composition not only within the MRB, but other watersheds throughout the world.

Thiamine and thiaminase status in forage fish of salmonines from Lake Michigan

USGS Publications Warehouse

Tillitt, D.E.; Zajicek, J.L.; Brown, S.B.; Brown, L.R.; Fitzsimons, J.D.; Honeyfield, D.C.; Holey, M.E.; Wright, G.M.

2005-01-01

Dietary sources of thiamine (vitamin B1) and thiamine-degrading enzymes (thiaminases) are thought to be primary factors in the development of thiamine deficiency among Great Lakes salmonines. We surveyed major forage fish species in Lake Michigan for their content of thiamine, thiamine vitamers, and thiaminase activity. Concentrations of total thiamine were similar (P ≤ 0.05) among most forage fishes (alewife Alosa pseudoharengus, bloater Coregonus hoyi, spottail shiner Notropis hudsonius, deepwater sculpin Myoxocephalus thompsonii, yellow perch Perca flavescens, ninespine stickleback Pungitius pungitius, and round goby Neogobius melanostomus) and slightly lower in rainbow smelt Osmerus mordax. Concentrations of total thiamine were all above the dietary requirements of coldwater fishes, suggesting the thiamine content of forage fish is not the critical factor in the development of thiamine deficiency in Lake Michigan salmonines. Thiamine pyrophosphate was the predominant form of thiamine in most species of forage fish, followed by free thiamine and thiamine monophosphate. Total thiamine was slightly greater in summer collections of alewife and rainbow smelt than in spring and fall collections, but the same was not true for bloater. Thiaminase activity varied among species and was greatest in gizzard shad Dorosoma cepedianum, spottail shiner, alewife, and rainbow smelt. Thiaminase activity in alewife varied among collection locations, season (greatest in spring), and size of the fish. Size and condition factors were positively correlated with both total thiamine and thiaminase activity in alewife. Thus, thiamine and thiaminase activity in forage fishes collected in Lake Michigan varied among species, seasons, year caught, and size (or condition). Therefore, multiple factors must be considered in the development of predictive models for the onset of thiamine deficiency in Great Lakes salmonines. Most importantly, thiaminase activity was great in alewives and rainbow smelt, suggesting that these prey fish are key causative factors of the thiamine deficiency in Great Lakes salmonines.

Linking mercury exposure to habitat and feeding behaviour in Beaufort Sea beluga whales

NASA Astrophysics Data System (ADS)

Loseto, L. L.; Stern, G. A.; Deibel, D.; Connelly, T. L.; Prokopowicz, A.; Lean, D. R. S.; Fortier, L.; Ferguson, S. H.

2008-12-01

Mercury (Hg) levels in the Beaufort Sea beluga population have been increasing since the 1990's. Ultimately, it is the Hg content of prey that determines beluga Hg levels. However, the Beaufort Sea beluga diet is not understood, and little is known about the diet Hg sources in their summer habitat. During the summer, they segregate into social groups based on habitat use leading to the hypothesis that they may feed in different food webs explaining Hg dietary sources. Methyl mercury (MeHg) and total mercury (THg) levels were measured in the estuarine-shelf, Amundsen Gulf and epibenthic food webs in the western Canadian Arctic collected during the Canadian Arctic Shelf Exchange Study (CASES) to assess their dietary Hg contribution. To our knowledge, this is the first study to report MeHg levels in estuarine fish and epibenthic invertebrates from the Arctic Ocean. Although the Mackenzie River is a large source of Hg, the estuarine-shelf prey items had the lowest MeHg levels, ranging from 0.1 to 0.27 μg/g dry weight (dw) in arctic cisco ( Coregonus autumnalis) and saffron cod ( Eleginus gracilis) respectively. Highest MeHg levels occurred in fourhorn sculpin ( Myoxocephalus quadricornis) (0.5 μg/g dw) from the epibenthic food web. Beluga hypothesized to feed in the epibenthic and Amundsen Gulf food webs had the highest Hg levels matching with high Hg levels in associated food webs, and estuarine-shelf belugas had the lowest Hg levels (2.6 μg/g dw), corresponding with the low food web Hg levels, supporting the variation in dietary Hg uptake. The trophic level transfer of Hg was similar among the food webs, highlighting the importance of Hg sources at the bottom of the food web as well as food web length. We propose that future biomagnification studies incorporate predator behaviour with food web structure to assist in the evaluation of dietary Hg sources.

Associations among fish assemblage structure and environmental variables in Willamette Basin streams, Oregon

USGS Publications Warehouse

Waite, I.R.; Carpenter, K.D.

2000-01-01

As part of the U.S. Geological Survey's National Water-Quality Assessment Program, fish were collected from 24 selected stream sites in the Willamette Basin during 1993-1995 to determine the composition of the fish assemblages and their relation to the chemical and physical environment. Variance in fish relative abundance was greater among all sites than among spatially distinct reaches within a site (spatial variation) or among multiple sampled years at a site (temporal variation). Therefore, data from a single reach in an individual year was considered to be a reliable estimator of the fish assemblage structure at a site when the data were normalized by percent relative abundance. Multivariate classification and ordination were used to examine patterns in environmental variables and fish relative abundance over differing spatial scales (among versus within ecoregions). Across all ecoregions (all sites), fish assemblages were primarily structured along environmental gradients of water temperature and stream gradient (coldwater, high-gradient forested sites versus warmwater, low-gradient Willamette Valley sites); this pattern superseded patterns that were ecoregion specific. Water temperature, dissolved oxygen, and physical habitat (e.g., riparian canopy and percent riffles) were associated with patterns of fish assemblages across all ecoregions; however, pesticide and total phosphorus concentrations were more important than physical habitat within the Willamette Valley ecoregion. Consideration of stream site stratification (e.g., stream size, ecoregion, and stream gradient), identification of fish to species level (particularly the sculpin family), and detailed measurement of habitat, diurnal dissolved oxygen, and water temperature were critical in evaluating the composition of fish assemblages in relation to land use. In general, these low-gradient valley streams typical of other agricultural regions had poor riparian systems and showed increases in water temperature, nutrients, and fine grain sediments that were associated with degradation in the native fish assemblages. There was an association of high abundances of introduced species and high percent external abnormalities in medium-sized river sites of mixed land use and high abundances of tolerant species in small streams of predominantly agricultural land use.

Increased piscivory by lake whitefish in Lake Huron

USGS Publications Warehouse

Pothoven, Steven A.; Madenjian, Charles P.

2013-01-01

We evaluated the diet of Lake Whitefish Coregonus clupeaformis in Lake Huron during 2002–2011 to determine the importance of Round Goby Neogobius melanostomus and other fish as prey items. Lake Whitefish that had reached approximately 400 mm in length incorporated fish into their diets. The overall percentage of adult Lake Whitefish in Lake Huron that had eaten fish increased from 10% in 2002–2006 to 20% in 2007–2011, with a corresponding decrease in the frequency of Lake Whitefish that ate Dreissena spp. from 52% to 33%. During 2002–2006, Round Goby (wet mass, 38%), sculpins (Cottidae) (34%), and Ninespine Stickleback Pungitius pungitius (18%) were the primary fish eaten, whereas Round Goby accounted for 92% of the fish eaten in 2007–2011. Overall, Round Goby were found in the fewest Lake Whitefish stomachs in the north region of Lake Huron (6%) and in the most in the central (23%) and south (19%) regions of the lake. In the central region, Round Goby were eaten during all seasons that were sampled (spring through fall). In the south region, Round Goby were eaten only in the winter and spring but not in the summer when Dreissena spp. and spiny water flea Bythotrephes longimanus dominated the diet. Based on the 2007–2011 diet composition, an individual Lake Whitefish would need to have increased their consumption relative to that in 1983–1994 by 6% in the north region, 12% in the central region, and 41% in the southern region in order to achieve the same growth that was observed before dreissenid mussels arrived. However, Lake Whitefish weight adjusted for length only increased by 2% between 2002–2006 and 2007–2011 in the central region, decreased by 4% in the northern region, and remained constant in the southern region. This suggests that a shift toward more frequent piscivory does not necessarily improve the condition of a generalist feeder like Lake Whitefish.

Heterosigma bloom and associated fish kill

USGS Publications Warehouse

Hershberger, P.K.; Rensel, J.E.; Postel, J.R.; Taub, F.B.

1997-01-01

A bloom of the harmful marine phytoplankton, Heterosigma carterae occurred in upper Case Inlet, south Puget Sound, Washington in late September, 1994, correlating with the presence of at least 35 dead salmon. This marks the first time that this alga has been closely correlated with a wild fish kill; in the past it was thought to be associated with kills of penned fish at fish farms only. We were informed of the presence of a possible harmful algal bloom and dead salinois Ilear the town of Allyn on 27 September and a team was formed to investigate. We arrived at the Allyn waterfront at 17:30 hours the same day. Prior to our arrival, state agency personnel walked approximatcly two miles of shoreline from the powerlines north of the dock, to the mouth of Sherwood Creek and conducted the only official count of dead fish present along the shore consisting of 12 coho salmon (Oncorhynchus kisutch), 11 chum salmon (Oncorhynchus keta), 12 chinook salmon (Oncorhynchus tschawytscha), one flat fish, and one sculpin on the morning of 9/27. Since previous harmful blooms of Heterosigma have resultedin the majority of net penreared salmon sinking to the bottom of pens, and only approximately two miles of shoreline were sampled, it is suspected that many more exposed fish may have succumbed than were counted. Witnesses who explored the east side of the bay reported seeing many dead salmon there as well, but no counts were made. State agency personnel who observed the fish kill reported seeing “dying fish coming to the beach, gulping at the surface, trying to get out of the water” Scavengers were seen consuming the salmon carcasses; these included two harbor seals, a house cat, and Hymenopteran insects. None suffered any noticeable acute ill effects. Although precise cause of death has not been ascertained, visual inspection of the reproductive organs from a deceased male chum salmon found on the shore at Allyn confirmed that the fish was not yet reproductively mature and therefore did not die from completion of the spawning process.

Monitoring marine heavy metal contamination via the chemical analysis of foraminifera and growth increments in bivalves - a pilot study from a Pb and Zn mining region in western Greenland

NASA Astrophysics Data System (ADS)

Jessen, C.; Asmund, G.; Elberling, B.; Frei, D.; Knudsen, C.; Rasmussen, P.

2011-12-01

Annual monitoring of heavy metal concentrations in the fjords (sea water, seaweed, lichens, blue mussels, shorthorn sculpin and Northern prawn) adjacent to the Black Angel lead-zinc mine (active 1973-1990) at Maarmorilik, western Greenland was initiated during operation of the mine and continues through to today. This pilot study tests whether the calcareous shells of bivalves and foraminifera register these known variations in heavy metal concentrations. Live individuals of Mytilus edulis were collected through a transect of monitoring stations in 2009 and PB-Zn concentrations were measured at multiple points within the yearly increments using LA-ICP-MS. Individuals aged between 12 and 28 years were measured and demonstrated a clear signal of mine closure even at 40 km distance from the plant. Foraminifera (Melonis barleeanus) from a sediment core dating from 1880 AD to present have previously been shown to display a greater percentage of deformities during the period of mining activity (Elberling et al. 2003) possibly suggesting a correlation between heavy metal concentrations in sea water and morphological development. LA-ICP-MS analysis of individual foraminifera confirms an increase in Pb-Zn uptake during mining operations. Although it could therefore be expected that Pb-Zn concentrations would be enhanced in the 'deformed' foraminifera relative to the 'non-deformed', no difference in Pb-Zn was concentrations was detected. This short pilot study (Jessen et al.2010) demonstrates the potential of calcareous material as indicators of environmental pollution and their applicability as a monitoring tool in remote regions. Jessen CA, Asmund G, Elberling B, Frei D, Knudsen C and Rasmussen P. 2010 Monitoring marine heavy metal contamination via the chemical analysis of growth increments in bivalves - a pilot study. Danmarks og Grønlands Geologiske Undersøgelse Rapport 2010/86. 1-20 Elberling, B., Knudsen, K. L., Kristensen, P. H., and Asmund, G. (2003) Applying foraminiferal stratigraphy as a biomarker for heavy metal contamination and mining impact in a fiord in West Greenland. Marine Environmental Research 55, 235-256

The fishes of Pea Ridge National Military Park, Arkansas, 2003

USGS Publications Warehouse

Justus, B.G.; Petersen, James C.

2005-01-01

A fish inventory was conducted at Pea Ridge National Military Park, Arkansas, during base-flow conditions in September 2003. Six sites including four streams and two ponds were sampled using conventional electrofishing equipment (a seine also was used at one site). There were 653 individuals collected comprising 18 species (plus 1 hybrid) and 15 genera. The number of species collected at the four stream sites ranged from 1 16. Most fish species collected generally are associated with small streams in the Ozark Plateaus. The two most common species were the banded sculpin and the southern redbelly dace. Three species and a sunfish hybrid were collected from the quarry pond. No fish were collected from the unnamed pond. A preliminary expected species list incorrectly listed 42 species because of incorrect species range or habitat requirements. One species not on the original list was added to the revised list. Upon revising this list, the inventory yielded 18 the 40 species (45 percent) and 1 hybrid. No previous fish inventories have been completed for park but some observations can be made relative to species distributions. There were only five fish species collected in three headwater streams, and it is unlikely that many other species would occur in these three streams because of constraints imposed on the fish community by stream size. Little Sugar Creek, a medium-sized stream, had the most species collected, and it is likely that additional species would be collected from this stream if additional sampling were to occur. Distribution records indicate that all 18 species occur in the general area. Although no species collected in this study are federallylisted threatened or endangered species, three species collected at Pea Ridge National Military Park may be of some special interest to National Park Service managers and others. Two the species collected (cardinal shiner and stippled darter) are endemic to the Ozark Plateaus; both are rather common in certain parts of the Ozark Plateaus. The white sucker has a restricted range in Arkansas because northern Arkansas is at southern edge of the white sucker's distributional range.

Evidence for glutamatergic mechanisms in the vagal sensory pathway initiating cardiorespiratory reflexes in the shorthorn sculpin Myoxocephalus scorpius.

PubMed

Sundin, L; Turesson, J; Taylor, E W

2003-03-01

Glutamate is a major neurotransmitter of chemoreceptor and baroreceptor afferent pathways in mammals and therefore plays a central role in the development of cardiorespiratory reflexes. In fish, the gills are the major sites of these receptors, and, consequently, the terminal field (sensory area) of their afferents (glossopharyngus and vagus) in the medulla must be an important site for the integration of chemoreceptor and baroreceptor signals. This investigation explored whether fish have glutamatergic mechanisms in the vagal sensory area (Xs) that could be involved in the generation of cardiorespiratory reflexes. The locations of the vagal sensory and motor (Xm) areas in the medulla were established by the orthograde and retrograde axonal transport of the neural tract tracer Fast Blue following its injection into the ganglion nodosum. Glutamate was then microinjected into identified sites within the Xs in an attempt to mimic chemoreceptor- and baroreceptor-induced reflexes commonly observed in fish. By necessity, the brain injections were performed on anaesthetised animals that were fixed by 'eye bars' in a recirculating water system. Blood pressure and heart rate were measured using an arterial cannula positioned in the afferent branchial artery of the 3rd gill arch, and ventilation was measured by impedance probes sutured onto the operculum. Unilateral injection of glutamate (40-100 nl, 10 mmol l(-1)) into the Xs caused marked cardiorespiratory changes. Injection (0.1-0.3 mm deep) in different rostrocaudal, medial-lateral positions induced a bradycardia, either increased or decreased blood pressure, ventilation frequency and amplitude and, sometimes, an initial apnea. Often these responses occurred simultaneously in various different combinations but, occasionally, they appeared singly, suggesting specific projections into the Xs for each cardiorespiratory variable and local determination of the modality of the response. Response patterns related to chemoreceptor reflex activation were predominantly located rostral of obex, whereas patterns related to baroreceptor reflex activation were more caudal, around obex. The glutamate-induced bradycardia was N-methyl-D-aspartate (NMDA) receptor dependent and atropine sensitive. Taken together, our data provide evidence that glutamate is a putative player in the central integration of chemoreceptor and baroreceptor information in fish.

Relative impacts of the fragmentation and spatial structure of habitats on freshwater fish distributions: application on French watersheds (Invited)

NASA Astrophysics Data System (ADS)

Le Pichon, C.; Belliard, J.; Talès, E.; Gorges, G.; Clément, F.

2009-12-01

Most of the rivers of the Ile de France region, intimately linked with the megalopolis of Paris, are severely altered and freshwater fishes are exposed to habitat alteration, reduced connectivity and pollution. Several species thus present fragmented distributions and decreasing densities. In this context, the European Water Framework Directive (2000) has goals of hydrosystems rehabilitation and no further damage. In particular, the preservation and restoration of ecological connectivity of river networks is a key element for fish populations. These goals require the identification of natural and anthropological factors which influence the spatial distribution of species. We have proposed a riverscape approach, based on landscape ecology concepts, combined with a set of spatial analysis methods to assess the multiscale relationships between the spatial pattern of fish habitats and processes depending on fish movements. In particular, we used this approach to test the relative roles of spatial arrangement of fish habitats and the presence of physical barriers in explaining fish spatial distributions in a small rural watershed (106 km2). We performed a spatially continuous analysis of fish-habitat relationships. Fish habitats and physical barriers were mapped along the river network (33 km) with a GPS and imported into a GIS. In parallel, a longitudinal electrofishing survey of the distribution and abundance of fishes was made using a point abundance sampling scheme. Longitudinal arrangement of fish habitats were evaluated using spatial analysis methods: patch/distance metrics and moving window analysis. Explanatory models were developed to test the relative contribution of local environmental variables and spatial context in explaining fish presence. We have recorded about 100 physical barriers, on average one every 330 meters; most artificial barriers were road pipe culverts, falls associated with ponds and sluice gates. Contrasted fish communities and densities were observed in the different areas of the watershed, related to various land use (riparian forest or agriculture). The first results of fish-habitat association analysis on a 5 km stream are that longitudinal distribution of fish species was mainly impacted by falls associated with ponds. The impact was both due to the barrier effect and to the modification of aquatic habitats. Abundance distribution of Salmo trutta and Cottus gobio was particularly affected. Spatially continuous analysis of fish-habitat relationships allowed us to identify the relative impacts of habitat alteration and presence of physical barriers to fish movements. These techniques could help prioritize preservation and restoration policies in human-impacted watersheds, in particular, identifying the key physical barriers to remove.

Defining environmental flows requirements at regional scale by using meso-scale habitat models and catchments classification

NASA Astrophysics Data System (ADS)

Vezza, Paolo; Comoglio, Claudio; Rosso, Maurizio

2010-05-01

The alterations of the natural flow regime and in-stream channel modification due to abstraction from watercourses act on biota through an hydraulic template, which is mediated by channel morphology. Modeling channel hydro-morphology is needed in order to evaluate how much habitat is available for selected fauna under specific environmental conditions, and consequently to assist decision makers in planning options for regulated river management. Meso-scale habitat modeling methods (e.g., MesoHABSIM) offer advantages over the traditional physical habitat evaluation, involving a larger range of habitat variables, allowing longer length of surveyed rivers and enabling understanding of fish behavior at larger spatial scale. In this study we defined a bottom-up method for the ecological discharge evaluation at regional scale, focusing on catchments smaller than 50 km2, most of them located within mountainous areas of Apennines and Alps mountain range in Piedmont (NW Italy). Within the regional study domain we identified 30 representative catchments not affected by water abstractions in order to build up the habitat-flow relationship, to be used as reference when evaluating regulated watercourses or new projects. For each stream we chose a representative reach and obtained fish data by sampling every single functional habitat (i.e. meso-habitat) within the site, keeping separated each area by using nets. The target species were brown trout (Salmo trutta), marble trout (Salmo trutta marmoratus), bullhead (Cottus gobius), chub (Leuciscus cephalus), barbel (Barbus barbus), vairone (Leuciscus souffia) and other rheophilic Cyprinids. The fish habitat suitability criteria was obtained from the observation of habitat use by a selected organism described with a multivariate relationship between habitat characteristics and fish presence. Habitat type, mean slope, cover, biotic choriotop and substrate, stream depth and velocity, water pH, temperature and percentage of dissolved oxygen were collected for each sampled area and considered as independent variables. According to the MesoHABSIM method, we performed a stepwise forward logistic regression in order to build up a biological model identifying the habitat characteristics mostly used by a target fish. For each stream we predicted changes in habitat area over a range of discharges by building the habitat-flow rating curves. Finally, in order to define a regional criteria needed to fulfill environmental flow requirements, we split the study domain according to the regression tree classification criterion defining homogenous sub-regions distinct on both environmental flows and catchment characteristics.

Changes in stream chemistry and biology in response to reduced levels of acid deposition during 1987-2003 in the Neversink River Basin, Catskill Mountains

USGS Publications Warehouse

Burns, Douglas A.; Riva-Murray, K.; Bode, R.W.; Passy, S.

2008-01-01

Atmospheric acid deposition has decreased in the northeastern United States since the 1970s, resulting in modest increases in pH, acid-neutralizing capacity (ANC), and decreases in inorganic monomeric aluminum (AlIM) concentrations since stream chemistry monitoring began in the 1980s in the acid-sensitive upper Neversink River basin in the Catskill Mountains of New York. Stream pH has increased by 0.01 units/year during 1987-2003 at three sites in the Neversink basin as determined by Seasonal Kendall trend analysis. In light of this observed decrease in stream acidity, we sampled 12 stream sites within the Neversink River watershed for water chemistry, macroinvertebrates, fish, and periphytic diatoms in 2003 to compare with a similar data set collected in 1987. Metrics and indices that reflect sensitivity to stream acidity were developed with these biological data to determine whether changes in stream biota over the intervening 16 years parallel those of stream chemistry. Statistical comparisons of data on stream chemistry and an acid biological assessment profile (Acid BAP) derived from invertebrate data showed no significant differences between the two years. For pH and ANC, however, values in 2003 were generally lower than those in 1987; this difference likely resulted from higher streamflow in summer 2003. Despite these likely flow-induced changes in summer 2003, an ordination and cluster analysis of macroinvertebrate taxa based on the Acid BAP indicated that the most acidic sites in the upstream half of the East Branch Neversink River form a statistically significant separate cluster consistent with less acidic stream conditions. This analysis is consistent with limited recovery of invertebrate species in the most acidic reaches of the river, but will require additional improvement in stream chemistry before a stronger conclusion can be drawn. Data on the fish and periphytic diatom communities in 2003 indicate that slimy sculpin had not extended their habitat to upstream reaches that previously were devoid of this acid-intolerant species in 1987; a diatom acid-tolerance index indicates continued high-acid impact throughout most of the East Branch and headwaters of the West Branch Neversink River. ?? 2007 Elsevier Ltd. All rights reserved.

Sustainability of the Lake Superior fish community: Interactions in a food web context

USGS Publications Warehouse

Kitchell, James F.; Cox, Sean P.; Harvey, Chris J.; Johnson, Timothy B.; Mason, Doran M.; Schoen, Kurt K.; Aydin, Kerim; Bronte, Charles; Ebener, Mark; Hansen, Michael; Hoff, Michael; Schram, Steve; Schreiner, Don; Walters, Carl J.

2000-01-01

The restoration and rehabilitation of the native fish communities is a long-term goal for the Laurentian Great Lakes. In Lake Superior, the ongoing restoration of the native lake trout populations is now regarded as one of the major success stories in fisheries management. However, populations of the deepwater morphotype (siscowet lake trout) have increased much more substantially than those of the nearshore morphotype (lean lake trout), and the ecosystem now contains an assemblage of exotic species such as sea lamprey, rainbow smelt, and Pacific salmon (chinook, coho, and steelhead). Those species play an important role in defining the constraints and opportunities for ecosystem management. We combined an equilibrium mass balance model (Ecopath) with a dynamic food web model (Ecosim) to evaluate the ecological consequences of future alternative management strategies and the interaction of two different sets of life history characteristics for fishes at the top of the food web. Relatively rapid turnover rates occur among the exotic forage fish, rainbow smelt, and its primary predators, exotic Pacific salmonids. Slower turnover rates occur among the native lake trout and burbot and their primary prey—lake herring, smelt, deepwater cisco, and sculpins. The abundance of forage fish is a key constraint for all salmonids in Lake Superior. Smelt and Mysis play a prominent role in sustaining the current trophic structure. Competition between the native lake trout and the exotic salmonids is asymmetric. Reductions in the salmon population yield only a modest benefit for the stocks of lake trout, whereas increased fishing of lake trout produces substantial potential increases in the yields of Pacific salmon to recreational fisheries. The deepwater or siscowet morphotype of lake trout has become very abundant. Although it plays a major role in the structure of the food web it offers little potential for the restoration of a valuable commercial or recreational fishery. Even if a combination of strong management actions is implemented, the populations of lean (nearshore) lake trout cannot be restored to pre-fishery and pre-lamprey levels. Thus, management strategy must accept the ecological constraints due in part to the presence of exotics and choose alternatives that sustain public interest in the resources while continuing the gradual progress toward restoration.

The fishes of Buffalo National River, Arkansas, 2001-2003

USGS Publications Warehouse

Petersen, James C.; Justus, B.G.

2005-01-01

During June through September 2001 and 2002, extensive fish community sampling was conducted at 29 sites within the boundaries of Buffalo National River. Samples were collected using backpack, tote barge, and boat electrofishing equipment. Kick seining also was used at all sites. To supplement these results, samples were collected in 2003 from less typical habitats and during other seasons of the year. Ten supplemental samples were collected from the Buffalo River and five samples were collected from tributaries of the Buffalo River. During the 3 years of sampling, 66 species of fish were collected or observed from the 42 sampling sites. Stonerollers, duskystripe shiners, longear sunfish, and rainbow darters were among the more abundant fish species at most sites. Each of these species is common and abundant throughout much of the Ozark Plateaus in creeks and small rivers. Other species (for example, banded sculpin, southern redbelly dace, orangethroat darter, and Ozark minnow) were among the more abundant species at other sites. These species prefer small- to medium-sized, springfed streams or small creeks. A preliminary list of species expected to occur at Buffalo National River provided by the National Park Service incorrectly listed 47 species because of incorrect species range or habitat requirements. Upon revising this list, the inventory yielded 66 of the 78 species (85 percent). Twelve additional species not collected in 2001-2003 may occur at Buffalo National River for two primary reasons--because the species had been collected previously at the park, or because the park occurs within the known species range and habitats found at the park are suitable for the species. Although no fish species collected from Buffalo National River are federally-listed threatened or endangered species, several species collected at Buffalo National River may be of special interest to National Park Service managers and others. Ten species are endemic to the Ozark Plateaus area and most of these ten are restricted to the White River Basin. For some species the Buffalo River is a population stronghold. The yoke darter and Ozark bass are especially abundant in the Buffalo River. In Arkansas, the Ozark shiner is most abundant in the Buffalo River and, although populations of Ozark shiners are declining in Arkansas, this is not typically the case in the Buffalo River. Data from 2001-2003 indicate that gilt darters currently (2005) are less common in the Buffalo River than during the 1970's. Populations of channel catfish (and any other fish species whose movements are inhibited by the cold water temperatures of the White River) may continue to decline without remedial efforts.

Taxonomic revision of Afrotropical Laccophilus Leach, 1815 (Coleoptera, Dytiscidae)

PubMed Central

Biström, Olof; Nilsson, Anders N.; Bergsten, Johannes

2015-01-01

Abstract The African species of the genus Laccophilus Leach, 1815, are revised, on the basis of study of adult specimens. In all, 105 species are now recognized. A phenetic character-analysis was undertaken, which resulted in a split of the genus into 17 species groups. Diagnoses and a description of each species are given together with keys for identification of species groups and species. We also provide habitus photos, illustration of male genitalia and distribution maps for all species. New species are described as follows: Laccophilus grossus sp. n. (Angola, Namibia), Laccophilus rocchii sp. n. (Tanzania, Namibia, Botswana, Mozambique), Laccophilus ferrugo sp. n. (Mozambique), Laccophilus furthi sp. n. (Madagascar), Laccophilus isamberti sp. n. (Madagascar), Laccophilus inobservatus sp. n. (Gambia, Senegal, Mali, Niger, Sudan, Chad, Ethiopia, Burkina Faso, Ivory Coast, Ghana, Nigeria, Cameroon, Zaire and Asia: Yemen), Laccophilus cryptos sp. n. (Zaire, Mozambique, Zimbabwe, Namibia, Botswana, South Africa), Laccophilus enigmaticus sp. n. (Nigeria, Sudan), Laccophilus bellus sp. n. (Benin, Nigeria), Laccophilus guentheri sp. n. (Guinea, Ghana), Laccophilus guineensis sp. n. (Guinea), Laccophilus decorosus sp. n. (Uganda), Laccophilus empheres sp. n. (Kenya), Laccophilus inconstans sp. n. (Guinea, Ivory Coast, Ghana, Nigeria, Cameroon), Laccophilus brancuccii sp. n. (Central African Republic), Laccophilus incomptus sp. n. (Cameroon), Laccophilus australis sp. n. (Tanzania, South Africa), Laccophilus minimus sp. n. (Namibia), Laccophilus eboris sp. n. (Ivory Coast), Laccophilus insularum sp. n. (Madagascar), Laccophilus occidentalis sp. n. (Gambia, Senegal, Mali, Guinea, Sierra Leone, Ivory Coast, Ghana, Benin, Nigeria, Central African Republic, Zaire) and Laccophilus transversovittatus sp. n. (Madagascar). Laccophilus restrictus Sharp, 1882, is restored as good species; not junior synonym of Laccophilus pictipennis Sharp, 1882. New synonyms are established as follows: Laccophilus continentalis Gschwendtner, 1935 = Laccophilus perplexus Omer-Cooper, 1970, syn. n., Laccophilus taeniolatus Régimbart, 1889 = Laccophilus congener Omer-Cooper, 1957, syn. n., Laccophilus adspersus Boheman, 1848 = Laccophilus vitshumbii Guignot, 1959, syn. n. = Laccophilus adspersus nigeriensis Omer-Cooper, 1970, syn. n. = Laccophilus adspersus sudanensis Omer-Cooper, 1970, syn. n., Laccophilus modestus Régimbart, 1895 = Laccophilus espanyoli Hernando, 1990, syn. n., Laccophilus flaveolus Régimbart, 1906 = Laccophilus pampinatus Guignot, 1941, syn. n., Laccophilus trilineola Régimbart, 1889 = Laccophilus simulator Omer-Cooper, 1958, syn. n., Laccophilus mediocris Guignot, 1952 = Laccophilus meii Rocchi, 2000, syn. n., Laccophilus epinephes Guignot, 1955 = Laccophilus castaneus Guignot, 1956, syn. n., Laccophilus saegeri Guignot, 1958 = Laccophilus comoensis Pederzani & Reintjes, 2002, syn. n., Laccophilus restrictus Sharp, 1882 = Laccophilus evanescens Régimbart, 1895, syn. n., Laccophilus incrassatus Gschwendtner, 1933 = Laccophilus virgatus Guignot, 1953, syn. n., Laccophilus cyclopis Sharp, 1882 = Laccophilus shephardi Omer-Cooper, 1965, syn. n., Laccophilus burgeoni Gschwendtner, 1930 = Laccophilus wittei Guignot, 1952, syn. n., Laccophilus secundus Régimbart, 1895 = Laccophilus torquatus Guignot, 1956, syn. n., Laccophilus desintegratus Régimbart, 1895 = Laccophilus sanguinosus Régimbart, 1895, syn. n. and Laccophilus flavopictus Régimbart, 1889 = Laccophilus bergeri Guignot, 1953, syn. n. = Laccophilus segmentatus Omer-Cooper, 1957, syn. n. Lectotypes are designated for the following taxa: Laccophilus productus Régimbart, 1906, Laccophilus ruficollis Zimmermann, 1919, Laccophilus sordidus Sharp, 1882, Laccophilus alluaudi Régimbart, 1899, Laccophilus pictipennis Sharp, 1882, Laccophilus wehnckei Sharp, 1882, Laccophilus continentalis Gschwendtner, 1935, Laccophilus simplicistriatus Gschwendtner, 1932, Laccophilus complicatus Sharp, 1882, Laccophilus rivulosus Klug, 1833, Laccophilus ampliatus Régimbart, 1895, Laccophilus pilitarsis Régimbart, 1906, Laccophilus adspersus Boheman, 1848, Laccophilus livens Régimbart, 1895, Laccophilus modestus Régimbart, 1895, Laccophilus nodieri Régimbart, 1895, Laccophilus flaveolus Régimbart, 1906, Laccophilus pallescens Régimbart, 1903, Laccophilus restrictus Sharp, 1882, Laccophilus vermiculosus Gerstaecker, 1867, Laccophilus mocquerysi Régimbart, 1895, Laccophilus bizonatus Régimbart, 1895, Laccophilus tschoffeni Régimbart, 1895, Laccophilus persimilis Régimbart, 1895, Laccophilus poecilus Klug, 1834, Laccophilus lateralis Sharp, 1882, Laccophilus lateralis var. polygrammus Régimbart, 1903, Laccophilus cyclopis Sharp, 1882, Laccophilus shephardi Omer-Cooper, 1965, Laccophilus conjunctus Guignot, 1950, Laccophilus grammicus Sharp, 1882, Laccophilus flavoscriptus Régimbart, 1895, Laccophilus flavosignatus Régimbart, 1895, Laccophilus brevicollis Sharp, 1882, Laccophilus secundus Régimbart, Laccophilus desintegratus Régimbart, 1895, Laccophilus gutticollis Régimbart, 1895, Laccophilus luctuosus Sharp, 1882 and Laccophilus inornatus Zimmermann, 1926. Laccophilus remex Guignot, 1952, comprises a species complex with uncertain taxonomic delimitation; the complex includes Laccophilus concisus Guignot, 1953, Laccophilus turneri Omer-Cooper, 1957 and Laccophilus praeteritus Omer-Cooper, 1957, as tentative synonyms of Laccophilus remex Guignot, 1952. PMID:26798285

Mercury levels and potential risk from subsistence foods from the Aleutians.

PubMed

Burger, Joanna; Gochfeld, Michael; Jeitner, Christian; Burke, Sean; Stamm, Tim; Snigaroff, Ronald; Snigaroff, Dan; Patrick, Robert; Weston, Jim

2007-10-01

Considerable attention has been devoted to contaminants (mainly PCBs and mercury) in subsistence foods (particularly fish) from various parts of the world. However, relatively little attention has been devoted to examining mercury levels in a full range of subsistence foods from a particular region. While managers and scientists compute risk based on site-specific data on contaminant levels and consumption rates, a first step in making risk decisions by subsistence peoples is knowledge about the relative levels of mercury in the foods they eat. This study examined levels of mercury in subsistence foods (edible components) from several islands in the western Aleutians of Alaska, including algae (4 species), invertebrates (9 species), fish (15 species) and birds (5 species). Samples were gathered by both subsistence hunters/fishers and by scientists using the same equipment. Another objective was to determine if there were differences in mercury levels in subsistence foods gathered from different Aleutian islands. We tested the null hypotheses that there were no interspecific and interisland differences in mercury levels. Because of variation in distribution and the nature of subsistence hunting and fishing, not all organisms were collected from each of the islands. There were significant and important differences in mercury levels among species, but the locational differences were rather small. There was an order of magnitude difference between algae/some invertebrates and fish/birds. Even within fish, there were significant differences. The highest mean mercury levels were in flathead sole (Hippoglossoides elassodon, 0.277 ppm), yellow irish lord (Hemilepidotus jardani, 0.281 ppm), great sculpin (Myoxocephalus polyacanthocephalus, 0.366 ppm), glaucous-winged gull (Larus glaucescens, 0.329 ppm) and its eggs (0.364 ppm), and pigeon guillemot (Cepphus columba, 0.494 ppm). Mercury levels increased with increasing weight of the organisms for limpets (Tectura scutum), and for 11 of the 15 fish species examined. Nine of the 15 fish species had some samples over the 0.3 ppm level, and 7 of 15 fish had some samples over 0.5 ppm. For birds, 95% of the pigeon guillemot muscle samples were above the 0.3 ppm, and 43% were above 0.5 ppm. While health professionals may argue about the risk and benefits of eating fish, and of eating alternative protein sources, the public should be provided with enough information for them to make informed decisions. This is particularly true for subsistence people who consume large quantities of self-caught foods, particularly for sensitive sub-populations, such as pregnant women. We argue that rather than giving people blanket statements about the health benefits or risks from eating fish, information on mean and maximum mercury levels should also be provided on a wide range of subsistence foods, allowing informed decisions, especially by those most at risk.

Effects of recent decreases in arctic sea ice on an ice-associated marine bird

NASA Astrophysics Data System (ADS)

Divoky, George J.; Lukacs, Paul M.; Druckenmiller, Matthew L.

2015-08-01

Recent major reductions in summer arctic sea ice extent could be expected to be affecting the distributions and life histories of arctic marine biota adapted to living adjacent to sea ice. Of major concern are the effects of ice reductions, and associated increasing SST, on the most abundant forage fish in the Arctic, Arctic cod (Boreogadus saida), the primary prey for the region's upper trophic level marine predators. The black guillemot (Cepphus grylle mandtii) is an ice-obligate diving seabird specializing in feeding on Arctic cod and has been studied annually since 1975 at a breeding colony in the western Beaufort Sea. The data set is one of the few allowing assessment of the response of an upper trophic marine predator to recent decadal changes in the region's cryosphere. Analysis of oceanographic conditions north of the colony from 1975 to 2012 for the annual period when parents provision young (mid-July to early September), found no major regime shifts in ice extent or SST until the late 1990s with major decreases in ice and increases in SST in the first decade of the 21st Century. We examined decadal variation in late summer oceanographic conditions, nestling diet and success, and overwinter adult survival, comparing a historical period (1975-1984) with a recent (2003-2012) one. In the historical period sea ice retreated an average of 1.8 km per day from 15 July to 1 September to an average distance of 95.8 km from the colony, while in the recent period ice retreat averaged 9.8 km per day to an average distance of 506.9 km for the same time period. SST adjacent to the island increased an average of 2.9 °C between the two periods. While Arctic cod comprised over 95% of the prey provided to nestlings in the historical period, in the recent period 80% of the years had seasonal decreases, with Arctic cod decreasing to <5% of the nestling diet, and nearshore demersals, primarily sculpin (Cottidae), comprising the majority of the diet. A five-fold increase in the rate of nestling starvation and reductions in nestling growth and fledging mass were associated with the shift from Arctic cod. Annual adult survival during the nonbreeding season (September-May), showed no significant difference between the two periods, indicating no major change in availability of Arctic cod or other prey in the wintering area in the Bering Sea. Our findings of a substantial decrease in Arctic cod availability in late summer in response to decreased ice extent and increasing SST have implications for the entire Arctic given the ongoing and predicted basin-wide reductions in sea ice.

Mercury in Sediment, Water, and Biota of Sinclair Inlet, Puget Sound, Washington, 1989-2007

USGS Publications Warehouse

Paulson, Anthony J.; Keys, Morgan E.; Scholting, Kelly L.

2010-01-01

Historical records of mercury contamination in dated sediment cores from Sinclair Inlet are coincidental with activities at the U.S. Navy Puget Sound Naval Shipyard; peak total mercury concentrations occurred around World War II. After World War II, better metallurgical management practices and environmental regulations reduced mercury contamination, but total mercury concentrations in surface sediment of Sinclair Inlet have decreased slowly because of the low rate of sedimentation relative to the vertical mixing within sediment. The slopes of linear regressions between the total mercury and total organic carbon concentrations of sediment offshore of Puget Sound urban areas was the best indicator of general mercury contamination above pre-industrial levels. Prior to the 2000-01 remediation, this indicator placed Sinclair Inlet in the tier of estuaries with the highest level of mercury contamination, along with Bellingham Bay in northern Puget Sound and Elliott Bay near Seattle. This indicator also suggests that the 2000/2001 remediation dredging had significant positive effect on Sinclair Inlet as a whole. In 2007, about 80 percent of the area of the Bremerton naval complex had sediment total mercury concentrations within about 0.5 milligrams per kilogram of the Sinclair Inlet regression. Three areas adjacent to the waterfront of the Bremerton naval complex have total mercury concentrations above this range and indicate a possible terrestrial source from waterfront areas of Bremerton naval complex. Total mercury concentrations in unfiltered Sinclair Inlet marine waters are about three times higher than those of central Puget Sound, but the small numbers of samples and complex physical and geochemical processes make it difficult to interpret the geographical distribution of mercury in marine waters from Sinclair Inlet. Total mercury concentrations in various biota species were compared among geographical locations and included data of composite samples, individual specimens, and caged mussels. Total mercury concentrations in muscle and liver of English sole from Sinclair Inlet ranked in the upper quarter and third, respectively, of Puget Sound locations. For other species, concentrations from Sinclair Inlet were within the mid-range of locations (for example, Chinook salmon). Total mercury concentrations of the long-lived and higher trophic rockfish in composites and individual specimens from Sinclair Inlet tended to be the highest in Puget Sound. For a given size, sand sole, graceful crab, staghorn sculpin, surf perch, and sea cucumber individuals collected from Sinclair Inlet had higher total mercury concentrations than individuals collected from non-urban estuaries. Total mercury concentrations in individual English sole and ratfish were not significantly different than in individuals of various sizes collected from either urban or non-urban estuaries in Puget Sound. Total mercury concentrations in English sole collected from Sinclair Inlet after the 2000-2001 dredging appear to have lower total mercury concentrations than those collected before (1996) the dredging project. The highest total mercury concentrations of mussels caged in 2002 were not within the Bremerton naval complex, but within the Port Orchard Marina and inner Sinclair Inlet.

Hydroclimatic alteration increases vulnerability of montane meadows in the Sierra Nevada, California

NASA Astrophysics Data System (ADS)

Viers, J. H.; Peek, R.; Purdy, S. E.; Emmons, J. D.; Yarnell, S. M.

2012-12-01

Meadow ecosystems of the Sierra Nevada (California, USA) have been maintained by the interplay of biotic and abiotic forces, where hydrological functions bridge aquatic and terrestrial realms. Meadows are not only key habitat for fishes, amphibians, birds, and mammals alike, but also provide enumerable ecosystem services to humans, not limited to regulating services (eg, water filtration), provisioning services (eg, grazing), and aesthetics. Using hydroclimatic models and spatial distribution models of indicator species, a range wide assessment was conducted to assess and synthesize the vulnerability of meadow ecosystems to hydroclimatic alteration, a result of regional climate change. Atmospheric warming is expected to result in a greater fraction of total precipitation falling as winter rain (rather than snow) and earlier snowmelt. These predicted changes will likely cause more precipitation-driven runoff in winter and reduced snowmelt runoff in spring, leading to reduced annual runoff and a general shift in runoff timing to earlier in the year. These profound effects have consequences for hydrological cycling and meadow functioning, though such changes will not occur steadily through time or uniformly across the range, and each individual meadow will respond as a function of its composition and land use history. Most vulnerable is groundwater recharge, a fundamental component of meadow hydrology. As a result of shortened snow melt period and absence of diel snowmelt fluxes that would otherwise gradually refill meadow aquifers, recharge is expected to decline due to less infiltration. Diminished water tables will likely stress hydric and mesic vegetation, promoting more xeric conditions. Coupled with greater magnitude stream flows, these conditions promote channel incision and ultimate state shift to non-meadow conditions. The biological effects of hydroclimatic alteration, such as lower mean annual flow and earlier timing, will result in an overall decrease in available habitat for aquatic species, particularly for cold water fishes (ie, salmonids and sculpins). Earlier timing and longer low flow duration will force aquatic biota to withstand more days at thermally challenging temperatures, potentially promoting non-native species. Decreased mean annual flow, less overall snow volume, and warmer daily air temperatures will potentially decrease the number of days of standing water available for amphibian reproduction. A core strategy for maintaining meadow ecosystems, ecosystem services, and dependent biodiversity is to reduce vulnerabilities, such as unstable stream banks that promote cycles of incision, and increase resilience to disturbance, such as actively removing encroaching vegetation that can overtap water tables and build up wildfire fuels. Reducing meadow vulnerability to hydroclimatic alteration and ensuring sustained ecosystem services will require active ecosystem management (ie, managed for indicator species, but with focus on hydrological functioning); coordinated hydrological management (ie, conservation action and removal of stressors coordinated across all ownerships and management regimes); and effective communication to minimize human activities that reduce resilience, as well as improve human

[Historical review of insulin and its preparations in pharmacopoeia (3). Fish insulins].

PubMed

Suehiro, M

1992-01-01

Existence of encapsulated glands situated in the mesentery of certain teleosti was reported by Brockmann (1846) and Stannius (1848), respectively. Thus the gland was named stannius corpuscle or Brockmann body. Later, as results of histological study, cells of stannius corpuscle tissues were constituted with Langerhans islet cells observed in mammalian pancreas by Diammare (1899) and Laguesse (1906). Thus, before the days of discovery of insulin by Banting and Best in 1921, stannius corpuscle has been interesting from the aspects of comparative anatomy and physiology. Rennie (1906) examined a large number of specimens in various species of teleosti and gave the term "principal islet" to easily recognizable stannius corpuscle. Osawa studied comparative anatomy in Freiburg and returned to Tokyo. He continued the study of comparative anatomy of Langerhans islet aand published a report on observation of "principal islet" of flatfish, limanda yokohamae Gth. in 1912 in Japanese. His report seemed to be a milestone of studies of fish insulin in Japan. Macleod attempted to demonstrate direct evidence on secretion of insulin from Langerhans islet cells. Experiments were made on extraction of "principal islet" of teleosti, angler Lophius) and sculpin (Myoxocephalus) to obtain insulin and demonstrated activity. No insulin activity was obtained from pancreatic tissues constituted with acinar cells of these fishes. In the case of elasmobranch, Langerhans islets are not separated, but potent insulin could be extracted from the pancreas. His report published in 1922 was the first report on fish insulin. Succeeding to Macleod's report, several reports on fish insulin were contnributed from Canada, England and U.S.A. until 1929. Dr. Kkumagai, Professor of Internal Medicine, Tohoku Imperial University (Sendai) also conducted the studies on extraction of active principle of pancreas since 1920, independently. But, a Toronto group reached the goal on discovery of insulin earlier than the Sendai group. The Sendai group also described extraction of active principle from the "principal islet" of teleosti. Especially, Ukai (1926) described morphological study on pancreas and stannius corpuscle for more than twenty species of fish. His report played an important role as the next milestone on the road of fish insulin development studies in Japan. In 1926, Dr. Sakaguchi who was a leading clinical diabetologist in Japan published a monograph entitled "Insulin" written in Japanese. He referred the report on fish insulins of McCormick and Noble and Dr. Kumagai's report, however, he commented that production of insulin from fish seemed to be less worthy due to requirements of laborious work to collect small stannius corpuscle from fish. Professor A. Ogata described a textbook entitled "Zoki-Yakuhin-Kagaku (chemistry of organotherapeutics): in 1931. In the first edition, papers of Macleod, McCormick, Dudley and Osawa were referred. In the revised fifth edition (1940) contained description of unpublished data of insulin content of various kinds of fish caught in Japan and supplied from his student Nagasawa. Under the circumstance of expanding tendency of the China Incident to World War II, shortage of importation and production of insulin preparations manufactured from domestic animals was anticipated. Development on manufacture of fish insulin became urgent. [Truncated

Fish communities of the Buffalo River Basin and nearby basins of Arkansas and their relation to selected environmental factors, 2001-2002

USGS Publications Warehouse

Petersen, James C.

2004-01-01

The Buffalo River lies in north-central Arkansas and is a tributary of the White River. Most of the length of the Buffalo River lies within the boundaries of Buffalo National River, a unit of the National Park Service; the upper 24 river kilometers lie within the boundary of the Ozark National Forest. Much of the upper and extreme lower parts of the basin on the south side of the Buffalo River is within the Ozark National Forest. During the summers of 2001 and 2002, fish communities were sampled at 52 sites in the study area that included the Buffalo River Basin and selected smaller nearby basins within the White River Basin in north-central Arkansas. Water quality (including nutrient and bacteria concentrations) and several other environmental factors (such as stream size, land use, substrate size, and riparian shading) also were measured. A total of 56 species of fish were collected from sites within the Buffalo River Basin in 2001 and 2002. All 56 species also were collected from within the boundaries of Buffalo National River. Twenty-two species were collected from headwater sites on tributaries of the Buffalo River; 27 species were collected from sites within or immediately adjacent to the Ozark National Forest. The list of species collected from Buffalo National River is similar to the list of species reported by previous investigators. Species richness at sites on the mainstem of the Buffalo River generally increased in a downstream direction. The number of species collected (both years combined) increased from 17 at the most upstream site to 38 near the mouth of the Buffalo River. In 2001 and 2002, a total of 53 species of fish were collected from sites outside the Buffalo River Basin. Several fish community metrics varied among sites in different site categories (mainstem, large tributary, small tributary, headwater, and developed out-of-basin sites). Median relative abundances of stonerollers ranged from about 25 to 55 percent and were highest at headwater and developed out-of-basin sites and lowest at mainstem sites. The relative abundances at the headwater and developed out-of-basin sites were significantly different from the relative abundances at the mainstem sites. Percentages of individuals of algivorous/herbivorous, invertivorous, and piscivorous species at headwater sites were significantly lower than values at mainstem and developed out-of-basin sites. Percentages of individuals of invertivorous species at mainstem sites were significantly higher than values at small tributary, headwater, and developed out-of-basin sites. Percentages of top carnivores at mainstem sites were significantly higher than values at tributary and headwater sites. The numbers of darter, sculpin, plus madtom species at mainstem, large tributary, and developed out-of-basin sites were significantly higher than values at other sites, and the values at small tributary sites and headwater sites were each significantly different from values at the other four types of sites. The number of lithophilic spawning species at large tributary sites was not significantly different from values at mainstem and developed out-of-basin sites, but values for small tributary and headwater sites each were significantly different from values for all other categories. Index of biotic integrity scores varied among the site categories. Scores for mainstem sites were significantly larger than all but large tributary site scores. Scores for headwater sites were significantly smaller than mainstem and large tributary site scores. Several analyses of the data described in this report suggest that drainage area is the most important single factor influencing fish communities of the Buffalo River Basin and nearby basins. Species richness increases with increasing drainage area and some species are restricted to smaller streams while other species are more common in larger streams. Some community metrics also are related to land use and related factors

Water-quality and biological conditions in the Lower Boise River, Ada and Canyon Counties, Idaho, 1994-2002

USGS Publications Warehouse

MacCoy, Dorene E.

2004-01-01

The water quality and biotic integrity of the lower Boise River between Lucky Peak Dam and the river's mouth near Parma, Idaho, have been affected by agricultural land and water use, wastewater treatment facility discharge, urbanization, reservoir operations, and river channel alteration. The U.S. Geological Survey (USGS) and cooperators have studied water-quality and biological aspects of the lower Boise River in the past to address water-quality concerns and issues brought forth by the Clean Water Act of 1977. Past and present issues include preservation of beneficial uses of the river for fisheries, recreation, and irrigation; and maintenance of high-quality water for domestic and agricultural uses. Evaluation of the data collected from 1994 to 2002 by the USGS revealed increases in constituent concentrations in the lower Boise in a downstream direction. Median suspended sediment concentrations from Diversion Dam (downstream from Lucky Peak Dam) to Parma increased more than 11 times, nitrogen concentrations increased more than 8 times, phosphorus concentrations increased more than 7 times, and fecal coliform concentrations increased more than 400 times. Chlorophyll-a concentrations, used as an indicator of nutrient input and the potential for nuisance algal growth, also increased in a downstream direction; median concentrations were highest at the Middleton and Parma sites. There were no discernible temporal trends in nutrients, sediment, or bacteria concentrations over the 8-year study. The State of Idaho?s temperature standards to protect coldwater biota and salmonid spawning were exceeded most frequently at Middleton and Parma. Suspended sediment concentrations exceeded criteria proposed by Idaho Department of Environmental Quality most frequently at Parma and at all but three tributaries. Total nitrogen concentrations at Glenwood, Middleton, and Parma exceeded national background levels; median flow-adjusted total nitrogen concentrations at Middleton and Parma were higher than those in undeveloped basins sampled nationwide by the USGS. Total phosphorus concentrations at Glenwood, Middleton, and Parma also exceeded those in undeveloped basins. Macroinvertebrate and fish communities were used to evaluate the long-term integration of water-quality contaminants and loss of habitat in the lower Boise. Biological integrity of the macroinvertebrate population was assessed with the attributes (metrics) of Ephemeroptera, Plecoptera, and Trichoptera (EPT) richness and metrics used in the Idaho River Macroinvertebrate Index (RMI): taxa richness; EPT richness; percent dominant taxon; percent Elmidae (riffle beetles); and percent predators. Average EPT was about 10, and RMI scores were frequently below 16, which indicated intermediate or poor water quality. The number of EPT taxa and RMI scores for the lower Boise were half those for least-impacted streams in Idaho. The fine sediment bioassessment index (FSBI) was used to evaluate macroinvertebrate sediment tolerance. The FSBI scores were lower than those for a site upstream in the Boise River Basin near Twin Springs, a site not impacted by urbanization and agriculture, which indicated that the lower Boise macroinvertebrate population may be impacted by fine sediment. Macroinvertebrate functional feeding groups and percent tolerant species, mainly at Middleton and Parma, were typical of those in areas of degraded water quality and habitat. The biological integrity of the fish population was evaluated using the Idaho River Fish Index (RFI), which consists of the 10 metrics: number of coldwater native species, percent sculpin, percent coldwater species, percent sensitive native individuals, percent tolerant individuals, number of nonindigenous species, number of coldwater fish captured per minute of electrofishing, percent of fish with deformities (eroded fins, lesions, or tumors), number of trout age classes, and percent carp. RFI scores for lower Boise sites indicated a d

A systematic revision of Operclipygus Marseul (Coleoptera, Histeridae, Exosternini)

PubMed Central

Caterino, Michael S.; Tishechkin, Alexey K.

2013-01-01

Abstract We revise the large Neotropical genus Operclipygus Marseul, in the histerid tribe Exosternini (Histeridae: Histerinae). We synonymize 3 species, move 14 species from other genera, sink the genus Tribalister Horn into Operclipygus, and describe 138 species as new, bringing the total to 177 species of Operclipygus. Keys are provided for the identification of all species, and the majority of the species are illustrated by habitus and male genitalia illustrations. The species are diverse throughout tropical South and Central America, with only a few species extending into the temperate parts of North America. The majority of species can be recognized by the presence of a distinct stria or sulcus along the apical margin of the pygidium, though it is not exclusive to the genus. Natural history details for species of Operclipygus are scant, as most specimens have been collected through the use of passive flight interception traps. Many are probably generally associated with decaying vegetation and leaf litter, where they prey on small arthropods. But a small proportion are known inquilines, with social insects such as ants and termites, and also with some burrowing mammals, such as Ctenomys Blainville. The genus now includes the following species groups and species: Operclipygus sulcistrius group [Operclipygus lucanoides sp. n., Operclipygus schmidti sp. n., Operclipygus simplistrius sp. n., Operclipygus sulcistrius Marseul, 1870], Operclipygus mirabilis group [Operclipygus mirabilis (Wenzel & Dybas, 1941) comb. n., Operclipygus pustulifer sp. n., Operclipygus plaumanni sp. n., Operclipygus sinuatus sp. n., Operclipygus mutuca sp. n., Operclipygus carinistrius (Lewis, 1908) comb. n., Operclipygus parensis sp. n., Operclipygus schlingeri sp. n.], Operclipygus kerga group [Operclipygus kerga (Marseul, 1870), Operclipygus planifrons sp. n., Operclipygus punctistrius sp. n.], Operclipygus conquisitus group [Operclipygus bicolor sp. n., Operclipygus conquisitus (Lewis, 1902), Operclipygus friburgius (Marseul, 1864)], Operclipygus impuncticollis group [Operclipygus bickhardti sp. n., Operclipygus britannicus sp. n., Operclipygus impuncticollis (Hinton, 1935)], Operclipygus panamensis group [Operclipygus crenatus (Lewis, 1888), Operclipygus panamensis (Wenzel & Dybas, 1941)], Operclipygus sejunctus group [Operclipygus depressus (Hinton, 1935), Operclipygus itoupe sp. n., Operclipygus juninensis sp. n., Operclipygus pecki sp. n., Operclipygus punctiventer sp. n., Operclipygus sejunctus (Schmidt, 1896) comb. n., Operclipygus setiventrissp. n.], Operclipygus mortavis group [Operclipygus ecitonis sp. n., Operclipygus mortavis sp. n., Operclipygus paraguensis sp. n.], Operclipygus dytiscoides group [Operclipygus carinisternus sp. n., Operclipygus crenulatus sp. n., Operclipygus dytiscoides sp. n., Operclipygus quadratus sp. n.], Operclipygus dubitabilis group [Operclipygus dubitabilis (Marseul, 1889), Operclipygus yasuni sp. n.], Operclipygus angulifer group [Operclipygus angulifer sp. n., Operclipygus impressifrons sp. n.], Operclipygus dubius group [Operclipygus andinus sp. n., Operclipygus dubius (Lewis, 1888), Operclipygus extraneus sp. n., Operclipygus intermissus sp. n., Operclipygus lunulus sp. n., Operclipygus occultus sp. n., Operclipygus perplexus sp. n., Operclipygus remotus sp. n., Operclipygus validus sp. n., Operclipygus variabilis sp. n.], Operclipygus hospes group [Operclipygus assimilis sp. n., Operclipygus belemensis sp. n., Operclipygus bulbistoma sp. n., Operclipygus callifrons sp. n., Operclipygus colombicus sp. n., Operclipygus communis sp. n., Operclipygus confertus sp. n., Operclipygus confluens sp. n., Operclipygus curtistrius sp. n., Operclipygus diffluens sp. n., Operclipygus fusistrius sp. n., Operclipygus gratus sp. n., Operclipygus hospes (Lewis, 1902), Operclipygus ibiscus sp. n., Operclipygus ignifer sp. n., Operclipygus impositus sp. n., Operclipygus incisus sp. n., Operclipygus innocuus sp. n., Operclipygus inquilinus sp. n., Operclipygus minutus sp. n., Operclipygus novateutoniae sp. n., Operclipygus praecinctus sp. n., Operclipygus prominens sp. n., Operclipygus rileyi sp. n., Operclipygus subterraneus sp. n., Operclipygus tenuis sp. n., Operclipygus tiputinus sp. n.], Operclipygus farctus group [Operclipygus atlanticus sp. n., Operclipygus bidessois (Marseul, 1889), Operclipygus distinctus (Hinton, 1935), Operclipygus distractus (Schmidt, 1896) comb. n., Operclipygus farctissimus sp. n., Operclipygus farctus (Marseul, 1864), Operclipygus gilli sp. n., Operclipygus impressistrius sp. n., Operclipygus inflatus sp. n., Operclipygus latemarginatus (Bickhardt, 1920) comb. n., Operclipygus petrovi sp. n., Operclipygus plicatus (Hinton, 1935) comb. n., Operclipygus prolixus sp. n., Operclipygus punctifrons sp. n., Operclipygus proximus sp. n., Operclipygus subrufus sp. n.], Operclipygus hirsutipes group [Operclipygus guianensis sp. n., Operclipygus hirsutipes sp. n.], Operclipygus hamistrius group [Operclipygus arquus sp. n., Operclipygus campbelli sp. n., Operclipygus chiapensis sp. n., Operclipygus dybasi sp. n., Operclipygus geometricus (Casey, 1893) comb. n., Operclipygus hamistrius (Schmidt, 1893) comb. n., Operclipygus impressicollis sp. n., Operclipygus intersectus sp. n., Operclipygus montanus sp. n., Operclipygus nubosus sp. n., Operclipygus pichinchensis sp. n., Operclipygus propinquus sp. n., Operclipygus quinquestriatus sp. n., Operclipygus rubidus (Hinton, 1935) comb. n., Operclipygus rufescens sp. n., Operclipygus troglodytes sp. n.], Operclipygus plicicollis group [Operclipygus cephalicus sp. n., Operclipygus longidens sp. n., Operclipygus plicicollis (Schmidt, 1893)], Operclipygus fossipygus group [Operclipygus disconnectus sp. n., Operclipygus fossipygus (Wenzel, 1944), Operclipygus foveipygus (Bickhardt, 1918), Operclipygus fungicolus (Wenzel & Dybas, 1941), Operclipygus gibbulus (Schmidt, 1889) comb. n., Operclipygus olivensis sp. n., Operclipygus simplicipygus sp. n., Operclipygus subdepressus (Schmidt, 1889), Operclipygus therondi (Wenzel, 1976)], Operclipygus impunctipennis group [Operclipygus chamelensis sp. n., Operclipygus foveiventris sp. n., Operclipygus granulipectus sp. n., Operclipygus impunctipennis (Hinton, 1935) comb. n., Operclipygus latifoveatus sp. n., Operclipygus lissipygus sp. n., Operclipygus maesi sp. n., Operclipygus mangiferus sp. n., Operclipygus marginipennis sp. n., Operclipygus nicodemus sp. n., Operclipygus nitidus sp. n., Operclipygus pacificus sp. n., Operclipygus pauperculus sp. n., Operclipygus punctissipygus sp. n., Operclipygus subviridis sp. n., Operclipygus tripartitus sp. n., Operclipygus vorax sp. n.], Operclipygus marginellus group [Operclipygus ashei sp. n., Operclipygus baylessae sp. n., Operclipygus dentatus sp. n., Operclipygus formicatus sp. n., Operclipygus hintoni sp. n., Operclipygus marginellus (J.E. LeConte, 1860) comb. n., Operclipygus orchidophilus sp. n., Operclipygus selvorum sp. n., Operclipygus striatellus (Fall, 1917) comb. n.], incertae sedis: O. teapensis (Marseul, 1853) comb. n., Operclipygus punctulatus sp. n., Operclipygus lama Mazur, 1988, Operclipygus florifaunensis sp. n., Operclipygus bosquesecus sp. n., Operclipygus arnaudi Dégallier, 1982, Operclipygus subsphaericus sp. n., Operclipygus latipygus sp. n., Operclipygus elongatus sp. n., Operclipygus rupicolus sp. n., Operclipygus punctipleurus sp. n., Operclipygus falini sp. n., Operclipygus peregrinus sp. n., Operclipygus brooksi sp. n., Operclipygus profundipygus sp. n., Operclipygus punctatissimus sp. n., Operclipygus cavisternus sp. n., Operclipygus siluriformis sp. n., Operclipygus parallelus sp. n., Operclipygus abbreviatus sp. n., Operclipygus pygidialis (Lewis, 1908), Operclipygus faltistrius sp. n., Operclipygus limonensis sp. n., Operclipygus wenzeli sp. n., Operclipygus iheringi (Bickhardt, 1917), Operclipygus angustisternus (Wenzel, 1944), Operclipygus shorti sp. n. We establish the following synonymies: Phelisteroides miladae Wenzel & Dybas, 1941 and Pseudister propygidialis Hinton, 1935e = Operclipygus crenatus (Lewis, 1888); Phelister subplicatus Schmidt, 1893b = Operclipygus bidessois (Marseul, 1889). We designate lectotypes for Operclipygus sulcistrius Marseul, 1870, Phelister carinistrius Lewis, 1908, Phelister kerga Marseul, 1870, Phelister friburgius Marseul, 1864, Phelister impuncticollis Hinton, 1935, Phelister crenatus Lewis, 1888, Phelister sejunctus Schmidt, 1896, Pseudister depressus Hinton, 1935, Epierus dubius Lewis, 1888, Phelister hospes Lewis, 1902, Phelister farctus Marseul, 1864, Phelister bidessois Marseul, 1889, Phelister subplicatus Schmidt, 1893, Phelister plicatus Hinton, 1935, Phelister distinctus Hinton, 1935, Phelister distractus Schmidt, 1896, Pseudister latemarginatus Bickhardt, 1920, Phelister hamistrius Schmidt, 1893, Phelister plicicollis Schmidt, 1893, Phelister gibbulus Schmidt, 1889, Phelister subdepressus Schmidt, 1889, Phelister teapensis Marseul, 1853, Phelister pygidialis Lewis, 1908, Phelister iheringi Bickhardt, 1917, and Phelister marginellus J.E. LeConte 1860. We designate a neotype for Operclipygus conquisitus Lewis, replacing its lost type specimen. PMID:23717185

A water framework directive (WFD) compliant determination of eologically acceptable flows in alpine rivers - a river type specific approach

NASA Astrophysics Data System (ADS)

Jäger, Paul; Zitek, Andreas

2010-05-01

Currently the EU-Water Framework Directive (WFD) represents the driving force behind the assessment for rehabilitation and conservation of aquatic resources throughout Europe. Hydropower production, often considered as "green energy", in the past has put significant pressures on river systems like fragmentation by weirs, impoundment, hydropeaking and water abstraction. Due to the limited availability of data for determining ecologically acceptable flow for rivers at water abstraction sites, a special monitoring program was conducted in the federal state of Salzburg in Austria from 2006 to 2009. Water abstraction sites at 19 hydropower plants, mostly within the trout region of the River Salzach catchment, were assessed in detail with regard to the effect of water abstraction on fish and macrozoobenthos. Based on a detailed assessment of the specific local hydro-morphological and biological situations, the validity of natural low flow criteria (Absolute Minimum Flow - AMF, the lowest daily average flow ever measured and Mean Annual Daily Low Flow - MADLF) as starting points for the determination of an ecologically acceptable flow was tested. It was assessed, if a good ecological status in accordance with the EU-WFD can be maintained at natural AMF. Additionally it was tested, if important habitat parameters describing connectivity, river type specific flow variability and river type specific habitats are maintained at this discharge. Habitat modelling was applied in some situations. Hydraulic results showed that at AMF the highest flow velocity classes were lost in most situations. When AMF was significantly undercut, flow velocities between 0,0 - 0,4 m/s became dominant, describing the loss of the river type specific flow character, leading to a loss of river type specific flow variability and habitats and increased sedimentation of fines. Furthermore limits for parameters describing connectivity for fish like maximum depth at the pessimum profile and minimum flow velocity in thalweg were undercut. Additionally a significant loss of wetted width in relation to the wetted width at MADLF was documented, leading to significantly reduced ecologically available habitats. At AMF the existence of a minimum amount of usable habitat prevented a total loss of adult fish, and a good ecological status was documented by the Fish Index Austria (FIA) in all situations, where water abstraction represented the only human pressure, and AMF was left in the river as residual flow. The fish ecological status was significantly worse in river stretches where minimum flow was significantly below the AMF. However, in about one third of these stretches a good ecological status was documented by fish. Fine grained habitat structures, expressed by mean choriotope sizes (> 20 cm) and relative roughness were found to provide enough shelter, especially for brown trout, to maintain a high variance of fish lengths influencing both, the age structure and biomass. Both variables are especially highly relevant when calculating the ecological status of rivers using the FIA, when only brown trout occurs as leading species, accompanied only by the bullhead, Cottus gobio L.. However, mean fish lengths and weights were significantly smaller in most water abstraction sites. The method currently applied for determining the ecological status by macrozoobenthos failed, because the method is still based on some types of water pollution and the flow velocity as dominating factor in rivers is not adequately considered. However, a species specific analysis of the data showed a consistent loss of rheophilic species at water abstraction sites. Based on this, recommendations for a more specified assessment of the ecological status by benthic invertebrates were developed. Natural factors like slope with significant effects on hydraulic stress (bottom shear stress, maximum flow velocities, etc.) strongly overlaid the effects of water abstraction within the whole dataset. Therefore an adequate consideration of natural factors like slope, hydraulic stress and structure parameters like mean choriotope size, and a realistic identification of the significant driving pressures (water abstraction, fragmentation, and channelization) proved to be a crucial pre-requisite for a meaningful analysis and interpretation of data and determination of efficient restoration measures. Summarizing, it can be concluded that the AMF represents a valid base for determining the ecologically acceptable flow. In most cases parameters for connectivity and river type specific habitat availability are met at this discharge. However, as this discharge represents a natural catastrophic event, it is recommended to add a dynamic component to this minimum base flow to maintain at least to some extent the river type specific flow variability, contributing to a maintenance of natural geomorphologic and ecological processes linked to natural flow patterns. Especially higher discharges, able to move substrates and flush fine sediments, should be provided in their river type specific seasonal dynamics. This seasonal clearing of sediments has been proved to be strongly related to the reproductive success of trout in the past and provides interstitial habitats for invertebrates at ecologically meaningful times of the year. Finally, re-establishment of river connectivity at weirs and the morphological restructuring of highly channelized rivers can be seen as other important pre-requisites to achieve the good ecological status in alpine river systems.