[Supercritical CO2 extraction and component analysis of Aesculus wilsonii seed oil].

PubMed

Chen, Guang-Yu; Shi, Zhao-Hua; Li, Hai-Chi; Ge, Fa-Huan; Zhan, Hua-Shu

2013-03-01

To research the optimal extraction process of supercritical CO2 extraction and analyze the component of the oil extracted from Aesculus wilsonii seed. Using the yield of Aesculus wilsonii seed oil as the index, optimized supercritical CO2 extraction parameter by orthogonal experiment methodology and analysed the compounds of Aesculus wilsonii seed oil by GC-MS. The optimal parameters of the supercritical CO2 extraction of the oil extracted from Aesculus wilsoniit seed were determined: the extraction pressure was 28 MPa and the temperature was 38 degrees C, the separation I pressure was 12 MPa and the temperature was 40 degrees C, the separation II pressure was 5 MPa and the temperature was 40 degrees C, the extraction time was 110 min. The average extraction rate of Aesculus wilsonii seed oil was 1.264%. 26 kinds of compounds were identified by GC-MS in Aesculus wilsonii seed oil extracted by supercritical CO2. The main components were fatty acids. Comparing with the petroleum ether extraction, the supercritical CO2 extraction has higher extraction rate, shorter extraction time, more clarity oil. The kinds of fatty acids with high amounts in Aesculus wilsonii seed oil is identical in general, the kinds of fatty acids with low amounts in Aesculus wilsonii seed oil have differences.

The effect of temperature on reproduction in the summer and winter annual Arabidopsis thaliana ecotypes Bur and Cvi

PubMed Central

Huang, Ziyue; Footitt, Steven; Finch-Savage, William E.

2014-01-01

Background and Aims Seed yield and dormancy status are key components of species fitness that are influenced by the maternal environment, in particular temperature. Responses to environmental conditions can differ between ecotypes of the same species. Therefore, to investigate the effect of maternal environment on seed production, this study compared two contrasting Arabidopsis thaliana ecotypes, Cape Verdi Isle (Cvi) and Burren (Bur). Cvi is adapted to a hot dry climate and Bur to a cool damp climate, and they exhibit winter and summer annual phenotypes, respectively. Methods Bur and Cvi plants were grown in reciprocal controlled environments that simulated their native environments. Reproductive development, seed production and subsequent germination behaviour were investigated. Measurements included: pollen viability, the development of floral structure, and germination at 10 and 25 °C in the light to determine dormancy status. Floral development was further investigated by applying gibberellins (GAs) to alter the pistil:stamen ratio. Key Results Temperature during seed development determined seed dormancy status. In addition, seed yield was greatly reduced by higher temperature, especially in Bur (>90 %) compared with Cvi (approx. 50 %). The reproductive organs (i.e. stamens) of Bur plants were very sensitive to high temperature during early flowering. Viability of pollen was unaffected, but limited filament extension relative to that of the pistils resulted in failure to pollinate. Thus GA applied to flowers to enhance filament extension largely overcame the effect of high temperature on yield. Conclusions High temperature in the maternal environment reduced dormancy and negatively affected the final seed yield of both ecotypes; however, the extent of these responses differed, demonstrating natural variation. Reduced seed yield in Bur resulted from altered floral development not reduced pollen viability. Future higher temperatures will impact on seed performance, but the consequences may differ significantly between ecotypes of the same species. PMID:24573642

Combining ability analysis for within-boll yield components in upland cotton (Gossypium hirsutum L.).

PubMed

Imran, M; Shakeel, A; Azhar, F M; Farooq, J; Saleem, M F; Saeed, A; Nazeer, W; Riaz, M; Naeem, M; Javaid, A

2012-08-24

Cotton is an important cash crop worldwide, accounting for a large percentage of world agricultural exports; however, yield per acre is still poor in many countries, including Pakistan. Diallel mating system was used to identify parents for improving within-boll yield and fiber quality parameters. Combining ability analysis was employed to obtain suitable parents for this purpose. The parental genotypes CP-15/2, NIAB Krishma, CIM-482, MS-39, and S-12 were crossed in complete diallel mating under green house conditions during 2009. The F₀ seed of 20 hybrids and five parents were planted in the field in randomized complete block design with three replications during 2010. There were highly significant differences among all F₁ hybrids and their parents. Specific combining ability (SCA) variance was greater than general combining ability (GCA) variance for bolls per plant (9.987), seeds per boll (0.635), seed density (5.672), lint per seed (4.174), boll size (3.69), seed cotton yield (0.315), and lint percentage (0.470), showing predominance of non-additive genes; while seed volume (3.84) was controlled by additive gene action based on maximum GCA variance. Cultivar MS-39 was found to be the best general combiner for seed volume (0.102), seeds per boll (0.448), and lint per seed (0.038) and its utilization produced valuable hybrids, including MS-39 x NIAB Krishma and MS-39 x S-12. The parental line CIM-482 had high GCA effects for boll size (0.33) and seeds per boll (0.90). It also showed good SCA with S-12 and NIAB Krishma for bolls per plant, with CP- 15/2 for boll size, and with MS-39 for seeds per boll. The hybrids, namely, CP-15/2 x NIAB Krishma, NIAB Krishma x S-12, NIAB Krishma x CIM-482, MS-39 x NIAB Krishma, MS-39 x CP-15/2, and S-12 x MS-39 showed promising results. Correlation analysis revealed that seed cotton yield showed significant positive correlation with bolls per plant, boll size and seeds per boll while it showed negative correlation with lint percentage and lint per seed. Seed volume showed significant negative correlation with seed density. Seeds per boll were positively correlated with boll size and negatively correlated with bolls per plant lint percentage and lint per seed. Similarly, lint per seed exhibited positive correlation with lint percentage and boll size showed significantly negative correlation with bolls per plant. Presence of non-additive genetic effects in traits like bolls per plant, seeds per boll, lint per seed, seed cotton yield, and lint percentage is indicative of later generation selection or heterosis breeding may be adopted. For boll size, seed volume and seed density early generation selection may be followed because of the presence of additive gene action. The parental material used in this study and cross combinations obtained from these parents may be exploited in future breeding endeavors.

Effects of imidacloprid and clothianidin seed treatments on wheat aphids and their natural enemies on winter wheat.

PubMed

Zhang, Peng; Zhang, Xuefeng; Zhao, Yunhe; Wei, Yan; Mu, Wei; Liu, Feng

2016-06-01

Wheat aphid (Hemiptera: Aphididae) is one of the major pests of winter wheat and has posed a significant threat to winter wheat production in China. Although neonicotinoid insecticidal seed treatments have been suggested to be a control method, the season-long efficacy on pests and the impact on their natural enemies are still uncertain. Experiments were conducted to determine the efficacy of imidacloprid and clothianidin on the control of aphids, the number of their natural enemies and the emergence rate and yield of wheat during 2011-2014. Imidacloprid and clothianidin seed treatments had no effect on the emergence rate of winter wheat and could prevent yield losses and wheat aphid infestations throughout the winter wheat growing season. Furthermore, their active ingredients were detected in winter wheat leaves up to 200 days after sowing. Imidacloprid and clothianidin seed treatments had no adverse effects on ladybirds, hoverflies or parasitoids, and instead increased the spider-aphid ratios. Wheat seeds treated with imidacloprid and clothianidin were effective against wheat aphids throughout the winter wheat growing season and reduced the yield loss under field conditions. Imidacloprid and clothianidin seed treatments may be an important component of the integrated management of wheat aphids on winter wheat. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

Nitrogen Source and Rate Management Improve Maize Productivity of Smallholders under Semiarid Climates.

PubMed

Amanullah; Iqbal, Asif; Ali, Ashraf; Fahad, Shah; Parmar, Brajendra

2016-01-01

Nitrogen is one of the most important factor affecting maize ( Zea mays L.) yield and income of smallholders under semiarid climates. Field experiments were conducted to investigate the impact of different N-fertilizer sources [urea, calcium ammonium nitrate (CAN), and ammonium sulfate (AS)] and rates (50, 100, 150, and 200 kg ha -1 ) on umber of rows ear -1 (NOR ear -1 ), number of seeds row -1 (NOS row -1 ), number of seeds ear -1 (NOS ear -1 ), number of ears per 100 plants (NOEP 100 plants -1 ), grain yield plant -1 , stover yield (kg ha -1 ), and shelling percentage (%) of maize genotypes "Local cultivars (Azam and Jalal) vs. hybrid (Pioneer-3025)." The experiment was conducted at the Agronomy Research Farm of the University of Agriculture Peshawar during summers of 2008 (year one) and 2010 (year two). The results revealed that the N treated (rest) plots (the average of all the experimental plots treated with N) had produced higher yield and yield components, and shelling percentage over N-control plots (plots where N was not applied). Application of nitrogen at the higher rate increased yield and yield components in maize (200 > 150 > 100 > 50 kg N ha -1 ). Application of AS and CAN had more beneficial impact on yield and yield components of maize as compared to urea (AS > CAN > urea). Hybrid maize (P-3025) produced significantly higher yield and yield components as well as higher shelling percentage than the two local cultivars (P-3025 > Jalal = Azam). Application of ammonium sulfate at the rate of 200 kg N ha -1 to hybrid maize was found most beneficial in terms of higher productivity and grower's income in the study area. For the two local cultivars, application of 150 kg N ha -1 was found more beneficial over 120 kg N ha -1 (recommended N rate) in terms of greater productivity and growers income.

Nitrogen Source and Rate Management Improve Maize Productivity of Smallholders under Semiarid Climates

PubMed Central

Amanullah; Iqbal, Asif; Ali, Ashraf; Fahad, Shah; Parmar, Brajendra

2016-01-01

Nitrogen is one of the most important factor affecting maize (Zea mays L.) yield and income of smallholders under semiarid climates. Field experiments were conducted to investigate the impact of different N-fertilizer sources [urea, calcium ammonium nitrate (CAN), and ammonium sulfate (AS)] and rates (50, 100, 150, and 200 kg ha−1) on umber of rows ear−1 (NOR ear−1), number of seeds row−1 (NOS row−1), number of seeds ear−1 (NOS ear−1), number of ears per 100 plants (NOEP 100 plants−1), grain yield plant−1, stover yield (kg ha−1), and shelling percentage (%) of maize genotypes “Local cultivars (Azam and Jalal) vs. hybrid (Pioneer-3025).” The experiment was conducted at the Agronomy Research Farm of the University of Agriculture Peshawar during summers of 2008 (year one) and 2010 (year two). The results revealed that the N treated (rest) plots (the average of all the experimental plots treated with N) had produced higher yield and yield components, and shelling percentage over N-control plots (plots where N was not applied). Application of nitrogen at the higher rate increased yield and yield components in maize (200 > 150 > 100 > 50 kg N ha−1). Application of AS and CAN had more beneficial impact on yield and yield components of maize as compared to urea (AS > CAN > urea). Hybrid maize (P-3025) produced significantly higher yield and yield components as well as higher shelling percentage than the two local cultivars (P-3025 > Jalal = Azam). Application of ammonium sulfate at the rate of 200 kg N ha−1 to hybrid maize was found most beneficial in terms of higher productivity and grower's income in the study area. For the two local cultivars, application of 150 kg N ha−1 was found more beneficial over 120 kg N ha−1 (recommended N rate) in terms of greater productivity and growers income. PMID:27965685

Seed vigour and crop establishment: extending performance beyond adaptation.

PubMed

Finch-Savage, W E; Bassel, G W

2016-02-01

Seeds are central to crop production, human nutrition, and food security. A key component of the performance of crop seeds is the complex trait of seed vigour. Crop yield and resource use efficiency depend on successful plant establishment in the field, and it is the vigour of seeds that defines their ability to germinate and establish seedlings rapidly, uniformly, and robustly across diverse environmental conditions. Improving vigour to enhance the critical and yield-defining stage of crop establishment remains a primary objective of the agricultural industry and the seed/breeding companies that support it. Our knowledge of the regulation of seed germination has developed greatly in recent times, yet understanding of the basis of variation in vigour and therefore seed performance during the establishment of crops remains limited. Here we consider seed vigour at an ecophysiological, molecular, and biomechanical level. We discuss how some seed characteristics that serve as adaptive responses to the natural environment are not suitable for agriculture. Past domestication has provided incremental improvements, but further actively directed change is required to produce seeds with the characteristics required both now and in the future. We discuss ways in which basic plant science could be applied to enhance seed performance in crop production. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Study of supercritical CO2 extraction of tamarillo (Cyphomandra Betacea) seed oil containing high added value compounds.

PubMed

Dorado Achicanoy, Daniela; Hurtado Benavides, Andrés; Martínez-Correa, Hugo A

2018-04-16

In the present investigation, the extraction of tamarillo seed oil was conducted using supercritical carbon dioxide (SC-CO2), under different conditions of pressure (20-38.1 MPa) and temperature (40-64°C). In order to determine the effect that these extraction parameters have over the yield and composition of the oil, a central composite design was used. The optimum yield was 21.07% obtained at 38.1 MPa and 64°C. The fatty acids of the tamarillo seed oil obtained with SC-CO2 were identified: linoleic (70.12%), oleic (16.18%), palmitic (9.68%), stearic (2.12%), linolenic (1.70%), and palmitoleic (0.23%). Other components, such as squalene (2.96-19.75 mg/mL), β-sitosterol (2.05-3.68 mg/mL), cycloartenol (1,23-2.81 mg/mL) dihydrolanosterol (0.28-0.70 mg/mL) sterols and γ-tocopherol (0.89-2.10 mg/mL) were also noted. The extraction kinetic was studied at 27.5 MPa -50°C and 38.1 MPa -64°C. The semi-empirical model of Sovová et al. [24] described 99.21% of the experimental behavior of extraction kinetics. High yields of tamarillo seed oil, as well as its unique composition of unsaturated fatty acids and minor components, show the potential for its application in the food, cosmetic, and pharmaceutical industries. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Pistil Smut Infection Increases Ovary Production, Seed Yield Components, and Pseudosexual Reproductive Allocation in Buffalograss

PubMed Central

Chandra, Ambika; Huff, David R.

2014-01-01

Sex expression of dioecious buffalograss [Bouteloua dactyloides Columbus (syn. Buchloë dactyloides (Nutt.) Engelm.)] is known to be environmentally stable with approximate 1:1, male to female, sex ratios. Here we show that infection by the pistil smut fungus [Salmacisia buchloëana Huff & Chandra (syn. Tilletia buchloëana Kellerman and Swingle)] shifts sex ratios of buffalograss to be nearly 100% phenotypically hermaphroditic. In addition, pistil smut infection decreased vegetative reproductive allocation, increased most seed yield components, and increased pseudosexual reproductive allocation in both sex forms compared to uninfected clones. In female sex forms, pistil smut infection resulted in a 26 fold increase in ovary production and a 35 fold increase in potential harvest index. In male sex forms, pistil smut infection resulted in 2.37 fold increase in floret number and over 95% of these florets contained a well-developed pistil. Although all ovaries of infected plants are filled with fungal teliospores and hence reproductively sterile, an average male-female pair of infected plants exhibited an 87 fold increase in potential harvest index compared to their uninfected clones. Acquiring an ability to mimic the effects of pistil smut infection would enhance our understanding of the flowering process in grasses and our efforts to increase seed yield of buffalograss and perhaps other grasses. PMID:27135522

Components of a rice-oilseed rape production system augmented with trichoderma sp. Tri-1 control sclerotinia sclerotiorum on oilseed rape

USDA-ARS?s Scientific Manuscript database

Sclerotinia sclerotiorum causes serious yield losses on many crops throughout the world. In two field trials conducted at the same location in consecutive years, a treatment containing formulated Trichoderma harzianum-1 (Tri-1) resulted in oilseed rape seed yield that was significantly greater than...

Stacked -gene hybrids were not found to be superior to glyphosate resistant or Non-GMO corn hybrids

USDA-ARS?s Scientific Manuscript database

Seed costs of modern corn hybrids genetically modified with multiple traits for insect and herbicide resistance “stacked-gene” are in excess of $100.00 US per acre. Yields and net returns per acre along with yield component data were determined for ten hybrids, four stacked-gene, four glyphosate re...

The Genetic Basis of Natural Variation in Kernel Size and Related Traits Using a Four-Way Cross Population in Maize.

PubMed

Chen, Jiafa; Zhang, Luyan; Liu, Songtao; Li, Zhimin; Huang, Rongrong; Li, Yongming; Cheng, Hongliang; Li, Xiantang; Zhou, Bo; Wu, Suowei; Chen, Wei; Wu, Jianyu; Ding, Junqiang

2016-01-01

Kernel size is an important component of grain yield in maize breeding programs. To extend the understanding on the genetic basis of kernel size traits (i.e., kernel length, kernel width and kernel thickness), we developed a set of four-way cross mapping population derived from four maize inbred lines with varied kernel sizes. In the present study, we investigated the genetic basis of natural variation in seed size and other components of maize yield (e.g., hundred kernel weight, number of rows per ear, number of kernels per row). In total, ten QTL affecting kernel size were identified, three of which (two for kernel length and one for kernel width) had stable expression in other components of maize yield. The possible genetic mechanism behind the trade-off of kernel size and yield components was discussed.

The Genetic Basis of Natural Variation in Kernel Size and Related Traits Using a Four-Way Cross Population in Maize

PubMed Central

Liu, Songtao; Li, Zhimin; Huang, Rongrong; Li, Yongming; Cheng, Hongliang; Li, Xiantang; Zhou, Bo; Wu, Suowei; Chen, Wei; Wu, Jianyu; Ding, Junqiang

2016-01-01

Kernel size is an important component of grain yield in maize breeding programs. To extend the understanding on the genetic basis of kernel size traits (i.e., kernel length, kernel width and kernel thickness), we developed a set of four-way cross mapping population derived from four maize inbred lines with varied kernel sizes. In the present study, we investigated the genetic basis of natural variation in seed size and other components of maize yield (e.g., hundred kernel weight, number of rows per ear, number of kernels per row). In total, ten QTL affecting kernel size were identified, three of which (two for kernel length and one for kernel width) had stable expression in other components of maize yield. The possible genetic mechanism behind the trade-off of kernel size and yield components was discussed. PMID:27070143

[Effects of sowing date and planting density on the seed yield and oil content of winter oilseed rape].

PubMed

Zhang, Shu-Jie; Li, Ling; Zhang, Chun-Lei

2012-05-01

A field experiment was conducted to investigate the effects of different sowing date and planting density on the seed yield and seed oil content of winter oilseed rape (Brassica napus). Sowing date mainly affected the seed yield of branch raceme, while planting density affected the seed yields of both branch raceme and main raceme. The seed oil content was less affected by sowing date. The proportion of the seed yield of main raceme to the seed yield per plant increased with increasing planting density, and the seed oil content of main raceme was about 1% higher than that of branch raceme. Consequently, the seed oil production per plot increased significantly with increasing planting density. In the experimental region, the sowing date of winter oilseed rape should be earlier than mid-October. When sowing in late October, the seed yield would be decreased significantly. A planting density of 36-48 plants x m(-2) could improve the seed yield and oil content of winter oilseed rape.

Biochemical methane potential, biodegradability, alkali treatment and influence of chemical composition on methane yield of yard wastes.

PubMed

Gunaseelan, Victor Nallathambi

2016-03-01

In this study, the biochemical CH4 potential, rate, biodegradability, NaOH treatment and the influence of chemical composition on CH4 yield of yard wastes generated from seven trees were examined. All the plant parts were sampled for their chemical composition and subjected to the biochemical CH4 potential assay. The component parts exhibited significant variation in biochemical CH4 potential, which was reflected in their ultimate CH4 yields that ranged from 109 to 382 ml g(-1) volatile solids added and their rate constants that ranged from 0.042 to 0.173 d(-1). The biodegradability of the yard wastes ranged from 0.26 to 0.86. Variation in the biochemical CH4 potential of the yard wastes could be attributed to variation in the chemical composition of the different fractions. In the Thespesia yellow withered leaf, Tamarindus fruit pericarp and Albizia pod husk, NaOH treatment enhanced the ultimate CH4 yields by 17%, 77% and 63%, respectively, and biodegradability by 15%, 77% and 61%, respectively, compared with the untreated samples. The effectiveness of NaOH treatment varied for different yard wastes, depending on the amounts of acid detergent fibre content. Gliricidia petals, Prosopis leaf, inflorescence and immature pod, Tamarindus seeds, Albizia seeds, Cassia seeds and Delonix seeds exhibited CH4 yields higher than 300 ml g(-1) volatile solids added. Multiple linear regression models for predicting the ultimate CH4 yield and biodegradability of yard wastes were designed from the results of this work. © The Author(s) 2016.

Sunflower seeds as eliciting agents of Compositae dermatitis.

PubMed

Paulsen, Evy; El-Houri, Rime B; Andersen, Klaus E; Christensen, Lars P

2015-03-01

Sunflowers may cause dermatitis because of allergenic sesquiterpene lactones (SLs). Contact sensitization to sunflower seeds has also been reported, but the allergens are unknown. To analyse sunflower seeds for the presence of SLs and to assess the prevalence of sunflower sensitization in Compositae-allergic individuals. Sunflower-sensitive patients were identified by aimed patch testing. A dichloromethane extract of whole sunflower seeds was analysed by liquid chromatography-mass spectrometry and high-performance liquid chromatography. The prevalence of sensitivity to sunflower in Compositae-allergic individuals was 56%. A solvent wash of whole sunflower seeds yielded an extract containing SLs, the principal component tentatively being identified as argophyllin A or B, other SLs being present in minute amounts. The concentration of SLs on the sunflower seeds is considered high enough to elicit dermatitis in sensitive persons, and it seems appropriate to warn Compositae-allergic subjects against handling sunflower seeds. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

The effect of high concentrations of glufosinate ammonium on the yield components of transgenic spring wheat (Triticum aestivum L.) constitutively expressing the bar gene.

PubMed

Áy, Zoltán; Mihály, Róbert; Cserháti, Mátyás; Kótai, Éva; Pauk, János

2012-01-01

We present an experiment done on a bar(+) wheat line treated with 14 different concentrations of glufosinate ammonium-an effective component of nonselective herbicides-during seed germination in a closed experimental system. Yield components as number of spikes per plant, number of grains per spike, thousand kernel weight, and yield per plant were thoroughly analysed and statistically evaluated after harvesting. We found that a concentration of glufosinate ammonium 5000 times the lethal dose was not enough to inhibit the germination of transgenic plants expressing the bar gene. Extremely high concentrations of glufosinate ammonium caused a bushy phenotype, significantly lower numbers of grains per spike, and thousand kernel weights. Concerning the productivity, we observed that concentrations of glufosinate ammonium 64 times the lethal dose did not lead to yield depression. Our results draw attention to the possibilities implied in the transgenic approaches.

Impacts of adding different components of wood vinegar on rape (Brassica napus L.) seed germiantion

NASA Astrophysics Data System (ADS)

Shan, Xue; Liu, Xia; Zhang, Qian

2018-03-01

In recent years, wood vinegar has been widely used in the agricultural production. It can be used as the soil amendment, antibacterial agent and organic fertilizer. This study investigated the effect of wood vinegar on rape (Brassica napus L.) seed germination. The results in this study showed that 1% (v/v) wood vinegar had the greatest inhibition effect on the seed germination of rape (Brassica napus L.). The wood vinegar (WV) and the distilled wood vinegar at 98 - 130 °C (D2) significantly inhibited seed germination by 100%, compared to the control treatment. However, the distilled wood vinegar (D1) had significantly increased the shoot length and root length by 58.4% and 31.7%, respectively. These positive effects could be attributed to the improved soil fertility, increased nutrient supply, and further stimulated plant growth. Overall, the D1 could be a promising soil amendment to promote plants growth and enhance crop yields. Effect of adding different components of distilled wood vinegar on the seed germination of rape

Seed Embryo Development Is Regulated via an AN3-MINI3 Gene Cascade

PubMed Central

Meng, Lai-Sheng; Wang, Yi-Bo; Loake, Gary J.; Jiang, Ji-Hong

2016-01-01

In agriculture, seed mass is one of the most important components related to seed yield. MINISEED3 (MINI3) which encodes the transcriptional activator WRKY10, is thought to be a pivotal regulator of seed mass. In Arabidopsis SHORT HYPOCOTYL UNDER BLUE1 (SHB1) associates with the promoter of MINI3, regulating embryo cell proliferation (both cell division and elongation), which, in turn, modulates seed mass. Furthermore, the recruitment of SHB1 via MINI3 to both its cognate promoter and that of IKU2 implies a two-step amplification for countering the low expression level of IKU2, which is thought to function as a molecular switch for seed cavity enlargement. However, it is largely unknown how embryo cell proliferation, which encompasses both cell division and elongation, is regulated by SHB1 and MINI3 function. Here, we show that a loss of function mutation within the transcriptional coactivator ANGUSTIFOLIA3 (AN3), increases seed mass. Further, AN3 associates with the MINI3 promoter in vivo. Genetic evidence indicates that the absence of MINI3 function suppresses the decrease of cell number observed in an3-4 mutants by regulating cell division and in turn inhibits increased cell size of the an3-4 line by controlling cell elongation. Thus, seed embryo development is modulated via an AN3-MINI3 gene cascade. This regulatory model provides a deeper understanding of seed mass regulation, which may in turn lead to increased crop yields. PMID:27857719

Genetic architecture, inter-relationship and selection criteria for yield improvement in rice (Oryza sativa L.).

PubMed

Yadav, S K; Pandey, P; Kumar, B; Suresh, B G

2011-05-01

This study has been conducted to determine the extent of genetic association between yield of Rice (Oryza sativa L.) and its components. The present experiment was carried out with 40 Rice (Oryza sativa L.) genotypes which were evaluated in a randomized block design with 3 replications during wet season of 2007 and 2008. Results showed that sufficient amount of variability was found in the entire gene pool for all traits studied. Higher magnitude of genotypic and phenotypic coefficients of variation was recorded for seed yield, harvest index, biological yield, number of spikelets per panicle, flag leaf length, plant height and number of tillers indicates that these characters are least influence by environment. High heritability coupled with high genetic advance as percent of mean was registered for seed yield, harvest index, number of spikelets per panicle, biological yield and flag leaf length, suggesting preponderance of additive gene action in the expression of these characters. Grain yield was significantly and positively associated with harvest index, number of tillers per hill, number of panicle per plant, panicle length, number of spikelet's per panicle and test weight at both genotypic and phenotypic levels. Path coefficient analysis revealed that harvest index, biological yield, number of tillers per hill, panicle length, number of spikelets per panicle, plant height and test weight had direct positive effect on seed yield, indicating these are the main contributors to yield. From this study it may be concluded that harvest index, number of tillers per hill, panicle length and number of spikelet per panicle and test weight are the most important characters that contributed directly to yield. Thus, these characters may serve selection criteria for improving genetic potential of rice.

Molecular mapping and genomics of soybean seed protein: a review and perspective for the future.

PubMed

Patil, Gunvant; Mian, Rouf; Vuong, Tri; Pantalone, Vince; Song, Qijian; Chen, Pengyin; Shannon, Grover J; Carter, Tommy C; Nguyen, Henry T

2017-10-01

Genetic improvement of soybean protein meal is a complex process because of negative correlation with oil, yield, and temperature. This review describes the progress in mapping and genomics, identifies knowledge gaps, and highlights the need of integrated approaches. Meal protein derived from soybean [Glycine max (L) Merr.] seed is the primary source of protein in poultry and livestock feed. Protein is a key factor that determines the nutritional and economical value of soybean. Genetic improvement of soybean seed protein content is highly desirable, and major quantitative trait loci (QTL) for soybean protein have been detected and repeatedly mapped on chromosomes (Chr.) 20 (LG-I), and 15 (LG-E). However, practical breeding progress is challenging because of seed protein content's negative genetic correlation with seed yield, other seed components such as oil and sucrose, and interaction with environmental effects such as temperature during seed development. In this review, we discuss rate-limiting factors related to soybean protein content and nutritional quality, and potential control factors regulating seed storage protein. In addition, we describe advances in next-generation sequencing technologies for precise detection of natural variants and their integration with conventional and high-throughput genotyping technologies. A syntenic analysis of QTL on Chr. 15 and 20 was performed. Finally, we discuss comprehensive approaches for integrating protein and amino acid QTL, genome-wide association studies, whole-genome resequencing, and transcriptome data to accelerate identification of genomic hot spots for allele introgression and soybean meal protein improvement.

Response of barley to grasshopper defoliation in interior Alaska: dry matter and grain yield.

PubMed

Begna, Sultan H; Fielding, Dennis J

2005-12-01

Barley, Hordeum vulgare L., is well adapted to subarctic Alaska growing conditions, but little is known about its response to grasshopper defoliation. A field experiment was conducted to study dry matter and grain yield in response to a combination of grasshopper defoliation and weeds in 2002 and 2003 near Delta Junction, AK (63 degrees 55' N, 145 degrees 20' W). Barley plants at third to fourth leaf stage were exposed to a combination of two levels of weeds (present or absent) and four densities of grasshoppers (equivalent to 0, 25, 50, and 75 grasshoppers per m2) of third to fourth instars of Melanoplus sanguinipes (F). Dry matter accumulation by the barley plants was determined at three times during the growing seasons: approximately 10 d after introduction of the grasshoppers, shortly after anthesis, and at maturity. Dry matter accumulation and grain yield were much lower in 2003 than in 2002, probably due to very low levels of soil moisture early in the growing season of 2003. Head clipping accounted for a greater portion of yield loss in 2003 than in 2002. The percentage of reduction in harvestable yield due to grasshoppers remained fairly constant between years (1.9 and 1.4 g per grasshopper per m2 in 2002 and 2003, respectively) despite a large difference in overall yield. Examination of the yield components suggest that yields were reduced by the early season drought in 2003 primarily through fewer seeds per head, whereas grasshoppers in both years reduced average seed weight, but not numbers of seeds.

Genotypic Variation in Nitrogen Utilization Efficiency of Oilseed Rape (Brassica napus) Under Contrasting N Supply in Pot and Field Experiments

PubMed Central

He, Huiying; Yang, Rui; Li, Yajun; Ma, Aisheng; Cao, Lanqin; Wu, Xiaoming; Chen, Biyun; Tian, Hui; Gao, Yajun

2017-01-01

Oilseed rape (Brassica napus) characteristically has high N uptake efficiency and low N utilization efficiency (NUtE, seed yield/shoot N accumulation). Determining the NUtE phenotype of various genotypes in different growth conditions is a way of finding target traits to improve oilseed rape NUtE. The aim of this study was to compare oilseed rape genotypes grown on contrasting N supply rates in pot and field experiments to investigate the genotypic variations of NUtE and to identify indicators of N efficient genotypes. For 50 oilseed rape genotypes, NUtE, dry matter and N partitioning, morphological characteristics, and the yield components were investigated under high and low N supplies in a greenhouse pot experiment and a field trial. Although the genotype rankings of NUtE were different between the pot experiment and the field trial, some genotypes performed consistently in both two environments. N-responder, N-nonresponder, N-efficient and N-inefficient genotypes were identified from these genotypes with consistent NUtE. The correlations between the pot experiment and the field trial in NUtE were only 0.34 at high N supplies and no significant correlations were found at low N supplies. However, Pearson coefficient correlation (r) and principal component analysis showed NUtE had similar genetic correlations with other traits across the pot and field experiment. Among the yield components, only seeds per silique showed strong and positive correlations with NUtE under varying N supply in both experiments (r = 0.47**; 0.49**; 0.47**; 0.54**). At high and low N supply, NUtE was positively correlated with seed yield (r = 0.45**; 0.53**; 0.39**; 0.87**), nitrogen harvest index (NHI, r = 0.68**; 0.82**; 0.99**; 0.89**), and harvest index (HI, r = 0.79**; 0.83**; 0.90**; 0.78**) and negatively correlated with biomass distribution to stem and leaf (r = −0.34**; −0.45**; −0.37**; 0.62**), all aboveground plant section N concentration (r from −0.30* to −0.80**), N distribution to the vegetative parts (silique husk, stem and leaf) (r from −0.40** to −0.83**). N-efficient (N-responder) genotypes produced more seeds per silique and had significantly higher NHI and HI than did N-inefficient (N-nonresponder) genotypes. In conclusion, across the pot and field experiments, the 50 genotypes had similar underlying traits correlated with NUtE and seeds per silique may be a good indicator of NUtE. PMID:29163565

Integrated approach for disease management and growth enhancement of Sesamum indicum L. utilizing Azotobacter chroococcum TRA2 and chemical fertilizer.

PubMed

Maheshwari, D K; Dubey, R C; Aeron, Abhinav; Kumar, Bhavesh; Kumar, Sandeep; Tewari, Sakshi; Arora, Naveen Kumar

2012-10-01

Azotobacter chroococcum TRA2, an isolate of wheat rhizosphere displayed plant growth promoting attributes including indole acetic acid, HCN, siderophore production, solubilization of inorganic phosphate and fixation of atmospheric nitrogen. In addition, it showed strong antagonistic effect against Macrophomina phaseolina and Fusarium oxysporum. It also caused degradation and digestion of cell wall components, resulting in hyphal perforations, empty cell (halo) formation, shrinking and lysis of fungal mycelia along with significant degeneration of conidia. Fertilizer adaptive variant strain of A. chroococcum TRA2 was studied with Tn5 induced streptomycin resistant transconjugants of wild type tetracycline-resistant TRA2 (designated TRA2(tetra+strep+)) after different durations. The strain was significantly competent in rhizosphere, as its population increased by 15.29 % in rhizosphere of Sesamum indicum. Seed bacterization with the strain TRA2 resulted in significant increase in vegetative growth parameters and yield of sesame over the non-bacterized seeds. However, application of TRA2 with half dose of fertilizers showed sesame yield almost similar to that obtained by full dose treatment. Moreover, the oil yield increased by 24.20 %, while protein yield increased by 35.92 % in treatment receiving half dose of fertilizer along with TRA2 bacterized seeds, as compared to untreated control.

Processing scale-up of sicklepod (Senna obtusifolia L.) seed.

PubMed

Harry-O'Kuru, Rogers E; Mohamed, Abdellatif

2009-04-08

Sicklepod (Senna obtusifolia L.) is an invasive weed species especially of soybean and other field crops in the southeastern United States. The seeds contain a small amount (5-7%) of a highly colored fat as well as various phenolics, proteins, and galactomannans. The color of sicklepod seed oil is such that the presence of a small amount of the weed seed in a soybean crush lowers the quality of the soybean oil. Sicklepod is very prolific, and even volunteer stands yield >1000 lb of seed per acre, and prudence calls for tapping the potential of this weed as an alternative economic crop in the affected region. Pursuant to this, we have shown in laboratory-scale work the feasibility of separating the components of sicklepod seed. However, at kilogram and higher processing quantities, difficulties arise leading to modification of the earlier approach in order to efficiently separate components of the defatted seed meal. In a version for cleanly separating the proteins, the defatted meal was extracted with 0.5 M NaCl solution to remove globular proteins. Prolamins were extracted from the pellet left after salt extraction using 80% ethanol, and glutelins were then obtained in 0.1 N alkali from the residual solids left from ethanol treatment. In a pilot-scale version for water-soluble polysaccharides, the defatted meal was stirred with deionized water (DI) and centrifuged. The pooled centrifugates were heated to 92 degrees C (20-25 min), filtered, cooled to room temperature, and passed through a column of Amberlite XAD-4 to separate the polysaccharides from the anthraquinones. Senna obtusifolia L. is a one-stop-shop of a seed (from food components to medicinals).

[Cytogenetic effects in experimental exposure to the heavy charged particles of galactic cosmic radiation on the Kosmos-1129 biosatellite].

PubMed

Nevzgodina, L V; Maksimova, E N

1982-01-01

The experiment was carried out on lattice (Lactuca sativa) seeds flown in a biocontainer equipped with plastic detectors to record heavy charged particles (HCP). The purpose of the experiment was to determine the yield of aberrant cells as a result of irradiation, and to identify this effect as a function of HCP topography in the seed. The cytogenetic examination of flight seedlings revealed a significant difference between the seeds which were hit with HCP and those that remained intact. This indicates a significant contribution of the heavy component of galactic cosmic rediation into the radiobiological effect. The relationship between the radiobiological effect and the HCP topography in the seed was established: zones of the root and stem meristema proved to be most sensitive targets.

Yield and composition of grape seed oils extracted by supercritical carbon dioxide and petroleum ether: varietal effects.

PubMed

Beveridge, Thomas H J; Girard, Benoit; Kopp, Thomas; Drover, John C G

2005-03-09

Grape seed has a well-known potential for production of oil as a byproduct of winemaking and is currently produced as a specialty oil byproduct of wine manufacture. Seed oils from eight varieties of grapes crushed for wine production in British Columbia were extracted by supercritical carbon dioxide (SCE) and petroleum ether (PE). Oil yields by SCE ranged from 5.85 +/- 0.33 to 13.6 +/- 0.46% (w/w), whereas PE yields ranged from 6.64 +/- 0.16 to 11.17 +/- 0.05% (+/- is standard deviation). The oils contained alpha-, beta-, and gamma-tocopherols and alpha- and gamma-tocotrienols, with gamma-tocotrienol being most important quantitatively. In both SCE- and PE-extracted oils, phytosterols were a prominent feature of the unsaponifiable fraction, with beta-sitosterol quantitatively most important with both extractants. Total phytosterol extraction was higher with SCE than with PE in seven of eight variety extractions. Fatty acid composition of oils from all varieties tested, and from both extraction methods, indicated linoleic acid as the major component ranging from 67.56 to 73.23% of the fatty acids present, in agreement with literature reports.

Chemicals involved in honeybee-sunflower relationship.

PubMed

Pham-Delegue, M H; Etievant, P; Guichard, E; Marilleau, R; Douault, P; Chauffaille, J; Masson, C

1990-11-01

We present a review of work on the plant chemicals involved in the honeybee-sunflower model system. Combined behavioral and chemical analyses were conducted under natural and controlled conditions. First the distribution of forager bees' visits on two pairs of sunflower genotypes producing a different level of hybrid seed yield was recorded under pollen-proof tunnels. Mirasol parental lines producing high seed yields were visited at random, whereas forager bees visited preferentially the female parental line of Marianne, resulting in low seed yield. Nectar samples collected on the genotypes were analyzed by gas chromatography. Fructose, glucose, and sucrose were identified. Parental lines of Mirasol showed similar sugar profiles, whereas the female line of Marianne contained higher amounts of sucrose than the male line. We assume that the bees' preferences between genotypes might rely on differences in the sugar composition of floral nectars, especially in the amount of sucrose. Aromas from headspace collection were compared between pairs and periodically during the flowering period. Of the 144 components indexed for Marianne lines and 136 components for Mirasol lines, 17 of the components for Marianne lines and 18 for Mirasol lines differed significantly according to flowering stage. Significant differences appeared in eight of the 134 components of Marianne lines and in 20 of the 250 components for Mirasol lines. Such differences, even restricted to a few components, might account for honeybees' discrimination between genotypes or flowering stage. Experiments then were conducted in a flight room using an artificial flower device. A total volatile extract was used as a conditioning scent previous to the test where the total extract was successively compared to several of its subfractions. Fractions significantly less visited than the total extract were discarded, whereas fractions confused with the total extract were kept. From step to step, a restricted fraction of 28 polar components, among which 15 were identified, was shown to be as active as the initial conditioning extract. These data emphasized honeybees' abilities to generalize from simplified to more complex chemical information. Finally, this work considers the possible use of such plant chemicals, from nectars or aromas, either as targets for genetic modification of crop plants or as direct attractants when sprayed on the crop, for the improvement of entomophilous cross pollination.

Effects of physical agitation on yield of greenhouse-grown soybean

NASA Technical Reports Server (NTRS)

Jones, R. S.; Mitchell, C. A.

1992-01-01

Agronomic and horticultural crop species experience reductions in growth and harvestable yield after exposure to physical agitation (also known as mechanical stress), as by wind or rain. A greenhouse study was conducted to test the influence of mechanical stress on soybean yield and to determine if exposure to mechanical stress during discrete growth periods has differential effects on seed yield. A modified rotatory shaker was used to apply seismic (i.e., shaking) stress. Brief, periodic episodes of seismic stress reduced stem length, total seed dry weight, and seed number of soybean [Glycine max (L.) Merr.]. Lodging resistance was greater for plants stressed during vegetative growth or throughout vegetative and reproductive growth than during reproductive growth only. Seed dry weight yield was reduced regardless of the timing or duration of stress application, but was lowest when applied during reproductive development. Seismic stress applied during reproductive growth stages R1 to R2 (Days 3 to 4) was as detrimental to seed dry weight accumulation as was stress applied during growth stages R1 to R6 (Days 39 to 42). Seed dry weight per plant was highly correlated with seed number per plant, and seed number was correlated with the seed number of two- and three-seeded pods. Dry weight per 100 seeds was unaffected by seismic-stress treatment. Growth and yield reductions resulting from treatments applied only during the vegetative stage imply that long-term mechanical effects were induced, from which the plants did not fully recover. It is unclear which yield-controlling physiological processes were affected by mechanical stress. Both transient and long-term effects on yield-controlling processes remain to be elucidated.

Peat Processing

NASA Technical Reports Server (NTRS)

1986-01-01

Humics, Inc. already had patented their process for separating wet peat into components and processing it when they consulted NERAC regarding possible applications. The NERAC search revealed numerous uses for humic acid extracted from peat. The product improves seed germination, stimulates root development, and improves crop yields. There are also potential applications in sewage disposal and horticultural peat, etc.

Variability in arginine content and yield components in Valencia peanut germplasm

USDA-ARS?s Scientific Manuscript database

Peanut seeds are rich in arginine, an amino acid that has several positive effects on human health. Establishing the genetic variability of arginine content in peanut will be useful for breeding programs that have high arginine as one of their goals. The objective of this study was to evaluate the...

Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

PubMed

Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

2006-02-01

Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

Manipulation of Auxin Response Factor 19 affects seed size in the woody perennial Jatropha curcas

PubMed Central

Sun, Yanwei; Wang, Chunming; Wang, Ning; Jiang, Xiyuan; Mao, Huizhu; Zhu, Changxiang; Wen, Fujiang; Wang, Xianghua; Lu, Zhijun; Yue, Genhua; Xu, Zengfu; Ye, Jian

2017-01-01

Seed size is a major determinant of seed yield but few is known about the genetics controlling of seed size in plants. Phytohormones cytokinin and brassinosteroid were known to be involved in the regulation of herbaceous plant seed development. Here we identified a homolog of Auxin Response Factor 19 (JcARF19) from a woody plant Jatropha curcas and genetically demonstrated its functions in controlling seed size and seed yield. Through Virus Induced Gene Silencing (VIGS), we found that JcARF19 was a positive upstream modulator in auxin signaling and may control plant organ size in J. curcas. Importantly, transgenic overexpression of JcARF19 significantly increased seed size and seed yield in plants Arabidopsis thaliana and J. curcas, indicating the importance of auxin pathway in seed yield controlling in dicot plants. Transcripts analysis indicated that ectopic expression of JcARF19 in J. curcas upregulated auxin responsive genes encoding essential regulators in cell differentiation and cytoskeletal dynamics of seed development. Our data suggested the potential of improving seed traits by precisely engineering auxin signaling in woody perennial plants. PMID:28102350

Relation between salt tolerance and biochemical changes in cumin (Cuminum cyminum L.) seeds.

PubMed

Bettaieb Rebey, Iness; Bourgou, Soumaya; Rahali, Fatma Zohra; Msaada, Kamel; Ksouri, Riadh; Marzouk, Brahim

2017-04-01

In this study, the effects of salinity on growth, fatty acid, essential oil, and phenolic composition of cumin (Cuminum cyminum L.) seeds as well as the antioxidant activities of their extracts were investigated. Plants were treated with different concentrations of NaCl treatment: 0, 50, 75, and 125 mmoL. Plant growth was significantly reduced with the severity of saline treatment. This also caused important reductions in the seed yield and yield components. Besides, NaCl treatments affected fatty acid composition. Petroselinic and linoleic acids proportions diminished consistently with the increase in NaCl concentration, whereas palmitic acid proportion increased. Furthermore, NaCl enhanced essential oil production in C. cyminum seeds and induced marked changes on the essential oil quality. Essential oil chemotype was modified from γ-terpinene/1-phenyl-1,2 ethanediol in control to γ-terpinene/β-pinene in salt stressed plants. Total polyphenol content was higher in treated seeds, and salinity improved the amount of individual phenolic compounds. Moreover, antioxidant activities of the extracts were determined by four different test systems, namely 2,2-diphenyl-1-picrylhydrazyl, β-carotene/linoleic acid chelating, and reducing power assays. The highest antioxidant activities were reveled in severe stressed plants. In this case, cumin seeds produced under saline conditions may function as a potential source of essential oil and antioxidant compounds, which could support the utilization of this plant in a large field of applications such as food industry. Copyright © 2016. Published by Elsevier B.V.

Phenotypic and Transcriptional Analysis of Divergently Selected Maize Populations Reveals the Role of Developmental Timing in Seed Size Determination1[W][OPEN

PubMed Central

Sekhon, Rajandeep S.; Hirsch, Candice N.; Childs, Kevin L.; Breitzman, Matthew W.; Kell, Paul; Duvick, Susan; Spalding, Edgar P.; Buell, C. Robin; de Leon, Natalia; Kaeppler, Shawn M.

2014-01-01

Seed size is a component of grain yield and an important trait in crop domestication. To understand the mechanisms governing seed size in maize (Zea mays), we examined transcriptional and developmental changes during seed development in populations divergently selected for large and small seed size from Krug, a yellow dent maize cultivar. After 30 cycles of selection, seeds of the large seed population (KLS30) have a 4.7-fold greater weight and a 2.6-fold larger size compared with the small seed population (KSS30). Patterns of seed weight accumulation from the time of pollination through 30 d of grain filling showed an earlier onset, slower rate, and earlier termination of grain filling in KSS30 relative to KLS30. This was further supported by transcriptome patterns in seeds from the populations and derived inbreds. Although the onset of key genes was earlier in small seeds, similar maximum transcription levels were observed in large seeds at later stages, suggesting that functionally weaker alleles, rather than transcript abundance, may be the basis of the slow rate of seed filling in KSS30. Gene coexpression networks identified several known genes controlling cellularization and proliferation as well as novel genes that will be useful candidates for biotechnological approaches aimed at altering seed size in maize and other cereals. PMID:24710068

Yield and quality of seed from yellow birch progenies.

Treesearch

Knud E. Clausen

1980-01-01

Seed yield in 8- ad 9-year-old yellow birch varied among families and years but averaged more than 1,500 seeds per tree. Long catkins contained more seed than short ones. Seed quality was poor due to insufficient pollination and to differences among trees in flowering phenology.

Phenology and Seed Yield Performance of Determinate Soybean Cultivars Grown at Elevated Temperatures in a Temperate Region.

PubMed

Choi, Doug-Hwan; Ban, Ho-Young; Seo, Beom-Seok; Lee, Kyu-Jong; Lee, Byun-Woo

2016-01-01

Increased temperature means and fluctuations associated with climate change are predicted to exert profound effects on the seed yield of soybean. We conducted an experiment to evaluate the impacts of global warming on the phenology and yield of two determinate soybean cultivars in a temperate region (37.27°N, 126.99°E; Suwon, South Korea). These two soybean cultivars, Sinpaldalkong [maturity group (MG) IV] and Daewonkong (MG VI), were cultured on various sowing dates within a four-year period, under no water-stress conditions. Soybeans were kept in greenhouses controlled at the current ambient temperature (AT), AT+1.5°C, AT+3.0°C, and AT+5.0°C throughout the growth periods. Growth periods (VE-R7) were significantly prolonged by the elevated temperatures, especially the R1-R5 period. Cultivars exhibited no significant differences in seed yield at the AT+1.5°C and AT+3.0°C treatments, compared to AT, while a significant yield reduction was observed at the AT+5.0°C treatment. Yield reductions resulted from limited seed number, which was due to an overall low numbers of pods and seeds per pod. Heat stress conditions induced a decrease in pod number to a greater degree than in seed number per pod. Individual seed weight exhibited no significant variation among temperature elevation treatments; thus, seed weight likely had negligible impacts on overall seed yield. A boundary line analysis (using quantile regression) estimated optimum temperatures for seed number at 26.4 to 26.8°C (VE-R5) for both cultivars; the optimum temperatures (R5-R7) for single seed weight were estimated at 25.2°C for the Sinpaldalkong smaller-seeded cultivar, and at 22.3°C for the Daewonkong larger-seeded cultivar. The optimum growing season (VE-R7) temperatures for seed yield, which were estimated by combining the two boundary lines for seed number and seed weight, were 26.4 and 25.0°C for the Sinpaldalkong and Daewonkong cultivars, respectively. Considering the current soybean growing season temperature, which ranges from 21.7 (in the north) to 24.6°C (in the south) in South Korea, and the temperature response of potential soybean yields, further warming of less than approximately 1°C would not become a critical limiting factor for soybean production in South Korea.

Using the candidate gene approach for detecting genes underlying seed oil concentration and yield in soybean.

PubMed

Eskandari, Mehrzad; Cober, Elroy R; Rajcan, Istvan

2013-07-01

Increasing the oil concentration in soybean seeds has been given more attention in recent years because of demand for both edible oil and biodiesel production. Oil concentration in soybean is a complex quantitative trait regulated by many genes as well as environmental conditions. To identify genes governing seed oil concentration in soybean, 16 putative candidate genes of three important gene families (GPAT: acyl-CoA:sn-glycerol-3-phosphate acyltransferase, DGAT: acyl-CoA:diacylglycerol acyltransferase, and PDAT: phospholipid:diacylglycerol acyltransferase) involved in triacylglycerol (TAG) biosynthesis pathways were selected and their sequences retrieved from the soybean database ( http://www.phytozome.net/soybean ). Three sequence mutations were discovered in either coding or noncoding regions of three DGAT soybean isoforms when comparing the parents of a 203 recombinant inbreed line (RIL) population; OAC Wallace and OAC Glencoe. The RIL population was used to study the effects of these mutations on seed oil concentration and other important agronomic and seed composition traits, including seed yield and protein concentration across three field locations in Ontario, Canada, in 2009 and 2010. An insertion/deletion (indel) mutation in the GmDGAT2B gene in OAC Wallace was significantly associated with reduced seed oil concentration across three environments and reduced seed yield at Woodstock in 2010. A mutation in the 3' untranslated (3'UTR) region of GmDGAT2C was associated with seed yield at Woodstock in 2009. A mutation in the intronic region of GmDGAR1B was associated with seed yield and protein concentration at Ottawa in 2010. The genes identified in this study had minor effects on either seed yield or oil concentration, which was in agreement with the quantitative nature of the traits. However, the novel gene-specific markers designed in the present study can be used in soybean breeding for marker-assisted selection aimed at increasing seed yield and oil concentration with no significant impact on seed protein concentration.

Anatomy and cell wall polysaccharides of almond (Prunus dulcis D. A. Webb) seeds.

PubMed

Dourado, Fernando; Barros, António; Mota, Manuel; Coimbra, Manuel A; Gama, Francisco M

2004-03-10

The anatomy of Prunus dulcis was analyzed by applying several differential staining techniques and light microscopy. Prunus dulcis seed has a thin and structurally complex seed coat, with lignified cellulosic tissue. The embryo has two voluminous cotyledons. Cotyledon cells have a high number of protein and lipid bodies, some of which have phytin. The provascular tissue, located in the cotyledons, is oriented in small bundles perpendicular to the transverse embryonic axis. Prunus dulcis cell wall material is very rich in arabinose (45 mol %). Glucose (23%), uronic acids (12%), and xylose (12%) are also major sugar components. The polymers obtained from the imidazole and Na(2)CO(3) extracts contain mainly pectic substances rich in arabinose, but the sugar content of these extracts was very low. The majority of the pectic substances (also rich in arabinose) was recovered with the KOH extracts. These extracts, with high sugar content, yielded also xyloglucans and acidic xylans. The 4 M KOH + H(3)BO(3) extracts yielded polysaccharides rich in uronic acids and xylose and very rich in arabinose, accounting for 27% of the cell wall material.

Genetic control of soybean seed oil: II. QTL and genes that increase oil concentration without decreasing protein or with increased seed yield.

PubMed

Eskandari, Mehrzad; Cober, Elroy R; Rajcan, Istvan

2013-06-01

Soybean [Glycine max (L.) Merrill] seed oil is the primary global source of edible oil and a major renewable and sustainable feedstock for biodiesel production. Therefore, increasing the relative oil concentration in soybean is desirable; however, that goal is complex due to the quantitative nature of the oil concentration trait and possible effects on major agronomic traits such as seed yield or protein concentration. The objectives of the present study were to study the relationship between seed oil concentration and important agronomic and seed quality traits, including seed yield, 100-seed weight, protein concentration, plant height, and days to maturity, and to identify oil quantitative trait loci (QTL) that are co-localized with the traits evaluated. A population of 203 F4:6 recombinant inbred lines, derived from a cross between moderately high oil soybean genotypes OAC Wallace and OAC Glencoe, was developed and grown across multiple environments in Ontario, Canada, in 2009 and 2010. Among the 11 QTL associated with seed oil concentration in the population, which were detected using either single-factor ANOVA or multiple QTL mapping methods, the number of QTL that were co-localized with other important traits QTL were six for protein concentration, four for seed yield, two for 100-seed weight, one for days to maturity, and one for plant height. The oil-beneficial allele of the QTL tagged by marker Sat_020 was positively associated with seed protein concentration. The oil favorable alleles of markers Satt001 and GmDGAT2B were positively correlated with seed yield. In addition, significant two-way epistatic interactions, where one of the interacting markers was solely associated with seed oil concentration, were identified for the selected traits in this study. The number of significant epistatic interactions was seven for yield, four for days to maturity, two for 100-seed weight, one for protein concentration, and one for plant height. The identified molecular markers associated with oil-related QTL in this study, which also have positive effects on other important traits such as seed yield and protein concentration, could be used in the soybean marker breeding programs aimed at developing either higher seed yield and oil concentration or higher seed protein and oil concentration per hectare. Alternatively, selecting complementary parents with greater breeding values due to positive epistatic interactions could lead to the development of higher oil soybean cultivars.

Seed set in guayule (Parthenium argentatum, Asteraceae) in relation to insect pollination

DOE Office of Scientific and Technical Information (OSTI.GOV)

Mamood, A.N.; Waller, G.D.; Ray, D.T.

Guayule (Parthenium argentatum, Asteraceae) is one of two major plant species grown for natural rubber. Studies were conducted to determine the effect of honey bee (Apis mellifera) pollination and season on seed set and total seed yield/ha. The experiments involved four pollination treatments: plants caged with bees; plants caged without bees; plants open pollinated (uncovered); and plants individually covered. Seeds were harvested monthly July-September 1984, and May-September 1985. Plots with bees produced at least 150% more seeds than plots without bees, and there were no qualitative differences in the seed weights among treatments. Highest seed yield was in May andmore » September. Results indicate that (1) insect pollination in guayule increases seed yield and (2) fewer seeds are produced in the warmest months.« less

Efficacy of Selected Insecticides Applied to Hybrid Rice Seed

PubMed Central

Adams, A.; Gore, J.; Musser, F.; Cook, D.; Walker, T.; Dobbins, C.

2016-01-01

Hybrid rice and insecticide seed treatments targeting rice water weevil, Lissorhoptrus oryzophilus Kuschel, have altered the landscape of rice production. The effect of reduced seeding rates on seed treatment efficacy in hybrid rice has not been studied. During 2011 and 2012, an experiment was conducted at seven locations to determine the relationship between low seeding rates used in hybrid rice and efficacy of selected insecticidal seed treatments as measured by rice water weevil densities and yield. Labeled rates of thiamethoxam, chlorantraniliprole, and clothianidin were compared with higher rates of these products to determine if labeled rates provide an acceptable level of control of the rice water weevil. Study locations were divided into low, moderate, and high groups based on rice water weevil larval densities. All seed treatments and seed treatment rates reduced rice water weevil densities. However, there was no observed yield or economic benefit from the use of an insecticidal seed treatment in areas of low pressure. Differences in yield were observed among seed treatments and seed treatment rates in moderate and high pressure locations, and all seed treatments yielded better than the untreated plots, but these differences were not always economical. All seed treatments showed an economic advantage in areas of high weevil pressure, and there were no differences among seed treatment products or rates, suggesting that currently labeled seed treatment rates in hybrid rice are effective for rice water weevil management. PMID:26537671

Multigene Engineering of Triacylglycerol Metabolism Boosts Seed Oil Content in Arabidopsis1[W][OPEN

PubMed Central

van Erp, Harrie; Kelly, Amélie A.; Menard, Guillaume; Eastmond, Peter J.

2014-01-01

Increasing the yield of oilseed crops is an important objective for biotechnologists. A number of individual genes involved in triacylglycerol metabolism have previously been reported to enhance the oil content of seeds when their expression is altered. However, it has yet to be established whether specific combinations of these genes can be used to achieve an additive effect and whether this leads to enhanced yield. Using Arabidopsis (Arabidopsis thaliana) as an experimental system, we show that seed-specific overexpression of WRINKLED1 (a transcriptional regulator of glycolysis and fatty acid synthesis) and DIACYLGLYCEROL ACYLTRANSFERASE1 (a triacylglycerol biosynthetic enzyme) combined with suppression of the triacylglycerol lipase SUGAR-DEPENDENT1 results in a higher percentage seed oil content and greater seed mass than manipulation of each gene individually. Analysis of total seed yield per plant suggests that, despite a reduction in seed number, the total yield of oil is also increased. PMID:24696520

Environmental effect on yield, composition and technological seed traits of some Italian ecotypes of grass pea (Lathyrus sativus L.).

PubMed

Piergiovanni, Angela R; Lupo, Francesco; Zaccardelli, Massimo

2011-01-15

Grass pea seeds are a good source of vegetable proteins, but the presence of toxic and antinutritional compounds represents a barrier to their large-scale use as food or animal feed. How much growing location and/or seasonal climate might affect the storage of these factors has been little investigated. Fourteen Italian ecotypes of grass pea were cultivated in two locations in southern Italy characterised by different climatic conditions. The seven ecotypes with the best yields and/or seed quality were investigated for a further two growing seasons. From a statistical point of view the physicochemical and nutritional traits among ecotypes were not the same from one year to the next. Moreover, a significant positive correlation was found between β-oxalyl-diamino-propionic acid and trypsin inhibitor contents. The lowest levels of both these compounds were associated with the highest amount of rainfall during the plant vegetative cycle. Principal component analysis of the data showed that the overall seed composition was affected by the growing location. Consequently, each grass pea genotype should also be carefully investigated in relation to different environments before being considered for release as safe for widespread human or animal consumption. Copyright © 2010 Society of Chemical Industry.

Extraction of methylxanthines from guaraná seeds, maté leaves, and cocoa beans using supercritical carbon dioxide and ethanol.

PubMed

Saldaña, Marleny D A; Zetzl, Carsten; Mohamed, Rahoma S; Brunner, G

2002-08-14

New experimental data on the extraction of caffeine from guaraná seeds and maté tea leaves, and theobromine from cocoa beans, with supercritical CO2 were obtained using a high-pressure extraction apparatus. The effect of the addition of ethanol to carbon dioxide on the extraction efficiency was also investigated. Caffeine extraction yields of 98% of the initial caffeine content in both wet ground guaraná seeds and maté tea leaves were obtained. Extractions of caffeine from guaraná seeds and maté tea leaves also exhibited a retrograde behavior for the two temperatures considered in this work. In the removal of theobromine from cocoa beans, a much smaller extraction yield was obtained with longer extraction periods and consequently larger solvent requirements. The results of this study confirm the higher selectivity of CO2 for caffeine in comparison with that for theobromine, and also the influence of other components in each particular natural product on the extraction of methylxanthines. The effect of the addition of ethanol to carbon dioxide on the extraction of methylxanthines was significant, particularly in the extraction of theobromine from cocoa beans. In general, the use of ethanol results in lower solvent and energy requirements and thereby improved extraction efficiency.

Impact of Thiamethoxam Seed Treatment on Growth and Yield of Rice, Oryza sativa.

PubMed

Lanka, S K; Senthil-Nathan, S; Blouin, D J; Stout, M J

2017-04-01

Neonicotinoid seed treatments are widely used in agriculture. In rice, Oryza sativa L., in the southern United States, neonicotinoid seed treatments are used to manage early-season populations of the rice water weevil, Lissorhoptrus oryzophilus Kuschel. In addition to their effects on pests, neonicotinoid seed treatments may benefit crop plants directly by increasing plant growth or altering plant responses to stresses. As part of an effort to assess the overall benefits of thiamethoxam seed treatment in rice, rice emergence, growth, and yield were evaluated. In a growth chamber, rice emergence from the soil was 1-2 d more rapid from treated than untreated seeds. These laboratory results were supported by field experiments that revealed higher stand counts from thiamethoxam-treated plots than from untreated plots. Yields from thiamethoxam treatments were no higher than those from untreated plots under conditions in which weevil larvae were absent, a result inconsistent with the hypothesis that thiamethoxam imparts direct yield benefits. In a series of field experiments conducted to compare the relationship between weevil larval densities and rice yields in plots treated with several rates of thiamethoxam or chlorantraniliprole (another widely used seed treatment insecticide), the relationship between weevil density and yield did not differ markedly among both seed treatments. Overall yields from both seed treatments did not differ significantly, despite more effective control in chlorantraniliprole-treated plots. These results provide strong support for effect of thiamethoxam on early-season growth of rice, but only weak support for its direct effect on rice yields. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Neck blast disease influences grain yield and quality traits of aromatic rice.

PubMed

Khan, Mohammad Ashik Iqbal; Bhuiyan, Md Rejwan; Hossain, Md Shahadat; Sen, Partha Pratim; Ara, Anjuman; Siddique, Md Abubakar; Ali, Md Ansar

2014-11-01

A critical investigation was conducted to find out the effect of neck blast disease on yield-contributing characters, and seed quality traits of aromatic rice in Bangladesh. Both healthy and neck-blast-infected panicles of three aromatic rice cultivars (high-yielding and local) were collected and investigated at Plant Pathology Division, Bangladesh Rice Research Institute (BRRI), Gazipur, Bangladesh. All of the tested varieties were highly susceptible to neck blast disease under natural conditions, though no leaf blast symptoms appear on leaves. Neck blast disease increased grain sterility percentages, reduced grain size, yield and quality traits of seeds. The degrees of yield and seed quality reduction depended on disease severity and variety's genetic make-up. Unfilled grains were the main source of seed-borne pathogen, especially for blast in the seed lot. Transmission of blast pathogen from neck (panicle base) to seed was very poor. These findings are important, especially concerning the seed certification programme in which seed lots are certified on the basis of field inspection. Finally, controlled experiments are needed to draw more critical conclusions. Copyright © 2014 Académie des sciences. Published by Elsevier SAS. All rights reserved.

Predicted global warming scenarios impact on the mother plant to alter seed dormancy and germination behaviour in Arabidopsis.

PubMed

Huang, Z; Footitt, S; Tang, A; Finch-Savage, W E

2018-01-01

Seed characteristics are key components of plant fitness that are influenced by temperature in their maternal environment, and temperature will change with global warming. To study the effect of such temperature changes, Arabidopsis thaliana plants were grown to produce seeds along a uniquely designed polyethylene tunnel having a thermal gradient reflecting local global warming predictions. Plants therefore experienced the same variations in temperature and light conditions but different mean temperatures. A range of seed-related plant fitness estimates were measured. There were dramatic non-linear temperature effects on the germination behaviour in two contrasting ecotypes. Maternal temperatures lower than 15-16 °C resulted in significantly greater primary dormancy. In addition, the impact of nitrate in the growing media on dormancy was shown only by seeds produced below 15-16 °C. However, there were no consistent effects on seed yield, number, or size. Effects on germination behaviour were shown to be a species characteristic responding to temperature and not time of year. Elevating temperature above this critical value during seed development has the potential to dramatically alter the timing of subsequent seed germination and the proportion entering the soil seed bank. This has potential consequences for the whole plant life cycle and species fitness. © 2017 John Wiley & Sons Ltd.

Effects of fungicide seed treatments on germination, population, and yield of maize grown from seed infected with fungal pathogens

USDA-ARS?s Scientific Manuscript database

Seedborne fungi can reduce survival, growth, and yield of maize (Zea mays L.). Laboratory, field, and growth chamber experiments were conducted to determine the effects of the seed treatment fungicides fludioxonil, mefenoxam, and azoxystrobin on germination, plant population, and grain yield of maiz...

Quantitative genetic studies relating to the domestication of meadowfoam (Limnanthes spp. ) as a new oil crop

DOE Office of Scientific and Technical Information (OSTI.GOV)

Abuelgasim, E.H.

1982-01-01

Meadowfoam (Limnanthes spp.) has recently aroused interest as a promising new source of industrial oil that is a good substitute for sperm whale oil. Fourteen natural populations of Limnanthes, involving two species and five taxonomic varieties, were studied for 12 quantitative characters, during two seasons. The objectives were: to evaluate the potential use of the populations for domestication purposes, study the interrelationships among characters, and to obtain heritability estimates for some of the important characters. A great deal of variability among the populations was observed for all the characters studied. Although no single taxon or population had all the desiredmore » characters combined, nevertheless, three populations of L. douglasii var. nivea and one population of L. douglasii var. sulphurea, gave consistently higher values for seed yield, seed number, plant dry weight, harvest index and fertility index, than L. alba or L. douglasii var. douglasii populations. The nivea group was also the earliest to flower, however, this group together with var. sulphurea population, suffer from severe seed shattering at maturity. In both seasons, seed yield was positively and highly significantly correlated with all of the other characters with the exception of days to the first flower and days to flower, which showed a highly significant negative correlation with seed yield. Stepwise multiple regression and path-coefficient analyses showed that seed number was the most important character in contribution to variation in seed yield; it accounted for over 85% of the variation in seed yield. The four characters: seed number, 100-seed weight, plant dry weight and harvest index, in that order, were the most important characters to be included in a multiple regression equation for determination of seed yield.« less

Bioinoculants: A sustainable approach to maximize the yield of Ethiopian mustard (Brassica carinata L.) under low input of chemical fertilizers.

PubMed

Nosheen, Asia; Bano, Asghari; Ullah, Faizan

2016-02-01

This study aimed to find out the effect of plant growth-promoting rhizobacteria (PGPR; Azospirillum brasilense and Azotobacter vinelandii) either alone or in combination with different doses of nitrogen and phosphate fertilizers on growth, seed yield, and oil quality of Brassica carinata (L.) cv. Peela Raya. PGPR were applied as seed inoculation at 10(6) cells/mL(-1) so that the number of bacterial cells per seed was 2.6 × 10(5) cells/seed. The chemical fertilizers, namely, urea and diammonium phosphate (DAP) were applied in different doses (full dose (urea 160 kg ha(-1) + DAP 180 kg ha(-1)), half dose (urea 80 kg ha(-1) + DAP 90 kg ha(-1)), and quarter dose (urea 40 kg ha(-1) + DAP 45 kg ha(-1)). The chemical fertilizers at full and half dose significantly increased the chlorophyll, carotenoids, and protein content of leaves and the seed yield (in kilogram per hectare) but had no effect on the oil content of seed. The erucic acid (C22:1) content present in the seed was increased. Azospirillum performed better than Azotobacter and its effect was at par with full dose of chemical fertilizers (CFF) for pigments and protein content of leaves when inoculated in the presence of half dose of chemical fertilizers (SPH). The seed yield and seed size were greater. Supplementing Azospirillum with SPH assisted Azospirillum to augment the growth and yield, reduced the erucic acid (C22:1) and glucosinolates contents, and increased the unsaturation in seed oil. It is inferred that A. brasilense could be applied as an efficient bioinoculant for enhancing the growth, seed yield, and oil quality of Ethiopian mustard at low fertilizer costs and sustainable ways. © The Author(s) 2013.

OsCNGC13 promotes seed-setting rate by facilitating pollen tube growth in stylar tissues.

PubMed

Xu, Yang; Yang, Jie; Wang, Yihua; Wang, Jiachang; Yu, Yang; Long, Yu; Wang, Yunlong; Zhang, Huan; Ren, Yulong; Chen, Jun; Wang, Ying; Zhang, Xin; Guo, Xiuping; Wu, Fuqing; Zhu, Shanshan; Lin, Qibing; Jiang, Ling; Wu, Chuanyin; Wang, Haiyang; Wan, Jianmin

2017-07-01

Seed-setting rate is a critical determinant of grain yield in rice (Oryza sativa L.). Rapid and healthy pollen tube growth in the style is required for high seed-setting rate. The molecular mechanisms governing this process remain largely unknown. In this study, we isolate a dominant low seed-setting rate rice mutant, sss1-D. Cellular examination results show that pollen tube growth is blocked in about half of the mutant styles. Molecular cloning and functional assays reveals that SSS1-D encodes OsCNGC13, a member of the cyclic nucleotide-gated channel family. OsCNGC13 is preferentially expressed in the pistils and its expression is dramatically reduced in the heterozygous plant, suggesting a haploinsufficiency nature for the dominant mutant phenotype. We show that OsCNGC13 is permeable to Ca2+. Consistent with this, accumulation of cytoplasmic calcium concentration ([Ca2+]cyt) is defective in the sss1-D mutant style after pollination. Further, the sss1-D mutant has altered extracellular matrix (ECM) components and delayed cell death in the style transmission tract (STT). Based on these results, we propose that OsCNGC13 acts as a novel maternal sporophytic factor required for stylar [Ca2+]cyt accumulation, ECM components modification and STT cell death, thus facilitating the penetration of pollen tube in the style for successful double fertilization and seed-setting in rice.

Effects of climate change on phenological trends and seed cotton yields in oasis of arid regions.

PubMed

Huang, Jian; Ji, Feng

2015-07-01

Understanding the effects of climatic change on phenological phases of cotton (Gossypium hirsutum L.) in oasis of arid regions may help optimize management schemes to increase productivity. This study assessed the impacts of climatic changes on the phenological phases and productivity of spring cotton. The results showed that climatic warming led the dates of sowing seed, seeding emergence, three-leaf, five-leaf, budding, anthesis, full bloom, cleft boll, boll-opening, boll-opening filling, and stop-growing become earlier by 24.42, 26.19, 24.75, 23.28, 22.62, 15.75, 14.58, 5.37, 2.85, 8.04, and 2.16 days during the period of 1981-2010, respectively. The growth period lengths from sowing seed to seeding emergence and from boll-opening to boll-opening filling were shortened by 1.76 and 5.19 days, respectively. The other growth period lengths were prolonged by 2-9.71 days. The whole growth period length was prolonged by 22.26 days. The stop-growing date was delayed by 2.49-3.46 days for every 1 °C rise in minimum, maximum, and mean temperatures; however, other development dates emerged earlier by 2.17-4.76 days. Rising temperatures during the stage from seeding emergence to three-leaf reduced seed cotton yields. However, rising temperatures increased seed cotton yields in the two stages from anthesis to cleft boll and from boll-opening filling to the stop-growing. Increasing accumulated temperatures (AT) had different impacts on different development stages. During the vegetative phase, rising AT led to reduced seed cotton yields, but rising AT during reproductive stage increased seed cotton yields. In conclusion, climatic warming helpfully obtained more seed cotton yields in oasis of arid regions in northwest China. Changing the sowing date is another way to enhance yields for climate change in the future.

Optimizing Hill Seeding Density for High-Yielding Hybrid Rice in a Single Rice Cropping System in South China

PubMed Central

Wang, Danying; Chen, Song; Wang, Zaiman; Ji, Chenglin; Xu, Chunmei; Zhang, Xiufu; Chauhan, Bhagirath Singh

2014-01-01

Mechanical hill direct seeding of hybrid rice could be the way to solve the problems of high seeding rates and uneven plant establishment now faced in direct seeded rice; however, it is not clear what the optimum hill seeding density should be for high-yielding hybrid rice in the single-season rice production system. Experiments were conducted in 2010 and 2011 to determine the effects of hill seeding density (25 cm×15 cm, 25 cm×17 cm, 25 cm×19 cm, 25 cm×21 cm, and 25 cm×23 cm; three to five seeds per hill) on plant growth and grain yield of a hybrid variety, Nei2you6, in two fields with different fertility (soil fertility 1 and 2). In addition, in 2012 and 2013, comparisons among mechanical hill seeding, broadcasting, and transplanting were conducted with three hybrid varieties to evaluate the optimum seeding density. With increases in seeding spacing from 25 cm×15 cm to 25 cm×23 cm, productive tillers per hill increased by 34.2% and 50.0% in soil fertility 1 and 2. Panicles per m2 declined with increases in seeding spacing in soil fertility 1. In soil fertility 2, no difference in panicles per m2 was found at spacing ranging from 25 cm×17 cm to 25 cm×23 cm, while decreases in the area of the top three leaves and aboveground dry weight per shoot at flowering were observed. Grain yield was the maximum at 25 cm×17 cm spacing in both soil fertility fields. Our results suggest that a seeding density of 25 cm×17 cm was suitable for high-yielding hybrid rice. These results were verified through on-farm demonstration experiments, in which mechanical hill-seeded rice at this density had equal or higher grain yield than transplanted rice. PMID:25290342

Interactive effects of pests increase seed yield.

PubMed

Gagic, Vesna; Riggi, Laura Ga; Ekbom, Barbara; Malsher, Gerard; Rusch, Adrien; Bommarco, Riccardo

2016-04-01

Loss in seed yield and therefore decrease in plant fitness due to simultaneous attacks by multiple herbivores is not necessarily additive, as demonstrated in evolutionary studies on wild plants. However, it is not clear how this transfers to crop plants that grow in very different conditions compared to wild plants. Nevertheless, loss in crop seed yield caused by any single pest is most often studied in isolation although crop plants are attacked by many pests that can cause substantial yield losses. This is especially important for crops able to compensate and even overcompensate for the damage. We investigated the interactive impacts on crop yield of four insect pests attacking different plant parts at different times during the cropping season. In 15 oilseed rape fields in Sweden, we estimated the damage caused by seed and stem weevils, pollen beetles, and pod midges. Pest pressure varied drastically among fields with very low correlation among pests, allowing us to explore interactive impacts on yield from attacks by multiple species. The plant damage caused by each pest species individually had, as expected, either no, or a negative impact on seed yield and the strongest negative effect was caused by pollen beetles. However, seed yield increased when plant damage caused by both seed and stem weevils was high, presumably due to the joint plant compensatory reaction to insect attack leading to overcompensation. Hence, attacks by several pests can change the impact on yield of individual pest species. Economic thresholds based on single species, on which pest management decisions currently rely, may therefore result in economically suboptimal choices being made and unnecessary excessive use of insecticides.

A High-Resolution InDel (Insertion–Deletion) Markers-Anchored Consensus Genetic Map Identifies Major QTLs Governing Pod Number and Seed Yield in Chickpea

PubMed Central

Srivastava, Rishi; Singh, Mohar; Bajaj, Deepak; Parida, Swarup K.

2016-01-01

Development and large-scale genotyping of user-friendly informative genome/gene-derived InDel markers in natural and mapping populations is vital for accelerating genomics-assisted breeding applications of chickpea with minimal resource expenses. The present investigation employed a high-throughput whole genome next-generation resequencing strategy in low and high pod number parental accessions and homozygous individuals constituting the bulks from each of two inter-specific mapping populations [(Pusa 1103 × ILWC 46) and (Pusa 256 × ILWC 46)] to develop non-erroneous InDel markers at a genome-wide scale. Comparing these high-quality genomic sequences, 82,360 InDel markers with reference to kabuli genome and 13,891 InDel markers exhibiting differentiation between low and high pod number parental accessions and bulks of aforementioned mapping populations were developed. These informative markers were structurally and functionally annotated in diverse coding and non-coding sequence components of genome/genes of kabuli chickpea. The functional significance of regulatory and coding (frameshift and large-effect mutations) InDel markers for establishing marker-trait linkages through association/genetic mapping was apparent. The markers detected a greater amplification (97%) and intra-specific polymorphic potential (58–87%) among a diverse panel of cultivated desi, kabuli, and wild accessions even by using a simpler cost-efficient agarose gel-based assay implicating their utility in large-scale genetic analysis especially in domesticated chickpea with narrow genetic base. Two high-density inter-specific genetic linkage maps generated using aforesaid mapping populations were integrated to construct a consensus 1479 InDel markers-anchored high-resolution (inter-marker distance: 0.66 cM) genetic map for efficient molecular mapping of major QTLs governing pod number and seed yield per plant in chickpea. Utilizing these high-density genetic maps as anchors, three major genomic regions harboring each of pod number and seed yield robust QTLs (15–28% phenotypic variation explained) were identified on chromosomes 2, 4, and 6. The integration of genetic and physical maps at these QTLs mapped on chromosomes scaled-down the long major QTL intervals into high-resolution short pod number and seed yield robust QTL physical intervals (0.89–2.94 Mb) which were essentially got validated in multiple genetic backgrounds of two chickpea mapping populations. The genome-wide InDel markers including natural allelic variants and genomic loci/genes delineated at major six especially in one colocalized novel congruent robust pod number and seed yield robust QTLs mapped on a high-density consensus genetic map were found most promising in chickpea. These functionally relevant molecular tags can drive marker-assisted genetic enhancement to develop high-yielding cultivars with increased seed/pod number and yield in chickpea. PMID:27695461

Efficacy of Rice Insecticide Seed Treatments at Selected Nitrogen Rates for Control of the Rice Water Weevil (Coleoptera: Curculionidae).

PubMed

Everett, Mallory; Lorenz, Gus; Slaton, Nathan; Hardke, Jarrod

2015-08-01

Seed-applied insecticides are the standard control method used in the United States to minimize rice water weevil (Lissorhoptrus oryzophilus Kuschel) injury to rice (Oryza sativa L.) roots, and often results in greater yields than rice that receives no seed-applied insecticide. Yield increases from seed-applied insecticides often occur even when insect pressure is low and should not cause yield loss. The research objective was to evaluate the effect of urea-nitrogen rate and seed-applied insecticide on number of rice water weevil larvae, nitrogen uptake, and rice grain yield. Six trials were conducted at the Pine Tree Research Station (PTRS) and the Rice Research Extension Center (RREC) to examine the response of rice plants receiving different insecticide-seed treatments and urea-nitrogen rate combinations. Insecticide-seed treatments included label rates of clothianidin, thiamethoxam, and a no-insecticide (fungicide only) control, in combination with season-total nitrogen rates of 0, 50, 100, 150, and 200 kg urea-nitrogen/ha. Rice seed that was treated with clothianidin or thiamethoxam generally had equal numbers of rice water weevil larvae, which were significantly fewer compared with rice that received no insecticide with an equivalent urea-nitrogen rate. Nitrogen uptake at panicle differentiation was not affected by insecticide-seed treatments at four of six sites and usually increased positively and linearly as urea-nitrogen rate increased. As urea-nitrogen rate increased, grain yield increased either linearly or nonlinearly. Averaged across urea-nitrogen rates, both insecticide seed treatments had similar yields that were 4 to 7% greater than the grain yields of rice that received no insecticide at four of the five harvested sites. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Irrigation and cultivar effect on flax fiber and seed yield in the southeast USA

USDA-ARS?s Scientific Manuscript database

Flax (Linum usitatissimum L.) is a potential winter crop for the Southeast USA that can be grown for both seed and fiber. The objective of this research was to evaluate the effect of irrigation on flax straw, fiber, and seed yield of fiber-type and seed-type cultivars at different flax growth stage...

Extraction optimization of mucilage from Basil (Ocimum basilicum L.) seeds using response surface methodology.

PubMed

Nazir, Sadaf; Wani, Idrees Ahmed; Masoodi, Farooq Ahmad

2017-05-01

Aqueous extraction of basil seed mucilage was optimized using response surface methodology. A Central Composite Rotatable Design (CCRD) for modeling of three independent variables: temperature (40-91 °C); extraction time (1.6-3.3 h) and water/seed ratio (18:1-77:1) was used to study the response for yield. Experimental values for extraction yield ranged from 7.86 to 20.5 g/100 g. Extraction yield was significantly ( P  < 0.05) affected by all the variables. Temperature and water/seed ratio were found to have pronounced effect while the extraction time was found to have minor possible effects. Graphical optimization determined the optimal conditions for the extraction of mucilage. The optimal condition predicted an extraction yield of 20.49 g/100 g at 56.7 °C, 1.6 h, and a water/seed ratio of 66.84:1. Optimal conditions were determined to obtain highest extraction yield. Results indicated that water/seed ratio was the most significant parameter, followed by temperature and time.

Characterisation of fatty acid, carotenoid, tocopherol/tocotrienol compositions and antioxidant activities in seeds of three Chenopodium quinoa Willd. genotypes.

PubMed

Tang, Yao; Li, Xihong; Chen, Peter X; Zhang, Bing; Hernandez, Marta; Zhang, Hua; Marcone, Massimo F; Liu, Ronghua; Tsao, Rong

2015-05-01

Composition of fatty acids, tocopherols, tocotrienols, and carotenoids, and their contribution to antioxidant activities were investigated in seeds of three coloured quinoa cultivars (white, red and black). The major components and individual compounds were significantly different, and their concentrations were higher in darker seeds (p < 0.05). The oil yield was 6.58-7.17% which contained predominantly unsaturated fatty acids (89.42%). The ratio of omega-6/omega-3 fatty acid was ca. 6/1. The total tocopherol content ranged from 37.49 to 59.82 μg/g and mainly consisted of γ-tocopherol. Trace amount of α- and β-tocotrienols was also found. Black quinoa had the highest vitamin E followed by red and white quinoas. Carotenoids, mainly trans-lutein (84.7-85.6%) and zeaxanthin were confirmed for the first time in quinoa seeds, and the concentration was also the highest in black seeds. The antioxidant activities of lipophilic extracts were positively correlated with polyunsaturated fatty acids, total carotenoids and total tocopherols. Copyright © 2014. Published by Elsevier Ltd.

Subdiffraction focusing of scanning beams by a negative-refraction layer combined with a nonlinear layer.

PubMed

Husakou, A; Herrmann, J

2006-11-13

We evaluate the possibility to focus scanning light beams below the diffraction limit by using the combination of a nonlinear material with a Kerr-type nonlinearity or two-photon absorption to create seed evanescent components of the beam and a negative-refraction material to enhance them. Superfocusing to spots with a FWHM in the range of 0.2 lambda is theoretically predicted both in the context of the effective-medium theory and by the direct numerical solution of Maxwell equations for an inhomogeneous pho-tonic crystal. The evolution of the transverse spectrum and the dependence of superfocusing on the parameters of the negative-refraction material are also studied. We show that the use of a Kerr-type nonlinear layer for the creation of seed evanescent components yields focused spots with a higher intensity compared with those obtained by the application of a saturable absorber.

Fresh and Stored Pollen From Slash and Loblolly Pines Compared For Seed Yields

Treesearch

John F. Kraus; Davie L. Hunt

1970-01-01

Seed yields showed no consistent differences between fresh and stored pollen from 8 years of controlled pollination on slash pine and 4 years on loblolly pine. Collection of male strobili at the proper stage of pollen maturity was an important factor in obtaining good seed yields from stored pollen. Criteria are described which were useful in determining when to...

Seed-specific RNAi in safflower generates a superhigh oleic oil with extended oxidative stability.

PubMed

Wood, Craig C; Okada, Shoko; Taylor, Matthew C; Menon, Amratha; Mathew, Anu; Cullerne, Darren; Stephen, Stuart J; Allen, Robert S; Zhou, Xue-Rong; Liu, Qing; Oakeshott, John G; Singh, Surinder P; Green, Allan G

2018-03-06

Vegetable oils extracted from oilseeds are an important component of foods, but are also used in a range of high value oleochemical applications. Despite being biodegradable, nontoxic and renewable current plant oils suffer from the presence of residual polyunsaturated fatty acids that are prone to free radical formation that limit their oxidative stability, and consequently shelf life and functionality. Many decades of plant breeding have been successful in raising the oleic content to ~90%, but have come at the expense of overall field performance, including poor yields. Here, we engineer superhigh oleic (SHO) safflower producing a seed oil with 93% oleic generated from seed produced in multisite field trials spanning five generations. SHO safflower oil is the result of seed-specific hairpin-based RNA interference of two safflower lipid biosynthetic genes, FAD2.2 and FATB, producing seed oil containing less than 1.5% polyunsaturates and only 4% saturates but with no impact on lipid profiles of leaves and roots. Transgenic SHO events were compared to non-GM safflower in multisite trial plots with a wide range of growing season conditions, which showed no evidence of impact on seed yield. The oxidative stability of the field-grown SHO oil produced from various sites was 50 h at 110°C compared to 13 h for conventional ~80% oleic safflower oils. SHO safflower produces a uniquely stable vegetable oil across different field conditions that can provide the scale of production that is required for meeting the global demands for high stability oils in food and the oleochemical industry. © 2018 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Changes in the germination process and growth of pea in effect of laser seed irradiation

NASA Astrophysics Data System (ADS)

Podleśna, Anna; Gładyszewska, Bożena; Podleśny, Janusz; Zgrajka, Wojciech

2015-10-01

The aim of this study was to determine the effect of pre-sowing helium-neon (He-Ne) laser irradiation of pea seeds on changes in seed biochemical processes, germination rate, seedling emergence, growth rate, and yield. The first experimental factor was exposure to laser radiation: D0 - no irradiation, D3 - three exposures, D5 - five exposures, and the harvest dates were the second factor. Pre-sowing treatment of pea seeds with He-Ne laser light increased the concentrations of amylolytic enzymes and the content of indole-3-acetic acid (IAA) in pea seeds and seedlings. The exposure of seeds to He-Ne laser light improved the germination rate and uniformity and modified growth stages, which caused acceleration of flowering and ripening of pea plants. Laser light stimulation improved the morphological characteristics of plants by increasing plant height and leaf surface area. Irradiation improved the yield of vegetative and reproductive organs of pea, although the effects varied at the different growth stages. The increase in the seed yield resulted from a higher number of pods and seeds per plant, whereas no significant changes were observed in the number of seeds per pod. Both radiation doses exerted similarly stimulating effects on pea growth, development, and yield.

Assessing the impacts of current and future concentrations of surface ozone on crop yield with meta-analysis

NASA Astrophysics Data System (ADS)

Feng, Zhaozhong; Kobayashi, Kazuhiko

Meta-analysis was conducted to quantitatively assess the effects of rising ozone concentrations ([O 3]) on yield and yield components of major food crops: potato, barley, wheat, rice, bean and soybean in 406 experimental observations. Yield loss of the crops under current and future [O 3] was expressed relative to the yield under base [O 3] (≤26 ppb). With potato, current [O 3] (31-50 ppb) reduced the yield by 5.3%, and it reduced the yield of barley, wheat and rice by 8.9%, 9.7% and 17.5%, respectively. In bean and soybean, the yield losses were 19.0% and 7.7%, respectively. Compared with yield loss at current [O 3], future [O 3] (51-75 ppb) drove a further 10% loss in yield of soybean, wheat and rice, and 20% loss in bean. Mass of individual grain, seed, or tuber was often the major cause of the yield loss at current and future [O 3], whereas other yield components also contributed to the yield loss in some cases. No significant difference was found between the responses in crops grown in pots and those in the ground for any yield parameters. The ameliorating effect of elevated [CO 2] was significant in the yields of wheat and potato, and the individual grain weight in wheat exposed to future [O 3]. These findings confirm the rising [O 3] as a threat to food security for the growing global population in this century.

Yield responses of wild C3 and C4 crop progenitors to subambient CO2 : a test for the role of CO2 limitation in the origin of agriculture.

PubMed

Cunniff, Jennifer; Jones, Glynis; Charles, Michael; Osborne, Colin P

2017-01-01

Limitation of plant productivity by the low partial pressure of atmospheric CO 2 (C a ) experienced during the last glacial period is hypothesized to have been an important constraint on the origins of agriculture. In support of this hypothesis, previous work has shown that glacial C a limits vegetative growth in the wild progenitors of both C 3 and C 4 founder crops. Here, we present data showing that glacial C a also reduces grain yield in both crop types. We grew four wild progenitors of C 3 (einkorn wheat and barley) and C 4 crops (foxtail and broomcorn millets) at glacial and postglacial C a , measuring grain yield and the morphological and physiological components contributing to these yield changes. The C 3 species showed a significant increase in unthreshed grain yield of ~50% with the glacial to postglacial increase in C a , which matched the stimulation of photosynthesis, suggesting that increases in photosynthesis are directly translated into yield at subambient levels of C a . Increased yield was controlled by a higher rate of tillering, leading to a larger number of tillers bearing fertile spikes, and increases in seed number and size. The C 4 species showed smaller, but significant, increases in grain yield of 10-15%, arising from larger seed numbers and sizes. Photosynthesis was enhanced by C a in only one C 4 species and the effect diminished during development, suggesting that an indirect mechanism mediated by plant water relations could also be playing a role in the yield increase. Interestingly, the C 4 species at glacial C a showed some evidence that photosynthetic capacity was upregulated to enhance carbon capture. Development under glacial C a also impacted negatively on the subsequent germination and viability of seeds. These results suggest that the grain production of both C 3 and C 4 crop progenitors was limited by the atmospheric conditions of the last glacial period, with important implications for the origins of agriculture. © 2016 John Wiley & Sons Ltd.

Integrated utilization of red radish seeds for the efficient production of seed oil and sulforaphene.

PubMed

Zhang, Jie; Zhou, Xing; Fu, Min

2016-02-01

Supercritical CO2 was used to obtain seed oil from red radish seeds. The influence of pressure, temperature, CO2 flow rate and time on extraction yield of oil were investigated in detail. The maximum extraction yield of oil was 92.07 ± 0.76% at the optimal extraction conditions. The physicochemical properties and fatty acid composition of oil indicated that the seed oil can be used as a dietary oil. Meanwhile, the high purity sulforaphene (96.84 ± 0.17%) was separated by solvent extraction coupled with preparative high performance liquid chromatography from red radish seed meal. The initial pH, R, extraction temperature and extraction time for each cycle had a considerable influence both on the extraction yield and purity of sulforaphene of crude product. The extraction of oil was directly responsible for an increase of 18.32% in the yield of sulforaphene. Copyright © 2015 Elsevier Ltd. All rights reserved.

Effect of tillage system on yield and weed populations of soybean ( Glycin Max L.).

PubMed

Hosseini, Seyed Z; Firouzi, Saeed; Aminpanah, Hashem; Sadeghnejhad, Hamid R

2016-03-01

Field experiment was conducted at Agricultural and Natural Resources Research Center of Golestan Province, Iran, to determine the effects of tillage system and weed management regime on yield and weed populations in soybean ( Glycin max L.). The experimental design was a split plot where the whole plot portion was a randomized complete block with three replicates. Main plots were tillage system: 1- No-till row crop seeding, 2- No-till seed drilling, 3- Tillage with disc harrow and drill planting, 4- Tillage with chisel packer and drill planting. The subplots were weed management regimes: 1-Weed control with herbicide application, 2- Hand weeding, 3- Herbicide application plus hand weeding, and 4- Non-weeding. Results indicated that the main effects of tillage system and weed management regime were significant for seed yield, pod number per plant, seed number per pod, weed density and biomass, while their interaction were significant only for weed density, weed biomass, and seed number per pod. The highest grain yields (3838 kg ha-1) were recorded for No-till row crop seeding. The highest seed yield (3877 kg ha-1) also was recorded for weed control with herbicide and hand weeding treatment, followed by hand weeding (3379 kg ha-1).

Estimating nutrient uptake requirements for soybean using QUEFTS model in China

PubMed Central

Yang, Fuqiang; Xu, Xinpeng; Wang, Wei; Ma, Jinchuan; Wei, Dan; He, Ping; Pampolino, Mirasol F.; Johnston, Adrian M.

2017-01-01

Estimating balanced nutrient requirements for soybean (Glycine max [L.] Merr) in China is essential for identifying optimal fertilizer application regimes to increase soybean yield and nutrient use efficiency. We collected datasets from field experiments in major soybean planting regions of China between 2001 and 2015 to assess the relationship between soybean seed yield and nutrient uptake, and to estimate nitrogen (N), phosphorus (P), and potassium (K) requirements for a target yield of soybean using the quantitative evaluation of the fertility of tropical soils (QUEFTS) model. The QUEFTS model predicted a linear–parabolic–plateau curve for the balanced nutrient uptake with a target yield increased from 3.0 to 6.0 t ha−1 and the linear part was continuing until the yield reached about 60–70% of the potential yield. To produce 1000 kg seed of soybean in China, 55.4 kg N, 7.9 kg P, and 20.1 kg K (N:P:K = 7:1:2.5) were required in the above-ground parts, and the corresponding internal efficiencies (IE, kg seed yield per kg nutrient uptake) were 18.1, 126.6, and 49.8 kg seed per kg N, P, and K, respectively. The QUEFTS model also simulated that a balanced N, P, and K removal by seed which were 48.3, 5.9, and 12.2 kg per 1000 kg seed, respectively, accounting for 87.1%, 74.1%, and 60.8% of the total above-ground parts, respectively. These results were conducive to make fertilizer recommendations that improve the seed yield of soybean and avoid excessive or deficient nutrient supplies. Field validation indicated that the QUEFTS model could be used to estimate nutrient requirements which help develop fertilizer recommendations for soybean. PMID:28498839

Laccase-13 Regulates Seed Setting Rate by Affecting Hydrogen Peroxide Dynamics and Mitochondrial Integrity in Rice.

PubMed

Yu, Yang; Li, Quan-Feng; Zhang, Jin-Ping; Zhang, Fan; Zhou, Yan-Fei; Feng, Yan-Zhao; Chen, Yue-Qin; Zhang, Yu-Chan

2017-01-01

Seed setting rate is one of the most important components of rice grain yield. To date, only several genes regulating setting rate have been identified in plant. In this study, we showed that laccase-13 ( OsLAC13 ), a member of laccase family genes which are known for their roles in modulating phenylpropanoid pathway and secondary lignification in cell wall, exerts a regulatory function in rice seed setting rate. OsLAC13 expressed in anthers and promotes hydrogen peroxide production both in vitro and in the filaments and anther connectives. Knock-out of OsLAC13 showed significantly increased seed setting rate, while overexpression of this gene exhibited induced mitochondrial damage and suppressed sugar transportation in anthers, which in turn affected seed setting rate. OsLAC13 also induced H 2 O 2 production and mitochondrial damage in the root tip cells which caused the lethal phenotype. We also showed that high abundant of OsmiR397, the suppressor of OsLAC13 mRNA, increased the seed setting rate of rice plants, and restrains H 2 O 2 accumulation in roots during oxidative stress. Our results suggested a novel regulatory role of OsLAC13 gene in regulating seed setting rate by affecting H 2 O 2 dynamics and mitochondrial integrity in rice.

Copper oxide nanoparticles and bulk copper oxide, combined with indole-3-acetic acid, alter aluminum, boron, and iron in Pisum sativum seeds.

PubMed

Ochoa, Loren; Zuverza-Mena, Nubia; Medina-Velo, Illya A; Flores-Margez, Juan Pedro; Peralta-Videa, José R; Gardea-Torresdey, Jorge L

2018-09-01

The interaction of CuO nanoparticles (nCuO), a potential nanopesticide, with the growth hormone indole-3-acetic acid (IAA) is not well understood. This study aimed to evaluate the nutritional components in seeds of green pea (Pisum sativum) cultivated in soil amended with nCuO at 50 or 100mgkg -1 , with/without IAA at 10 or 100μM. Similar treatments including bulk CuO (bCuO) and CuCl 2 were set as controls. Bulk CuO at 50mgkg -1 reduced seed yield (52%), compared with control. Bulk CuO at 50mgkg -1 and nCuO at 100mgkg -1 , plus IAA at 100μM, increased iron in seeds (41 and 42%, respectively), while nCuO at 50mgkg -1 , plus IAA at 100μM reduced boron (80%, respect to control and 63%, respect to IAA at 100μM). IAA, at 10μM increased seed protein (33%), compared with control (p≤0.05). At both concentrations IAA increased sugar in seeds (20%). Overall, nCuO, plus IAA at 10μM, does not affect the production or nutritional quality of green pea seeds. Copyright © 2018 Elsevier B.V. All rights reserved.

The importance of key floral bioactive compounds to honey bees for the detection and attraction of hybrid vegetable crops and increased seed yield.

PubMed

Mas, Flore; Harper, Aimee; Horner, Rachael; Welsh, Taylor; Jaksons, Peter; Suckling, David M

2018-02-15

Crop breeding programmes generally select for traits for improved yield and human consumption preferences. Yet, they often overlook one fundamental trait essential for insect-pollinated crops: pollinator attraction. This is even more critical for hybrid plants that rely on cross-pollination between the male-fertile line and the male-sterile line to set seeds. This study investigated the role of floral odours for honey bee pollination that could explain the poor seed yield in hybrid crops. The key floral bioactive compounds that honey bees detect were identified for three vegetable hybrid crops. It was found that 30% of the variation in bioactive compound quantities was explained by variety. Differences in quantities of the bioactive compounds triggered different degrees of olfactory response and were also associated with varied appetitive response. Correlating the abundance of each bioactive compound with seed yield, it was found that aldehydes such as nonanal and decanal can have a strong negative influence on seed yield with increasing quantity. Using these methodologies to identify relevant bioactive compounds associated with honey bee pollination, plant breeding programmes should also consider selecting for floral traits attractive to honey bees to improve crop pollination for enhanced seed yield. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

Elevated Genetic Diversity in an F2:6 Population of Quinoa (Chenopodium quinoa) Developed through an Inter-ecotype Cross

PubMed Central

Benlhabib, Ouafae; Boujartani, Noura; Maughan, Peter J.; Jacobsen, Sven E.; Jellen, Eric N.

2016-01-01

Quinoa (Chenopodium quinoa) is a seed crop of the Andean highlands and Araucanian coastal regions of South America that has recently expanded in use and production beyond its native range. This is largely due to its superb nutritional value, consisting of protein that is rich in essential amino acids along with vitamins and minerals. Quinoa also presents a remarkable degree of tolerance to saline conditions, drought, and frost. The present study involved 72 F2:6 recombinant-inbred lines and parents developed through hybridization between highland (0654) and coastal (NL-6) germplasm groups. The purpose was to characterize the quinoa germplasm developed, to assess the discriminating potential of 21 agro-morpho-phenological traits, and to evaluate the extent of genetic variability recovered through selfing. A vast amount of genetic variation was detected among the 72 lines evaluated for quantitative and qualitative traits. Impressive transgressive segregation was measured for seed yield (22.42 g/plant), while plant height and maturity had higher heritabilities (73 and 89%, respectively). Other notable characters segregating in the population included panicle and stem color, panicle form, and resistance to downy mildew. In the Principal Component analysis, the first axis explained 74% of the total variation and was correlated to plant height, panicle size, stem diameter, biomass, mildew reaction, maturation, and seed yield; those traits are relevant discriminatory characters. Yield correlated positively with panicle length and biomass. Unweighted Pair Group Method with Arithmetic Mean-based cluster analysis identified three groups: one consisting of late, mildew-resistant, high-yielding lines; one having semi-late lines with intermediate yield and mildew susceptibility; and a third cluster consisting of early to semi-late accessions with low yield and mildew susceptibility. This study highlighted the extended diversity regenerated among the 72 accessions and helped to identify potentially adapted quinoa genotypes for production in the Moroccan coastal environment. PMID:27582753

Canopy warming caused photosynthetic acclimation and reduced seed yield in maize grown at ambient and elevated [CO2 ].

PubMed

Ruiz-Vera, Ursula M; Siebers, Matthew H; Drag, David W; Ort, Donald R; Bernacchi, Carl J

2015-11-01

Rising atmospheric CO2 concentration ([CO2 ]) and attendant increases in growing season temperature are expected to be the most important global change factors impacting production agriculture. Although maize is the most highly produced crop worldwide, few studies have evaluated the interactive effects of elevated [CO2 ] and temperature on its photosynthetic physiology, agronomic traits or biomass, and seed yield under open field conditions. This study investigates the effects of rising [CO2 ] and warmer temperature, independently and in combination, on maize grown in the field throughout a full growing season. Free-air CO2 enrichment (FACE) technology was used to target atmospheric [CO2 ] to 200 μmol mol(-1) above ambient [CO2 ] and infrared heaters to target a plant canopy increase of 3.5 °C, with actual season mean heating of ~2.7 °C, mimicking conditions predicted by the second half of this century. Photosynthetic gas-exchange parameters, leaf nitrogen and carbon content, leaf water potential components, and developmental measurements were collected throughout the season, and biomass and yield were measured at the end of the growing season. As predicted for a C4 plant, elevated [CO2 ] did not stimulate photosynthesis, biomass, or yield. Canopy warming caused a large shift in aboveground allocation by stimulating season-long vegetative biomass and decreasing reproductive biomass accumulation at both CO2 concentrations, resulting in decreased harvest index. Warming caused a reduction in photosynthesis due to down-regulation of photosynthetic biochemical parameters and the decrease in the electron transport rate. The reduction in seed yield with warming was driven by reduced photosynthetic capacity and by a shift in aboveground carbon allocation away from reproduction. This field study portends that future warming will reduce yield in maize, and this will not be mitigated by higher atmospheric [CO2 ] unless appropriate adaptation traits can be introduced into future cultivars. © 2015 John Wiley & Sons Ltd.

Nonlethal Thrips Damage to Slash Pine Flowers Reduces Seed Yields

Treesearch

Gary L. DeBarr; John A. Williams

1971-01-01

Nonlethal damage to female flowers of slash pine (Pinus elliottii Engelm.) by a thrips, Gnophothrips fuscus Morgan, was examined a Florida seed orchard. Thrips-damaged flowers developed into crooked mature cones with areas of sunken, deformed cone scales. Damaged cones were significantly shorter, yielded fewer total seed and...

Application of different fertilizers on morphological traits of dill (Anethum graveolens L.).

PubMed

Nejatzadeh-Barandozi, Fatemeh; Gholami-Borujeni, Fathollah

2014-12-01

The aim of this study was to evaluate the effects of nitroxin biofertilizer and chemical fertilizer on the growth, yield, and essential oil composition of dill. The experiment was conducted under field condition in randomized complete block design with three replications and two factors. The first factor was the concentrations of nitroxin biofertilizer (0%, 50%, and 100%) of the recommended amount (1 l of biological fertilizer for 30 kg of seed). The second factor was the following chemical fertilizer treatments: no fertilizer (control) and 50 and 100 kg ha(-1) urea along with 300 kg ha(-1) ammonium phosphate. Different characteristics such as plant height, number of umbel per plant, number of umbellet per umbel, number of grain per umbellet, 1,000 seed weight, grain yield, biological yield, and oil percentage were recorded. According to the results, the highest height, biological yield, and grain yield components (except harvest index) were obtained on biological fertilizer. The results showed the highest essential oil content detected in biological fertilizer and chemical fertilizer. Identification of essential oil composition showed that the content of carvone increased with the application of biofertilizers and chemical fertilizers. The results indicated that the application of biofertilizers enhanced yield and other plant criteria in this plant. Generally, it seems that the use of biofertilizers or combinations of biofertilizer and chemical fertilizer could improve dill performance in addition to reduction of environmental pollution.

Identification and validation of quantitative trait loci for seed yield, oil and protein contents in two recombinant inbred line populations of soybean.

PubMed

Wang, Xianzhi; Jiang, Guo-Liang; Green, Marci; Scott, Roy A; Song, Qijian; Hyten, David L; Cregan, Perry B

2014-10-01

Soybean seeds contain high levels of oil and protein, and are the important sources of vegetable oil and plant protein for human consumption and livestock feed. Increased seed yield, oil and protein contents are the main objectives of soybean breeding. The objectives of this study were to identify and validate quantitative trait loci (QTLs) associated with seed yield, oil and protein contents in two recombinant inbred line populations, and to evaluate the consistency of QTLs across different environments, studies and genetic backgrounds. Both the mapping population (SD02-4-59 × A02-381100) and validation population (SD02-911 × SD00-1501) were phenotyped for the three traits in multiple environments. Genetic analysis indicated that oil and protein contents showed high heritabilities while yield exhibited a lower heritability in both populations. Based on a linkage map constructed previously with the mapping population and using composite interval mapping and/or interval mapping analysis, 12 QTLs for seed yield, 16 QTLs for oil content and 11 QTLs for protein content were consistently detected in multiple environments and/or the average data over all environments. Of the QTLs detected in the mapping population, five QTLs for seed yield, eight QTLs for oil content and five QTLs for protein content were confirmed in the validation population by single marker analysis in at least one environment and the average data and by ANOVA over all environments. Eight of these validated QTLs were newly identified. Compared with the other studies, seven QTLs for seed yield, eight QTLs for oil content and nine QTLs for protein content further verified the previously reported QTLs. These QTLs will be useful for breeding higher yield and better quality cultivars, and help effectively and efficiently improve yield potential and nutritional quality in soybean.

Microwave-assisted extraction of Nigella sativa L. essential oil and evaluation of its antioxidant activity.

PubMed

Abedi, Abdol-Samad; Rismanchi, Marjan; Shahdoostkhany, Mehrnoush; Mohammadi, Abdorreza; Mortazavian, Amir Mohammad

2017-11-01

It has been previously reported that the essential oil of Nigella sativa L. seeds and its major active component, thymoquinone (TQ), possess a broad variety of biological activities and therapeutic properties. In this work, microwave-assisted extraction (MAE) of the essential oil from Nigella sativa L. seeds and its antioxidant activity were studied. Response surface methodology based on central composite design was used to evaluate the effects of extraction time, irradiation power and moisture content on extraction yield and TQ content. Optimal parameters obtained by CCD and RSM were extraction time 30 min, irradiation power 450 W, and moisture content 50%. The extraction yield and TQ content of the essential oil were 0.33 and 20% under the optimum conditions, respectively. In contrast, extraction yield and TQ amount of oil obtained by hydrodistillation (HD) were 0.23 and 3.71%, respectively. The main constituents of the essential oil extracted by MAE and HD were p -cymene, TQ, α-thujene and longifolene, comprising more than 60% of total peak area. The antioxidant capacity of essential oils extracted by different methods were evaluated using 2,2-diphenyl-1-picrylhydrazyl and Ferric reducing antioxidant power assays, and compared with traditional antioxidants. The results showed that MAE method was a viable alternative to HD for the essential oil extraction from N. sativa seeds due to the excellent extraction efficiency, higher thymoquinone content, and stronger antioxidant activity.

Performance of some Ethiopian fenugreek (Trigonella foenum-graecum L.) germplasm collections as compared with the commercial variety Challa.

PubMed

Fikreselassie, Million

2012-05-01

Systematic breeding efforts on fenugreek have so far been neglected in Ethiopia. For this, 143 random samples of fenugreek accessions along with a commercial variety were used in this study to evaluate the potential of the land races. The field experiment was conducted at Haramaya University research station during 2011 main cropping season. Treatments were arranged in a 12x12 simple lattice design. The highest biomass and seed yielding accessions were generally concentrated more in the categories of yellow and green seed colors. When compared with the commercial variety, above 27% of the tested accessions performed significantly better in terms of seed yield indicating that significant yield gains could be secured by simple selection. However, further evaluation over wider environments is necessary to arrive at conclusive points for such quantitative traits. Green and yellow seeded accessions are widely distributed over all the country and over half of the accessions (63%) had green seed color. High seed yield bearing accessions were those collected from northwest and central part of Ethiopia, while accessions collected from eastern and northwestern Ethiopia were strikingly bold seed size. This variability would provide a basis for improving the crop in breeding program.

A shrunken-2 Transgene Increases Maize Yield by Acting in Maternal Tissues to Increase the Frequency of Seed Development[W

PubMed Central

Hannah, L. Curtis; Futch, Brandon; Bing, James; Shaw, Janine R.; Boehlein, Susan; Stewart, Jon D.; Beiriger, Robert; Georgelis, Nikolaos; Greene, Thomas

2012-01-01

The maize (Zea mays) shrunken-2 (Sh2) gene encodes the large subunit of the rate-limiting starch biosynthetic enzyme, ADP-glucose pyrophosphorylase. Expression of a transgenic form of the enzyme with enhanced heat stability and reduced phosphate inhibition increased maize yield up to 64%. The extent of the yield increase is dependent on temperatures during the first 4 d post pollination, and yield is increased if average daily high temperatures exceed 33°C. As found in wheat (Triticum aestivum) and rice (Oryza sativa), this transgene increases maize yield by increasing seed number. This result was surprising, since an entire series of historic observations at the whole-plant, enzyme, gene, and physiological levels pointed to Sh2 playing an important role only in the endosperm. Here, we present several lines of evidence that lead to the conclusion that the Sh2 transgene functions in maternal tissue to increase seed number and, in turn, yield. Furthermore, the transgene does not increase ovary number; rather, it increases the probability that a seed will develop. Surprisingly, the number of fully developed seeds is only ∼50% of the number of ovaries in wild-type maize. This suggests that increasing the frequency of seed development is a feasible agricultural target, especially under conditions of elevated temperatures. PMID:22751213

Yield potential of pigeon pea cultivars

USDA-ARS?s Scientific Manuscript database

Yield potential of twelve vegetable pigeon pea (Cajanus cajun) cultivars was evaluated at two locations in eastern Kenya during 2012 and 2013 cropping years. Pigeon pea pod numbers, seeds per pod, seed mass, grain yield and shelling percentage were quantified in three replicated plots, arranged in a...

Value of Neonicotinoid Insecticide Seed Treatments in Mid-South Corn (Zea mays) Production Systems.

PubMed

North, J H; Gore, J; Catchot, A L; Stewart, S D; Lorenz, G M; Musser, F R; Cook, D R; Kerns, D L; Leonard, B R; Dodds, D M

2018-02-09

Neonicotinoid seed treatments are one of several effective control options used in corn, Zea mays L., production in the Mid-South for early season insect pests. An analysis was performed on 91 insecticide seed treatment trials from Arkansas, Louisiana, Mississippi, and Tennessee to determine the value of neonicotinoids in corn production systems. The analysis compared neonicotinoid insecticide treated seed plus a fungicide to seed only with the same fungicide. When analyzed by state, corn yields were significantly higher when neonicotinoid seed treatments were used compared to fungicide only treated seed in Louisiana and Mississippi. Corn seed treated with neonicotinoid seed treatments yielded 111, 1,093, 416, and 140 kg/ha, higher than fungicide only treatments for Arkansas, Louisiana, Mississippi, and Tennessee, respectively. Across all states, neonicotinoid seed treatments resulted in a 700 kg/ha advantage compared to fungicide only treated corn seed. Net returns for corn treated with neonicotinoid seed treatment were $1,446/ha compared with $1,390/ha for fungicide only treated corn seed across the Mid-South. Economic returns for neonicotinoid seed treated corn were significantly greater than fungicide-only-treated corn seed in 8 out of 14 yr. When analyzed by state, economic returns for neonicotinoid seed treatments were significantly greater than fungicide-only-treated seed in Louisiana. In some areas, dependent on year, neonicotinoid seed treatments provide significant yield and economic benefits in Mid-South corn. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Potential of multiseeded mutant (msd) to boost sorghum grain yield

USDA-ARS?s Scientific Manuscript database

Seed number per plant is an important determinant of the grain yield in cereal and other crops. We have isolated a class of multiseeded (msd) sorghum (Sorghum bicolor L. Moench) mutants that are capable of producing three times the seed number and twice the seed weight per panicle as compared with t...

Cone and seed yields from controlled breeding of southern pines

Treesearch

E. B. Snyder; A. E. Squillace

1966-01-01

Over a 10-year period, survivals of cones from controlled cross-pollinations were less than 40 percent, and seed yields per cone averaged about half those from wind-pollinations. Self-pollinations produced about 15 percent as much seed as cross-pollinations. Interspecific pollinations were generally less productive than intraspecific pollinations.

Maternal synthesis of abscisic acid controls seed development and yield in Nicotiana plumbaginifolia.

PubMed

Frey, Anne; Godin, Béatrice; Bonnet, Magda; Sotta, Bruno; Marion-Poll, Annie

2004-04-01

The role of maternally derived abscisic acid (ABA) during seed development has been studied using ABA-deficient mutants of Nicotiana plumbaginifolia Viviani. ABA deficiency induced seed abortion, resulting in reduced seed yield, and delayed growth of the remaining embryos. Mutant grafting onto wild-type stocks and reciprocal crosses indicated that maternal ABA, synthesized in maternal vegetative tissues and translocated to the seed, promoted early seed development and growth. Moreover ABA deficiency delayed both seed coat pigmentation and capsule dehiscence. Mutant grafting did not restore these phenotypes, indicating that ABA synthesized in the seed coat and capsule envelope may have a positive effect on capsule and testa maturation. Together these results shed light on the positive role of maternal ABA during N. plumbaginifolia seed development.

Influence of metal-mediated aerosol-phase oxidation on secondary organic aerosol formation from the ozonolysis and OH-oxidation of α-pinene

PubMed Central

Chu, Biwu; Liggio, John; Liu, Yongchun; He, Hong; Takekawa, Hideto; Li, Shao-Meng; Hao, Jiming

2017-01-01

The organic component is the most abundant fraction of atmospheric submicron particles, while the formation mechanisms of secondary organic aerosol (SOA) are not fully understood. The effects of sulfate seed aerosols on SOA formation were investigated with a series of experiments carried out using a 9 m3 smog chamber. The presence of FeSO4 or Fe2(SO4)3 seed aerosols decreased SOA yields and increased oxidation levels in both ozonolysis and OH-oxidation of α-pinene compared to that in the presence of ZnSO4 or (NH4)2SO4. These findings were explained by metal-mediated aerosol-phase oxidation of organics: reactive radicals were generated on FeSO4 or Fe2(SO4)3 seed aerosols and reacted further with the organic mass. This effect would help to explain the high O/C ratios of organics in ambient particles that thus far cannot be reproduced in laboratory and model studies. In addition, the gap in the SOA yields between experiments with different seed aerosols was more significant in OH-oxidation experiments compared to ozonolysis experiments, while the gap in estimated O/C ratios was less obvious. This may have resulted from the different chemical compositions and oxidation levels of the SOA generated in the two systems, which affect the branching ratio of functionalization and fragmentation during aerosol oxidation. PMID:28059151

Influence of metal-mediated aerosol-phase oxidation on secondary organic aerosol formation from the ozonolysis and OH-oxidation of α-pinene.

PubMed

Chu, Biwu; Liggio, John; Liu, Yongchun; He, Hong; Takekawa, Hideto; Li, Shao-Meng; Hao, Jiming

2017-01-06

The organic component is the most abundant fraction of atmospheric submicron particles, while the formation mechanisms of secondary organic aerosol (SOA) are not fully understood. The effects of sulfate seed aerosols on SOA formation were investigated with a series of experiments carried out using a 9 m 3 smog chamber. The presence of FeSO 4 or Fe 2 (SO 4 ) 3 seed aerosols decreased SOA yields and increased oxidation levels in both ozonolysis and OH-oxidation of α-pinene compared to that in the presence of ZnSO 4 or (NH 4 ) 2 SO 4 . These findings were explained by metal-mediated aerosol-phase oxidation of organics: reactive radicals were generated on FeSO 4 or Fe 2 (SO 4 ) 3 seed aerosols and reacted further with the organic mass. This effect would help to explain the high O/C ratios of organics in ambient particles that thus far cannot be reproduced in laboratory and model studies. In addition, the gap in the SOA yields between experiments with different seed aerosols was more significant in OH-oxidation experiments compared to ozonolysis experiments, while the gap in estimated O/C ratios was less obvious. This may have resulted from the different chemical compositions and oxidation levels of the SOA generated in the two systems, which affect the branching ratio of functionalization and fragmentation during aerosol oxidation.

Modern Breeding and Biotechnological Approaches to Enhance Carotenoid Accumulation in Seeds.

PubMed

Federico, M L; Schmidt, M A

There is an increasing demand for carotenoids, which are fundamental components of the human diet, for example as precursors of vitamin A. Carotenoids are also potent antioxidants and their health benefits are becoming increasingly evident. Protective effects against prostate cancer and age-related macular degeneration have been proposed for lycopene and lutein/zeaxanthin, respectively. Additionally, β-carotene, astaxanthin and canthaxanthin are high-value carotenoids used by the food industry as feed supplements and colorants. The production and consumption of these carotenoids from natural sources, especially from seeds, constitutes an important step towards fortifying the diet of malnourished people in developing nations. Therefore, attempts to metabolically manipulate β-carotene production in plants have received global attention, especially after the generation of Golden Rice (Oryza sativa). The endosperms of Golden Rice seeds synthesize and accumulate large quantities of β-carotene (provitamin A), yielding a characteristic yellow color in the polished grains. Classical breeding efforts have also focused in the development of cultivars with elevated seed carotenoid content, with maize and other cereals leading the way. In this communication we will summarize transgenic efforts and modern breeding strategies to fortify various crop seeds with nutraceutical carotenoids.

Diverse regulatory factors associate with flowering time and yield responses in winter-type Brassica napus.

PubMed

Schiessl, Sarah; Iniguez-Luy, Federico; Qian, Wei; Snowdon, Rod J

2015-09-29

Flowering time, plant height and seed yield are strongly influenced by climatic and day-length adaptation in crop plants. To investigate these traits under highly diverse field conditions in the important oilseed crop Brassica napus, we performed a genome-wide association study using data from diverse agroecological environments spanning three continents. A total of 158 European winter-type B.napus inbred lines were genotyped with 21,623 unique, single-locus single-nucleotide polymorphism (SNP) markers using the Brassica 60 K-SNP Illumina® Infinium consortium array. Phenotypic associations were calculated in the panel over the years 2010-2012 for flowering time, plant height and seed yield in 5 highly diverse locations in Germany, China and Chile, adding up to 11 diverse environments in total. We identified 101 genome regions associating with the onset of flowering, 69 with plant height, 36 with seed yield and 68 cross-trait regions with potential adaptive value. Within these regions, B.napus orthologs for a number of candidate adaptation genes were detected, including central circadian clock components like CIRCADIAN CLOCK- ASSOCIATED 1 (Bna.CCA1) and the important flowering-time regulators FLOWERING LOCUS T (Bna.FT) and FRUITFUL (Bna.FUL). Gene ontology (GO) enrichment analysis of candidate regions suggested that selection of genes involved in post-transcriptional and epigenetic regulation of flowering time may play a potential role in adaptation of B. napus to highly divergent environments. The classical flowering time regulators Bna.FLC and Bna.CO were not found among the candidate regions, although both show functional variation. Allelic effects were additive for plant height and yield, but not for flowering time. The scarcity of positive minor alleles for yield in this breeding pool points to a lack of diversity for adaptation that could restrict yield gain in the face of environmental change. Our study provides a valuable framework to further improve the adaptability and yield stability of this recent allopolyploid crop under changing environments. The results suggest that flowering time regulation within an adapted B. napus breeding pool is driven by a high number of small modulating processes rather than major transcription factors like Bna.CO. In contrast, yield regulation appears highly parallel, therefore yield could be increased by pyramiding positively associated haplotypes.

Change of arginine content and some physiological traits under midseason drought in peanut genotypes with different levels of drought resistance

USDA-ARS?s Scientific Manuscript database

Peanut production areas frequently suffer from drought, which can cause severe yield losses, increased aflatoxin, and compositional changes in seed. Midseason drought is generally the most detrimental to seed yields and in altering seed protein composition. The purpose of this study was to investi...

Screening soybean germplasm and commerical varieties for resistance to Phomopsis seed decay: results from 2012 trials

USDA-ARS?s Scientific Manuscript database

Soybean Phomopsis seed decay (PSD) causes poor seed quality and suppresses yield in most soybean production areas of the United States. In 2009, PSD caused a yield loss of over 12 million bushels in 16 southern states. The disease is primarily caused by Phomopsis longicolla along with other Phomopsi...

Reaction of maturity group IV soybean plant introductions to Phomopsis Seed Decay in Arkansas Mississippi and Missouri 2009

USDA-ARS?s Scientific Manuscript database

Soybean Phomopsis seed decay (PSD) causes poor seed quality and suppresses yield in most of soybean-growing states in United States. In 2009, PSD caused over 12 million bushel yield loss in 16 southern states. The disease is primarily caused by Phomopsis longicolla along with other Phomopsis and Dia...

Identification of soybean accessions with resistance to Phomopsis seed decay: joint effort from USDA and university scientists

USDA-ARS?s Scientific Manuscript database

Soybean Phomopsis seed decay (PSD) is primarily caused by Phomopsis longicolla along with other Phomopsis and Diaporthe spp. This disease causes poor seed quality and suppresses yield in most soybean-growing states in the United States. In 2009, PSD caused yield loss of over 12 million bushels in 16...

Evaluation of exotically-derived soybean breeding lines for seed yield, germination, damage, and composition under dryland production in the midsouthern USA

USDA-ARS?s Scientific Manuscript database

Although the Early Soybean Production System (ESPS) in the Midsouthern USA increased seed yield under irrigated and non-irrigated conditions, heat stress and drought still lead to poor seed quality in heat sensitive soybean cultivars. Our goal was to identify breeding lines that possess high germin...

Bioclimatic modeling predicts potential distribution of Armillaria solidipes and Pseudotsuga menziesii (Douglas-fir) under contemporary and changing climates in the interior western U.S.A

Treesearch

John Hanna; M. V. Warwell; H. Maffei; M. L. Fairweather; J. T. Blodgett; P. J. Zambino; J. Worrall; K. S. Burns; J. J. Jacobs; S. M. Ashiglar; J. E. Lundquist; M. -S. Kim; Amy Ross-Davis; C. Hoffman; R. Mathiasen; R. Hofstetter; John Shaw; E. W. I. Pitman; E. V. Nelson; Geral I. McDonald; M. R. Cleary; S. Brar; B. Richardson; Ned Klopfenstein

2016-01-01

Pseudotsuga menziesii (Douglas-fir) is a dominant component of forest stands in much of western North America. It is an important tree to the timber industry, yielding more timber than any other species in North America. It is also extremely important for wildlife as habitat and food. Many small birds and mammals feed on its seeds . Armillaria solidipes [...

Effect of weed management and seed rate on crop growth under direct dry seeded rice systems in Bangladesh.

PubMed

Ahmed, Sharif; Salim, Muhammad; Chauhan, Bhagirath S

2014-01-01

Weeds are a major constraint to the success of dry-seeded rice (DSR). The main means of managing these in a DSR system is through chemical weed control using herbicides. However, the use of herbicides alone may not be sustainable in the long term. Approaches that aim for high crop competitiveness therefore need to be exploited. One such approach is the use of high rice seeding rates. Experiments were conducted in the aman (wet) seasons of 2012 and 2013 in Bangladesh to evaluate the effect of weed infestation level (partially-weedy and weed-free) and rice seeding rate (20, 40, 60, 80, and 100 kg ha(-1)) on weed and crop growth in DSR. Under weed-free conditions, higher crop yields (5.1 and 5.2 t ha(-1) in the 2012 and 2013 seasons, respectively) were obtained at the seeding rate of 40 kg ha(-1) and thereafter, yield decreased slightly beyond 40 kg seed ha(-1). Under partially-weedy conditions, yield increased by 30 to 33% (2.0-2.2 and 2.9-3.2 t ha(-1) in the 2012 and 2013 seasons, respectively) with increase in seeding rate from 20 to 100 kg ha(-1). In the partially-weedy plots, weed biomass decreased by 41-60% and 54-56% at 35 days after sowing and at crop anthesis, respectively, when seeding rate increased from 20 to 100 kg ha(-1). Results from our study suggest that increasing seeding rates in DSR can suppress weed growth and reduce grain yield losses from weed competition.

Historical gains in soybean (Glycine max Merr.) seed yield are driven by linear increases in light interception, energy conversion, and partitioning efficiencies

PubMed Central

Koester, Robert P.; Skoneczka, Jeffrey A.; Cary, Troy R.; Diers, Brian W.; Ainsworth, Elizabeth A.

2014-01-01

Soybean (Glycine max Merr.) is the world’s most widely grown leguminous crop and an important source of protein and oil for food and feed. Soybean yields have increased substantially throughout the past century, with yield gains widely attributed to genetic advances and improved cultivars as well as advances in farming technology and practice. Yet, the physiological mechanisms underlying the historical improvements in soybean yield have not been studied rigorously. In this 2-year experiment, 24 soybean cultivars released between 1923 and 2007 were grown in field trials. Physiological improvements in the efficiencies by which soybean canopies intercepted light (εi), converted light energy into biomass (εc), and partitioned biomass into seed (εp) were examined. Seed yield increased by 26.5kg ha–1 year–1, and the increase in seed yield was driven by improvements in all three efficiencies. Although the time to canopy closure did not change in historical soybean cultivars, extended growing seasons and decreased lodging in more modern lines drove improvements in εi. Greater biomass production per unit of absorbed light resulted in improvements in εc. Over 84 years of breeding, soybean seed biomass increased at a rate greater than total aboveground biomass, resulting in an increase in εp. A better understanding of the physiological basis for yield gains will help to identify targets for soybean improvement in the future. PMID:24790116

Exploring the effects of cell seeding density on the differentiation of human pluripotent stem cells to brain microvascular endothelial cells.

PubMed

Wilson, Hannah K; Canfield, Scott G; Hjortness, Michael K; Palecek, Sean P; Shusta, Eric V

2015-05-21

Brain microvascular-like endothelial cells (BMECs) derived from human pluripotent stem cells (hPSCs) have significant promise as tools for drug screening and studying the structure and function of the BBB in health and disease. The density of hPSCs is a key factor in regulating cell fate and yield during differentiation. Prior reports of hPSC differentiation to BMECs have seeded hPSCs in aggregates, leading to non-uniform cell densities that may result in differentiation heterogeneity. Here we report a singularized-cell seeding approach compatible with hPSC-derived BMEC differentiation protocols and evaluate the effects of initial hPSC seeding density on the subsequent differentiation, yield, and blood-brain barrier (BBB) phenotype. A range of densities of hPSCs was seeded and differentiated, with the resultant endothelial cell yield quantified via VE-cadherin flow cytometry. Barrier phenotype of purified hPSC-derived BMECs was measured via transendothelial electrical resistance (TEER), and purification protocols were subsequently optimized to maximize TEER. Expression of characteristic vascular markers, tight junction proteins, and transporters was confirmed by immunocytochemistry and quantified by flow cytometry. P-glycoprotein and MRP-family transporter activity was assessed by intracellular accumulation assay. The initial hPSC seeding density of approximately 30,000 cells/cm(2) served to maximize the yield of VE-cadherin+ BMECs per input hPSC. BMECs displayed the highest TEER (>2,000 Ω × cm(2)) within this same range of initial seeding densities, although optimization of the BMEC purification method could minimize the seeding density dependence for some lines. Localization and expression levels of tight junction proteins as well as efflux transporter activity were largely independent of hPSC seeding density. Finally, the utility of the singularized-cell seeding approach was demonstrated by scaling the differentiation and purification process down from 6-well to 96-well culture without impacting BBB phenotype. Given the yield and barrier dependence on initial seeding density, the singularized-cell seeding approach reported here should enhance the reproducibility and scalability of hPSC-derived BBB models, particularly for the application to new pluripotent stem cell lines.

TaCYP78A5 regulates seed size in wheat (Triticum aestivum).

PubMed

Ma, Meng; Zhao, Huixian; Li, Zhaojie; Hu, Shengwu; Song, Weining; Liu, Xiangli

2016-03-01

Seed size is an important agronomic trait and a major component of seed yield in wheat. However, little is known about the genes and mechanisms that determine the final seed size in wheat. Here, we isolated TaCYP78A5, the orthologous gene of Arabidopsis CYP78A5/KLUH in wheat, from wheat cv. Shaan 512 and demonstrated that the expression of TaCYP78A5 affects seed size. TaCYP78A5 encodes the cytochrome P450 (CYP) 78A5 protein in wheat and rescued the phenotype of the Arabidopsis deletion mutant cyp78a5. By affecting the extent of integument cell proliferation in the developing ovule and seed, TaCYP78A5 influenced the growth of the seed coat, which appears to limit seed growth. TaCYP78A5 silencing caused a 10% reduction in cell numbers in the seed coat, resulting in a 10% reduction in seed size in wheat cv. Shaan 512. By contrast, the overexpression of TaCYP78A5 increased the number of cells in the seed coat, resulting in seed enlargement of ~11-35% in Arabidopsis. TaCYP78A5 activity was positively correlated with the final seed size. However, TaCYP78A5 overexpression significantly reduced seed set in Arabidopsis, possibly due to an ovule development defect. TaCYP78A5 also influenced embryo development by promoting embryo integument cell proliferation during seed development. Accordingly, a working model of the influence of TaCYP7A5 on seed size was proposed. This study provides direct evidence that TaCYP78A5 affects seed size and is a potential target for crop improvement. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Jet fuel from 18 cool-season oilseed feedstocks in a semi-arid environment

NASA Astrophysics Data System (ADS)

Allen, Brett; Jabro, Jay

2017-04-01

Renewable jet fuel feedstocks can potentially offset the demand for petroleum based transportation resources, diversify cropping systems, and provide numerous ecosystem services . However, identifying suitable feedstock supplies remains a primary constraint to adoption. A 4-yr, multi-site experiment initiated in fall 2012 investigated the yield potential of six winter- and twelve spring-types of cool-season oilseed feedstocks. Sidney, MT (250 mm annual growing season precipitation) was one of eight sites in the western USA with others in Colorado, Idaho, Iowa, Minnesota, North Dakota, Oregon, and Texas. Winter types of Camelina sativa (1), Brassica napus (4), and B. rapa (1) were planted in mid-September, while spring types of Camelina sativa (1), B. napus (4), B. rapa (1), B. juncea (2), B. carinata (2), and Sinapis alba (2) were planted in early to late April. Seeding rates varied by entry and were between 4 to 11 kg/ha. All plots were under no-till management. Plots were 3 by 9 m with each treatment (oilseed entry) replicated four times. Camelina 'Joelle' was the only fall-seeded entry that survived winters with little to no snow cover on plots and where minimum air temperature reached -32°C. Stands of 'Joelle' in the spring of all years were excellent. 'Joelle' plots were typically harvested in July, while spring types were harvested 2-6 weeks later. Severe hailstorms during the late growing seasons of 2013 and 2015 resulted in up to 95% seed loss, preventing normal seed yield harvest of spring types. The B. carinata and spring camelina were the least and most susceptible to hail damage during plant maturity, respectively. 'Joelle' winter camelina was harvested before the severe weather in both years, showing the benefit of an early maturing crop in regions prone to late season hail. Overall, camelina was the only winter type that showed potential as an oilseed feedstock due to its superior winter hardiness. For spring types, B. napus, Camelina sativa, and B. carinata showed the greatest potential. Seed yield, excluding the five winter types that succumbed every year to winter kill, ranged from about 200 to 2000 kg/ha, with B. napus hybrids (1900 kg/ha), winter and spring camelina (1700 kg/ha), and B. carinata (1300 kg/ha) showing the greatest feedstock potential. Other measurements taken, but not reported included crop phenology, canopy spectral reflectance, leaf area, leaf area index, canopy temperature, soil water use, crop biomass, yield components, seed oil%, seed fatty acid composition, and drought resistance. Overall, camelina was the only winter type in addition to spring types of B. napus, B. carinata, and camelina that showed good potential for jet fuel feedstocks in the semi-arid northern Great Plains, USA.

Guidelines for Estimating Cone and Seed Yields of Southern Pines

Treesearch

James P. Barnett

1999-01-01

Our ability to predict cone and seed yields of southern pines (Pinus spp.) prior to collection is important when scheduling and allocating resources. Many managers have enough historical data to predict their orchards' yield; but such data are generally unavailable for some species and for collections outside of orchards. Guidelines are...

[Effects of flower bud removal and artificial pollination on growth and yield of Tulipa edulis].

PubMed

Miao, Yuan-Yuan; Zhu, Zai-Biao; Guo, Qiao-Sheng; Ma, Hong-Liang; Yang, Ying; Zhu, Li-Fang

2014-06-01

The study was conducted to explore the response of growth and yield of Tulipa edulis to flower bud removal and artificial pollination. And flower bud removal and artificial pollination were carried out in the squaring period and bloom stage respectively. The morphological index and biomass indicators were determined and the yield was counted in harvest time. Result showed that flower bud removal was beneficial to the growth of T. edulis, resulting in increasing growth index, biomass as well as the yield of bulb. The diameter and dry weight of T. edulis fruit by artificial pollination were increased significantly compared with the control. Seed setting percentage increased to 100%, and the number of seed as well as the single grain weight increased by 69.03% and 16.48%, respectively, which did not significantly affect the bulb production. In conclusion, Flower bud removal treatment accelerates bulb biomass increase, so as to improve its yield. Artificial pollination raised significantly seed setting percentage, seed number as well as the single grain weight.

Investigating the use of Active Crop Canopy Sensors for Soybean Management in Field Research and Production

NASA Astrophysics Data System (ADS)

Miller, Joshua Jay

Approximately one-third of soybean yield gain is a result of improved agronomic practices, which includes disease and insect management. Treatments containing fungicide, insecticide, biological, and nutrient components were evaluated in Nebraska soybean fields during 2013 through 2015 to determine effects on soybean yield and profitability. The greatest yield (4.83 Mg ha -1, p=0.019) was achieved with a complete seed and pod set treatment, but resulted in the second lowest calculated net return (US151 ha -1, p=0.019) after accounting for fixed and variable costs at a soybean market price of US0.367 kg-1. The most profitable treatment was the fungicide seed treatment followed by no pod set treatment (US$241 ha-1, p=0.019). The use of pod set treatments in the absence of significant disease and insect pressure was not profitable in most instances. Crop canopy reflectance was measured several times throughout the season during 2014 and 2015 to evaluate normalized difference red edge (NDRE) index to predict soybean productivity. The NDRE values were used to calculate a cumulative reflectance value through the R6 growth stage, defined as area under the reflectance progress curve (AURPC). The AURPC values and seed yield were classified as top 25%, middle 50%, or bottom 25% by location. Multinomial regression determined that bottom AURPC values correctly predicted bottom yield 52.5% of the time (p=0.033), but ranged from 46.7 to 86.2% by location. Misclassifications by incorrectly identifying a bottom yield within the top AURPC ranged from 0.0% to 16.7% by location. The AURPC offers a novel method to delineate management zones in soybean production fields. Soybean canopy reflectance was also evaluated for the relationship between NDRE and soybean response to soybean cyst nematode (SCN; Heterodera glycines Ichinohe) infection. SCN-resistant and -susceptible varieties were planted in SCN-infested and non-infested sites during 2015 and 2016. Susceptible varieties yielded more than the resistant varieties at the non-infested sites by 245 kg ha-1 (p=0.004), and resistant varieties yielded more than the susceptible varieties at the SCN-infested sites by 340 kg ha -1 (p=0.0021). Measured NDRE values at R4 and R5 were different between resistant and susceptible varieties, but were not correlated with yield.

Over-expression of AtPAP2 in Camelina sativa leads to faster plant growth and higher seed yield

PubMed Central

2012-01-01

Background Lipids extracted from seeds of Camelina sativa have been successfully used as a reliable source of aviation biofuels. This biofuel is environmentally friendly because the drought resistance, frost tolerance and low fertilizer requirement of Camelina sativa allow it to grow on marginal lands. Improving the species growth and seed yield by genetic engineering is therefore a target for the biofuels industry. In Arabidopsis, overexpression of purple acid phosphatase 2 encoded by Arabidopsis (AtPAP2) promotes plant growth by modulating carbon metabolism. Overexpression lines bolt earlier and produce 50% more seeds per plant than wild type. In this study, we explored the effects of overexpressing AtPAP2 in Camelina sativa. Results Under controlled environmental conditions, overexpression of AtPAP2 in Camelina sativa resulted in longer hypocotyls, earlier flowering, faster growth rate, higher photosynthetic rate and stomatal conductance, increased seed yield and seed size in comparison with the wild-type line and null-lines. Similar to transgenic Arabidopsis, activity of sucrose phosphate synthase in leaves of transgenic Camelina was also significantly up-regulated. Sucrose produced in photosynthetic tissues supplies the building blocks for cellulose, starch and lipids for growth and fuel for anabolic metabolism. Changes in carbon flow and sink/source activities in transgenic lines may affect floral, architectural, and reproductive traits of plants. Conclusions Lipids extracted from the seeds of Camelina sativa have been used as a major constituent of aviation biofuels. The improved growth rate and seed yield of transgenic Camelina under controlled environmental conditions have the potential to boost oil yield on an area basis in field conditions and thus make Camelina-based biofuels more environmentally friendly and economically attractive. PMID:22472516

The Source of the PB1 Gene in Influenza Vaccine Reassortants Selectively Alters the Hemagglutinin Content of the Resulting Seed Virus

PubMed Central

Cobbin, Joanna C. A.; Verity, Erin E.; Gilbertson, Brad P.; Rockman, Steven P.

2013-01-01

The yields of egg-grown influenza vaccines are maximized by the production of a seed strain using a reassortment of the seasonal influenza virus isolate with a highly egg-adapted strain. The seed virus is selected based on high yields of viral hemagglutinin (HA) and expression of the surface antigens from the seasonal isolate. The remaining proteins are usually derived from the high-growth parent. However, a retrospective analysis of vaccine seeds revealed that the seasonal PB1 gene was selected in more than 50% of reassortment events. Using the model seasonal H3N2 virus A/Udorn/307/72 (Udorn) virus and the high-growth A/Puerto Rico/8/34 (PR8) virus, we assessed the influence of the source of the PB1 gene on virus growth and vaccine yield. Classical reassortment of these two strains led to the selection of viruses that predominantly had the Udorn PB1 gene. The presence of Udorn PB1 in the seed virus, however, did not result in higher yields of virus or HA compared to the yields in the corresponding seed virus with PR8 PB1. The 8-fold-fewer virions produced with the seed virus containing the Udorn PB1 were somewhat compensated for by a 4-fold increase in HA per virion. A higher HA/nucleoprotein (NP) ratio was found in past vaccine preparations when the seasonal PB1 was present, also indicative of a higher HA density in these vaccine viruses. As the HA viral RNA (vRNA) and mRNA levels in infected cells were similar, we propose that PB1 selectively alters the translation of viral mRNA. This study helps to explain the variability of vaccine seeds with respect to HA yield. PMID:23468502

Engineering Camelina sativa (L.) Crantz for enhanced oil and seed yields by combining diacylglycerol acyltransferase1 and glycerol-3-phosphate dehydrogenase expression.

PubMed

Chhikara, Sudesh; Abdullah, Hesham M; Akbari, Parisa; Schnell, Danny; Dhankher, Om Parkash

2018-05-01

Plant seed oil-based liquid transportation fuels (i.e., biodiesel and green diesel) have tremendous potential as environmentally, economically and technologically feasible alternatives to petroleum-derived fuels. Due to their nutritional and industrial importance, one of the major objectives is to increase the seed yield and oil production of oilseed crops via biotechnological approaches. Camelina sativa, an emerging oilseed crop, has been proposed as an ideal crop for biodiesel and bioproduct applications. Further increase in seed oil yield by increasing the flux of carbon from increased photosynthesis into triacylglycerol (TAG) synthesis will make this crop more profitable. To increase the oil yield, we engineered Camelina by co-expressing the Arabidopsis thaliana (L.) Heynh. diacylglycerol acyltransferase1 (DGAT1) and a yeast cytosolic glycerol-3-phosphate dehydrogenase (GPD1) genes under the control of seed-specific promoters. Plants co-expressing DGAT1 and GPD1 exhibited up to 13% higher seed oil content and up to 52% increase in seed mass compared to wild-type plants. Further, DGAT1- and GDP1-co-expressing lines showed significantly higher seed and oil yields on a dry weight basis than the wild-type controls or plants expressing DGAT1 and GPD1 alone. The oil harvest index (g oil per g total dry matter) for DGTA1- and GPD1-co-expressing lines was almost twofold higher as compared to wild type and the lines expressing DGAT1 and GPD1 alone. Therefore, combining the overexpression of TAG biosynthetic genes, DGAT1 and GPD1, appears to be a positive strategy to achieve a synergistic effect on the flux through the TAG synthesis pathway, and thereby further increase the oil yield. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Super-optimal CO2 reduces seed yield but not vegetative growth in wheat

NASA Technical Reports Server (NTRS)

Grotenhuis, T. P.; Bugbee, B.

1997-01-01

Although terrestrial atmospheric CO2 levels will not reach 1000 micromoles mol-1 (0.1%) for decades, CO2 levels in growth chambers and greenhouses routinely exceed that concentration. CO2 levels in life support systems in space can exceed 10000 micromoles mol-1(1%). Numerous studies have examined CO2 effects up to 1000 micromoles mol-1, but biochemical measurements indicate that the beneficial effects of CO2 can continue beyond this concentration. We studied the effects of near-optimal (approximately 1200 micromoles mol-1) and super-optimal CO2 levels (2400 micromoles mol-1) on yield of two cultivars of hydroponically grown wheat (Triticum aestivum L.) in 12 trials in growth chambers. Increasing CO2 from sub-optimal to near-optimal (350-1200 micromoles mol-1) increased vegetative growth by 25% and seed yield by 15% in both cultivars. Yield increases were primarily the result of an increased number of heads per square meter. Further elevation of CO2 to 2500 micromoles mol-1 reduced seed yield by 22% (P < 0.001) in cv. Veery-10 and by 15% (P < 0.001) in cv. USU-Apogee. Super-optimal CO2 did not decrease the number of heads per square meter, but reduced seeds per head by 10% and mass per seed by 11%. The toxic effect of CO2 was similar over a range of light levels from half to full sunlight. Subsequent trials revealed that super-optimal CO2 during the interval between 2 wk before and after anthesis mimicked the effect of constant super-optimal CO2. Furthermore, near-optimal CO2 during the same interval mimicked the effect of constant near-optimal CO2. Nutrient concentration of leaves and heads was not affected by CO2. These results suggest that super-optimal CO2 inhibits some process that occurs near the time of seed set resulting in decreased seed set, seed mass, and yield.

Quality of Lupinus albus L. (white lupin) seed: extent of genotypic and environmental effects.

PubMed

Annicchiarico, Paolo; Manunza, Patrizia; Arnoldi, Anna; Boschin, Giovanna

2014-07-16

White lupin seed can be used for traditional and functional foods or as animal feed. This study aimed to support lupin breeders and production stakeholders by assessing the extent of genotypic, environmental, and genotype × environment (GE) interaction effects on seed contents of oil, tocopherols (TOC), and quinolizidine alkaloids (QA), grain yield, and seed weight of eight elite genotypes grown in two climatically contrasting Italian locations for two cropping years. On average, plants in the subcontinental climate site exhibited higher grain yield and seed size, about 8% lower oil content, and almost 85% higher QA content than those in the Mediterranean climate site. The range of genotype means was 2.97-5.14 t/ha for yield, 92-110 mg/g for oil, and 0.121-0.133 mg/g for TOC. TOC amount was largely unpredictable and featured large GE interactions that hinder its genetic improvement. Oil and alkaloid contents and seed size are more predictable and offer potential for selection.

Effect of Weed Management and Seed Rate on Crop Growth under Direct Dry Seeded Rice Systems in Bangladesh

PubMed Central

Ahmed, Sharif; Salim, Muhammad; Chauhan, Bhagirath S.

2014-01-01

Weeds are a major constraint to the success of dry-seeded rice (DSR). The main means of managing these in a DSR system is through chemical weed control using herbicides. However, the use of herbicides alone may not be sustainable in the long term. Approaches that aim for high crop competitiveness therefore need to be exploited. One such approach is the use of high rice seeding rates. Experiments were conducted in the aman (wet) seasons of 2012 and 2013 in Bangladesh to evaluate the effect of weed infestation level (partially-weedy and weed-free) and rice seeding rate (20, 40, 60, 80, and 100 kg ha−1) on weed and crop growth in DSR. Under weed-free conditions, higher crop yields (5.1 and 5.2 t ha−1 in the 2012 and 2013 seasons, respectively) were obtained at the seeding rate of 40 kg ha−1 and thereafter, yield decreased slightly beyond 40 kg seed ha−1. Under partially-weedy conditions, yield increased by 30 to 33% (2.0–2.2 and 2.9–3.2 t ha−1 in the 2012 and 2013 seasons, respectively) with increase in seeding rate from 20 to 100 kg ha−1. In the partially-weedy plots, weed biomass decreased by 41–60% and 54–56% at 35 days after sowing and at crop anthesis, respectively, when seeding rate increased from 20 to 100 kg ha−1. Results from our study suggest that increasing seeding rates in DSR can suppress weed growth and reduce grain yield losses from weed competition. PMID:25000520

Reintroduction of rare arable plants by seed transfer. What are the optimal sowing rates?

PubMed

Lang, Marion; Prestele, Julia; Fischer, Christina; Kollmann, Johannes; Albrecht, Harald

2016-08-01

During the past decades, agro-biodiversity has markedly declined and some species are close to extinction in large parts of Europe. Reintroduction of rare arable plant species in suitable habitats could counteract this negative trend. The study investigates optimal sowing rates of three endangered species (Legousia speculum-veneris (L.) Chaix, Consolida regalis Gray, and Lithospermum arvense L.), in terms of establishment success, seed production, and crop yield losses.A field experiment with partial additive design was performed in an organically managed winter rye stand with study species added in ten sowing rates of 5-10,000 seeds m(-2). They were sown as a single species or as a three-species mixture (pure vs. mixed sowing) and with vs. without removal of spontaneous weeds. Winter rye was sown at a fixed rate of 350 grains m(-2). Performance of the study species was assessed as plant establishment and seed production. Crop response was determined as grain yield.Plant numbers and seed production were significantly affected by the sowing rate, but not by sowing type (pure vs. mixed sowing of the three study species), and weed removal. All rare arable plant species established and reproduced at sowing rates >25 seeds m(-2), with best performance of L. speculum-veneris. Negative density effects occurred to some extent for plant establishment and more markedly for seed production.The impact of the three study species on crop yield followed sigmoidal functions. Depending on the species, a yield loss of 10% occurred at >100 seeds m(-2). Synthesis and applications: The study shows that reintroduction of rare arable plants by seed transfer is a suitable method to establish them on extensively managed fields, for example, in organic farms with low nutrient level and without mechanical weed control. Sowing rates of 100 seeds m(-2) for C. regalis and L. arvense, and 50 seeds m(-2) for L. speculum-veneris are recommended, to achieve successful establishment with negligible crop yield losses.

Seedling Emergence and Phenotypic Response of Common Bean Germplasm to Different Temperatures under Controlled Conditions and in Open Field.

PubMed

De Ron, Antonio M; Rodiño, Ana P; Santalla, Marta; González, Ana M; Lema, María J; Martín, Isaura; Kigel, Jaime

2016-01-01

Rapid and uniform seed germination and seedling emergence under diverse environmental conditions is a desirable characteristic for crops. Common bean genotypes (Phaseolus vulgaris L.) differ in their low temperature tolerance regarding growth and yield. Cultivars tolerant to low temperature during the germination and emergence stages and carriers of the grain quality standards demanded by consumers are needed for the success of the bean crop. The objectives of this study were (i) to screen the seedling emergence and the phenotypic response of bean germplasm under a range of temperatures in controlled chamber and field conditions to display stress-tolerant genotypes with good agronomic performances and yield potential, and (ii) to compare the emergence of bean seedlings under controlled environment and in open field conditions to assess the efficiency of genebanks standard germination tests for predicting the performance of the seeds in the field. Three trials were conducted with 28 dry bean genotypes in open field and in growth chamber under low, moderate, and warm temperature. Morpho-agronomic data were used to evaluate the phenotypic performance of the different genotypes. Cool temperatures resulted in a reduction of the rate of emergence in the bean genotypes, however, emergence and early growth of bean could be under different genetic control and these processes need further research to be suitably modeled. Nine groups arose from the Principal Component Analysis (PCA) representing variation in emergence time and proportion of emergence in the controlled chamber and in the open field indicating a trend to lower emergence in large and extra-large seeded genotypes. Screening of seedling emergence and phenotypic response of the bean germplasm under a range of temperatures in controlled growth chambers and under field conditions showed several genotypes, as landraces 272, 501, 593, and the cultivar Borlotto, with stress-tolerance at emergence, and high yield potential that could be valuable genetic material for breeding programs. Additionally, the potential genetic erosion in genebanks was assessed. Regarding bean commercial traits, under low temperature at sowing time seed reached larger size, and crop yield was higher compared to warmer temperatures at the sowing time. Therefore, early sowing of bean is strongly recommended.

Seedling Emergence and Phenotypic Response of Common Bean Germplasm to Different Temperatures under Controlled Conditions and in Open Field

PubMed Central

De Ron, Antonio M.; Rodiño, Ana P.; Santalla, Marta; González, Ana M.; Lema, María J.; Martín, Isaura; Kigel, Jaime

2016-01-01

Rapid and uniform seed germination and seedling emergence under diverse environmental conditions is a desirable characteristic for crops. Common bean genotypes (Phaseolus vulgaris L.) differ in their low temperature tolerance regarding growth and yield. Cultivars tolerant to low temperature during the germination and emergence stages and carriers of the grain quality standards demanded by consumers are needed for the success of the bean crop. The objectives of this study were (i) to screen the seedling emergence and the phenotypic response of bean germplasm under a range of temperatures in controlled chamber and field conditions to display stress-tolerant genotypes with good agronomic performances and yield potential, and (ii) to compare the emergence of bean seedlings under controlled environment and in open field conditions to assess the efficiency of genebanks standard germination tests for predicting the performance of the seeds in the field. Three trials were conducted with 28 dry bean genotypes in open field and in growth chamber under low, moderate, and warm temperature. Morpho-agronomic data were used to evaluate the phenotypic performance of the different genotypes. Cool temperatures resulted in a reduction of the rate of emergence in the bean genotypes, however, emergence and early growth of bean could be under different genetic control and these processes need further research to be suitably modeled. Nine groups arose from the Principal Component Analysis (PCA) representing variation in emergence time and proportion of emergence in the controlled chamber and in the open field indicating a trend to lower emergence in large and extra-large seeded genotypes. Screening of seedling emergence and phenotypic response of the bean germplasm under a range of temperatures in controlled growth chambers and under field conditions showed several genotypes, as landraces 272, 501, 593, and the cultivar Borlotto, with stress-tolerance at emergence, and high yield potential that could be valuable genetic material for breeding programs. Additionally, the potential genetic erosion in genebanks was assessed. Regarding bean commercial traits, under low temperature at sowing time seed reached larger size, and crop yield was higher compared to warmer temperatures at the sowing time. Therefore, early sowing of bean is strongly recommended. PMID:27532005

Impact of Water Management on Efficacy of Insecticide Seed Treatments Against Rice Water Weevil (Coleoptera: Curculionidae) in Mississippi Rice

PubMed Central

Adams, A.; Gore, J.; Musser, F.; Cook, D.; Catchot, A.; Walker, T.; Awuni, G. A.

2015-01-01

Two experiments were conducted at the Delta Research and Extension Center in Stoneville, MS, during 2011 and 2012 to determine the impact of water management practices on the efficacy of insecticidal seed treatments targeting rice water weevil, Lissorhoptrus oryzophilus Kuschel. Larval densities and yield were compared for plots treated with labeled rates of thiamethoxam, chlorantraniliprole, and clothianidin and an untreated control. In the first experiment, plots were subjected to flood initiated at 6 and 8 wk after planting. Seed treatments significantly reduced larval densities with the 8-wk flood timing, but not the 6-wk flood timing. Overall, the treated plots yielded higher than the control plots. In the second experiment, the impact of multiple flushes on the efficacy of insecticidal seed treatments was evaluated. Plots were subjected to zero, one, or two flushes with water. All seed treatments reduced larval densities compared with the untreated control. Significantly fewer larvae were observed in plots that received one or two flushes compared with plots that did not receive a flush. All seed treatments resulted in higher yields compared to the untreated control in the zero and one flush treatments. When two flushes were applied, yield from the thiamethoxam and clothianidin treated plots was not significantly different from those of the control plots, while the chlorantraniliprole treated plots yielded significantly higher than the control. These data suggest that time from planting to flood did not impact the efficacy of seed treatments, but multiple flushes reduced the efficacy of thiamethoxam and clothianidin. PMID:26470232

Preliminary Studies of the Performance of Quinoa (Chenopodium quinoa Willd.) Genotypes under Irrigated and Rainfed Conditions of Central Malawi.

PubMed

Maliro, Moses F A; Guwela, Veronica F; Nyaika, Jacinta; Murphy, Kevin M

2017-01-01

The goal of sustainable intensification of agriculture in Malawi has led to the evaluation of innovative, regionally novel or under-utilized crop species. Quinoa ( Chenopodium quinoa Willd.) has the potential to provide a drought tolerant, nutritious alternative to maize. We evaluated 11 diverse varieties of quinoa for their yield and agronomic performance at two locations, Bunda and Bembeke, in Malawi. The varieties originated from Ecuador, Chile and Bolivia in South America; the United States and Canada in North America; and, Denmark in Europe, and were chosen based on their variation in morphological and agronomic traits, and their potential for adaptation to the climate of Malawi. Plant height, panicle length, days to maturity, harvest index, and seed yield were recorded for each variety under irrigation at Bunda and Bembeke, and under rainfed conditions at Bunda. Plant height was significantly influenced by both genotype and environment. There were also significant differences between the two locations for panicle length whereas genotype and genotype × environment (G × E) interaction were not significantly different. Differences were found for genotype and G × E interaction for harvest index. Notably, differences for genotype, environment and G × E were found for grain yield. Seed yield was higher at Bunda (237-3019 kg/ha) than Bembeke (62-692 kg/ha) under irrigated conditions. The highest yielding genotype at Bunda was Titicaca (3019 kg/ha) whereas Multi-Hued was the highest (692 kg/ha) at Bembeke. Strong positive correlations between seed yield and (1) plant height ( r = 0.74), (2) days to maturity ( r = 0.76), and (3) biomass ( r = 0.87) were found under irrigated conditions. The rainfed evaluations at Bunda revealed significant differences in seed yield, plant biomass, and seed size among the genotypes. The highest yielding genotype was Black Seeded (2050 kg/ha) followed by Multi-Hued (1603 kg/ha) and Bio-Bio (1446 kg/ha). Ecuadorian (257 kg/ha) was the lowest yielding genotype. In general the seed yields of the genotypes were lower under rainfed conditions than under irrigated conditions at Bunda. The results also highlight the need to continue evaluating a diverse number of cultivars to select for genotypes adapted to specific agro-ecological areas and across seasons in Malawi.

Preliminary Studies of the Performance of Quinoa (Chenopodium quinoa Willd.) Genotypes under Irrigated and Rainfed Conditions of Central Malawi

PubMed Central

Maliro, Moses F. A.; Guwela, Veronica F.; Nyaika, Jacinta; Murphy, Kevin M.

2017-01-01

The goal of sustainable intensification of agriculture in Malawi has led to the evaluation of innovative, regionally novel or under-utilized crop species. Quinoa (Chenopodium quinoa Willd.) has the potential to provide a drought tolerant, nutritious alternative to maize. We evaluated 11 diverse varieties of quinoa for their yield and agronomic performance at two locations, Bunda and Bembeke, in Malawi. The varieties originated from Ecuador, Chile and Bolivia in South America; the United States and Canada in North America; and, Denmark in Europe, and were chosen based on their variation in morphological and agronomic traits, and their potential for adaptation to the climate of Malawi. Plant height, panicle length, days to maturity, harvest index, and seed yield were recorded for each variety under irrigation at Bunda and Bembeke, and under rainfed conditions at Bunda. Plant height was significantly influenced by both genotype and environment. There were also significant differences between the two locations for panicle length whereas genotype and genotype × environment (G × E) interaction were not significantly different. Differences were found for genotype and G × E interaction for harvest index. Notably, differences for genotype, environment and G × E were found for grain yield. Seed yield was higher at Bunda (237–3019 kg/ha) than Bembeke (62–692 kg/ha) under irrigated conditions. The highest yielding genotype at Bunda was Titicaca (3019 kg/ha) whereas Multi-Hued was the highest (692 kg/ha) at Bembeke. Strong positive correlations between seed yield and (1) plant height (r = 0.74), (2) days to maturity (r = 0.76), and (3) biomass (r = 0.87) were found under irrigated conditions. The rainfed evaluations at Bunda revealed significant differences in seed yield, plant biomass, and seed size among the genotypes. The highest yielding genotype was Black Seeded (2050 kg/ha) followed by Multi-Hued (1603 kg/ha) and Bio-Bio (1446 kg/ha). Ecuadorian (257 kg/ha) was the lowest yielding genotype. In general the seed yields of the genotypes were lower under rainfed conditions than under irrigated conditions at Bunda. The results also highlight the need to continue evaluating a diverse number of cultivars to select for genotypes adapted to specific agro-ecological areas and across seasons in Malawi. PMID:28289421

Historical gains in soybean (Glycine max Merr.) seed yield are driven by linear increases in light interception, energy conversion, and partitioning efficiencies.

PubMed

Koester, Robert P; Skoneczka, Jeffrey A; Cary, Troy R; Diers, Brian W; Ainsworth, Elizabeth A

2014-07-01

Soybean (Glycine max Merr.) is the world's most widely grown leguminous crop and an important source of protein and oil for food and feed. Soybean yields have increased substantially throughout the past century, with yield gains widely attributed to genetic advances and improved cultivars as well as advances in farming technology and practice. Yet, the physiological mechanisms underlying the historical improvements in soybean yield have not been studied rigorously. In this 2-year experiment, 24 soybean cultivars released between 1923 and 2007 were grown in field trials. Physiological improvements in the efficiencies by which soybean canopies intercepted light (εi), converted light energy into biomass (εc), and partitioned biomass into seed (εp) were examined. Seed yield increased by 26.5kg ha(-1) year(-1), and the increase in seed yield was driven by improvements in all three efficiencies. Although the time to canopy closure did not change in historical soybean cultivars, extended growing seasons and decreased lodging in more modern lines drove improvements in εi. Greater biomass production per unit of absorbed light resulted in improvements in εc. Over 84 years of breeding, soybean seed biomass increased at a rate greater than total aboveground biomass, resulting in an increase in εp. A better understanding of the physiological basis for yield gains will help to identify targets for soybean improvement in the future. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Responses of seed germination, seedling growth, and seed yield traits to seed pretreatment in maize (Zea mays L.).

PubMed

Tian, Yu; Guan, Bo; Zhou, Daowei; Yu, Junbao; Li, Guangdi; Lou, Yujie

2014-01-01

A series of seed priming experiments were conducted to test the effects of different pretreatment methods to seed germination, seedling growth, and seed yield traits in maize (Zea mays L.). Results indicated that the seeds primed by gibberellins (GA), NaCl, and polyethylene glycol (PEG) reagents showed a higher imbibitions rate compared to those primed with water. The final germination percentage and germination rate varied with different reagents significantly (P < 0.05). The recommended prime reagents were GA at 10 mg/L, NaCl at 50 mM, and PEG at 15% on account of germination experiment. 15% PEG priming reagent increased shoot and root biomass of maize seedling. The shoot biomass of seedlings after presoaking the seeds with NaCl reagent was significantly higher than the seedlings without priming treatment. No significant differences of plant height, leaf number, and hundred-grain weight were observed between control group and priming treatments. Presoaking with water, NaCl (50 mM), or PEG (15%) significantly increased the hundred-grain weight of maize. Therefore, seed pretreatment is proved to be an effective technique to improve the germination performance, seedling growth, and seed yield of maize. However, when compared with the two methods, if immediate sowing is possible, presoaking is recommended to harvest better benefits compared to priming method.

Validation of mega-environment universal and specific QTL associated with seed yield and agronomic traits in soybeans.

PubMed

Palomeque, Laura; Liu, Li-Jun; Li, Wenbin; Hedges, Bradley R; Cober, Elroy R; Smid, Mathew P; Lukens, Lewis; Rajcan, Istvan

2010-03-01

The value of quantitative trait loci (QTL) is dependent on the strength of association with the traits of interest, allelic diversity at the QTL and the effect of the genetic background on the expression of the QTL. A number of recent studies have identified QTL associated with traits of interest that appear to be independent of the environment but dependent on the genetic background in which they are found. Therefore, the objective of this study was to validate universal and/or mega-environment-specific seed yield QTL that have been previously reported in an independent recombinant inbred line (RIL) population derived from the cross between an elite Chinese and Canadian parent. The population was evaluated at two field environments in China and in five environments in Canada in 2005 and 2006. Of the seven markers linked to seed yield QTL reported by our group in a previous study, four were polymorphic between the two parents. No association between seed yield and QTL was observed. The result could imply that seed yield QTL were either not stable in this particular genetic background or harboured different alleles than the ones in the original mapping population. QTL(U) Satt162 was associated with several agronomic traits of which lodging was validated. Both the non-adapted and adapted parent contributed favourable alleles to the progeny. Therefore, plant introductions have been validated as a source of favourable alleles that could increase the genetic variability of the soybean germplasm pool and lead to further improvements in seed yield and other agronomic traits.

Imidacloprid seed treatments affect individual ant behavior and community structure but not egg predation, pest abundance or soybean yield.

PubMed

Penn, Hannah J; Dale, Andrew M

2017-08-01

Neonicotinoid seed treatments are under scrutiny because of their variable efficacy against crop pests and for their potential negative impacts on non-target organisms. Ants provide important biocontrol services in agroecosystems and can be indicators of ecosystem health. This study tested for effects of exposure to imidacloprid plus fungicide or fungicide-treated seeds on individual ant survival, locomotion and foraging capabilities and on field ant community structure, pest abundance, ant predation and yield. Cohorts of ants exposed to either type of treated seed had impaired locomotion and a higher incidence of morbidity and mortality but no loss of foraging capacity. In the field, we saw no difference in ant species richness, regardless of seed treatment. Blocks with imidacloprid did have higher species evenness and diversity, probably owing to variable effects of the insecticide on different ant species, particularly Tetramorium caespitum. Ant predation on sentinel eggs, pest abundance and soybean growth and yield were similar in the two treatments. Both seed treatments had lethal and sublethal effects on ant individuals, and the influence of imidacloprid seed coating in the field was manifested in altered ant community composition. Those effects, however, were not strong enough to affect egg predation, pest abundance or soybean yield in field blocks. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Onion Hybrid Seed Production: Relation with Nectar Composition and Flower Traits.

PubMed

Soto, Veronica C; Caselles, Cristian A; Silva, Maria F; Galmarini, Claudio R

2018-05-28

Onion (Allium cepa L.) is one of the main vegetable crops. Pollinators are required for onion seed production, being honeybees the most used. Around the world, two types of onion varieties are grown: open pollinated (OP) and hybrids. Hybrids offer numerous advantages to growers, but usually have lower seed yields than OP cultivars, which in many cases compromise the success of new hybrids. As pollination is critical for seed set, understanding the role of floral rewards and attractants to pollinator species is the key to improve crop seed yield. In this study, the correlation of nectar-analyzed compounds, floral traits, and seed yield under open field conditions in two experimental sites was determined. Nectar composition was described through the analysis of sugars, phenol, and alkaloid compounds. Length and width of the style and tepals of the flowers were measured to describe floral traits. Floral and nectar traits showed differences among the studied lines. For nectar traits, we found a significant influence of the environment where plants were cultivated. Nonetheless, flower traits were not influenced by the experimental sites. The OP and the male-sterile lines (MSLs) showed differences in nectar chemical composition and floral traits. In addition, there were differences between and within MSLs, some of which were correlated with seed yield, bringing the opportunity to select the most productive MSL, using simple determinations of morphological characters like the length of the style or tepals size.

Impact of Lygus spp. (Hemiptera: Miridae) on damage, yield and quality of lesquerella (Physaria fendleri), a potential new oil-seed crop.

PubMed

Naranjo, Steven E; Ellsworth, Peter C; Dierig, David A

2011-10-01

Lesquerella, Physaria fendleri (A. Gray) S. Watson, is a mustard native to the western United States and is currently being developed as a commercial source of valuable hydroxy fatty acids that can be used in a number of industrial applications, including biolubricants, biofuel additives, motor oils, resins, waxes, nylons, plastics, corrosion inhibitors, cosmetics, and coatings. The plant is cultivated as a winter-spring annual and in the desert southwest it harbors large populations of arthropods, several of which could be significant pests once production expands. Lygus spp. (Hemiptera: Miridae) are common in lesquerella and are known pests of a number of agronomic and horticultural crops where they feed primarily on reproductive tissues. A 4-yr replicated plot study was undertaken to evaluate the probable impact of Lygus spp. on production of this potential new crop. Plant damage and subsequent seed yield and quality were examined relative to variable and representative densities of Lygus spp. (0.3-4.9 insects per sweep net) resulting from variable frequency and timing of insecticide applications. Increasing damage to various fruiting structures (flowers [0.9-13.9%], buds [1.2-7.1%], and seed pods [19.4-42.5%]) was significantly associated with increasing pest abundance, particularly the abundance of nymphs, in all years. This damage, however, did not consistently translate into reductions in seed yield (481-1,336 kg/ha), individual seed weight (0.5-0.7 g per 1,000 seed), or seed oil content (21.8-30.4%), and pest abundance generally explained relatively little of the variation in crop yield and quality. Negative effects on yield were not sensitive to the timing of pest damage (early versus late season) but were more pronounced during years when potential yields were lower due to weed competition and other agronomic factors. Results suggest that if the crop is established and managed in a more optimal fashion, Lygus spp. may not significantly limit yield. Nonetheless, additional work will be needed once more uniform cultivars become available and yield effects can be more precisely measured. Densities of Lygus spp. in unsprayed lesquerella are on par with those in other known agroecosystem level sources of this pest (e.g., forage and seed alfalfa, Medicago sativa L.). Thus, lesquerella production may introduce new challenges to pest management in crops such as cotton.

Blackleg (Leptosphaeria maculans) Severity and Yield Loss in Canola in Alberta, Canada

PubMed Central

Hwang, Sheau-Fang; Strelkov, Stephen E.; Peng, Gary; Ahmed, Hafiz; Zhou, Qixing; Turnbull, George

2016-01-01

Blackleg, caused by Leptosphaeria maculans, is an important disease of oilseed rape (Brassica napus L.) in Canada and throughout the world. Severe epidemics of blackleg can result in significant yield losses. Understanding disease-yield relationships is a prerequisite for measuring the agronomic efficacy and economic benefits of control methods. Field experiments were conducted in 2013, 2014, and 2015 to determine the relationship between blackleg disease severity and yield in a susceptible cultivar and in moderately resistant to resistant canola hybrids. Disease severity was lower, and seed yield was 120%–128% greater, in the moderately resistant to resistant hybrids compared with the susceptible cultivar. Regression analysis showed that pod number and seed yield declined linearly as blackleg severity increased. Seed yield per plant decreased by 1.8 g for each unit increase in disease severity, corresponding to a decline in yield of 17.2% for each unit increase in disease severity. Pyraclostrobin fungicide reduced disease severity in all site-years and increased yield. These results show that the reduction of blackleg in canola crops substantially improves yields. PMID:27447676

Recent Genetic Gains in Nitrogen Use Efficiency in Oilseed Rape

PubMed Central

Stahl, Andreas; Pfeifer, Mara; Frisch, Matthias; Wittkop, Benjamin; Snowdon, Rod J.

2017-01-01

Nitrogen is essential for plant growth, and N fertilization allows farmers to obtain high yields and produce sufficient agricultural commodities. On the other hand, nitrogen losses potentially cause adverse effects to ecosystems and to human health. Increasing nitrogen use efficiency (NUE) is vital to solve the conflict between productivity, to secure the demand of a growing world population, and the protection of the environment. To ensure this, genetic improvement is considered to be a paramount aspect toward ecofriendly crop production. Winter oilseed rape (Brassica napus L.) is the second most important oilseed crop in the world and is cultivated in many regions across the temperate zones. To our knowledge, this study reports the most comprehensive field-based data generated to date for an empirical evaluation of genetic improvement in winter oilseed rape varieties under two divergent nitrogen fertilization levels (NFLs). A collection of 30 elite varieties registered between 1989 and 2014, including hybrids and open pollinated varieties, was tested in a 2-year experiment in 10 environments across Germany for changes in seed yield and seed quality traits. Furthermore, NUE was calculated. We observed a highly significant genetics-driven increase in seed yield per-se and, thus, increased NUE at both NFLs. On average, seed yield from modern open-pollinated varieties and modern hybrids was higher than from old open-pollinated varieties and old hybrids. The annual yield progress across all tested varieties was ~35 kg ha−1 year−1 at low nitrogen and 45 kg ha−1 year−1 under high nitrogen fertilization. Furthermore, in modern varieties an increased oil concentration and decreased protein concentration was observed. Despite, the significant effects of nitrogen fertilization, a surprisingly low average seed yield gap of 180 kg N ha−1 was noted between high and low nitrogen fertilization. Due to contrary effects of N fertilization on seed yield per-se and seed oil concentration an oil yield of 2.04 t ha−1 was measured at both N levels. Collectively, the data reveal that genetic improvement through modern breeding techniques in conjunction with reduced N fertilizer inputs has a tremendous potential to increase NUE of oilseed rape. PMID:28638399

Image-Based Rapid Phenotyping Method of Chickpeas Seed Size Characterization

USDA-ARS?s Scientific Manuscript database

The value of a chickpea crop is influenced by both total seed yield and also by the size of the harvested seed. Larger seeds are used for canning, salads, and fresh markets and have a higher value than smaller seeds, which are typically processed into hummus. The standard method for determining seed...

Preparation and mechanism analysis of an environment-friendly maize seed coating agent.

PubMed

Zeng, Defang; Fan, Zhao; Tian, Xu; Wang, Wenjin; Zhou, Mingchun; Li, Haochuan

2018-06-01

Traditional seed coating agents often contain toxic ingredients, which contaminate the environment and threaten human health. This paper expounds a method of preparing a novel environment-friendly seed coating agent for maize and researches its mechanism of action. The natural polysaccharide polymer, which is the main active ingredient of this environment-friendly seed coating agent, has the characteristics of innocuity and harmlessness, and it can replace the toxic ingredients used in traditional seed coating agents. This environment-friendly seed coating agent for maize was mainly made up of the natural polysaccharide polymer and other additives. The field trials results showed that the control efficacy of Helminthosporium maydis came to 93.72%, the anti-feeding rate of cutworms came to 81.29%, and the maize yield was increased by 17.75%. Besides, the LD 50 value (half the lethal dose in rats) of this seed coating agent was 10 times higher than that of the traditional seed coating agents. This seed coating agent could improve the activity of plant protective enzymes (peroxidase, catalase and superoxidase dismutase) and increase the chlorophyll content. This seed coating agent has four characteristics of disease prevention, desinsectization, increasing yield and safety. Results of mechanism analyses showed that this seed coating agent could enhance disease control effectiveness by improving plant protective enzymes activity and increase maize yield by improving chlorophyll content. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Sci-Sat AM(2): Brachy-07: Tomosynthesis-based seed reconstruction in LDR prostate brachytherapy: A clinical study.

PubMed

Brunet-Benkhoucha, M; Verhaegen, F; Lassalle, S; Béliveau-Nadeau, D; Reniers, B; Donath, D; Taussky, D; Carrier, J-F

2008-07-01

To develop a tomosynthesis-based dose assessment procedure that can be performed after an I-125 prostate seed implantation, while the patient is still under anaesthesia on the treatment table. Our seed detection procedure involves the reconstruction of a volume of interest based on the backprojection of 7 seed-only binary images acquired over an angle of 60° with an isocentric imaging system. A binary seed-only volume is generated by a simple thresholding of the volume of interest. Seeds positions are extracted from this volume with a 3D connected component analysis and a statistical classifier that determines the number of seeds in each cluster of connected voxels. A graphical user interface (GUI) allows to visualize the result and to introduce corrections, if needed. A phantom and a clinical study (24 patients) were carried out to validate the technique. A phantom study demonstrated a very good localization accuracy of (0.4+/-0.4) mm when compared to CT-based reconstruction. This leads to dosimetric error on D90 and V100 of respectively 0.5% and 0.1%. In a patient study with an average of 56 seeds per implant, the automatic tomosynthesis-based reconstruction yields a detection rate of 96% of the seeds and less than 1.5% of false-positives. With the help of the GUI, the user can achieve a 100% detection rate in an average of 3 minutes. This technique would allow to identify possible underdosage and to correct it by potentially reimplanting additional seeds. A more uniform dose coverage could then be achieved in LDR prostate brachytherapy. © 2008 American Association of Physicists in Medicine.

Natural variation of fecundity components in a widespread plant with dimorphic seeds

NASA Astrophysics Data System (ADS)

Braza, Rita; Arroyo, J.; García, M. B.

2010-09-01

The number and size of seeds are the basis of the quantity and quality components of female reproductive fitness in plants, playing a central role in the evolutionary ecology of life history diversification. In this study we show and analyze the natural variability of several fecundity variables (fruit set, seed production per fruit, seed size, total seed production per plant, and proportion of small seeds) in Plantago coronopus, a widespread, short-lived herb with dimorphic seeds. The structure of such variability was examined at the individual, population (eight locations with different environments within the same region), and life history levels (annual vs perennial), and correlated to soil fertility. There was no divergence associated to the life history for any of the variables studied. Total seed production (the quantity component of female fitness) was correlated with maternal resources, while the size of the large mucilaginous, basal seeds, and the proportion of the small apical seeds (quality component) were more associated to environmental resources. Thus, internal and external resources shape different fitness components, maximizing seed production, and fitting the size and proportion of different kind of seeds to local conditions irrespective of life history. P. coronopus illustrates the versatility of short-lived widespread plants to combine fecundity traits in a flexible manner, in order to increase fitness at each of the many possible habitats they occupy over heterogeneous environments.

Preinoculation of Soybean Seeds Treated with Agrichemicals up to 30 Days before Sowing: Technological Innovation for Large-Scale Agriculture

PubMed Central

da Cruz, Sonia Purin; Martin, Thomas Newton; Nakatani, André Shigueyoshi; Nogueira, Marco Antonio; Hungria, Mariangela

2017-01-01

The cultivation of soybean in Brazil experienced an expressive growth in the last decades. Soybean is highly demanding on nitrogen (N) that must come from fertilizers or from biological fixation. The N supply to the soybean crop in Brazil relies on the inoculation with elite strains of Bradyrhizobium japonicum, B. elkanii, and B. diazoefficiens, which are able to fulfill the crop's N requirements and enrich the soil for the following crop. The effectiveness of the association between N2-fixing bacteria and soybean plants depends on the efficacy of the inoculation process. Seed treatment with pesticides, especially fungicides or micronutrients, may rapidly kill the inoculated bacteria, affecting the establishment and outcome of the symbiosis. The development of technologies that allow inoculation to become a successful component of industrial seed treatment represents a valuable tool for the seed industry, as well as for the soybean crop worldwide. In this article, we report the results of new technologies, developed by the company Total Biotecnologia Indústria e Comércio S/A of Brazil, for preinoculation of soybean seeds with bradyrhizobia, in the presence of agrichemicals. Our results demonstrate improved bacterial survival for up to 30 days after inoculation, without compromising nodulation, N2-fixation, and yield in the field. PMID:29129977

Preinoculation of Soybean Seeds Treated with Agrichemicals up to 30 Days before Sowing: Technological Innovation for Large-Scale Agriculture.

PubMed

Araujo, Ricardo Silva; da Cruz, Sonia Purin; Souchie, Edson Luiz; Martin, Thomas Newton; Nakatani, André Shigueyoshi; Nogueira, Marco Antonio; Hungria, Mariangela

2017-01-01

The cultivation of soybean in Brazil experienced an expressive growth in the last decades. Soybean is highly demanding on nitrogen (N) that must come from fertilizers or from biological fixation. The N supply to the soybean crop in Brazil relies on the inoculation with elite strains of Bradyrhizobium japonicum, B. elkanii, and B. diazoefficiens , which are able to fulfill the crop's N requirements and enrich the soil for the following crop. The effectiveness of the association between N 2 -fixing bacteria and soybean plants depends on the efficacy of the inoculation process. Seed treatment with pesticides, especially fungicides or micronutrients, may rapidly kill the inoculated bacteria, affecting the establishment and outcome of the symbiosis. The development of technologies that allow inoculation to become a successful component of industrial seed treatment represents a valuable tool for the seed industry, as well as for the soybean crop worldwide. In this article, we report the results of new technologies, developed by the company Total Biotecnologia Indústria e Comércio S/A of Brazil, for preinoculation of soybean seeds with bradyrhizobia, in the presence of agrichemicals. Our results demonstrate improved bacterial survival for up to 30 days after inoculation, without compromising nodulation, N 2 -fixation, and yield in the field.

Effect of mechanical extraction parameters on the yield and quality of tobacco (Nicotiana tabacum L.) seed oil.

PubMed

Sannino, M; Del Piano, L; Abet, Massimo; Baiano, S; Crimaldi, M; Modestia, F; Raimo, F; Ricciardiello, G; Faugno, S

2017-11-01

The aim of this study was to investigate how the combination of extraction parameters, such as extraction temperature seeds preheating and screw rotation speed, influenced the yield and chemical quality of tobacco seed oil (TSO). For its peculiar properties, TSO can be used for several purposes, as raw material in the manufacturing of soap, paints, resins, lubricants, biofuels and also as edible oil. TSO was obtained using a mechanical screw press and the quality of the oil was evaluated by monitoring the free fatty acids (FFA), the peroxide value (PV), the spectroscopic indices K 232 , K 270 and ΔK and the fatty acid composition. The maximum extraction yield, expressed as percent of oil mechanically extracted respect to the oil content in the seeds, determined by solvent extraction, was obtained with the combination of the highest extraction temperature, the slowest screw rotation speed and seeds preheating. Under these conditions yield was 80.28 ± 0.33% (w/w), 25% higher than the lowest yield obtained among investigated conditions. The extraction temperature and seed preheating showed a significant effect on FFA, on spectroscopic indices K 232 , K 270 and ΔK values. The average values of these parameters slightly increased rising the temperature and in presence of preheating, the screw rotation speed did not affect the chemical characteristic tested. In the extraction conditions investigated no significant changes in PV and fatty acids composition of oil were observed.

Aplication of giberelins on flowering and yield of two varieties of shallot in lowland

NASA Astrophysics Data System (ADS)

Triharyanto, E.; Nyoto, S.; Yusrifani, I.

2018-03-01

Shallot is one of horticultural commodities which has difficulties in flowering and producing seeds. Flowering of shallot generally occurs in highlands at 9-12° C. Flowering in lowland can be supported with vernalization or replace cold temperature with gibberelin (GA3). This research is aimed to determine the effect of varieties, the concentration of GA3 applied and their interaction on flowering and yield of shallots grown in the lowlands, 98 m altitude with Vertisol-type soil. The research was conducted in a randomized complete block design (RCBD) with two factors, which were varieties (V): Bima and Mentes and concentration of GA3 (C) 0 ppm, 50 ppm, 100 ppm, 150 ppm and 200 ppm and repeated three times. Varieties have significant effect (P<0.05) on plant height, leaf number, the number of bulbs per clumps, weight of fresh bulbs per clumps, and percentage of small and large bulbs produced. Bima varieties were able to flower and produced seeds, while Mentes varieties could not produce flowers and seeds. GA3 concentration have no significant effect in all of the observed component. GA3 can’t replace cold temperature for supported flowering in varieties Mentes which were planted in lowlands. There was interaction between varieties and GA3 concentration occurs in variable percentage of small and large bulbs.

Effects of methanol-to-oil ratio, catalyst amount and reaction time on the FAME yield by in situ transesterification of rubber seeds (Hevea brasiliensis)

NASA Astrophysics Data System (ADS)

Abdulkadir, Bashir Abubakar; Uemura, Yoshimitsu; Ramli, Anita; Osman, Noridah B.; Kusakabe, Katsuki; Kai, Takami

2014-10-01

In this research, biodiesel is produced by in situ transesterification (direct transesterification) method from the rubber seeds using KOH as a catalyst. The influence of methanol to seeds mass ratio, duration of reaction, and catalyst loading was investigated. The result shows that, the best ratio of seeds to methanol is 1:6 (10 g seeds with 60 g methanol), 120 minutes reaction time and catalyst loading of 3.0 g. The maximum FAME yield obtain was 70 %. This findings support FAME production from the seeds of rubber tree using direct transesterifcation method from the seeds of rubber tree as an alternative to diesel fuel. Also, significant properties of biodiesel such as cloud point, density, pour point, specific gravity, and viscosity were investigated.

Static magnetic field treatment of seeds improves carbon and nitrogen metabolism under salinity stress in soybean.

PubMed

Baghel, Lokesh; Kataria, Sunita; Guruprasad, Kadur Narayan

2016-10-01

The effectiveness of magnetopriming was assessed for alleviation of salt-induced adverse effects on soybean growth. Soybean seeds were pre-treated with static magnetic field (SMF) of 200 mT for 1 h to evaluate the effect of magnetopriming on growth, carbon and nitrogen metabolism, and yield of soybean plants under different salinity levels (0, 25, and 50 mM NaCl). The adverse effect of NaCl-induced salt stress was found on growth, yield, and various physiological attributes of soybeans. Results indicate that SMF pre-treatment significantly increased plant growth attributes, number of root nodules, nodules, fresh weight, biomass accumulation, and photosynthetic performance under both non-saline and saline conditions as compared to untreated seeds. Polyphasic chlorophyll a fluorescence (OJIP) transients from magnetically treated plants gave a higher fluorescence yield at J-I-P phase. Nitrate reductase activity, PIABS , photosynthetic pigments, and net rate of photosynthesis were also higher in plants that emerged from SMF pre-treated seeds as compared to untreated seeds. Leghemoglobin content and hemechrome content in root nodules were also increased by SMF pre-treatment. Thus pre-sowing exposure of seeds to SMF enhanced carbon and nitrogen metabolism and improved the yield of soybeans in terms of number of pods, number of seeds, and seed weight under saline as well as non-saline conditions. Consequently, SMF pre-treatment effectively mitigated adverse effects of NaCl on soybeans. It indicates that magnetopriming of dry soybean seeds can be effectively used as a pre-sowing treatment for alleviating salinity stress. Bioelectromagnetics. 37:455-470, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Seed-Specific Expression of OsDWF4, a Rate-Limiting Gene Involved in Brassinosteroids Biosynthesis, Improves Both Grain Yield and Quality in Rice.

PubMed

Li, Qian-Feng; Yu, Jia-Wen; Lu, Jun; Fei, Hong-Yuan; Luo, Ming; Cao, Bu-Wei; Huang, Li-Chun; Zhang, Chang-Quan; Liu, Qiao-Quan

2018-04-18

Brassinosteroids (BRs) are essential plant-specific steroidal hormones that regulate diverse growth and developmental processes in plants. We evaluated the effects of OsDWF4, a gene that encodes a rate-limiting enzyme in BR biosynthesis, on both rice yield and quality when driven by the Gt1 or Ubi promoter, which correspond to seed-specific or constitutive expression, respectively. Generally, transgenic plants expressing OsDWF4 showed increased grain yield with more tillers and longer and heavier seeds. Moreover, the starch physicochemical properties of the transgenic rice were also improved. Interestingly, OsDWF4 was found to exert different effects on either rice yield or quality when driven by the different promoters. The overall performance of the pGt1::OsDWF4 lines was better than that of the pUbi::OsDWF4 lines. Our data not only demonstrate the effects of OsDWF4 overexpression on both rice yield and quality but also suggest that a seed-specific promoter is a good choice in BR-mediated rice breeding programs.

Yield and seed oil content response of dwarf, rapid-cycling Brassica to nitrogen treatments, planting density, and carbon dioxide enrichment

NASA Technical Reports Server (NTRS)

Frick, J.; Nielsen, S. S.; Mitchell, C. A.

1994-01-01

Effects of N level (15 to 30 mM), time of N increase (14 to 28 days after planting), and planting density (1163 to 2093 plants/m2) were determined for crop yield responses of dwarf, rapid-cycling brassica (Brassica napus L., CrGC 5-2, Genome: ACaacc). Crops were grown in solid-matrix hydroponic systems and under controlled-environment conditions, including nonsupplemented (ambient) or elevated CO2 concentrations (998 +/- 12 micromoles mol-1). The highest seed yield rate obtained (4.4 g m-2 day-1) occurred with the lowest N level (15 mM) applied at the latest treatment time (day 28). In all trials, CO2 enrichment reduced seed yield rate and harvest index by delaying the onset of flowering and senescence and stimulating vegetative shoot growth. The highest shoot biomass accumulation rate (55.5 g m-2 day-1) occurred with the highest N level (30 mM) applied at the earliest time (day 14). Seed oil content was not significantly affected by CO2 enrichment. Maximum seed oil content (30% to 34%, dry weight basis) was obtained using the lowest N level (15 mM) initiated at the latest treatment time (day 28). In general, an increase in seed oil content was accompanied by a decrease in seed protein. Seed carbohydrate, moisture, and ash contents did not vary significantly in response to experimental treatments. Effects of N level and time of N increase were consistently significant for most crop responses. Planting density was significant only under elevated CO2 conditions.

Tomato seeds as a novel by-product feed for lactating dairy cows.

PubMed

Cassinerio, C A; Fadel, J G; Asmus, J; Heguy, J M; Taylor, S J; DePeters, E J

2015-07-01

Whole tomato seeds, a novel by-product feedstuff, were fed to lactating Holstein cows to determine the nutritive value of whole tomato seeds by replacing whole cottonseed in the total mixed ration. Four primiparous and 4 multiparous Holstein cows were used in a 4×4 Latin square design and fed 1 of 4 total mixed rations. Whole tomato seeds replaced whole cottonseed on a weight-to-weight basis for lipid. The proportion of whole tomato seeds to whole cottonseed in the diets were 100:0, 50:50, 25:75, and 0:100 on a lipid basis. Thus, tomato seeds were 4.0, 2.4, 1.1, and 0% of the ration dry matter, respectively. Milk yield and the concentrations and yields of protein, lactose, and solids-not-fat did not differ for the effect of diet. However, milk fat concentration decreased and milk fat yield tended to decrease as whole tomato seeds replaced whole cottonseed. Intakes of dry matter, lipid, and crude protein did not differ. Whole-tract apparent digestibility of dry matter and ash-free neutral detergent fiber did not differ, but digestibility of total fatty acids and crude protein decreased with increasing proportion of whole tomato seeds. Urea concentration in milk and plasma both decreased with increasing whole tomato seeds. Fecal concentration of linoleic and α-linolenic acids increased with increasing whole tomato seeds, suggesting that seeds were passing out of the digestive tract undigested. The concentrations of C18:2n-6 and C18:3n-3 in milk fat had small increases, but their yields were not different, suggesting that only a small amount of whole-tomato-seed lipid might have been digested postruminally. Amounts of trans C18:1 fatty acids in milk fat were higher with increasing whole cottonseed, which might suggest a shift in rumen biohydrogenation pathways. At the level of feeding used in the current study, whole tomato seeds replaced whole cottonseed in the diet of lactating dairy cows without a change in production. Copyright © 2015 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

Combining-ability for cacao (Theobroma cacao L.) yield components under southern Bahia conditions.

PubMed

Dias, L A; Kageyama, P Y

1995-03-01

The objective of this study was to assess five cacao cultivars (selfs) and 20 hybrids with regard to their general-and specific-combining ability for yield components using method 1, model I, of the diallel analysis system. The selfings and the hybrids were obtained through controlled crossings, tested in the field in a random block design with four replications and plots containing 16 plants. The experiment was set up in the Centro de Pesquisas do Cacau, in Itabuna, Bahia, Brasil, in 1975. The characteristics studied were: the number of healthy and collected fruits per plant (NHFP and NCFP), the weight of humid seeds per plant and per fruit (WHSP and WHSF), and the percentage of diseased fruits per plant (PDFP), for 5 years (1986-1990). The F-test values, highly significant for general combining ability (GCA) and specific combining ability (SCA), demonstrated the existence of variability for both effects. However, the effects of SCA were greater than those of GCA, when compared in terms of the average squared effects. This condition held for the characteristics NHFP, NCFP and WHSP, which shows the relative importance of the non-additive genetic effects over the additive effects. The reciprocal effects did not show significance. Breeding methods which explore the additive portion of genetic variance should be employed for obtaining higher-yielding cacao and high seed weight. For this, the segregant populations should involve cultivars CEPEC 1, SIAL 169 and ICS 1. Combinations involving the cultivar ICS 1 presented the most favorable results for the characteristics WHSP and WHSF, where the hybrid SIAL 169 x ICS 1 and its reciprocal were outstanding.

Suppression of the SUGAR-DEPENDENT1 triacylglycerol lipase family during seed development enhances oil yield in oilseed rape (Brassica napus L.).

PubMed

Kelly, Amélie A; Shaw, Eve; Powers, Stephen J; Kurup, Smita; Eastmond, Peter J

2013-04-01

Increasing the productivity of oilseed crops is an important challenge for plant breeders and biotechnologists. To date, attempts to increase oil production in seeds via metabolic pathway engineering have focused on boosting synthetic capacity. However, in the tissues of many organisms, it is well established that oil levels are determined by both anabolism and catabolism. Indeed, the oil content of rapeseed (Brassica napus L.) has been reported to decline by approximately 10% in the final stage of development, as the seeds desiccate. Here, we show that RNAi suppression of the SUGAR-DEPENDENT1 triacylglycerol lipase gene family during seed development results in up to an 8% gain in oil yield on either a seed, plant or unit area basis in the greenhouse, with very little adverse impact on seed vigour. Suppression of lipolysis could therefore constitute a new method for enhancing oil yield in oilseed crops. © 2012 The Authors Plant Biotechnology Journal © 2012 Society for Experimental Biology, Association of Applied Biologists and Blackwell Publishing Ltd.

Modeling Biometric Traits, Yield and Nutritional and Antioxidant Properties of Seeds of Three Soybean Cultivars Through the Application of Biostimulant Containing Seaweed and Amino Acids

PubMed Central

Kocira, Sławomir; Szparaga, Agnieszka; Kocira, Anna; Czerwińska, Ewa; Wójtowicz, Agnieszka; Bronowicka-Mielniczuk, Urszula; Koszel, Milan; Findura, Pavol

2018-01-01

In recent years, attempts have been made to use preparations that allow obtaining high and good quality yields, while reducing the application of pesticides and mineral fertilizers. These include biostimulants that are safe for the natural environment and contribute to the improvement of yield size and quality, especially after the occurrence of stressors. Their use is advisable in the case of crops sensitive to such biotic stress factors like low temperatures or drought. One of these is soybean which is a very important plant from the economic viewpoint. Field experiments were established in the years 2014-2016 in a random block design in four replicates on experimental plots of 10 m2. Three soybean cultivars: Annushka, Mavka, and Atlanta were planted in the third decade of April. Fylloton biostimulant was used at 0.7% or 1% concentrations as single spraying (BBCH 13-15) or double spraying (BBCH 13-15, BBCH 61) in the vegetation period. The number of seeds per 1 m2, seed yield, thousand seed weight, number of pods per plant, number of nodes in the main shoot, height of plants, and protein and fat contents in seeds were determined. The content of phenolic compounds, antioxidant capacity and antioxidant effect of soybean seeds were assayed as well. Foliar treatment of soybean with Fylloton stimulated the growth and yield of plants without compromising their nutritional and nutraceutical properties. The double application of the higher concentration of Fylloton was favorable for the plant height, seed number and soybean yield. Moreover, the highest number of pods was obtained after single treatment of plants with the lower biostimulant concentration. There was also a positive effect of using this biostimulant on the content and activity of some bioactive compounds, such as phenolics and flavonoids, and on the reducing power. PMID:29636764

Modeling Biometric Traits, Yield and Nutritional and Antioxidant Properties of Seeds of Three Soybean Cultivars Through the Application of Biostimulant Containing Seaweed and Amino Acids.

PubMed

Kocira, Sławomir; Szparaga, Agnieszka; Kocira, Anna; Czerwińska, Ewa; Wójtowicz, Agnieszka; Bronowicka-Mielniczuk, Urszula; Koszel, Milan; Findura, Pavol

2018-01-01

In recent years, attempts have been made to use preparations that allow obtaining high and good quality yields, while reducing the application of pesticides and mineral fertilizers. These include biostimulants that are safe for the natural environment and contribute to the improvement of yield size and quality, especially after the occurrence of stressors. Their use is advisable in the case of crops sensitive to such biotic stress factors like low temperatures or drought. One of these is soybean which is a very important plant from the economic viewpoint. Field experiments were established in the years 2014-2016 in a random block design in four replicates on experimental plots of 10 m 2 . Three soybean cultivars: Annushka, Mavka, and Atlanta were planted in the third decade of April. Fylloton biostimulant was used at 0.7% or 1% concentrations as single spraying (BBCH 13-15) or double spraying (BBCH 13-15, BBCH 61) in the vegetation period. The number of seeds per 1 m 2 , seed yield, thousand seed weight, number of pods per plant, number of nodes in the main shoot, height of plants, and protein and fat contents in seeds were determined. The content of phenolic compounds, antioxidant capacity and antioxidant effect of soybean seeds were assayed as well. Foliar treatment of soybean with Fylloton stimulated the growth and yield of plants without compromising their nutritional and nutraceutical properties. The double application of the higher concentration of Fylloton was favorable for the plant height, seed number and soybean yield. Moreover, the highest number of pods was obtained after single treatment of plants with the lower biostimulant concentration. There was also a positive effect of using this biostimulant on the content and activity of some bioactive compounds, such as phenolics and flavonoids, and on the reducing power.

Phomopsis seed decay of soybean

USDA-ARS?s Scientific Manuscript database

Soybean Phomopsis seed decay (PSD) causes poor seed quality and suppresses yield in most soybean-growing countries. The disease is caused primarily by the fungal pathogen Phomopsis longicolla along with other Phomopsis and Diaporthe spp. Infected seed range from symptomless to shriveled, elongated, ...

Assessing the Potential Oleoresin Yields of Slash Pine Progenies at Juvenile Ages

Treesearch

A.E. Squillace; Charles R. Gansel

1968-01-01

The potential oleoresin yields of slash pine progenies can be assessed at juvenile ages, 7 to 8 years earlier than with previous methods. Seeds are sown in peat pots, outplanted shortly after germination at a spacing of 14 by 3 feet, and given intensive cultural treatment. At 26 years from seed, when the trees average about 9 feet tall, their potential yields are...

Very high CO2 reduces photosynthesis, dark respiration and yield in wheat

NASA Technical Reports Server (NTRS)

Reuveni, J.; Bugbee, B.

1997-01-01

Although terrestrial CO2 concentrations, [CO2] are not expected to reach 1000 micromoles mol-1 for many decades, CO2 levels in closed systems such as growth chambers and glasshouses, can easily exceed this concentration. CO2 levels in life support systems in space can exceed 10000 micromoles mol-1 (1%). Here we studied the effect of six CO2 concentrations, from ambient up to 10000 micromoles mol-1, on seed yield, growth and gas exchange of two wheat cultivars (USU-Apogee and Veery-l0). Elevating [CO2] from 350 to 1000 micromoles mol-1 increased seed yield (by 33%), vegetative biomass (by 25%) and number of heads m-2 (by 34%) of wheat plants. Elevation of [CO2] from 1000 to 10000 micromoles mol-1 decreased seed yield (by 37%), harvest index (by 14%), mass per seed (by 9%) and number of seeds per head (by 29%). This very high [CO2] had a negligible, non-significant effect on vegetative biomass, number of heads m-2 and seed mass per head. A sharp decrease in seed yield, harvest index and seeds per head occurred by elevating [CO2] from 1000 to 2600 micromoles mol-1. Further elevation of [CO2] from 2600 to 10000 micromoles mol-1 caused a further but smaller decrease. The effect of CO2 on both wheat cultivars was similar for all growth parameters. Similarly there were no differences in the response to high [CO2] between wheat grown hydroponically in growth chambers under fluorescent lights and those grown in soilless media in a glasshouse under sunlight and high pressure sodium lamps. There was no correlation between high [CO2] and ethylene production by flag leaves or by wheat heads. Therefore, the reduction in seed set in wheat plants is not mediated by ethylene. The photosynthetic rate of whole wheat plants was 8% lower and dark respiration of the wheat heads 25% lower when exposed to 2600 micromoles mol-1 CO2 compared to ambient [CO2]. It is concluded that the reduction in the seed set can be mainly explained by the reduction in the dark respiration in wheat heads, when most of the respiration is functional and is needed for seed development.

Reaction of maturity group V soybean plant introductions to Phomopsis Seed Decay in Arkansas Mississippi and Missouri 2009

USDA-ARS?s Scientific Manuscript database

In 2009, Soybean Phomopsis seed decay (PSD) caused over 12 million bushels of yield loss in 16 southern states. This disease severely affects soybean seed quality due to the reduction of seed viability, oil content, and alteration of seed composition, and it may also increase moldy and/or split seed...

Seed yield, development, and variation in diverse poa pratensis accessions

USDA-ARS?s Scientific Manuscript database

Post harvest residue removal is critical for continued high seed production of Kentucky bluegrass (Poa pratensis L.). Previous work showed some accessions have little or no yield reduction with mechanical residue removal compared with the controversial practice of open field burning. Using 10 of t...

[Infrared spectroscopic study on the component and vigor analysis of Cistanche deserticola seeds].

PubMed

Xu, Rong; Sun, Su-Qin; Chen, Jun; Chen, Shi-Lin; Zhou, Feng

2009-01-01

Comparative study of the different parts of cistanche deserticola seeds and their changes after different processing were examined by Fourier transform infrared spectroscopy spectra (FTIR). The results of the analysis showed that components in the cistanche deserticola seeds were abundant, which contained characteristic absorption peaks of protein, fat and carbohydrate. As well, pectin and aromatic compound can be also found in the seeds. However, the components were different in different parts of cistanche deserticola seeds. The characteristic absorption peak intensities of fat at 2,926, 1,746, 1,161 and 721 cm(-1) were the strongest in the seed kernels. However, the seed coats mainly consisted of carbohydrate and pectin, which were showed at 1,054 cm(-1). The contents of protein and carbohydrate were decreased distinctly in the moldy and dead seeds after processing. The characteristic absorption peak intensity ratio of protein to fat (I1,630/I1,745 ) was all higher than 1.05 in the live seeds. The characteristic absorption peak intensity ratio of amido link I of protein to fat (11,653/I1,745) in the dead seed kernels of the cistanche deserticola was decreased from 0.31 to 0. 23, which was 25.8% less than that in vital seed kernels. The results suggest that FTIR not only can be used in fast comprehensive analysis of seed components, but also can be used in the seed vigor analysis, seed longevity determination and seed quality evaluation.

β-Sitosterol: supercritical carbon dioxide extraction from sea buckthorn (Hippophae rhamnoides L.) seeds.

PubMed

Sajfrtová, Marie; Licková, Ivana; Wimmerová, Martina; Sovová, Helena; Wimmer, Zdenek

2010-04-22

Supercritical fluid extraction represents an efficient and environmentally friendly technique for isolation of phytosterols from different plant sources. Sea buckthorn (Hippophae rhamnoides L.) seeds were extracted with supercritical carbon dioxide at pressures ranging from 15-60 MPa and temperatures of 40-80 degrees C. Oil and β-sitosterol yields were measured in the extraction course and compared with Soxhlet extraction with hexane. The average yield of β-sitosterol was 0.31 mg/g of seeds. The maximum concentration of β-sitosterol in the extract, 0.5% w/w, was achieved at 15 MPa, 40 degrees C, and a carbon dioxide consumption of 50 g/g of seeds. The extraction rate was maximal at 60 MPa and 40 degrees C. Both β-sitosterol yield and its concentration in the extract obtained with hexane were lower than with carbon dioxide.

Photomorphogenesis, photosynthesis, and seed yield of wheat plants grown under red light-emitting diodes (LEDs) with and without supplemental blue lighting

NASA Technical Reports Server (NTRS)

Goins, G. D.; Yorio, N. C.; Sanwo, M. M.; Brown, C. S.; Sager, J. C. (Principal Investigator)

1997-01-01

Red light-emitting diodes (LEDs) are a potential light source for growing plants in spaceflight systems because of their safety, small mass and volume, wavelength specificity, and longevity. Despite these attractive features, red LEDs must satisfy requirements for plant photosynthesis and photomorphogenesis for successful growth and seed yield. To determine the influence of gallium aluminium arsenide (GaAlAs) red LEDs on wheat photomorphogenesis, photosynthesis, and seed yield, wheat (Triticum aestivum L., cv. 'USU-Super Dwarf') plants were grown under red LEDs and compared to plants grown under daylight fluorescent (white) lamps and red LEDs supplemented with either 1% or 10% blue light from blue fluorescent (BF) lamps. Compared to white light-grown plants, wheat grown under red LEDs alone demonstrated less main culm development during vegetative growth through preanthesis, while showing a longer flag leaf at 40 DAP and greater main culm length at final harvest (70 DAP). As supplemental BF light was increased with red LEDs, shoot dry matter and net leaf photosynthesis rate increased. At final harvest, wheat grown under red LEDs alone displayed fewer subtillers and a lower seed yield compared to plants grown under white light. Wheat grown under red LEDs+10% BF light had comparable shoot dry matter accumulation and seed yield relative to wheat grown under white light. These results indicate that wheat can complete its life cycle under red LEDs alone, but larger plants and greater amounts of seed are produced in the presence of red LEDs supplemented with a quantity of blue light.

Yield and size of oyster mushroom grown on rice/wheat straw basal substrate supplemented with cotton seed hull.

PubMed

Yang, Wenjie; Guo, Fengling; Wan, Zhengjie

2013-10-01

Oyster mushroom (Pleurotus ostreatus) was cultivated on rice straw basal substrate, wheat straw basal substrate, cotton seed hull basal substrate, and wheat straw or rice straw supplemented with different proportions (15%, 30%, and 45% in rice straw substrate, 20%, 30%, and 40% in wheat straw substrate) of cotton seed hull to find a cost effective substrate. The effect of autoclaved sterilized and non-sterilized substrate on growth and yield of oyster mushroom was also examined. Results indicated that for both sterilized substrate and non-sterilized substrate, oyster mushroom on rice straw and wheat basal substrate have faster mycelial growth rate, comparatively poor surface mycelial density, shorter total colonization period and days from bag opening to primordia formation, lower yield and biological efficiency, lower mushroom weight, longer stipe length and smaller cap diameter than that on cotton seed hull basal substrate. The addition of cotton seed hull to rice straw and wheat straw substrate slowed spawn running, primordial development and fruit body formation. However, increasing the amount of cotton seed hull can increase the uniformity and white of mycelium, yield and biological efficiency, and increase mushroom weight, enlarge cap diameter and shorten stipe length. Compared to the sterilized substrate, the non-sterilized substrate had comparatively higher mycelial growth rate, shorter total colonization period and days from bag opening to primordia formation. However, the non-sterilized substrate did not gave significantly higher mushroom yield and biological efficiency than the sterilized substrate, but some undesirable characteristics, i.e. smaller mushroom cap diameter and relatively long stipe length.

Optimization of mucilage extraction from chia seeds (Salvia hispanica L.) using response surface methodology.

PubMed

Orifici, Stefania C; Capitani, Marianela I; Tomás, Mabel C; Nolasco, Susana M

2018-02-25

Chia mucilage has potential application as a functional ingredient; advances on maximizing its extraction yield could represent a significant technological and economic impact for the food industry. Thus, first, the effect of mechanical agitation time (1-3 h) on the exudation of chia mucilage was analyzed. Then, response surface methodology was used to determine the optimal combination of the independent variables temperature (15-85 °C) and seed: water ratio (1: 12-1: 40.8 w/v) for the 2 h exudation that give maximum chia mucilage yield. Experiments were designed according to central composite rotatable design. A second-order polynomial model predicted the variation in extraction mucilage yield with the variables temperature and seed: water ratio. The optimal operating conditions were found to be temperature 85 °C and a seed: water ratio of 1: 31 (w/v), reaching an experimental extraction yield of 116 ± 0.21 g kg -1 (dry basis). The mucilage obtained exhibited good functional properties, mainly in terms of water-holding capacity, emulsifying activity, and emulsion stability. The results obtained show that temperature, seed: water ratio, and exudation time are important variables of the process that affect the extraction yield and the quality of the chia mucilage, determined according to its physicochemical and functional properties. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

Impact of combined exposure of chemical, fertilizer, bio-fertilizer and compost on growth, physiology and productivity of Brassica campestries in old alluvial soil.

PubMed

Datta, J K; Banerjee, A; Sikdar, M Saha; Gupta, S; Mondal, N K

2009-09-01

Field experiment was carried out during November 2006 to February 2007 under old alluvial soil to evaluate the impact of combined dose of chemical fertilizer, biofertilizer in combination with compost for the yellow sarson (Brassica campestries cv. B9) in a randomized block design replicated thrice. Various morpho-physiological parameters viz., plant population, length of shoot and root, leaf area index (LAI), crop growth rate (CGR), net assimilation rate (NAR), yield attributes viz., number of siliquae per plant, number of seeds/siliquae, 1000 seed weight (test weight), seed yield, stover yield and physiological and biochemical parameters viz., pigment content, sugar, amino acid, protein, ascorbic acid content in physiologically active leaf were performed. The treatment T1 i.e., 40% less N fertilizer 25% less P fertilizer K fertilizer constant + 12 kg ha(-1) biofertilizer (Azophos) and organic manure (compost) @ 5Mt ha(-1), showed the maximum chlorophyll accumulation (10. 231 mg g(-1) freshweight), highest seed/siliquae (25.143), test weight of seeds (4. 861g) and highest seed yield (10.661 tha(-1)). A comparison between all the morphological, anatomical, physiological and biochemical parameters due to application of chemical fertilizer; bio-fertilizer and compost alone and in combination and their impact on soil microorganism, flora and fauna will throw a sound environmental information.

Components of a Rice-Oilseed Rape Production System Augmented with Trichoderma sp. Tri-1 Control Sclerotinia sclerotiorum on Oilseed Rape.

PubMed

Hu, Xiaojia; Roberts, Daniel P; Xie, Lihua; Maul, Jude E; Yu, Changbing; Li, Yinshui; Zhang, Yinbo; Qin, Lu; Liao, Xing

2015-10-01

Sclerotinia sclerotiorum causes serious yield losses on many crops throughout the world. A multicomponent treatment that consisted of the residual rice straw remaining after rice harvest and Trichoderma sp. Tri-1 (Tri-1) formulated with the oilseed rape seedcake fertilizer was used in field soil infested with S. sclerotiorum. This treatment resulted in oilseed rape seed yield that was significantly greater than the nontreated control or when the fungicide carbendizem was used in the presence of this pathogen in field trials. Yield data suggested that the rice straw, oilseed rape seedcake, and Tri-1 components of this treatment all contributed incrementally. Similar treatment results were obtained regarding reduction in disease incidence. Slight improvements in yield and disease incidence were detected when this multicomponent treatment was combined with a fungicide spray. Inhibition of sclerotial germination by this multicomponent treatment trended greater than the nontreated control at 90, 120, and 150 days in field studies but was not significantly different from this control. This multicomponent treatment resulted in increased yield relative to the nontreated control in the absence of pathogen in a greenhouse pot study, while the straw alone and the straw plus oilseed rape seedcake treatments did not; suggesting that Tri-1 was capable of promoting growth. Experiments reported here indicate that a treatment containing components of a rice-oilseed rape production system augmented with Tri-1 can control S. sclerotiorum on oilseed rape, be used in integrated strategies containing fungicide sprays for control of this pathogen, and promote plant growth.

Resistance to Phomopsis Seed Decay in soybean

USDA-ARS?s Scientific Manuscript database

Phomopsis seed decay (PSD) of soybean is caused primarily by the fungal pathogen, Phomopsis longicolla T.W. Hobbs along with other Phomopsis and Diaporthe spp. This disease causes poor seed quality and suppresses yield in most soybean-growing countries. Infected soybean seeds can be symptomless, but...

Evaluation of Exotically-Derived Soybean Breeding Lines for Seed Yield, Germination, Damage, and Composition under Dryland Production in the Midsouthern USA

PubMed Central

Bellaloui, Nacer; Smith, James R.; Mengistu, Alemu; Ray, Jeffery D.; Gillen, Anne M.

2017-01-01

Although the Early Soybean Production System (ESPS) in the Midsouthern USA increased seed yield under irrigated and non-irrigated conditions, heat stress and drought still lead to poor seed quality in heat sensitive soybean cultivars. Our breeding goal was to identify breeding lines that possess high germination, nutritional quality, and yield potential under high heat and dryland production conditions. Our hypothesis was that breeding lines derived from exotic germplasm might possess physiological and genetic traits allowing for higher seed germinability under high heat conditions. In a 2-year field experiment, breeding lines derived from exotic soybean accessions, previously selected for adaptability to the ESPS in maturity groups (MG) III and IV, were grown under non-irrigated conditions. Results showed that three exotic breeding lines had consistently superior germination across 2 years. These lines had a mean germination percentage of >80%. Two (25-1-1-4-1-1 and 34-3-1-2-4-1) out of the three lines with ≥80% germination in both years maintained high seed protein, oleic acid, N, P, K, B, Cu, and Mo in both years. Significant (P < 0.05) positive correlations were found between germination and oleic acid and with K and Cu in both years. Significant negative correlations were found between germination and linoleic acid, Ca, and hard seed in both years. There were positive correlations between germination and N, P, B, Mo, and palmitic acid only in 2013. A negative correlation was found between germination and green seed damage and linolenic acid in 2013 only. Seed wrinkling was significantly negatively correlated with germination in 2012 only. A lower content of Ca in the seed of high germinability genotypes may explain the lower rates of hard seed in those lines, which could lead to higher germination. Many of the differences in yield, germination, diseases, and seed composition between years are likely due to heat and rainfall differences between years. The results also showed the potential roles of seed minerals, especially K, Ca, B, Cu, and Mo, in maintaining high seed quality. The knowledge gained from this research will help breeders to select for soybean with high seed nutritional qualities and high germinability. PMID:28289420

Distillation time as tool for improved antimalarial activity and differential oil composition of cumin seed oil

USDA-ARS?s Scientific Manuscript database

A steam distillation extraction kinetics experiment was conducted to estimate essential oil yield, composition, antimalarial, and antioxidant capacity of cumin (Cuminum cyminum L.) seed (fruits). Furthermore, regression models were developed to predict essential oil yield and composition for a given...

Ultrasound-assisted extraction (UAE) and solvent extraction of papaya seed oil: yield, fatty acid composition and triacylglycerol profile.

PubMed

Samaram, Shadi; Mirhosseini, Hamed; Tan, Chin Ping; Ghazali, Hasanah Mohd

2013-10-10

The main objective of the current work was to evaluate the suitability of ultrasound-assisted extraction (UAE) for the recovery of oil from papaya seed as compared to conventional extraction techniques (i.e., Soxhlet extraction (SXE) and solvent extraction (SE)). In the present study, the recovery yield, fatty acid composition and triacylglycerol profile of papaya seed oil obtained from different extraction methods and conditions were compared. Results indicated that both solvent extraction (SE, 12 h/25 °C) and ultrasound-assisted extraction (UAE) methods recovered relatively high yields (79.1% and 76.1% of total oil content, respectively). Analysis of fatty acid composition revealed that the predominant fatty acids in papaya seed oil were oleic (18:1, 70.5%-74.7%), palmitic (16:0, 14.9%-17.9%), stearic (18:0, 4.50%-5.25%), and linoleic acid (18:2, 3.63%-4.6%). Moreover, the most abundant triacylglycerols of papaya seed oil were triolein (OOO), palmitoyl diolein (POO) and stearoyl oleoyl linolein (SOL). In this study, ultrasound-assisted extraction (UAE) significantly (p < 0.05) influenced the triacylglycerol profile of papaya seed oil, but no significant differences were observed in the fatty acid composition of papaya seed oil extracted by different extraction methods (SXE, SE and UAE) and conditions.

Dissection of genotype × environment interactions for mucilage and seed yield in Plantago species: Application of AMMI and GGE biplot analyses

PubMed Central

Shahriari, Zolfaghar; Dadkhodaie, Ali

2018-01-01

Genotype × environment interaction (GEI) is an important aspect of both plant breeding and the successful introduction of new cultivars. In the present study, additive main effects and multiplicative interactions (AMMI) and genotype (G) main effects and genotype (G) × environment (E) interaction (GGE) biplot analyses were used to identify stable genotypes and to dissect GEI in Plantago. In total, 10 managed field trials were considered as environments to analyze GEI in thirty genotypes belonging to eight Plantago species. Genotypes were evaluated in a drought stress treatment and in normal irrigation conditions at two locations in Shiraz (Bajgah) for three years (2013-2014- 2015) and Kooshkak (Marvdasht, Fars, Iran) for two years (2014–2015). Three traits, seed yield and mucilage yield and content, were measured at each experimental site and in natural Plantago habitats. AMMI2 biplot analyses identified genotypes from several species with higher stability for seed yield and other genotypes with stable mucilage content and yield. P. lanceolata (G26), P. officinalis (G10), P. ovata (G14), P. ampleexcaulis (G11) and P. major (G4) had higher stability for seed yield. For mucilage yield, G21, G18 and G20 (P. psyllium), G1, G2 and G4 (P. major), G9 and G10 (P. officinalis) and P. lanceolata were identified as stable. G13 (P. ovata), G5 and G6 (P. major) and G30 (P. lagopus) had higher stability for mucilage content. No one genotype was found to have high levels of stability for more than one trait but some species had more than one genotype exhibiting stable trait performance. Based on trait variation, GGE biplot analysis identified two representative environments, one for seed yield and one for mucilage yield and content, with good discriminating ability. The identification of stable genotypes and representative environments should assist the breeding of new Plantago cultivars. PMID:29715274

Dissection of genotype × environment interactions for mucilage and seed yield in Plantago species: Application of AMMI and GGE biplot analyses.

PubMed

Shahriari, Zolfaghar; Heidari, Bahram; Dadkhodaie, Ali

2018-01-01

Genotype × environment interaction (GEI) is an important aspect of both plant breeding and the successful introduction of new cultivars. In the present study, additive main effects and multiplicative interactions (AMMI) and genotype (G) main effects and genotype (G) × environment (E) interaction (GGE) biplot analyses were used to identify stable genotypes and to dissect GEI in Plantago. In total, 10 managed field trials were considered as environments to analyze GEI in thirty genotypes belonging to eight Plantago species. Genotypes were evaluated in a drought stress treatment and in normal irrigation conditions at two locations in Shiraz (Bajgah) for three years (2013-2014- 2015) and Kooshkak (Marvdasht, Fars, Iran) for two years (2014-2015). Three traits, seed yield and mucilage yield and content, were measured at each experimental site and in natural Plantago habitats. AMMI2 biplot analyses identified genotypes from several species with higher stability for seed yield and other genotypes with stable mucilage content and yield. P. lanceolata (G26), P. officinalis (G10), P. ovata (G14), P. ampleexcaulis (G11) and P. major (G4) had higher stability for seed yield. For mucilage yield, G21, G18 and G20 (P. psyllium), G1, G2 and G4 (P. major), G9 and G10 (P. officinalis) and P. lanceolata were identified as stable. G13 (P. ovata), G5 and G6 (P. major) and G30 (P. lagopus) had higher stability for mucilage content. No one genotype was found to have high levels of stability for more than one trait but some species had more than one genotype exhibiting stable trait performance. Based on trait variation, GGE biplot analysis identified two representative environments, one for seed yield and one for mucilage yield and content, with good discriminating ability. The identification of stable genotypes and representative environments should assist the breeding of new Plantago cultivars.

Contribution of insect pollinators to crop yield and quality varies with agricultural intensification

PubMed Central

Potts, Simon G.; Steffan-Dewenter, Ingolf; Vaissière, Bernard E.; Woyciechowski, Michal; Krewenka, Kristin M.; Tscheulin, Thomas; Roberts, Stuart P.M.; Szentgyörgyi, Hajnalka; Westphal, Catrin; Bommarco, Riccardo

2014-01-01

Background. Up to 75% of crop species benefit at least to some degree from animal pollination for fruit or seed set and yield. However, basic information on the level of pollinator dependence and pollinator contribution to yield is lacking for many crops. Even less is known about how insect pollination affects crop quality. Given that habitat loss and agricultural intensification are known to decrease pollinator richness and abundance, there is a need to assess the consequences for different components of crop production. Methods. We used pollination exclusion on flowers or inflorescences on a whole plant basis to assess the contribution of insect pollination to crop yield and quality in four flowering crops (spring oilseed rape, field bean, strawberry, and buckwheat) located in four regions of Europe. For each crop, we recorded abundance and species richness of flower visiting insects in ten fields located along a gradient from simple to heterogeneous landscapes. Results. Insect pollination enhanced average crop yield between 18 and 71% depending on the crop. Yield quality was also enhanced in most crops. For instance, oilseed rape had higher oil and lower chlorophyll contents when adequately pollinated, the proportion of empty seeds decreased in buckwheat, and strawberries’ commercial grade improved; however, we did not find higher nitrogen content in open pollinated field beans. Complex landscapes had a higher overall species richness of wild pollinators across crops, but visitation rates were only higher in complex landscapes for some crops. On the contrary, the overall yield was consistently enhanced by higher visitation rates, but not by higher pollinator richness. Discussion. For the four crops in this study, there is clear benefit delivered by pollinators on yield quantity and/or quality, but it is not maximized under current agricultural intensification. Honeybees, the most abundant pollinator, might partially compensate the loss of wild pollinators in some areas, but our results suggest the need of landscape-scale actions to enhance wild pollinator populations. PMID:24749007

Nanobiotechnology can boost crop production and quality: first evidence from increased plant biomass, fruit yield and phytomedicine content in bitter melon (Momordica charantia).

PubMed

Kole, Chittaranjan; Kole, Phullara; Randunu, K Manoj; Choudhary, Poonam; Podila, Ramakrishna; Ke, Pu Chun; Rao, Apparao M; Marcus, Richard K

2013-04-26

Recent research on nanoparticles in a number of crops has evidenced for enhanced germination and seedling growth, physiological activities including photosynthetic activity and nitrogen metabolism, mRNA expression and protein level, and also positive changes in gene expression indicating their potential use in crop improvement. We used a medicinally rich vegetable crop, bitter melon, as a model to evaluate the effects of seed treatment with a carbon-based nanoparticle, fullerol [C60(OH)20], on yield of plant biomass and fruit characters, and phytomedicine contents in fruits. We confirmed the uptake, translocation and accumulation of fullerol through bright field imaging and Fourier transform infra-red spectroscopy. We observed varied effects of seed treatment at five concentrations, including non-consequential and positive, on plant biomass yield, fruit yield and its component characters, and content of five phytomedicines in fruits. Fullerol-treatment resulted in increases up to 54% in biomass yield and 24% in water content. Increases of up to 20% in fruit length, 59% in fruit number, and 70% in fruit weight led to an improvement up to 128% in fruit yield. Contents of two anticancer phytomedicines, cucurbitacin-B and lycopene, were enhanced up to 74% and 82%, respectively, and contents of two antidiabetic phytomedicines, charantin and insulin, were augmented up to 20% and 91%, respectively. Non-significant correlation inter se plant biomass, fruit yield, phytomedicine content and water content evidenced for separate genetic control and biosynthetic pathways for production of plant biomass, fruits, and phytomedicines in fruits, and also no impact of increased water uptake. While our results indicated possibility of improving crop yield and quality by using proper concentrations of fullerol, extreme caution needs to be exercised given emerging knowledge about accumulation and toxicity of nanoparticles in bodily tissues.

Nanobiotechnology can boost crop production and quality: first evidence from increased plant biomass, fruit yield and phytomedicine content in bitter melon (Momordica charantia)

PubMed Central

2013-01-01

Background Recent research on nanoparticles in a number of crops has evidenced for enhanced germination and seedling growth, physiological activities including photosynthetic activity and nitrogen metabolism, mRNA expression and protein level, and also positive changes in gene expression indicating their potential use in crop improvement. We used a medicinally rich vegetable crop, bitter melon, as a model to evaluate the effects of seed treatment with a carbon-based nanoparticle, fullerol [C60(OH)20], on yield of plant biomass and fruit characters, and phytomedicine contents in fruits. Results We confirmed the uptake, translocation and accumulation of fullerol through bright field imaging and Fourier transform infra-red spectroscopy. We observed varied effects of seed treatment at five concentrations, including non-consequential and positive, on plant biomass yield, fruit yield and its component characters, and content of five phytomedicines in fruits. Fullerol-treatment resulted in increases up to 54% in biomass yield and 24% in water content. Increases of up to 20% in fruit length, 59% in fruit number, and 70% in fruit weight led to an improvement up to 128% in fruit yield. Contents of two anticancer phytomedicines, cucurbitacin-B and lycopene, were enhanced up to 74% and 82%, respectively, and contents of two antidiabetic phytomedicines, charantin and insulin, were augmented up to 20% and 91%, respectively. Non-significant correlation inter se plant biomass, fruit yield, phytomedicine content and water content evidenced for separate genetic control and biosynthetic pathways for production of plant biomass, fruits, and phytomedicines in fruits, and also no impact of increased water uptake. Conclusions While our results indicated possibility of improving crop yield and quality by using proper concentrations of fullerol, extreme caution needs to be exercised given emerging knowledge about accumulation and toxicity of nanoparticles in bodily tissues. PMID:23622112

Contribution of insect pollinators to crop yield and quality varies with agricultural intensification.

PubMed

Bartomeus, Ignasi; Potts, Simon G; Steffan-Dewenter, Ingolf; Vaissière, Bernard E; Woyciechowski, Michal; Krewenka, Kristin M; Tscheulin, Thomas; Roberts, Stuart P M; Szentgyörgyi, Hajnalka; Westphal, Catrin; Bommarco, Riccardo

2014-01-01

Background. Up to 75% of crop species benefit at least to some degree from animal pollination for fruit or seed set and yield. However, basic information on the level of pollinator dependence and pollinator contribution to yield is lacking for many crops. Even less is known about how insect pollination affects crop quality. Given that habitat loss and agricultural intensification are known to decrease pollinator richness and abundance, there is a need to assess the consequences for different components of crop production. Methods. We used pollination exclusion on flowers or inflorescences on a whole plant basis to assess the contribution of insect pollination to crop yield and quality in four flowering crops (spring oilseed rape, field bean, strawberry, and buckwheat) located in four regions of Europe. For each crop, we recorded abundance and species richness of flower visiting insects in ten fields located along a gradient from simple to heterogeneous landscapes. Results. Insect pollination enhanced average crop yield between 18 and 71% depending on the crop. Yield quality was also enhanced in most crops. For instance, oilseed rape had higher oil and lower chlorophyll contents when adequately pollinated, the proportion of empty seeds decreased in buckwheat, and strawberries' commercial grade improved; however, we did not find higher nitrogen content in open pollinated field beans. Complex landscapes had a higher overall species richness of wild pollinators across crops, but visitation rates were only higher in complex landscapes for some crops. On the contrary, the overall yield was consistently enhanced by higher visitation rates, but not by higher pollinator richness. Discussion. For the four crops in this study, there is clear benefit delivered by pollinators on yield quantity and/or quality, but it is not maximized under current agricultural intensification. Honeybees, the most abundant pollinator, might partially compensate the loss of wild pollinators in some areas, but our results suggest the need of landscape-scale actions to enhance wild pollinator populations.

Dynamic changes of genome-wide DNA methylation during soybean seed development

USDA-ARS?s Scientific Manuscript database

Seed development is programmed by expression of many genes in plants. Seed maturation is an important developmental process to soybean seed quality and yield. DNA methylation is a major epigenetic modification regulating gene expression. However, little is known about the dynamic nature of DNA me...

Soil quality assessment in long-term direct seed

USDA-ARS?s Scientific Manuscript database

Producers in the Pacific Northwest are adopting direct seed farming to reduce soil erosion, improve soil quality and increase water infiltration. Some direct seed producers are concerned with reaching the yield and profit potential expected with long-term direct seed, and this may be due to soil st...

Role of Soybean mosaic virus-encoded proteins in seed and aphid transmission in soybean

USDA-ARS?s Scientific Manuscript database

Soybean mosaic virus (SMV) is seed and aphid transmitted and can cause significant reductions in yield and seed quality in soybean, Glycine max. The roles in seed and aphid transmission of selected SMV-encoded proteins were investigated by constructing chimeric recombinants between SMV 413 (efficien...

β-Sitosterol: Supercritical Carbon Dioxide Extraction from Sea Buckthorn (Hippophae rhamnoides L.) Seeds

PubMed Central

Sajfrtová, Marie; Ličková, Ivana; Wimmerová, Martina; Sovová, Helena; Wimmer, Zdeněk

2010-01-01

Supercritical fluid extraction represents an efficient and environmentally friendly technique for isolation of phytosterols from different plant sources. Sea buckthorn (Hippophae rhamnoides L.) seeds were extracted with supercritical carbon dioxide at pressures ranging from 15–60 MPa and temperatures of 40–80 °C. Oil and β-sitosterol yields were measured in the extraction course and compared with Soxhlet extraction with hexane. The average yield of β-sitosterol was 0.31 mg/g of seeds. The maximum concentration of β-sitosterol in the extract, 0.5% w/w, was achieved at 15 MPa, 40 °C, and a carbon dioxide consumption of 50 g/g of seeds. The extraction rate was maximal at 60 MPa and 40 °C. Both β-sitosterol yield and its concentration in the extract obtained with hexane were lower than with carbon dioxide. PMID:20480045

21 CFR 176.350 - Tamarind seed kernel powder.

Code of Federal Regulations, 2011 CFR

2011-04-01

... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Tamarind seed kernel powder. 176.350 Section 176... Substances for Use Only as Components of Paper and Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing...

21 CFR 176.350 - Tamarind seed kernel powder.

Code of Federal Regulations, 2012 CFR

2012-04-01

... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Tamarind seed kernel powder. 176.350 Section 176... Substances for Use Only as Components of Paper and Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing...

21 CFR 176.350 - Tamarind seed kernel powder.

Code of Federal Regulations, 2010 CFR

2010-04-01

... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Tamarind seed kernel powder. 176.350 Section 176... Substances for Use Only as Components of Paper and Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing...

21 CFR 176.350 - Tamarind seed kernel powder.

Code of Federal Regulations, 2013 CFR

2013-04-01

... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Tamarind seed kernel powder. 176.350 Section 176... Substances for Use Only as Components of Paper and Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing...

Adaptation of six shallots varieties to phosphate solubilizing bacteria on the flower formation, seeds fromation, and yields on the lowland

NASA Astrophysics Data System (ADS)

Triharyanto, E.; Sudadi; Rawandari, S.

2018-03-01

Using seeds as planting materials is a solution to improve the quality and quantity of shallot. This study aims to determine the interaction between shallot varieties and Phosphate- Solubilizing Bacteria (PSB) on the flowering and shallot yield on the lowlands. The research was conducted in Mijil Village, Jaten, Karanganyar, 98 m altitude with Vertisol-type soil order in June to December 2016, using Randomized Complete Block Design (RCBD) with two factors. Shallot varieties used as factors are Bima, Manjung, Ilokos, Bima (bulb seeds), Mentes and Rubaru. PSB factors are control and with PSB inoculation. Observed variables included plant height, number of leaves, flowering percentage, seed formation and shallot bulb yield. Results showed that there was no interaction between varieties and PSB inoculation on all observed variables. However, PSB inoculation were able to increase the number of flowering plants and seed weight per plot. Bima variety have the highest average yield compared to other varieties in terms of number of leaves, number of bulbs per plant and bulb weight per plot (fresh harvest weight 317.74 g equivalent to 17.65 ton per hectare and dry weight 288.16 g consumption equivalent to 16 ton per hectare).

Increased effectiveness of competitive rhizobium strains upon inoculation of Cajanus cajan

DOE Office of Scientific and Technical Information (OSTI.GOV)

Hernandez, B.S.; Poth, M.; Focht, D.D.

A field study was conducted in lysimeters containing /sup 15/N-enriched soil to determine the effects of four competitive rhizobium strains upon yield parameters of pigeon peas (Cajanus cajan). The greatest differences observed were in seed yields; strain P132 effected the highest seed yield (121 +/- 20 g per plant), and the control strain (indigenous rhizobia) effected the lowest yield (43.9 +/- 8 g per plant). With the exception of seeds and pods, the dry matter weights were not different. Although there appeared to be no effect by inoculum strains on the fractional content of N derived from biological nitrogen fixationmore » when the total plant biomass was considered, strains P132 and 401 partitioned more of the N derived from fixation into seeds and leaves than did the other strains. Because the seeds comprised the major portion of plant N, more total N and more N derived from biological nitrogen fixation (about half of total N) were found in plants inoculated with P132, whereas the smallest amount was found in the uninoculated controls. P132 was also the best competitor with respect to indigenous rhizobia and accounted for all of the nodules found on the plants in which it was inoculated.« less

Cone and seed yields in white spruce seed production areas

Treesearch

John A. Pitcher

1966-01-01

The source of seed is an important consideration in the reforestation program on the National Forests in the North Central Region. Thirty-five seed production areas have been set up in the Region, along the lines proposed by the North Central Forest Experiment Station, to provide control of seed source. Red pine, white pine, shortleaf and loblolly pine, and white...

The Impact of Insects on Second-Year Cone Crops in Red Pine Seed-Production Areas

Treesearch

William J. Mattson

1968-01-01

Second-year cone crops in red pine seed-production areas have been severely damaged by five species of insects. Control of the two most destructive pests could increase present seed yields in most areas by at least 50 percent. Some seed-production areas may not produce harvestable seed crops until cone-insect populations are suppressed.

Estimating Cone and Seed Production and Monitoring Pest Damage in Southern Pine Seed Orchards

Treesearch

Carl W. Fatzinger; H. David Muse; Thomas Miller; Helen T. Bhattacharyya

1988-01-01

Field sampling procedures and computer programs are described for monitoring seed production and pest damage in southern pine seed orchards. The system estimates total orchard yields of female strobili and seeds, quantifies pest damage, determines times of year when losses occur, and produces life tables for female strobili. An example is included to illustrate the...

Status and use of important native grasses adapted to sagebrush communities

Treesearch

Thomas A. Jones; Steven R. Larson

2005-01-01

Due to the emphasis on restoration, native cool-season grass species are increasing in importance in the commercial seed trade in the Western U.S. Cultivated seed production of these native grasses has often been hampered by seed dormancy, seed shattering, and pernicious awns that are advantageous outside of cultivation. Relatively low seed yields and poor seedling...

Method for obtaining three products with different properties from fennel (Foeniculum vulgare) seed

USDA-ARS?s Scientific Manuscript database

The objectives of this study were to determine the effects of distillation time (DT; 15-1080 min) on yield, composition, and antioxidant capacity of fennel (Foeniculum vulgare) seed essential oil (EO) as well as on the yield, composition, and properties of lipids extracted from steam-distilled fenne...

Evaluation of seeding depth and guage-wheel load effects on maize emergence and yield

USDA-ARS?s Scientific Manuscript database

Planting represents perhaps the most important field operation with errors likely to negatively affect crop yield and thereby farm profitability. Performance of row-crop planters are evaluated by their ability to accurately place seeds into the soil at an adequate and pre-determined depth, the goal ...

Bio-ecological consequences of crop seeds treatment with metal nano-powders

NASA Astrophysics Data System (ADS)

Churilov, G.

2015-11-01

As a result of our investigations we have determined the optimal concentrations of ferrum, cobalt and cuprum nano-powders recommended to be used as micro-fertilizers increasing the yield and feed value of crops at the expense of accumulating biologically active combinations by 25-35%. In unfavorable climate conditions, for example in a case of excess moisture or heat and drought, the plants development and ripening suffer. Our investigations have shown that the stimulating effect of nano-powders has lowered the effect of stress situations on plants development and simultaneously increased the rape seeds yield and quality. Treating the seeds with the drugs being studied has provided the high crop protection. If consider that the maximum efficiency of protectants Chinuk, SK (20 kg/t of seeds) and Cruiser, KS (10 kg/t of seeds) then for the same effect one needs nano-powders 0.1 g per hectare norm of seeds planting.

Study of optimal extraction conditions for achieving high yield and antioxidant activity of tomato seed oil.

PubMed

Shao, Dongyan; Atungulu, Griffiths G; Pan, Zhongli; Yue, Tianli; Zhang, Ang; Li, Xuan

2012-08-01

Value of tomato seed has not been fully recognized. The objectives of this research were to establish suitable processing conditions for extracting oil from tomato seed by using solvent, determine the impact of processing conditions on yield and antioxidant activity of extracted oil, and elucidate kinetics of the oil extraction process. Four processing parameters, including time, temperature, solvent-to-solid ratio and particle size were studied. A second order model was established to describe the oil extraction process. Based on the results, increasing temperature, solvent-to-solid ratio, and extraction time increased oil yield. In contrast, larger particle size reduced the oil yield. The recommended oil extraction conditions were 8 min of extraction time at temperature of 25 °C, solvent-to-solids ratio of 5/1 (v/w) and particle size of 0.38 mm, which gave oil yield of 20.32% with recovery rate of 78.56%. The DPPH scavenging activity of extracted oil was not significantly affected by the extraction parameters. The inhibitory concentration (IC(50) ) of tomato seed oil was 8.67 mg/mL which was notably low compared to most vegetable oils. A 2nd order model successfully described the kinetics of tomato oil extraction process and parameters of extraction kinetics including initial extraction rate (h), equilibrium concentration of oil (C(s) ), and the extraction rate constant (k) could be precisely predicted with R(2) of at least 0.957. The study revealed that tomato seed which is typically treated as a low value byproduct of tomato processing has great potential in producing oil with high antioxidant capability. The impact of processing conditions including time, temperature, solvent-to-solid ratio and particle size on yield, and antioxidant activity of extracted tomato seed oil are reported. Optimal conditions and models which describe the extraction process are recommended. The information is vital for determining the extraction processing conditions for industrial production of high quality tomato seed oil. Journal of Food Science © 2012 Institute of Food Technologists® No claim to original US government works.

The Seeding and Cultivation of a Tropical Species of Filamentous Ulva for Algal Biomass Production

PubMed Central

Carl, Christina; de Nys, Rocky; Paul, Nicholas A.

2014-01-01

Filamentous species of Ulva are ideal for cultivation because they are robust with high growth rates and maintained across a broad range of environments. Temperate species of filamentous Ulva are commercially cultivated on nets which can be artificially ‘seeded’ under controlled conditions allowing for a high level of control over seeding density and consequently biomass production. This study quantified for the first time the seeding and culture cycle of a tropical species of filamentous Ulva (Ulva sp. 3) and identified seeding density and nursery period as key factors affecting growth and biomass yield. A seeding density of 621,000 swarmers m-1 rope in combination with a nursery period of five days resulted in the highest growth rate and correspondingly the highest biomass yield. A nursery period of five days was optimal with up to six times the biomass yield compared to ropes under either shorter or longer nursery periods. These combined parameters of seeding density and nursery period resulted in a specific growth rate of more than 65% day−1 between 7 and 10 days of outdoor cultivation post-nursery. This was followed by a decrease in growth through to 25 days. This study also demonstrated that the timing of harvest is critical as the maximum biomass yield of 23.0±8.8 g dry weight m−1 (228.7±115.4 g fresh weight m−1) was achieved after 13 days of outdoor cultivation whereas biomass degraded to 15.5±7.3 g dry weight m−1 (120.2±71.8 g fresh weight m−1) over a longer outdoor cultivation period of 25 days. Artificially seeded ropes of Ulva with high biomass yields over short culture cycles may therefore be an alternative to unattached cultivation in integrated pond-based aquaculture systems. PMID:24897115

Comparison of HeNe laser and sinusoidal non-uniform magnetic field seed pre-sowing treatment effect on Glycine max (Var 90-I) germination, growth and yield.

PubMed

Asghar, Tehseen; Iqbal, Munawar; Jamil, Yasir; Zia-Ul-Haq; Nisar, Jan; Shahid, Muhammad

2017-01-01

Recently, laser and magnetic field pre-sowing seed treatments attracted the attention of the scientific community in response to their positive effect on plant characteristics and the present study was exemplified for Glycine max Var 90-I. Seeds were exposed to laser (HeNe-wave length 632nm and density power of 1mW/cm 2 ) and magnetic field (sinusoidal non-uniform-50, 75 and 100mT for 3, 5min with exposure) and seed germination, seedling growth and yield attributes were compared. The germination (mean germination, germination percentage, emergence index, germination speed, relative germination coefficient, emergence coefficient of uniformity) growth (root dry weight, root length, shoot fresh weight and shoot dry weight, leaf dry & fresh weight, root fresh weight, leaf area, shoot length, plant total dry weight at different stages, stem diameter, number of leaves, vigor index I & II), biochemical (essential oil) and yield attributes (seed weight, count) were enhanced significantly in response to both laser and magnetic field treatments. However, magnetic field treatment furnished slightly higher response versus laser except relative water contents, whole plant weight and shoot length. Results revealed that both laser and magnetic field pre-sowing seed treatments affect the germination, seedling growth, and yield characteristics positively and could possibly be used to enhance Glycine max productivity. Copyright © 2016 Elsevier B.V. All rights reserved.

Effect of seed age on gold nanorod formation. A microfluidic, real-time investigation

DOE Office of Scientific and Technical Information (OSTI.GOV)

Watt, John; Hance, Bradley G.; Anderson, Rachel S.

We report a real time investigation into the effect of seed age on the growth of gold nanorods using a microfluidic reaction apparatus. Through small-angle X-ray scattering (SAXS) and ultraviolet–visible spectroscopy (UV–vis) analysis, we observe the seeds aging in accordance with Ostwald ripening. A seed solution is then aged in situ and continuously injected into a microfluidic chip to initiate rod growth. We track nanorod formation in real time using in-line ultraviolet–visible and near-infrared (UV–vis–NIR) monitoring and observe a dramatic decrease in yield with increasing seed age. We then demonstrate that, by diluting the gold seed solution immediately following synthesis,more » the rate of aging can be reduced and nanorods synthesized continuously, in good yield. As a result, these findings suggest ultrasmall, catalytically active seeds, which are rapidly lost due to ripening and are critical for the formation of gold nanorods.« less

Effect of seed age on gold nanorod formation. A microfluidic, real-time investigation

DOE PAGES

Watt, John; Hance, Bradley G.; Anderson, Rachel S.; ...

2015-09-02

We report a real time investigation into the effect of seed age on the growth of gold nanorods using a microfluidic reaction apparatus. Through small-angle X-ray scattering (SAXS) and ultraviolet–visible spectroscopy (UV–vis) analysis, we observe the seeds aging in accordance with Ostwald ripening. A seed solution is then aged in situ and continuously injected into a microfluidic chip to initiate rod growth. We track nanorod formation in real time using in-line ultraviolet–visible and near-infrared (UV–vis–NIR) monitoring and observe a dramatic decrease in yield with increasing seed age. We then demonstrate that, by diluting the gold seed solution immediately following synthesis,more » the rate of aging can be reduced and nanorods synthesized continuously, in good yield. As a result, these findings suggest ultrasmall, catalytically active seeds, which are rapidly lost due to ripening and are critical for the formation of gold nanorods.« less

Traits Explaining Durum Wheat (Triticum turgidum L. spp. Durum) Yield in Dry Chilean Mediterranean Environments

PubMed Central

González-Ribot, Gerlitt; Opazo, Marcela; Silva, Paola; Acevedo, Edmundo

2017-01-01

Yield under water stress (YS) is used as the main criterion in the selection of wheat varieties for dry Mediterranean environments. It has been proposed that selection of genotypes using YS assisted by morphological and physiological traits associated with YS is more efficient in selecting high yielding genotypes for dry environments. A study was carried out at the Antumapu Experiment Station of the University of Chile, located in Santiago, Chile (33° 40′S and 70° 38′ W). The objective was to evaluate the extent to which morpho physiological traits could explain YS. For this purpose, grain yield and yield components of 185 durum wheat genotypes from ICARDA (International Center for Agricultural Research in the Dry Areas) and INIA (Chilean National Institute for Agricultural Research) were evaluated along with seed size and weight, days to heading (DH), glaucousness (GLAU), plant height (PH) and 13C discrimination (Δ). The design was an α-lattice with two replications, the genotypes were grown in two different water conditions (high and low irrigation) during two seasons (2011-2012/2012-2013). Grain weight (GW) was the only yield component with high H associated with YS, but it was not associated with yield under high irrigation (YI). The combination of YI with DH+GLAU+PH+Δ+GW obtained in LI environments explained a greater fraction of YS (38%) across years; these traits had lower genotype x environment interaction than YS, they also explained a higher proportion of yield under drought than YI. None of the traits studied could replace YS in selections for grain yield. It is concluded that these traits could aid in the selection of durum wheat subject to water stress, particularly in early generations. PMID:29104578

Pepper seed variety identification based on visible/near-infrared spectral technology

NASA Astrophysics Data System (ADS)

Li, Cuiling; Wang, Xiu; Meng, Zhijun; Fan, Pengfei; Cai, Jichen

2016-11-01

Pepper is a kind of important fruit vegetable, with the expansion of pepper hybrid planting area, detection of pepper seed purity is especially important. This research used visible/near infrared (VIS/NIR) spectral technology to detect the variety of single pepper seed, and chose hybrid pepper seeds "Zhuo Jiao NO.3", "Zhuo Jiao NO.4" and "Zhuo Jiao NO.5" as research sample. VIS/NIR spectral data of 80 "Zhuo Jiao NO.3", 80 "Zhuo Jiao NO.4" and 80 "Zhuo Jiao NO.5" pepper seeds were collected, and the original spectral data was pretreated with standard normal variable (SNV) transform, first derivative (FD), and Savitzky-Golay (SG) convolution smoothing methods. Principal component analysis (PCA) method was adopted to reduce the dimension of the spectral data and extract principal components, according to the distribution of the first principal component (PC1) along with the second principal component(PC2) in the twodimensional plane, similarly, the distribution of PC1 coupled with the third principal component(PC3), and the distribution of PC2 combined with PC3, distribution areas of three varieties of pepper seeds were divided in each twodimensional plane, and the discriminant accuracy of PCA was tested through observing the distribution area of samples' principal components in validation set. This study combined PCA and linear discriminant analysis (LDA) to identify single pepper seed varieties, results showed that with the FD preprocessing method, the discriminant accuracy of pepper seed varieties was 98% for validation set, it concludes that using VIS/NIR spectral technology is feasible for identification of single pepper seed varieties.

CLUSTERED PRIMARY BRANCH 1, a new allele of DWARF11, controls panicle architecture and seed size in rice.

PubMed

Wu, Yongzhen; Fu, Yongcai; Zhao, Shuangshuang; Gu, Ping; Zhu, Zuofeng; Sun, Chuanqing; Tan, Lubin

2016-01-01

Panicle architecture and seed size are important agronomic traits that directly determine grain yield in rice (Oryza sativa L.). Although a number of key genes controlling panicle architecture and seed size have been cloned and characterized in recent years, their genetic and molecular mechanisms remain unclear. In this study, we identified a mutant that produced panicles with fascicled primary branching and reduced seeds in size. We isolated the underlying CLUSTERED PRIMARY BRANCH 1 (CPB1) gene, a new allele of DWARF11 (D11) encoding a cytochrome P450 protein involved in brassinosteroid (BR) biosynthesis pathway. Genetic transformation experiments confirmed that a His360Leu amino acid substitution residing in the highly conserved region of CPB1/D11 was responsible for the panicle architecture and seed size changes in the cpb1 mutants. Overexpression of CPB1/D11 under the background of cpb1 mutant not only rescued normal panicle architecture and plant height, but also had a larger leaf angle and seed size than the controls. Furthermore, the CPB1/D11 transgenic plants driven by panicle-specific promoters can enlarge seed size and enhance grain yield without affecting other favourable agronomic traits. These results demonstrated that the specific mutation in CPB1/D11 influenced development of panicle architecture and seed size, and manipulation of CPB1/D11 expression using the panicle-specific promoter could be used to increase seed size, leading to grain yield improvement in rice. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

Ozone dose-response relationships for spring oilseed rape and broccoli

NASA Astrophysics Data System (ADS)

De Bock, Maarten; Op de Beeck, Maarten; De Temmerman, Ludwig; Guisez, Yves; Ceulemans, Reinhart; Vandermeiren, Karine

2011-03-01

Tropospheric ozone is an important air pollutant with known detrimental effects for several crops. Ozone effects on seed yield, oil percentage, oil yield and 1000 seed weight were examined for spring oilseed rape ( Brassica napus cv. Ability). For broccoli ( Brassica oleracea L. cv. Italica cv. Monaco) the effects on fresh marketable weight and total dry weight were studied. Current ozone levels were compared with an increase of 20 and 40 ppb during 8 h per day, over the entire growing season. Oilseed rape seed yield was negatively correlated with ozone dose indices calculated from emergence until harvest. This resulted in an R2 of 0.24 and 0.26 ( p < 0.001) for the accumulated hourly O 3 exposure over a threshold of 40 ppb (AOT40) and the phytotoxic ozone dose above a threshold of 6 nmol m -2 s -1 (POD 6) respectively. Estimated critical levels, above which 5% yield reduction is expected, were 3.7 ppm h and 4.4 mmol m -2 respectively. Our results also confirm that a threshold value of 6 nmol s -1 m -2 projected leaf area, as recommended for agricultural crops (UNECE, Mills, 2004), can indeed be applied for spring oilseed rape. The reduction of oilseed rape yield showed the highest correlation with the ozone uptake during the vegetative growth stage: when only the first 47 days after emergence were used to calculate POD 6, R2 values increased up to 0.476 or even 0.545 when the first 23 days were excluded. The highest ozone treatments, corresponding to the future ambient level by 2100 (IPCC, Meehl et al., 2007), led to a reduction of approximately 30% in oilseed rape seed yield in comparison to the current ozone concentrations. Oil percentage was also significantly reduced in response to ozone ( p < 0.001). As a consequence oil yield was even more severely affected by elevated ozone exposure compared to seed yield: critical levels for oil yield dropped to 3.2 ppm h and 3.9 mmol m -2. For broccoli the applied ozone doses had no effect on yield.

Growth and Yield Responses of Cowpea to Inoculation and Phosphorus Fertilization in Different Environments

PubMed Central

Kyei-Boahen, Stephen; Savala, Canon E. N.; Chikoye, David; Abaidoo, Robert

2017-01-01

Cowpea (Vigna unguiculata) is a major source of dietary protein and essential component of the cropping systems in semi-arid regions of Sub-Saharan Africa. However, yields are very low due to lack of improved cultivars, poor management practices, and limited inputs use. The objectives of this study were to assess the effects of rhizobia inoculant and P on nodulation, N accumulation and yield of two cowpea cultivars in Mozambique. Field study was conducted in three contrasting environments during the 2013/2014 and 2014/2015 seasons using randomized complete block design with four replications and four treatments. Treatments consisted of seed inoculation, application of 40 kg P2O5 ha-1, inoculation + P, and a non-inoculated control. The most probable number (MPN) technique was used to estimate the indigenous bradyrhizobia populations at the experimental sites. The rhizobia numbers at the sites varied from 5.27 × 102 to 1.07 × 103 cells g-1 soil. Inoculation increased nodule number by 34–76% and doubled nodule dry weight (78 to 160 mg plant-1). P application improved nodulation and interacted positively with the inoculant. Inoculation, P, and inoculant + P increased shoot dry weight, and shoot and grain N content across locations but increases in number of pods plant-1, seeds pod-1, and 100-seed weight were not consistent among treatments across locations. Shoot N content was consistently high for the inoculated plants and also for the inoculated + P fertilized plants, whereas the non-inoculated control plants had the lowest tissue N content. P uptake in shoot ranged from 1.72 to 3.77 g kg-1 and was higher for plants that received P fertilizer alone. Inoculation and P either alone or in combination consistently increased cowpea grain yield across locations with yields ranging from 1097 kg ha-1 for the non-inoculated control to 1674 kg ha-1 for the inoculant + P treatment. Grain protein concentration followed a similar trend as grain yield and ranged from 223 to 252 g kg-1 but a negative correlation between grain yield and protein concentration was observed. Inoculation increased net returns by $104–163 ha-1 over that for the control. The results demonstrate the potential of improving cowpea grain yield, quality and profitability using inoculant, although the cost-benefit for using P at the current fertilizer price is not attractive except when applied together with inoculant at low P site. PMID:28515729

Low-energy N-ion beam biotechnology application in the induction of Thai jasmine rice mutant with improved seed storability

NASA Astrophysics Data System (ADS)

Semsang, Nuananong; Techarang, Jiranat; Yu, Liangdeng; Phanchaisri, Boonrak

2018-06-01

Low-energy heavy-ion beam is a novel biotechnology used for mutation induction in plants. We used a low-energy N-ion beam to induce mutations in Thai jasmine rice (Oryza sativa L. cv. KDML 105) to improve the yield and seed quality. Seeds of BKOS6, a Thai jasmine rice mutant previously induced by ion beams, were re-bombarded with 60-kV-accelerated N-ions (N++N2+) to fluences of 1-2 × 1016 ions/cm2. The resulting mutant, named HyKOS21, exhibited photoperiod insensitivity, semi-dwarfness, and high yield potential. Seed storability of the mutant was studied in natural and accelerated ageing conditions and compared to that of KDML 105 and six other Thai rice varieties. In both testing conditions, HyKOS21 mutant had the highest seed storability among the tested varieties. After storage in the natural condition for 18 months, HyKOS21 had a seed germination percentage nearly two times as that of the original KDML 105. Biochemical analysis showed that the lipid peroxidation level of the mutant seeds was the lowest among those of the tested varieties. Furthermore, an expression analysis of genes encoding lipoxygenase isoenzyme (lox1, lox2, and lox3) revealed that the mutant lacked expression of lox1 and lox2 and expressed only lox3 in seeds. These results may explain the improved seed longevity of the mutant after storage. This work provides further evidence of the modification of biological materials using a low-energy ion beam to produce rice mutants with improved yield and seed storability. The benefits of this technology, to create new varieties with improved values, could serve for local economic development.

Birds and bats diverge in the qualitative and quantitative components of seed dispersal of a pioneer tree

NASA Astrophysics Data System (ADS)

Jacomassa, Fábio André F.; Pizo, Marco Aurélio

2010-09-01

Although the overlap in fruit diet between birds and bats is low, they sometimes consume and compete for fruits of the same plant species. What is poorly known is how birds and bats compare with each other in relation to the effectiveness of seed dispersal. In this paper we contrasted birds and bats in relation to quantitative (the amount of fruits removed from plants) and qualitative (germination performance of seeds) components of the seed dispersal of Solanum granuloso- leprosum, a pioneer, small-seeded tree of open areas and forest edges in south Brazil. We tagged fruits on the plants and monitored their removal by day and night. We compared the final percent of germination and speed of germination of seeds ingested by birds and bats with non-ingested, control seeds. While bats removed more fruits than birds, performing better in the quantitative component, birds improved the germination performance of seeds, an aspect of the qualitative component of seed dispersal effectiveness. Although bats are more likely to deposit seeds in highly disturbed sites that favor the recruitment of pioneer plant species, birds frequent forest edges, which is also suitable habitat for S. granuloso- leprosum, We concluded that birds and bats are not 'redundant' seed dispersers for S. granuloso- leprosum because in conjunction they may enhance its recruitment by diversifying the microsites where seeds are deposited, performing in addition different ecological functions in terms of quantity and quality of dispersal.

The impact of sulfate restriction on seed yield and quality of winter oilseed rape depends on the ability to remobilize sulfate from vegetative tissues to reproductive organs

PubMed Central

Girondé, Alexandra; Dubousset, Lucie; Trouverie, Jacques; Etienne, Philippe; Avice, Jean-Christophe

2014-01-01

Our current knowledge about sulfur (S) management by winter oilseed rape to satisfy the S demand of developing seeds is still scarce, particularly in relation to S restriction. Our goals were to determine the physiological processes related to S use efficiency that led to maintain the seed yield and quality when S limitation occurred at the bolting or early flowering stages. To address these questions, a pulse-chase 34SO2−4 labeling method was carried out in order to study the S fluxes from uptake and remobilization at the whole plant level. In response of S limitation at the bolting or early flowering stages, the leaves are the most important source organ for S remobilization during reproductive stages. By combining 34S-tracer with biochemical fractionation in order to separate sulfate from other S-compounds, it appeared that sulfate was the main form of S remobilized in leaves at reproductive stages and that tonoplastic SULTR4-type transporters were specifically involved in the sulfate remobilisation in case of low S availability. In response to S limitation at the bolting stage, the seed yield and quality were dramatically reduced compared to control plants. These data suggest that the increase of both S remobilization from source leaves and the root proliferation in order to maximize sulfate uptake capacities, were not sufficient to maintain the seed yield and quality. When S limitation occurred at the early flowering stage, oilseed rape can optimize the mobilization of sulfate reserves from vegetative organs (leaves and stem) to satisfy the demand of seeds and maintain the seed yield and quality. Our study also revealed that the stem may act as a transient storage organ for remobilized S coming from source leaves before its utilization by seeds. The physiological traits (S remobilization, root proliferation, transient S storage in stem) observed under S limitation could be used in breeding programs to select oilseed rape genotypes with high S use efficiency. PMID:25566272

Cone Analysis of Southern Pines - A Guidebook

Treesearch

D.L. Bramlett; E.W. Belcher; G.L. DeBarr; G.D. Hertel; Robert P. Karrfalt; C.W. Lantz; T. Miller; K.D. Ware; H.O. Yates

1977-01-01

Southern pine tree improvement programs require an ample supply of improved seeds, but productron from southern pine seed orchards has often been disappointing. If high productron is to be malntained yields must be monitored and causes of seed losses must be identified. Techniques for determining seed efficiency were first used for red pine, Pinus resinosa...

Production response to corn silage produced from normal, brown midrib, or waxy corn hybrids.

PubMed

Barlow, J S; Bernard, J K; Mullis, N A

2012-08-01

The objective was to evaluate the nutrient intake and digestibility and milk production response of lactating dairy cows fed diets based on corn silage produced from 3 different types of corn hybrids. Experimental diets contained 36.4% of the dietary dry matter (DM) from corn silage produced from normal (Agratech 1021, AgraTech Seeds Inc., Atlanta, GA), brown midrib (BMR; Mycogen F2F797, Mycogen Seeds, Indianapolis, IN), or waxy (Master's Choice 590, Master's Choice Hybrids, Ullin, IL) hybrids. Thirty-six multiparous and primiparous Holstein cows (66 ± 22 d in milk, 41 ± 8 kg/d of milk) were used in an 11-wk completely randomized design trial during the fall of 2009. All cows were fed a diet containing normal corn silage during the first 2wk of the trial before being assigned to 1 of 3 treatments for the following 9 wk. Data collected during the first 2 wk were used as a covariate in the statistical analysis. No difference was observed in dry matter intake (DMI) among treatments, which averaged 22.6 kg/d. Milk yield was higher for cows fed BMR (37.6 kg/d) compared with waxy (35.2 kg/d) but was similar to that of cows fed control (36.2 kg/d). Milk fat percentage tended to be lower for cows fed control (3.28%) compared with those fed BMR (3.60%) or waxy (3.55%) corn silage. Milk protein percentage tended to be lower for cows fed control (2.79%) compared with waxy (2.89%) but similar to that of those fed BMR (2.85%). No differences were observed in yield of milk components. Energy-corrected milk (ECM) yield and dairy efficiency (ECM:DMI) did not differ among treatments. Cows fed BMR tended to gain more body weight compared with those fed control and waxy. Results of this trial are consistent with previous reports in which cows fed diets based on corn silage produced from BMR hybrids have higher milk yield compared with those fed other hybrids. Corn silage produced from the waxy hybrid supported a similar yield of ECM because of higher milk components, but milk yield was not improved compared with the control. Copyright © 2012 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

Use of Direct and Indirect Estimates of Crown Dimensions to Predict One Seed Juniper Woody Biomass Yield for Alternative Energy Uses

USDA-ARS?s Scientific Manuscript database

Throughout the western United States there is increased interest in utilizing woodland biomass as an alternative energy source. We conducted a pilot study to predict one seed juniper (Juniperus monosperma) chip yield from tree-crown dimensions measured on the ground or derived from Very Large Scale ...

Effect of high oleic acid soybean on seed oil, protein concentration, and yield

USDA-ARS?s Scientific Manuscript database

Soybeans with high oleic acid content are desired by oil processors because of their improved oxidative stability for broader use in food, fuel and other products. However, non-GMO high-oleic soybeans have tended to have low seed yield. The objective of this study was to test non-GMO, high-oleic s...

Validation of Helicopter Gear Condition Indicators Using Seeded Fault Tests

NASA Technical Reports Server (NTRS)

Dempsey, Paula; Brandon, E. Bruce

2013-01-01

A "seeded fault test" in support of a rotorcraft condition based maintenance program (CBM), is an experiment in which a component is tested with a known fault while health monitoring data is collected. These tests are performed at operating conditions comparable to operating conditions the component would be exposed to while installed on the aircraft. Performance of seeded fault tests is one method used to provide evidence that a Health Usage Monitoring System (HUMS) can replace current maintenance practices required for aircraft airworthiness. Actual in-service experience of the HUMS detecting a component fault is another validation method. This paper will discuss a hybrid validation approach that combines in service-data with seeded fault tests. For this approach, existing in-service HUMS flight data from a naturally occurring component fault will be used to define a component seeded fault test. An example, using spiral bevel gears as the targeted component, will be presented. Since the U.S. Army has begun to develop standards for using seeded fault tests for HUMS validation, the hybrid approach will be mapped to the steps defined within their Aeronautical Design Standard Handbook for CBM. This paper will step through their defined processes, and identify additional steps that may be required when using component test rig fault tests to demonstrate helicopter CI performance. The discussion within this paper will provide the reader with a better appreciation for the challenges faced when defining a seeded fault test for HUMS validation.

Honey bee (Hymenoptera: Apidae) foraging in response to preconditioning with onion flower scent compounds.

PubMed

Silva, Erin M; Dean, Bill B; Hiller, Larry K

2003-10-01

Onion (Allium cepa L.) seed production has long been plagued with yield problems because of lack of pollination by the honey bee, Apis mellifera L. To attempt to attract more pollinators to the onion seed production field, honey bees were conditioned to associate onion floral odor components with a reward. Isolated nucleus hives of honey bees were fed 30% sucrose solutions scented with a 0.2% solution of onion floral odor compounds. After feeding on these solutions for 6 wk, bees were not found to prefer onion flowers to two competing food sources, carrot and alfalfa flowers, at the 5% significance level. However, there was an overall trend indicating a change in honey bee behavior, with fewer "trained" bees visiting alfalfa and carrot and more visiting onion. Thus, it may be possible to alter honey bee behavior with preconditioning but probably not to a degree that would be economically significant.

Ion beam texturing of surfaces

NASA Technical Reports Server (NTRS)

Kaufman, H. R.; Robinson, R. S.

1979-01-01

Textured surfaces, typically with conical structures, have been produced previously by simultaneously etching a surface and seeding that surface with another material. A theory based on surface diffusion predicts a variation in cone spacing with surface temperature, as well as a critical temperature below which cones will not form. Substantial agreement with theory has been found for several combinations of seed and surface materials, including one with a high sputter yield seed on a low sputter yield surface (gold on aluminum). Coning with this last combination was predicted by the theory for a sufficiently mobile seed material. The existence of a minimum temperature for the formation of cones should also be important to those interested in ion-beam machining smooth surfaces. Elements contained in the environmental contaminants or in the sputtered alloys or compounds may serve as seed material.

Effectiveness of vegetation-based biodiversity offset metrics as surrogates for ants.

PubMed

Hanford, Jayne K; Crowther, Mathew S; Hochuli, Dieter F

2017-02-01

Biodiversity offset schemes are globally popular policy tools for balancing the competing demands of conservation and development. Trading currencies for losses and gains in biodiversity value at development and credit sites are usually based on several vegetation attributes combined to yield a simple score (multimetric), but the score is rarely validated prior to implementation. Inaccurate biodiversity trading currencies are likely to accelerate global biodiversity loss through unrepresentative trades of losses and gains. We tested a model vegetation multimetric (i.e., vegetation structural and compositional attributes) typical of offset trading currencies to determine whether it represented measurable components of compositional and functional biodiversity. Study sites were located in remnant patches of a critically endangered ecological community in western Sydney, Australia, an area representative of global conflicts between conservation and expanding urban development. We sampled ant fauna composition with pitfall traps and enumerated removal by ants of native plant seeds from artificial seed containers (seed depots). Ants are an excellent model taxon because they are strongly associated with habitat complexity, respond rapidly to environmental change, and are functionally important at many trophic levels. The vegetation multimetric did not predict differences in ant community composition or seed removal, despite underlying assumptions that biodiversity trading currencies used in offset schemes represent all components of a site's biodiversity value. This suggests that vegetation multimetrics are inadequate surrogates for total biodiversity value. These findings highlight the urgent need to refine existing offsetting multimetrics to ensure they meet underlying assumptions of surrogacy. Despite the best intentions, offset schemes will never achieve their goal of no net loss of biodiversity values if trades are based on metrics unrepresentative of total biodiversity. © 2016 Society for Conservation Biology.

Ultrahigh-yield growth of GaN via halogen-free vapor-phase epitaxy

NASA Astrophysics Data System (ADS)

Nakamura, Daisuke; Kimura, Taishi

2018-06-01

The material yield of Ga during GaN growth via halogen-free vapor-phase epitaxy (HF-VPE) was systematically investigated and found to be much higher than that obtained using conventional hydride VPE. This is attributed to the much lower process pressure and shorter seed-to-source distance, owing to the inherent chemical reactions and corresponding reactor design used for HF-VPE growth. Ultrahigh-yield GaN growth was demonstrated on a 4-in.-diameter sapphire seed substrate.

[Analysis of essential oil extracted from Lactuca sativa seeds growing in Xinjiang by GC-MS].

PubMed

Xu, Fang; Wang, Qiang; Haji, Akber Aisa

2011-12-01

To analyze the components of essential oil from Lactuca sativa seeds growing in Xinjiang. The components of essential oil from Lactuca sativa seeds were analyzed by gas chromatography-mass spectrometry (GC-MS). 62 components were identified from 71 separated peaks,amounting to total mass fraction 95.07%. The dominant compounds were n-Hexanol (36.31%), n-Hexanal (13.71%), trans-2-Octen-l-ol (8.09%) and 2-n-Pentylfuran (4.41%). The research provides a theoretical basis for the exploitation and use of Lactuca sativa seeds resource.

Evaluation of maturity group III soybean lines for resistance to purple seed stain in Mississippi, 2010

USDA-ARS?s Scientific Manuscript database

Purple seed stain (PSS) of soybean is an important disease caused by Cercospora kikuchii. PSS reduces seed quality and market grade, affects seed germination and vigor, and has been reported wherever soybeans are grown worldwide. In 2009, PSS caused 6.4 million bushels of yield losses in 16 southern...

Reaction of maturity group V soybean lines to purple seed stains in Mississippi 2010

USDA-ARS?s Scientific Manuscript database

In 2009, soybean purple seed stain (PSS) caused 6.4 million bushels of yield losses in 16 southern states. This disease severely reduces seed market grade and affects seed germination and vigor. PSS is caused by Cercospora kikuchii and is an economy important disease. To identify new sources of resi...

Evaluation of maturity group IV soybean lines for resistance to purple seed stains in Mississippi 2010

USDA-ARS?s Scientific Manuscript database

Purple seed stain (PSS) of soybean is an important disease caused by Cercospora kikuchii. PSS reduces seed quality and market grade, affects seed germination and vigor, and has been reported wherever soybeans are grown worldwide. In 2009, PSS caused 6.4 million bushels of yield losses in 16 southern...

Functional morphology and seed anatomy of the invasive weed, benghal dayflower (Commelina benghalensis): Implications for dispersal by mourning doves

USDA-ARS?s Scientific Manuscript database

Benghal dayflower (BD) is an exotic weed that reduces yields in many agricultural crops. Potential dispersal of this weed by migratory Mourning doves was investigated in this study. Evidence shows that doves feed on BD seeds, with some birds containing hundreds of seeds. Seeds extracted from harvest...

Chiral dynamos and magnetogenesis induced by torsionful Maxwell-Chern Simons electrodynamics

NASA Astrophysics Data System (ADS)

de Andrade, L. C. Garcia

2018-03-01

Recently chiral anomalous currents have been investigated by Boyarsky et al. and Brandenburg et al. with respect to applications to the early universe. In this paper we show that these magnetic field anomalies, which can give rise to dynamo magnetic field amplification can also be linked to spacetime torsion through the use of a chemical potential and Maxwell electrodynamics with torsion firstly proposed by de Sabbata and Gasperini. When the axial torsion is constant this electrodynamics acquires the form of a Maxwell-Chern-Simmons (MCS) equations where the chiral current appears naturally and the zero component of torsion plays the role of a chemical potential, while the other components play the role of anisotropic conductivity. The chiral dynamo equation in torsionful spacetime is derived here from MSC electrodynamics. Here we have used a recently derived a torsion LV bound of T0˜ {10^{-26}} GeV and the constraint that this chiral magnetic field is a seed for galactic dynamo. This estimate is weaker than the one obtained from the chiral battery seed of ˜ {10^{30}} G without making use of Cartan torsion. The torsion obtained here was derived at 500 pc coherence scale. When a chiral MF is forced to seed a galactic dynamo one obtains a yet weaker MF, of the order of B˜ {10^{12}} G, which is the value of a MF at nucleosynthesis. By the use of chiral dynamo equations from parity-violating torsion one obtains a seed field of B˜ {10^{27}} G, which is a much stronger MF closer to the one obtained by making use of chiral batteries. Chiral vortical currents in non-Riemannian spacetimes derived in Riemannian spaces previously by Flaschi and Fukushima are extended to include minimal coupling with torsion. The present universe yields B˜ {10^{-24}} G, still sufficient to seed galactic dynamos.

Genome-Wide Analysis of the Complex Transcriptional Networks of Rice Developing Seeds

PubMed Central

Xue, Liang-Jiao; Zhang, Jing-Jing; Xue, Hong-Wei

2012-01-01

Background The development of rice (Oryza sativa) seed is closely associated with assimilates storage and plant yield, and is fine controlled by complex regulatory networks. Exhaustive transcriptome analysis of developing rice embryo and endosperm will help to characterize the genes possibly involved in the regulation of seed development and provide clues of yield and quality improvement. Principal Findings Our analysis showed that genes involved in metabolism regulation, hormone response and cellular organization processes are predominantly expressed during rice development. Interestingly, 191 transcription factor (TF)-encoding genes are predominantly expressed in seed and 59 TFs are regulated during seed development, some of which are homologs of seed-specific TFs or regulators of Arabidopsis seed development. Gene co-expression network analysis showed these TFs associated with multiple cellular and metabolism pathways, indicating a complex regulation of rice seed development. Further, by employing a cold-resistant cultivar Hanfeng (HF), genome-wide analyses of seed transcriptome at normal and low temperature reveal that rice seed is sensitive to low temperature at early stage and many genes associated with seed development are down-regulated by low temperature, indicating that the delayed development of rice seed by low temperature is mainly caused by the inhibition of the development-related genes. The transcriptional response of seed and seedling to low temperature is different, and the differential expressions of genes in signaling and metabolism pathways may contribute to the chilling tolerance of HF during seed development. Conclusions These results provide informative clues and will significantly improve the understanding of rice seed development regulation and the mechanism of cold response in rice seed. PMID:22363552

Value of neonicotinoid seed treatments to US soybean farmers.

PubMed

Hurley, Terrance; Mitchell, Paul

2017-01-01

The benefits of neonicotinoid seed treatment to soybean farmers have received increased scrutiny. Rather than use data from small-plot experiments, this research uses survey data from 500 US farmers to estimate the benefit of neonicotinoid seed treatments to them. As seed treatment users, farmers are familiar with their benefits in the field and have economic incentives to only use them if they provide value. Of the surveyed farmers, 51% used insecticide seed treatments, averaging 87% of their soybean area. Farmers indicated that human and environmental safety is an important consideration affecting their pest management decisions and reported aphids as the most managed and important soybean pest. Asking farmers who used seed treatments to state how much value they provided gives an estimate of $US 28.04 ha -1 treated in 2013, net of seed treatment costs. Farmer-reported average yields provided an estimated average yield gain of 128.0 kg ha -1 treated in 2013, or about $US 42.20 ha -1 treated, net of seed treatment costs. These estimates using different data and methods are consistent and suggest the value of insecticide seed treatments to the US soybean farmers who used them in 2013 was around $US 28-42 ha -1 treated, net of seed treatment costs. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Physiological and transcriptomic responses in the seed coat of field-grown soybean (Glycine max L. Merr.) to abiotic stress.

PubMed

Leisner, Courtney P; Yendrek, Craig R; Ainsworth, Elizabeth A

2017-12-12

Understanding how intensification of abiotic stress due to global climate change affects crop yields is important for continued agricultural productivity. Coupling genomic technologies with physiological crop responses in a dynamic field environment is an effective approach to dissect the mechanisms underpinning crop responses to abiotic stress. Soybean (Glycine max L. Merr. cv. Pioneer 93B15) was grown in natural production environments with projected changes to environmental conditions predicted for the end of the century, including decreased precipitation, increased tropospheric ozone concentrations ([O 3 ]), or increased temperature. All three environmental stresses significantly decreased leaf-level photosynthesis and stomatal conductance, leading to significant losses in seed yield. This was driven by a significant decrease in the number of pods per node for all abiotic stress treatments. To understand the underlying transcriptomic response involved in the yield response to environmental stress, RNA-Sequencing analysis was performed on the soybean seed coat, a tissue that plays an essential role in regulating carbon and nitrogen transport to developing seeds. Gene expression analysis revealed 49, 148 and 1,576 differentially expressed genes in the soybean seed coat in response to drought, elevated [O 3 ] and elevated temperature, respectively. Elevated [O 3 ] and drought did not elicit substantive transcriptional changes in the soybean seed coat. However, this may be due to the timing of sampling and does not preclude impacts of those stresses on different tissues or different stages in seed coat development. Expression of genes involved in DNA replication and metabolic processes were enriched in the seed coat under high temperate stress, suggesting that the timing of events that are important for cell division and proper seed development were altered in a stressful growth environment.

Seed priming and transgenerational drought memory improves tolerance against salt stress in bread wheat.

PubMed

Tabassum, Tahira; Farooq, Muhammad; Ahmad, Riaz; Zohaib, Ali; Wahid, Abdul

2017-09-01

This study was conducted to evaluate the potential of seed priming following terminal drought on tolerance against salt stress in bread wheat. Drought was imposed in field sown wheat at reproductive stage (BBCH growth stage 49) and was maintained till physiological maturity (BBCH growth stage 83). Seeds of bread wheat, collected from crop raised under terminal drought and/or well-watered conditions, were subjected to hydropriming and osmopriming (with 1.5% CaCl 2 ) and were sown in soil-filled pots. After stand establishment, salt stress treatments viz. 10 mM NaCl (control) and 100 mM NaCl were imposed. Seed from terminal drought stressed source had less fat (5%), and more fibers (11%), proteins (22%) and total soluble phenolics (514%) than well-watered seed source. Salt stress reduced the plant growth, perturbed water relations and decreased yield. However, an increase in osmolytes accumulation (4-18%), malondialdehyde (MDA) (27-35%) and tissue Na + contents (149-332%) was observed under salt stress. The seeds collected from drought stressed crop had better tolerance against salt stress as indicated by better yield (28%), improved water relations (3-18%), osmolytes accumulation (21-33%), and less MDA (8%) and Na contents (35%) than progeny of well-watered crop. Seed priming, osmopriming in particular, further improved the tolerance against salt stress through improvement in leaf area, water relations, leaf proline, glycine betaine and grain yield while lowering MDA and Na + contents. In conclusion, changed seed composition during terminal drought and seed priming improved the salt tolerance in wheat by modulating the water relations, osmolytes accumulation and lipid peroxidation. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

Soil nitrogen dynamics in switchgrass seeded to a marginally yielding cropland of South Dakota

USDA-ARS?s Scientific Manuscript database

Soil nitrate (NO3-), nitrate leaching, and nitrous oxide (N2O) emissions for 2009 through 2015 were monitored to explore N dynamics in switchgrass (Panicum virgatum L.) seeded to a marginally yielding cropland. Our findings indicated that N rate impacted soil NO3- (0-5 cm depth) and soil surface N2O...

Development of a biologically based fertilizer, incorporating Bacillus megaterium A6, for improved phosphorus nutrition of oilseed rape.

PubMed

Hu, Xiaojia; Roberts, Daniel P; Xie, Lihua; Maul, Jude E; Yu, Changbing; Li, Yinshui; Zhang, Shujie; Liao, Xing

2013-04-01

Sustainable methods with diminished impact on the environment need to be developed for the production of oilseed rape in China and other regions of the world. A biological fertilizer consisting of Bacillus megaterium A6 cultured on oilseed rape meal improved oilseed rape seed yield (P < 0.0001) relative to the nontreated control in 2 greenhouse pot experiments using natural soil. This treatment resulted in slightly greater yield than oilseed rape meal without strain A6 in 1 of 2 experiments, suggesting a role for strain A6 in improving yield. Strain A6 was capable of solubilizing phosphorus from rock phosphate in liquid culture and produced enzymes capable of mineralizing organic phosphorus (acid phosphatase, phytase) in liquid culture and in the biological fertilizer. The biologically based fertilizer, containing strain A6, improved plant phosphorus nutrition in greenhouse pot experiments resulting in significantly greater available phosphorus in natural soil and in significantly greater plant phosphorus content relative to the nontreated control. Seed yield and available phosphorus in natural soil were significantly greater with a synthetic chemical fertilizer treatment, reduced in phosphorus content, than the biological fertilizer treatment, but a treatment containing the biological fertilizer combined with the synthetic fertilizer provided the significantly greatest seed yield, available phosphorus in natural soil, and plant phosphorus content. These results suggest that the biological fertilizer was capable of improving oilseed rape seed yield, at least in part, through the phosphorus-solubilizing activity of B. megaterium A6.

Growth, pod, and seed yield, and gas exchange of hydroponically grown peanut in response to CO2 enrichment

NASA Technical Reports Server (NTRS)

Stanciel, K.; Mortley, D. G.; Hileman, D. R.; Loretan, P. A.; Bonsi, C. K.; Hill, W. A.

2000-01-01

The effects of elevated CO2 on growth, pod, and seed yield, and gas exchange of 'Georgia Red' peanut (Arachis hypogaea L.) were evaluated under controlled environmental conditions. Plants were exposed to concentrations of 400 (ambient), 800, and 1200 micromoles mol-1 CO2 in reach-in growth chambers. Foliage fresh and dry weights increased with increased CO2 up to 800 micromoles mol-1, but declined at 1200 micromoles mol-1. The number and the fresh and dry weights of pods also increased with increasing CO2 concentration. However, the yield of immature pods was not significantly influenced by increased CO2. Total seed yield increased 33% from ambient to 800 micromoles mol-1 CO2, and 4% from 800 to 1200 micromoles mol-1 CO2. Harvest index increased with increasing CO2. Branch length increased while specific leaf area decreased linearly as CO2 increased from ambient to 1200 micromoles mol-1. Net photosynthetic rate was highest among plants grown at 800 micromoles mol-1. Stomatal conductance decreased with increased CO2. Carboxylation efficiency was similar among plants grown at 400 and 800 micromoles mol-1 and decreased at 1200 micromoles mol-1 CO2. These results suggest that CO2 enrichment from 400 to 800 micromoles mol-1 had positive effects on peanut growth and yield, but above 800 micromoles mol-1 enrichment seed yield increased only marginally.

Extra soil fertilization of mother plants increases botanical seed yield but not long-term germination in wild Solanum (potato) species

USDA-ARS?s Scientific Manuscript database

Potato has about 100 wild species relatives that are multiplied in the form of botanical seed populations by genebanks, and distributed for use in research and breeding, so factors that affect long term seed germination are of interest. In 1987 the US Potato Genebank conducted routine seed multiplic...

Comparison of gamma and electron beam irradiation in reducing populations of E. coli artificially inoculated on Mung Bean, clover and Fenugreek Seeds, and affecting germination and growth of seeds

USDA-ARS?s Scientific Manuscript database

Sprouts have frequently been implicated in outbreaks of foodborne illnesses, mostly due to contaminated seeds. Intervention technologies to decontaminate seeds without affecting sprout yield are needed. In the present study, we compared gamma rays with electron beam in inactivating E. coli artifici...

Non-Destructive Quality Evaluation of Pepper (Capsicum annuum L.) Seeds Using LED-Induced Hyperspectral Reflectance Imaging

PubMed Central

Mo, Changyeun; Kim, Giyoung; Lee, Kangjin; Kim, Moon S.; Cho, Byoung-Kwan; Lim, Jongguk; Kang, Sukwon

2014-01-01

In this study, we developed a viability evaluation method for pepper (Capsicum annuum L.) seeds based on hyperspectral reflectance imaging. The reflectance spectra of pepper seeds in the 400–700 nm range are collected from hyperspectral reflectance images obtained using blue, green, and red LED illumination. A partial least squares–discriminant analysis (PLS-DA) model is developed to classify viable and non-viable seeds. Four spectral ranges generated with four types of LEDs (blue, green, red, and RGB), which were pretreated using various methods, are investigated to develop the classification models. The optimal PLS-DA model based on the standard normal variate for RGB LED illumination (400–700 nm) yields discrimination accuracies of 96.7% and 99.4% for viable seeds and nonviable seeds, respectively. The use of images based on the PLS-DA model with the first-order derivative of a 31.5-nm gap for red LED illumination (600–700 nm) yields 100% discrimination accuracy for both viable and nonviable seeds. The results indicate that a hyperspectral imaging technique based on LED light can be potentially applied to high-quality pepper seed sorting. PMID:24763251

An Economic Analysis of Pigeonpea Seed Production Technology and Its Adoption Behavior: Indian Context.

PubMed

Pal, Govind; Channanamchery, Radhika; Singh, R K; Kethineni, Udaya Bhaskar; Ram, H; Prasad, S Rajendra

2016-01-01

The present study was based on primary data collected from 100 farmers in Gulbarga district of Karnataka, India, during the agricultural year 2013-2014. Study shows that average land holding size of pigeonpea seed farmers was higher in comparison to grain farmers and district average. The study illustrates a ratio of 32 : 68 towards fixed and variable costs in pigeonpea certified seed production with a total cost of ₹ 39436 and the gross and net returns were ₹ 73300 and ₹ 33864 per hectare, respectively. The total cost of cultivation, gross return, and net return in pigeonpea seed production were higher by around 23, 32, and 44 percent than grain production, respectively. Hence, production of certified seed has resulted in a win-win situation for the farmers with higher yield and increased returns. The decision of the farmer on adoption of seed production technology was positively influenced by his education, age, land holding, irrigated land, number of crops grown, and extension contacts while family size was influencing negatively. Higher yield and profitability associated with seed production can be effectively popularized among farmers, resulting in increased certified seed production.

Non-destructive quality evaluation of pepper (Capsicum annuum L.) seeds using LED-induced hyperspectral reflectance imaging.

PubMed

Mo, Changyeun; Kim, Giyoung; Lee, Kangjin; Kim, Moon S; Cho, Byoung-Kwan; Lim, Jongguk; Kang, Sukwon

2014-04-24

In this study, we developed a viability evaluation method for pepper (Capsicum annuum L.) seeds based on hyperspectral reflectance imaging. The reflectance spectra of pepper seeds in the 400-700 nm range are collected from hyperspectral reflectance images obtained using blue, green, and red LED illumination. A partial least squares-discriminant analysis (PLS-DA) model is developed to classify viable and non-viable seeds. Four spectral ranges generated with four types of LEDs (blue, green, red, and RGB), which were pretreated using various methods, are investigated to develop the classification models. The optimal PLS-DA model based on the standard normal variate for RGB LED illumination (400-700 nm) yields discrimination accuracies of 96.7% and 99.4% for viable seeds and nonviable seeds, respectively. The use of images based on the PLS-DA model with the first-order derivative of a 31.5-nm gap for red LED illumination (600-700 nm) yields 100% discrimination accuracy for both viable and nonviable seeds. The results indicate that a hyperspectral imaging technique based on LED light can be potentially applied to high-quality pepper seed sorting.

Characterizing oxidative flow reactor SOA production and OH radical exposure from laboratory experiments of complex mixtures (engine exhaust) and simple precursors (monoterpenes)

NASA Astrophysics Data System (ADS)

Michael Link, M. L.; Friedman, B.; Ortega, J. V.; Son, J.; Kim, J.; Park, G.; Park, T.; Kim, K.; Lee, T.; Farmer, D.

2016-12-01

Recent commercialization of the Oxidative Flow Reactor (OFR, occasionally described in the literature as a "Potential Aerosol Mass") has created the opportunity for many researchers to explore the mechanisms behind OH-driven aerosol formation on a wide range of oxidative timescales (hours to weeks) in both laboratory and field measurements. These experiments have been conducted in both laboratory and field settings, including simple (i.e. single component) and complex (multi-component) precursors. Standard practices for performing OFR experiments, and interpreting data from the measurements, are still being developed. Measurement of gas and particle phase chemistry, from oxidation products generated in the OFR, through laboratory studies on single precursors and the measurement of SOA from vehicle emissions on short atmospheric timescales represent two very different experiments in which careful experimental design is essential for exploring reaction mechanisms and SOA yields. Two parameters essential in experimental design are (1) the role of seed aerosol in controlling gas-particle partitioning and SOA yields, and (2) the accurate determination of OH exposure during any one experiment. We investigated the role of seed aerosol surface area in controlling the observed SOA yields and gas/particle composition from the OH-initiated oxidation of four monoterpenes using an aerosol chemical ionization time-of-flight mass spectrometer and scanning mobility particle sizer. While the OH exposure during laboratory experiments is simple to constrain, complex mixtures such as diesel exhaust have high estimated OH reactivity values, and thus require careful consideration. We developed methods for constraining OH radical exposure in the OFR during vehicle exhaust oxidation experiments. We observe changes in O/C ratios and highly functionalized species over the temperature gradient employed in the aerosol-CIMS measurement. We relate this observed, speciated chemistry to the volatility of the aerosol, and compare observed SOA yields to other OFR and smog chamber SOA generation methods. Additionally, estimates of OH radical exposure in the OFR during different vehicle experiments of varying fuel type and speed were observed to vary as determined from a high-NOx and variable humidity calibration set.

Biobased lubricants and functional products from Cuphea oil

USDA-ARS?s Scientific Manuscript database

Cuphea (Lythraceae) is an annual plant that produces a small seed rich in saturated medium-chain triacylglycerols (TAGs). With the need for higher seed yields, oil content, and less seed shattering, Oregon State University began developing promising cuphea crosses. Cuphea PSR23 is a hybrid between C...

Hydroxyapatite fiber reinforced poly(alpha-hydroxy ester) foams for bone regeneration

NASA Technical Reports Server (NTRS)

Thomson, R. C.; Yaszemski, M. J.; Powers, J. M.; Mikos, A. G.; McIntire, L. V. (Principal Investigator)

1998-01-01

A process has been developed to manufacture biodegradable composite foams of poly(DL-lactic-co-glycolic acid) (PLGA) and hydroxyapatite short fibers for use in bone regeneration. The processing technique allows the manufacture of three-dimensional foam scaffolds and involves the formation of a composite material consisting of a porogen material (either gelatin microspheres or salt particles) and hydroxyapatite short fibers embedded in a PLGA matrix. After the porogen is leached out, an open-cell composite foam remains which has a pore size and morphology defined by the porogen. By changing the weight fraction of the leachable component it was possible to produce composite foams with controlled porosities ranging from 0.47 +/- 0.02 to 0.85 +/- 0.01 (n = 3). Up to a polymer:fiber ratio of 7:6, short hydroxyapatite fibers served to reinforce low-porosity PLGA foams manufactured using gelatin microspheres as a porogen. Foams with a compressive yield strength up to 2.82 +/- 0.63 MPa (n = 3) and a porosity of 0.47 +/- 0.02 (n = 3) were manufactured using a polymer:fiber weight ratio of 7:6. In contrast, high-porosity composite foams (up to 0.81 +/- 0.02, n = 3) suitable for cell seeding were not reinforced by the introduction of increasing quantities of hydroxyapatite short fibers. We were therefore able to manufacture high-porosity foams which may be seeded with cells but which have minimal compressive yield strength, or low porosity foams with enhanced osteoconductivity and compressive yield strength.

Stabilized diode seed laser for flight and space-based remote lidar sensing applications

NASA Astrophysics Data System (ADS)

McNeil, Shirley; Pandit, Pushkar; Battle, Philip; Rudd, Joe; Hovis, Floyd

2017-08-01

AdvR, through support of the NASA SBIR program, has developed fiber-based components and sub-systems that are routinely used on NASA's airborne missions, and is now developing an environmentally hardened, diode-based, locked wavelength, seed laser for future space-based high spectral resolution lidar applications. The seed laser source utilizes a fiber-coupled diode laser, a fiber-coupled, calibrated iodine reference module to provide an absolute wavelength reference, and an integrated, dual-element, nonlinear optical waveguide component for second harmonic generation, spectral formatting and wavelength locking. The diode laser operates over a range close to 1064.5 nm, provides for stabilization of the seed to the desired iodine transition and allows for a highly-efficient, fully-integrated seed source that is well-suited for use in airborne and space-based environments. A summary of component level environmental testing and spectral purity measurements with a seeded Nd:YAG laser will be presented. A direct-diode, wavelength-locked seed laser will reduce the overall size weight and power (SWaP) requirements of the laser transmitter, thus directly addressing the need for developing compact, efficient, lidar component technologies for use in airborne and space-based environments.

Effects of Boron foliar-fertilization on irrigated soybean (Glycine max L. Merr.) in the Mississippi River Valley Delta of the midsouth, USA

USDA-ARS?s Scientific Manuscript database

Irrigated soybeans in the Mississippi Delta have been reported to with increased seed yields when fertilized with a boron (B). Furrow irrigated soybean cultivars were foliar fertilized with a B solution at growth stages R3 and/or R5. No consistent trends in yield or seed weight were noted. No phy...

Seed-to-seed growth of superdwarf wheat and arabidopsis using red light-emitting diodes (LED's): A report on baseline tests conducted for NASA's proposed Plant Research Unit (PRU)

NASA Technical Reports Server (NTRS)

Goins, G. D.; Yorio, N. C.; Sanwo, M. M.; Brown, C. S.

1996-01-01

To determine the influence of narrow-spectrum red light-emitting diodes (LED's) on plant growth and seed production, wheat (Triticum aestivum L.cv Superdwarf) and Arabidopsis (Arabidopsis thaliana (L.) Heynh, race Columbia) plants were grown under red LED's (peak emission 660 nm) and compared to plants grown under daylight fluorescent (white) light and red LED's supplemented with either 1 percent or 10 percent blue fluorescent (BF) light. Wheat growth under red LED's alone appeared normal, whereas Arabidopsis under red LED's alone developed curled leaf margins and a spiraling growth pattern. Both wheat and Arabidopsis under red LED's alone or red LED's + 1 percent BF light had significantly lower seed yield than plants grown under white light. However, the addition of 10 percent BF light to red LED's partially alleviated the adverse effect of red LED's on yield. Irrespective of the light treatment, viable seeds were produced by wheat(75-92 percent germination rate) and Arabidopsis (85-100 percent germination rate). These results indicate that wheat, and to a lesser extent Arabidopsis, can be successfully grown under red LED's alone, but supplemental blue light is required with red LED's to sufficiently match the growth characteristics and seed yield associated with plants grown under white light.

Brachypodium seed - a potential model for studying grain development of cereal crops

USDA-ARS?s Scientific Manuscript database

Seeds of small grains are important resources for human and animal food. The understanding of seed biology is essential for crop improvement by increasing grain yields and nutritional value. In the last decade, Brachypodium distachyon has been developed as a model plant for temperate cereal grasses...

Improving sustainable seed yield in Wyoming big sagebrush

Treesearch

Jeremiah C. Armstrong

2007-01-01

As part of the Great Basin Restoration Initiative, the effects of browsing, competition removal, pruning, fertilization and seed collection methods on increasing seed production in Wyoming big sagebrush (Artemisia tridentata Nutt. spp wyomingensis Beetle & Young) were studied. Study sites were located in Idaho, Nevada, and Utah. A split-plot...

Linear velocity fields in non-Gaussian models for large-scale structure

NASA Technical Reports Server (NTRS)

Scherrer, Robert J.

1992-01-01

Linear velocity fields in two types of physically motivated non-Gaussian models are examined for large-scale structure: seed models, in which the density field is a convolution of a density profile with a distribution of points, and local non-Gaussian fields, derived from a local nonlinear transformation on a Gaussian field. The distribution of a single component of the velocity is derived for seed models with randomly distributed seeds, and these results are applied to the seeded hot dark matter model and the global texture model with cold dark matter. An expression for the distribution of a single component of the velocity in arbitrary local non-Gaussian models is given, and these results are applied to such fields with chi-squared and lognormal distributions. It is shown that all seed models with randomly distributed seeds and all local non-Guassian models have single-component velocity distributions with positive kurtosis.

The Douglas-fir seed-source movement trial yields early results

Treesearch

Constance A. Harrington; Brad St. Clair

2017-01-01

Climate change in the 21st century is likely to dramatically alter the growing conditions that Pacific Northwest tree species experience. It has been suggested that foresters plan for these changes by moving seed sources to locations where the seed-source environment and the future climate will be similar. Some people have called this type of seed-source movement “...

Effects of foliar boron application on seed composition, cell wall boron, and seed delta 15N and delta 13C isotopes in soybean are influenced by water stress

USDA-ARS?s Scientific Manuscript database

Although the effect of foliar boron (B) application on yield and quality is well established for crops, limited information and controversial results still exist on the effects of foliar B application on soybean seed composition (seed protein, oil, fatty acids, and sugars). The objective of this res...

Mass production alternatives for fast-growing spruce hybrids

Treesearch

Hans Nienstaedt

1977-01-01

A reciptrocal crossing program of Picea glauca and P. omorika, and P. mariana and P. omorika with adequate intraspecific control crosses was carried out. Yields of full seed/cone ranged from 0 to 2.6 for the P. glauca-P. omorika combination. These low seed sets and a 9-day difference in female receptivity rule out producing this hybrid via seed. The full seed/cone...

Thiamethoxam Seed Treatments Have No Impact on Pest Numbers or Yield in Cultivated Sunflowers.

PubMed

Bredeson, Michael M; Lundgren, Jonathan G

2015-12-01

The use of neonicotinoid seed treatments is a nearly ubiquitous practice in sunflower (Helianthus annuus) pest management. Sunflowers have a speciose pest complex, but also harbor a diverse and abundant community of beneficial, nontarget organisms which may be negatively affected by pest management practices. Here, we investigate how the foliar and subterranean arthropod pest communities in sunflower fields were affected by a thiamethoxam seed treatment over three site years (two years on one farm, and another year at an additional field in the second year). Thiamethoxam and its metabolite clothianidin in leaf tissue were quantified throughout the growing season, and yield differences between treatments were measured. Across site years, foliar herbivores and key pests of sunflowers were unaffected by the seed treatment. Likewise, subterranean herbivores were unaffected. Thiamethoxam was measurable in leaf tissue through the R1 plant stage, while its metabolite clothianidin was detected throughout flowering (R6). No difference in sunflower yield was observed between treatments across site years. This research suggests that neonicotinoid seed treatments in sunflowers do not always provide economic benefits to farmers in the form of pest reductions or yield improvements. Future research should focus on sunflower integrated pest management strategies that limit nontarget effects of agrochemicals, while providing greater economic returns to farmers. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

Lack of transgene and glyphosate effects on yield, and mineral and amino acid content of glyphosate-resistant soybean.

PubMed

Duke, Stephen O; Rimando, Agnes M; Reddy, Krishna N; Cizdziel, James V; Bellaloui, Nacer; Shaw, David R; Williams, Martin M; Maul, Jude E

2018-05-01

There has been controversy as to whether the glyphosate resistance gene and/or glyphosate applied to glyphosate-resistant (GR) soybean affect the content of cationic minerals (especially Mg, Mn and Fe), yield and amino acid content of GR soybean. A two-year field study (2013 and 2014) examined these questions at sites in Mississippi, USA. There were no effects of glyphosate, the GR transgene or field crop history (for a field with both no history of glyphosate use versus one with a long history of glyphosate use) on grain yield. Furthermore, these factors had no consistent effects on measured mineral (Al, As, Ba, Cd, Ca, Co, Cr, Cs, Cu, Fe, Ga, K, Li, Mg, Mn, Ni, Pb, Rb, Se, Sr, Tl, U, V, Zn) content of leaves or harvested seed. Effects on minerals were small and inconsistent between years, treatments and mineral, and appeared to be random false positives. No notable effects on free or protein amino acids of the seed were measured, although glyphosate and its degradation product, aminomethylphosphonic acid (AMPA), were found in the seed in concentrations consistent with previous studies. Neither glyphosate nor the GR transgene affect the content of the minerals measured in leaves and seed, harvested seed amino acid composition, or yield of GR soybean. Furthermore, soils with a legacy of GR crops have no effects on these parameters in soybean. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Heterotic patterns in rapeseed (Brassica napus L.): I. Crosses between spring and Chinese semi-winter lines.

PubMed

Qian, W; Sass, O; Meng, J; Li, M; Frauen, M; Jung, C

2007-06-01

Chinese semi-winter rapeseed is genetically diverse from Canadian and European spring rapeseed. This study was conducted to evaluate the potential of semi-winter rapeseed for spring rapeseed hybrid breeding, to assess the genetic effects involved, and to estimate the correlation of parental genetic distance (GD) with hybrid performance, heterosis, general combining ability (GCA) and specific combining ability (SCA) in crosses between spring and semi-winter rapeseed lines. Four spring male sterile lines from Germany and Canada as testers were crossed with 13 Chinese semi-winter rapeseed lines to develop 52 hybrids, which were evaluated together with their parents and commercial hybrids for seed yield and oil content in three sets of field trials with 8 environments in Canada and Europe. The Chinese parental lines were not adapted to local environmental conditions as demonstrated by poor seed yields per se. However, the hybrids between the Chinese parents and the adapted spring rapeseed lines exhibited high heterosis for seed yield. The average mid-parent heterosis was 15% and ca. 50% of the hybrids were superior to the respective hybrid control across three sets of field trials. Additive gene effects mainly contributed to hybrid performance since the mean squares of GCA were higher as compared to SCA. The correlation between parental GD and hybrid performance and heterosis was found to be low whereas the correlation between GCA((f + m)) and hybrid performance was high and significant in each set of field trials, with an average of r = 0.87 for seed yield and r = 0.89 for oil content, indicating that hybrid performance can be predicted by GCA((f + m)). These results demonstrate that Chinese semi-winter rapeseed germplasm has a great potential to increase seed yield in spring rapeseed hybrid breeding programs in Canada and Europe.

Effects of inbreeding on coastal Douglas fir growth and yield in operational plantations: a model-based approach.

PubMed

Wang, Tongli; Aitken, Sally N; Woods, Jack H; Polsson, Ken; Magnussen, Steen

2004-04-01

In advanced generation seed orchards, tradeoffs exist between genetic gain obtained by selecting the best related individuals for seed orchard populations, and potential losses due to subsequent inbreeding between these individuals. Although inbreeding depression for growth rate is strong in most forest tree species at the individual tree level, the effect of a small proportion of inbreds in seed lots on final stand yield may be less important. The effects of inbreeding on wood production of mature stands cannot be assessed empirically in the short term, thus such effects were simulated for coastal Douglas fir [ Pseudotsuga menziesii var. menziesii (Mirb.) Franco] using an individual-tree growth and yield model TASS (Tree and Stand Simulator). The simulations were based on seed set, nursery culling rates, and 10-year-old field test performance for trees resulting from crosses between unrelated individuals and for inbred trees produced through mating between half-sibs, full-sibs, parents and offspring and self-pollination. Results indicate that inclusion of a small proportion of related clones in seed orchards will have relatively low impacts on stand yields due to low probability of related individuals mating, lower probability of producing acceptable seedlings from related matings than from unrelated matings, and a greater probability of competition-induced mortality for slower growing inbred individuals than for outcrossed trees. Thus, competition reduces the losses expected due to inbreeding depression at harvest, particularly on better sites with higher planting densities and longer rotations. Slightly higher breeding values for related clones than unrelated clones would offset or exceed the effects of inbreeding resulting from related matings. Concerns regarding the maintenance of genetic diversity are more likely to limit inclusion of related clones in orchards than inbreeding depression for final stand yield.

Alfalfa seed germination and yield ratio and alfalfa sprout microbial keeping quality following irradiation of seeds and sprouts.

PubMed

Rajkowski, K T; Thayer, D W

2001-12-01

Foods can be treated with gamma radiation, a nonthermal food process, to inactivate foodborne pathogens and fungi, to kill insects on or in fruits and vegetables, and to increase shelf life. Gamma irradiation is especially well suited for these treatments because of its ability to penetrate commercial pallets of foods. Irradiated fruits, vegetables, poultry, and hamburger have been received favorably by the public and are now available in supermarkets. The use of irradiation on fresh alfalfa sprouts was studied to determine its effect on keeping quality as related to aerobic microbial load. After an irradiation dose of 2 kGy, the total aerobic count decreased from 10(5-8) to 10(3-5) CFU/g, and the total coliform counts decreased from 10(5-8) to 10(3-0) CFU/g. The results showed that the sprouts maintained their structure after irradiation, and the keeping quality was extended to 21 days, which is an increase of 10 days from the usual shelf life. The effect of various doses of irradiation on alfalfa seeds as measured by percent germination and yield ratio (wt/wt) of sprouts was determined. There was little effect on the percent germination, but as the dose increased, the yield ratio of alfalfa sprouts decreased. As the length of growing time increased, so did the yield ratio of the lower dose irradiated seeds (1 to 2 kGy). The irradiation process can be used to increase the shelf life of alfalfa sprouts, and irradiating alfalfa seeds at doses up to 2 kGy does not unacceptably decrease the yield ratio for production of alfalfa sprouts.

Response of chickpea (Cicer arietinum L.) to terminal drought: leaf stomatal conductance, pod abscisic acid concentration, and seed set.

PubMed

Pang, Jiayin; Turner, Neil C; Khan, Tanveer; Du, Yan-Lei; Xiong, Jun-Lan; Colmer, Timothy D; Devilla, Rosangela; Stefanova, Katia; Siddique, Kadambot H M

2017-04-01

Flower and pod production and seed set of chickpea (Cicer arietinum L.) are sensitive to drought stress. A 2-fold range in seed yield was found among a large number of chickpea genotypes grown at three dryland field sites in south-western Australia. Leaf water potential, photosynthetic characteristics, and reproductive development of two chickpea genotypes with contrasting yields in the field were compared when subjected to terminal drought in 106kg containers of soil in a glasshouse. The terminal drought imposed from early podding reduced biomass, reproductive growth, harvest index, and seed yield of both genotypes. Terminal drought at least doubled the percentage of flower abortion, pod abscission, and number of empty pods. Pollen viability and germination decreased when the fraction of transpirable soil water (FTSW) decreased below 0.18 (82% of the plant-available soil water had been transpired); however, at least one pollen tube in each flower reached the ovary. The young pods which developed from flowers produced when the FTSW was 0.50 had viable embryos, but contained higher abscisic acid (ABA) concentrations than those of the well-watered plants; all pods ultimately aborted in the drought treatment. Cessation of seed set at the same soil water content at which stomata began to close and ABA increased strongly suggested a role for ABA signalling in the failure to set seed either directly through abscission of developing pods or seeds or indirectly through the reduction of photosynthesis and assimilate supply to the seeds. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Integration of soil application and seed treatment formulations of Trichoderma species for management of wet root rot of mungbean caused by Rhizoctonia solani.

PubMed

Dubey, Sunil C; Bhavani, Ranganaicker; Singh, Birendra

2011-09-01

The efficacy of seed dressing and soil application formulations from the isolates of Trichoderma viride (IARI P1; MTCC 5369), T. virens (IARI P3; MTCC 5370) and T. harzianum (IARI P4; MTCC 5371) were evaluated individually and in combination in pot and field experiments during the rainy seasons of 2005, 2006 and 2007 for the management of wet root rot (Rhizoctonia solani) and improvement in the yield of mungbean. A seed dressing formulation, Pusa 5SD, and soil application formulations, Pusa Biogranule 6 (PBG 6) and Pusa Biopellet 16G (PBP 16G), based on Trichoderma virens, were found to be superior to other formulations in reducing disease incidence and increasing seed germination and shoot and root lengths in mungbean. In field experiments, a combination of soil application with PBP 16G (T. virens) and seed treatment with Pusa 5SD (T. virens) + carboxin was superior to any of these formulations individually in increasing seed germination, shoot and root lengths and grain yield and reducing wet root rot incidence in mungbean. Seed treatment was more effective than soil application for all the evaluated parameters. The combined application of Pusa 5SD and carboxin was also superior to individual treatment. The efficacy of the evaluated formulations against wet root rot of mungbean proved that the integration of soil application of PBP 16G and seed treatment with Pusa 5SD + carboxin is highly effective for the management of wet root rot, increasing plant growth and grain yield of mungbean. Copyright © 2011 Society of Chemical Industry.

Seed population dynamics on abandoned slopes in the hill and gully Loess Plateau region of China

NASA Astrophysics Data System (ADS)

Yu, Weijie; Jiao, Juying

2017-04-01

Recovery of natural vegetation is an effective but slow approach to control the soil erosion in the Chinese hill and gully Loess Plateau region. As seed stage is particularly vulnerable to environmental conditions, characteristics of seed population should be needed to study for determining whether the recovery of natural vegetation is limited during this stage on the abandoned slopes in this region. The study was performed on three abandoned slopes in a watershed with an area of 8.27 km2in the Shaanxi province of China. The differences in soil seed banks were investigated in two different points in time, late March2011 and early April 2013. Main factors of seed population dynamics, such as seed yield of dominant species, seed inputs by seed rain as well as seed outputs through seed loss by overland flow and seedling emergence, were monitored from late March 2011 to early April 2013. In this study, seed rain densities of the main later successional species, i.e., Lespedeza davurica, Stipa bungeana and Artemisia gmelinii accounted for 51.5-71.6% of their own seed yields. The soil seed bank density in early April 2013 was larger than that in late March 2011. The density of seed inputs by seed rain was 10186 seeds•m-2, and the total seed bank, including seed rain and seeds present in the soil seed bank in late March 2011, reached a density of 15018 seeds•m-2 during the study period. Seed densities of loss due to overland flow and seedling emergence were 79 seeds•m-2 from 20 species and 938 seedlings•m-2 that belonged to 38 species during a study period, and the seed output through them accounted for 0.5% and 6.3% of the total seed bank, respectively. The study concluded that overland flow could not result in large numbers of seeds loss and seeds were accumulating in the soil seed bank due to seed rain, and vegetation succession might be limited by curbed spatial seed dispersal and seedling establishment.

[Analytic methods for seed models with genotype x environment interactions].

PubMed

Zhu, J

1996-01-01

Genetic models with genotype effect (G) and genotype x environment interaction effect (GE) are proposed for analyzing generation means of seed quantitative traits in crops. The total genetic effect (G) is partitioned into seed direct genetic effect (G0), cytoplasm genetic of effect (C), and maternal plant genetic effect (Gm). Seed direct genetic effect (G0) can be further partitioned into direct additive (A) and direct dominance (D) genetic components. Maternal genetic effect (Gm) can also be partitioned into maternal additive (Am) and maternal dominance (Dm) genetic components. The total genotype x environment interaction effect (GE) can also be partitioned into direct genetic by environment interaction effect (G0E), cytoplasm genetic by environment interaction effect (CE), and maternal genetic by environment interaction effect (GmE). G0E can be partitioned into direct additive by environment interaction (AE) and direct dominance by environment interaction (DE) genetic components. GmE can also be partitioned into maternal additive by environment interaction (AmE) and maternal dominance by environment interaction (DmE) genetic components. Partitions of genetic components are listed for parent, F1, F2 and backcrosses. A set of parents, their reciprocal F1 and F2 seeds is applicable for efficient analysis of seed quantitative traits. MINQUE(0/1) method can be used for estimating variance and covariance components. Unbiased estimation for covariance components between two traits can also be obtained by the MINQUE(0/1) method. Random genetic effects in seed models are predictable by the Adjusted Unbiased Prediction (AUP) approach with MINQUE(0/1) method. The jackknife procedure is suggested for estimation of sampling variances of estimated variance and covariance components and of predicted genetic effects, which can be further used in a t-test for parameter. Unbiasedness and efficiency for estimating variance components and predicting genetic effects are tested by Monte Carlo simulations.

Strategies for soil-based precision agriculture in cotton

NASA Astrophysics Data System (ADS)

Neely, Haly L.; Morgan, Cristine L. S.; Stanislav, Scott; Rouze, Gregory; Shi, Yeyin; Thomasson, J. Alex; Valasek, John; Olsenholler, Jeff

2016-05-01

The goal of precision agriculture is to increase crop yield while maximizing the use efficiency of farm resources. In this application, UAV-based systems are presenting agricultural researchers with an opportunity to study crop response to environmental and management factors in real-time without disturbing the crop. The spatial variability soil properties, which drive crop yield and quality, cannot be changed and thus keen agronomic choices with soil variability in mind have the potential to increase profits. Additionally, measuring crop stress over time and in response to management and environmental conditions may enable agronomists and plant breeders to make more informed decisions about variety selection than the traditional end-of-season yield and quality measurements. In a previous study, seed-cotton yield was measured over 4 years and compared with soil variability as mapped by a proximal soil sensor. It was found that soil properties had a significant effect on seed-cotton yield and the effect was not consistent across years due to different precipitation conditions. However, when seed-cotton yield was compared to the normalized difference vegetation index (NDVI), as measured using a multispectral camera from a UAV, predictions improved. Further improvement was seen when soil-only pixels were removed from the analysis. On-going studies are using UAV-based data to uncover the thresholds for stress and yield potential. Long-term goals of this research include detecting stress before yield is reduced and selecting better adapted varieties.

Performance of Mentik Wangi rice (Oryza sativa, L.) M2 generation from gamma ray irradiation

NASA Astrophysics Data System (ADS)

Yunus, A.; Parjanto; Nandariyah; Wulandari, S.

2018-03-01

The objective of this research is to produce Mentik Wangi rice with shorter flowering age, shorter rice stem and high yield. This research was conducted in Palur Village, Mojolaban Sub-district, Sukoharjo District, from April to August 2016. This research used descriptive method, performed by observing each individual and comparing to the control average. Observational variables included plant height, total number of tillers, number of productive tillers, panicle length, number of grain per panicle, panicle density index, 1,000 filled seed weight, seed weight of cluster, flowering age and M2 mutant selection. The results showed that there were several plants indicated mutation, there were 7 plants indicate short stem mutation with height 85 cm to 97 cm. The plants which indicated short flowering age were 5 weeks after planting up to 6 weeks after planting. The mutated plants indicating of the highest number of productive tillers which were 27 up to 36. Each component result includes total number of tillers, number of productive tillers, number of grain of panicle as well as the weight of 1000 seeds in the plant indicated some mutation that has a high level of diversity in each treatment.

Comparison of secondary organic aerosol formation from toluene on initially wet and dry ammonium sulfate particles at moderate relative humidity

NASA Astrophysics Data System (ADS)

Liu, Tengyu; Huang, Dan Dan; Li, Zijun; Liu, Qianyun; Chan, ManNin; Chan, Chak K.

2018-04-01

The formation of secondary organic aerosol (SOA) has been widely studied in the presence of dry seed particles at low relative humidity (RH). At higher RH, initially dry seed particles can exist as wet particles due to water uptake by the seeds as well as the SOA. Here, we investigated the formation of SOA from the photooxidation of toluene using an oxidation flow reactor in the absence of NOx under a range of OH exposures on initially wet or dry ammonium sulfate (AS) seed particles at an RH of 68 %. The ratio of the SOA yield on wet AS seeds to that on dry AS seeds, the relative SOA yield, decreased from 1.31 ± 0.02 at an OH exposure of 4.66 × 1010 molecules cm-3 s to 1.01 ± 0.01 at an OH exposure of 5.28 × 1011 molecules cm-3 s. This decrease may be due to the early deliquescence of initially dry AS seeds after being coated by highly oxidized toluene-derived SOA. SOA formation lowered the deliquescence RH of AS and resulted in the uptake of water by both AS and SOA. Hence the initially dry AS seeds contained aerosol liquid water (ALW) soon after SOA formed, and the SOA yield and ALW approached those of the initially wet AS seeds as OH exposure and ALW increased, especially at high OH exposure. However, a higher oxidation state of the SOA on initially wet AS seeds than that on dry AS seeds was observed at all levels of OH exposure. The difference in mass fractions of m / z 29, 43 and 44 of SOA mass spectra, obtained using an aerosol mass spectrometer (AMS), indicated that SOA formed on initially wet seeds may be enriched in earlier-generation products containing carbonyl functional groups at low OH exposures and later-generation products containing acidic functional groups at high exposures. Our results suggest that inorganic dry seeds become at least partially deliquesced particles during SOA formation and hence that ALW is inevitably involved in the SOA formation at moderate RH. More laboratory experiments conducted with a wide variety of SOA precursors and inorganic seeds under different NOx and RH conditions are warranted.

Application of paclobutrazol affect maize grain yield by regulating root morphological and physiological characteristics under a semi-arid region.

PubMed

Kamran, Muhammad; Wennan, Su; Ahmad, Irshad; Xiangping, Meng; Wenwen, Cui; Xudong, Zhang; Siwei, Mou; Khan, Aaqil; Qingfang, Han; Tiening, Liu

2018-03-19

A field experiment was conducted to investigate the effects of paclobutrazol on ear characteristics and grain yield by regulating root growth and root-bleeding sap of maize crop. Seed-soaking at rate of 0 (CK1), 200 (S1), 300 (S2), and 400 (S3) mg L -1 , and seed-dressing at rate of 0 (CK2), 1.5 (D1), 2.5 (D2), and 3.5 (D3) g kg -1 were used. Our results showed that paclobutrazol improved the ear characteristics and grain yield, and were consistently higher than control during 2015-2016. The average grain yield of S1, S2 and S3 were 18.9%, 61.3%, and 45.9% higher, while for D1, D2 and D3 were 20.2%, 33.3%, and 45.2%, compared to CK, respectively. Moreover, paclobutrazol-treated maize had improved root-length density (RLD), root-surface area density (RSD) and root-weight density (RWD) at most of the soil profiles (0-70 cm for seed-soaking, 0-60 cm for seed-dressing) and was attributed to enhancing the grain yield. In addition, root-activity, root-bleeding sap, root dry weight, diameter and root/shoot ratio increased by paclobutrazol, with highest values achieved in S2 and D3 treatments, across the whole growth stages in 2015-2016. Our results suggested that paclobutrazol could efficiently be used to enhance root-physiological and morphological characteristics, resulting in higher grain yield.

Critical period of weed control in aerobic rice.

PubMed

Anwar, M P; Juraimi, A S; Samedani, B; Puteh, A; Man, A

2012-01-01

Critical period of weed control is the foundation of integrated weed management and, hence, can be considered the first step to design weed control strategy. To determine critical period of weed control of aerobic rice, field trials were conducted during 2010/2011 at Universiti Putra Malaysia. A quantitative series of treatments comprising two components, (a) increasing duration of weed interference and (b) increasing length of weed-free period, were imposed. Critical period was determined through Logistic and Gompertz equations. Critical period varied between seasons; in main season, it started earlier and lasted longer, as compared to off-season. The onset of the critical period was found relatively stable between seasons, while the end was more variable. Critical period was determined as 7-49 days after seeding in off-season and 7-53 days in main season to achieve 95% of weed-free yield, and 23-40 days in off-season and 21-43 days in main season to achieve 90% of weed-free yield. Since 5% yield loss level is not practical from economic view point, a 10% yield loss may be considered excellent from economic view point. Therefore, aerobic rice should be kept weed-free during 21-43 days for better yield and higher economic return.

Constitutive expression of cell wall invertase genes increases grain yield and starch content in maize.

PubMed

Li, Bei; Liu, Hua; Zhang, Yue; Kang, Tao; Zhang, Li; Tong, Jianhua; Xiao, Langtao; Zhang, Hongxia

2013-12-01

Grain size, number and starch content are important determinants of grain yield and quality. One of the most important biological processes that determine these components is the carbon partitioning during the early grain filling, which requires the function of cell wall invertase. Here, we showed the constitutive expression of cell wall invertase-encoding gene from Arabidopsis, rice (Oryza sativa) or maize (Zea mays), driven by the cauliflower mosaic virus (CaMV) 35S promoter, all increased cell wall invertase activities in different tissues and organs, including leaves and developing seeds, and substantially improved grain yield up to 145.3% in transgenic maize plants as compared to the wild-type plants, an effect that was reproduced in our 2-year field trials at different locations. The dramatically increased grain yield is due to the enlarged ears with both enhanced grain size and grain number. Constitutive expression of the invertase-encoding gene also increased total starch content up to 20% in the transgenic kernels. Our results suggest that cell wall invertase gene can be genetically engineered to improve both grain yield and grain quality in crop plants. © 2013 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

Novel Insights into the Influence of Seed Sarcotesta Photosynthesis on Accumulation of Seed Dry Matter and Oil Content in Torreya grandis cv. “Merrillii”

PubMed Central

Hu, Yuanyuan; Zhang, Yongling; Yu, Weiwu; Hänninen, Heikki; Song, Lili; Du, Xuhua; Zhang, Rui; Wu, Jiasheng

2018-01-01

Seed oil content is an important trait of nut seeds, and it is affected by the import of carbon from photosynthetic sources. Although green leaves are the main photosynthetic organs, seed sarcotesta photosynthesis also supplies assimilates to seed development. Understanding the relationship between seed photosynthesis and seed development has theoretical and practical significance in the cultivation of Torreya grandis cv. “Merrillii.” To assess the role of seed sarcotesta photosynthesis on the seed development, anatomical and physiological traits of sarcotesta were measured during two growing seasons in the field. Compared with the attached current-year leaves, the sarcotesta had higher gross photosynthetic rate at the first stage of seed development. At the late second stage of seed development, sarcotesta showed down-regulation of PSII activity, as indicated by significant decrease in the following chlorophyll fluorescence parameters: the maximum PSII efficiency (Fv/Fm), the PSII quantum yield (ΦPSII), and the photosynthetic quenching coefficient (qP). The ribulose 1, 5—bisphosphate carboxylase (Rubisco) activity, the total chlorophyll content (Chl(a+b)) and nitrogen content in the sarcotesta were also significantly decreased during that period. Treatment with DCMU [3-(3,4-dichlorophenyl)-1,1-dimethylurea] preventing seed photosynthesis decreased the seed dry weight and the oil content by 25.4 and 25.5%, respectively. We conclude that seed photosynthesis plays an important role in the dry matter accumulation at the first growth stage. Our results also suggest that down-regulation of seed photosynthesis is a plant response to re-balance the source-sink ratio at the second growth stage. These results suggest that seed photosynthesis is important for biomass accumulation and oil synthesis of the Torreya seeds. The results will facilitate achieving higher yields and oil contents in nut trees by selection for higher seed photosynthesis cultivars. PMID:29375592

Process optimisation of microwave-assisted extraction of peony ( Paeonia suffruticosa Andr .) seed oil using hexane-ethanol mixture and its characterisation

Treesearch

Xiaoli Sun; Wengang Li; Jian Li; Yuangang Zu; Chung-Yun Hse; Jiulong Xie; Xiuhua Zhao

2016-01-01

Ethanol and hexane mixture agent microwave-assisted extraction (MAE) method was conducted to extract peony (Paeonia suffruticosa Andr.) seed oil (PSO). The aim of the study was to optimise the extraction for both yield and energy consumption in mixture agent MAE. The highest oil yield (34.49%) and lowest unit energy consumption (14 125.4 J g -1)...

Experimental study of bioethanol production using mixed cassava and durian seed

NASA Astrophysics Data System (ADS)

Seer, Q. H.; Nandong, J.; Shanon, T.

2017-06-01

The production of biofuels using conventional fermentation feedstocks, such as sugar-and starch-based agricultural crops will in the long-term lead to a serious competition with human-animal food consumption. To avoid this competition, it is important to explore various alternative feedstocks especially those from inedible waste materials. Potentially, fruit wastes such as damaged fruits, peels and seeds represent alternative cheap feedstocks for biofuel production. In this work, an experimental study was conducted on ethanol production using mixed cassava and durian seeds through fermentation by Saccharomyces cerevisiae yeast. The effects of pH, temperature and ratio of hydrolyzed cassava to durian seeds on the ethanol yield, substrate consumption and product formation rates were analyzed in the study. In flask-scale fermentation using the mixed cassava-durian seeds, it was found that the highest ethanol yield of 45.9 and a final ethanol concentration of 24.92 g/L were achieved at pH 5.0, temperature 35°C and 50:50 volume ratio of hydrolyzed cassava to durian seeds for a batch period of 48 hours. Additionally, the ethanol, glucose and biomass concentration profiles in a lab-scale bioreactor were examined for the fermentation using the proposed materials under the flask-scale optimum conditions. The ethanol yield of 35.7 and a final ethanol concentration of 14.61 g/L were obtained over a period of 46 hours where the glucose was almost fully consumed. It is worth noting that both pH and temperature have significant impacts on the fermentation process using the mixed cassava-durian seeds.

Genetic architecture of cold tolerance in rice (Oryza sativa) determined through high resolution genome-wide analysis

PubMed Central

Shakiba, Ehsan; Edwards, Jeremy D.; Jodari, Farman; Duke, Sara E.; Baldo, Angela M.; Korniliev, Pavel; McCouch, Susan R.; Eizenga, Georgia C.

2017-01-01

Cold temperature is an important abiotic stress which negatively affects morphological development and seed production in rice (Oryza sativa L.). At the seedling stage, cold stress causes poor germination, seedling injury and poor stand establishment; and at the reproductive stage cold decreases seed yield. The Rice Diversity Panel 1 (RDP1) is a global collection of over 400 O. sativa accessions representing the five major subpopulations from the INDICA and JAPONICA varietal groups, with a genotypic dataset consisting of 700,000 SNP markers. The objectives of this study were to evaluate the RDP1 accessions for the complex, quantitatively inherited cold tolerance traits at the germination and reproductive stages, and to conduct genome-wide association (GWA) mapping to identify SNPs and candidate genes associated with cold stress at these stages. GWA mapping of the germination index (calculated as percent germination in cold divided by warm treatment) revealed 42 quantitative trait loci (QTLs) associated with cold tolerance at the seedling stage, including 18 in the panel as a whole, seven in temperate japonica, six in tropical japonica, 14 in JAPONICA, and nine in INDICA, with five shared across all subpopulations. Twenty-two of these QTLs co-localized with 32 previously reported cold tolerance QTLs. GWA mapping of cold tolerance at the reproductive stage detected 29 QTLs, including seven associated with percent sterility, ten with seed weight per panicle, 14 with seed weight per plant and one region overlapping for two traits. Fifteen co-localized with previously reported QTLs for cold tolerance or yield components. Candidate gene ontology searches revealed these QTLs were associated with significant enrichment for genes related to with lipid metabolism, response to stimuli, response to biotic stimuli (suggesting cross-talk between biotic and abiotic stresses), and oxygen binding. Overall the JAPONICA accessions were more tolerant to cold stress than INDICA accessions. PMID:28282385

A photorespiratory bypass increases plant growth and seed yield in biofuel crop Camelina sativa

DOE PAGES

Dalal, Jyoti; Lopez, Harry; Vasani, Naresh B.; ...

2015-10-29

Camelina sativa is an oilseed crop with great potential for biofuel production on marginal land. The seed oil from camelina has been converted to jet fuel and improved fuel efficiency in commercial and military test flights. Hydrogenation-derived renewable diesel from camelina is environmentally superior to that from canola due to lower agricultural inputs, and the seed meal is FDA approved for animal consumption. However, relatively low yield makes its farming less profitable. Our study is aimed at increasing camelina seed yield by reducing carbon loss from photorespiration via a photorespiratory bypass. Genes encoding three enzymes of the Escherichia coli glycolatemore » catabolic pathway were introduced: glycolate dehydrogenase (GDH), glyoxylate carboxyligase (GCL) and tartronic semialdehyde reductase (TSR). These enzymes compete for the photorespiratory substrate, glycolate, convert it to glycerate within the chloroplasts, and reduce photorespiration. As a by-product of the reaction, CO 2 is released in the chloroplast, which increases photosynthesis. Camelina plants were transformed with either partial bypass (GDH), or full bypass (GDH, GCL and TSR) genes. Furthermore, transgenic plants were evaluated for physiological and metabolic traits.« less

A photorespiratory bypass increases plant growth and seed yield in biofuel crop Camelina sativa

DOE Office of Scientific and Technical Information (OSTI.GOV)

Dalal, Jyoti; Lopez, Harry; Vasani, Naresh B.

Camelina sativa is an oilseed crop with great potential for biofuel production on marginal land. The seed oil from camelina has been converted to jet fuel and improved fuel efficiency in commercial and military test flights. Hydrogenation-derived renewable diesel from camelina is environmentally superior to that from canola due to lower agricultural inputs, and the seed meal is FDA approved for animal consumption. However, relatively low yield makes its farming less profitable. Our study is aimed at increasing camelina seed yield by reducing carbon loss from photorespiration via a photorespiratory bypass. Genes encoding three enzymes of the Escherichia coli glycolatemore » catabolic pathway were introduced: glycolate dehydrogenase (GDH), glyoxylate carboxyligase (GCL) and tartronic semialdehyde reductase (TSR). These enzymes compete for the photorespiratory substrate, glycolate, convert it to glycerate within the chloroplasts, and reduce photorespiration. As a by-product of the reaction, CO 2 is released in the chloroplast, which increases photosynthesis. Camelina plants were transformed with either partial bypass (GDH), or full bypass (GDH, GCL and TSR) genes. Furthermore, transgenic plants were evaluated for physiological and metabolic traits.« less

Effect of ultrasonic treatment on the polyphenol content and antioxidant capacity of extract from defatted hemp, flax and canola seed cakes.

PubMed

Teh, Sue-Siang; Birch, Edward John

2014-01-01

The effectiveness of ultrasonic extraction of phenolics and flavonoids from defatted hemp, flax and canola seed cakes was compared to the conventional extraction method. Ultrasonic treatment at room temperature showed increased polyphenol extraction yield and antioxidant capacity by two-fold over the conventional extraction method. Different combinations of ultrasonic treatment parameters consisting of solvent volume (25, 50, 75 and 100 mL), extraction time (20, 30 and 40 min) and temperature (40, 50, 60 and 70 °C) were selected for polyphenol extractions from the seed cakes. The chosen parameters had a significant effect (p<0.05) on the polyphenol extraction yield and subsequent antioxidant capacity from the seed cakes. Application of heat during ultrasonic extraction yielded higher polyphenol content in extracts compared to the non-heated extraction. From an orthogonal design test, the best combination of parameters was 50 mL of solvent volume, 20 min of extraction time and 70 °C of ultrasonic temperature. Copyright © 2013. Published by Elsevier B.V.

Effects of boron nutrition and water stress on nitrogen fixation, seed d15N and d13C daynamics, and seed composition in soybean cultivars differing in maturities

USDA-ARS?s Scientific Manuscript database

Water stress is a major abiotic stress factor, resulting in a major yield loss and poor seed quality. Little information is available on the effects of B nutrition on seed composition under water stress. Therefore, the objective of the current research was to investigate the effects of foliar B nutr...

Supercritical fluid extraction of phenolic compounds and antioxidants from grape (Vitis labrusca B.) seeds.

PubMed

Ghafoor, Kashif; Al-Juhaimi, Fahad Y; Choi, Yong Hee

2012-12-01

Supercritical fluid extraction (SFE) technique was applied and optimized for temperature, CO₂ pressure and ethanol (modifier) concentration using orthogonal array design and response surface methodology for the extract yield, total phenols and antioxidants from grape (Vitis labrusca B.) seeds. Effects of extraction temperature and pressure were found to be significant for all these response variables in SFE process. Optimum SFE conditions (44 ~ 46 °C temperature and 153 ~ 161 bar CO₂ pressure) along with ethanol (<7 %) as modifier, for the maximum predicted values of extract yield (12.09 %), total phenols (2.41 mg GAE/ml) and antioxidants (7.08 mg AAE/ml), were used to obtain extracts from grape seeds. The predicted values matched well with the experimental values (12.32 % extract yield, 2.45 mg GAE/ml total phenols and 7.08 mg AAE/ml antioxidants) obtained at optimum SFE conditions. The antiradical assay showed that SFE extracts of grape seeds can scavenge more than 85 % of 1, 1-diphenyl-2-picrylhydrazyl (DPPH) radicals. The grape seeds extracts were also analyzed for hydroxybenzoic acids which included gallic acid (1.21 ~ 3.84 μg/ml), protocatechuic acid (3.57 ~ 11.78 μg/ml) and p-hydroxybenzoic acid (206.72 ~ 688.18 μg/ml).

Identification of soybean genotypes adaptive to tropical area and suitable for industry

NASA Astrophysics Data System (ADS)

Adie, M. M.; Krisnawati, A.

2018-01-01

Soybeans in Indonesia are mostly used for raw material of tempeh industry. This study aims to identify 150 soybean genotypes for their suitability for raw materials of tempeh and adaptability to be developed in tropical area of Indonesia. The research material consisted of 150 soybean genotypes. The field research was conducted in Malang from February to May 2016, using a randomized block design with two replicates. The identification of 150 soybean genotypes showed 30.67% of super early maturity (<75 days), 50% of early maturity (76 - 79 days), and 19.33% were medium maturity (80 - 90 days). In the group of super early maturity, 11 genotypes were yielded between 3.01 - 3.69 t/ha and the 100 seed weight ranged from 15.27 - 20.18 g. In the early maturity group, there were 23 genotypes with seed yields between 3.01 - 3.66 t/ha, and the 100 seed weight ranged from 13.90 - 20.23 g. In Indonesia, tempeh industry requires soybeans with large seed size. In this research, G511H/Anj//Anj////Anjs-8-5 was suitable to be developed in Indonesia’s tropical climate and also preferred by industry for tempeh raw material due to its high yield, super early days to maturity, and large seed size.

Cold adaptation generates mutations associated with the growth of influenza B vaccine viruses.

PubMed

Kim, Hyunsuh; Velkov, Tony; Camuglia, Sarina; Rockman, Steven P; Tannock, Gregory A

2015-10-26

Seasonal inactivated influenza vaccines are usually trivalent or quadrivalent and are prepared from accredited seed viruses. Yields of influenza A seed viruses can be enhanced by gene reassortment with high-yielding donor strains, but similar approaches for influenza B seed viruses have been largely unsuccessful. For vaccine manufacture influenza B seed viruses are usually adapted for high-growth by serial passage. Influenza B antigen yields so obtained are often unpredictable and selection of influenza B seed viruses by this method can be a rate-limiting step in seasonal influenza vaccine manufacture. We recently have shown that selection of stable cold-adapted mutants from seasonal epidemic influenza B viruses is associated with improved growth. In this study, specific mutations were identified that were responsible for growth enhancement as a consequence of adaptation to growth at lower temperatures. Molecular analysis revealed that the following mutations in the HA, NP and NA genes are required for enhanced viral growth: G156/N160 in the HA, E253, G375 in the NP and T146 in the NA genes. These results demonstrate that the growth of seasonal influenza B viruses can be optimized or improved significantly by specific gene modifications. Copyright © 2015 Elsevier Ltd. All rights reserved.

[Sowing date of corn in semiarid region of Jilin Province, Northeast China in adapting to climate change].

PubMed

Jin, Ying-Hua; Zhou, Dao-Wei; Qin, Li-Jie

2012-10-01

Under the background of global climate change, the climate in semiarid region of west Jilin Province changed greatly, producing a profound impact on the corn production in this region. In this study, the corn seeds were under three treatments (accelerating germination at 10 and 25 degrees C, and dry seeds), and a field experiment with early sowing and traditional sowing was conducted in 2008 to investigate the effects of early sowing these seeds on the seedling emergence, growth, and yield, and compare the effects of early sowing and traditional sowing dates on the corn production and yield. In 1961-2010, the first day of the growth season of corn in semiarid region of west Jilin Province was advanced, the air temperature increased significantly, and the precipitation displayed a decreasing trend. At present, the corn sowing date in this region could be advanced to 11th, April. Accelerating germination at 10 degrees C, directly sowing dry seeds, and bed-irrigation sowing all benefited the seedling emergence and cold resistance of early-sown seeds, and the corn plant height and leaf area under early sowing were significantly higher, with the yield increased by 35% - 48%, compared with those under traditional sowing.

7 CFR 457.112 - Hybrid sorghum seed crop insurance provisions.

Code of Federal Regulations, 2011 CFR

2011-01-01

... seed test. Insurable interest. Your share of the financial loss that occurs in the event seed... by the price election you select and subtracting any minimum guaranteed payment, not to exceed the... value to dollars by multiplying it by the price election you selected. Approved yield. In lieu of the...

DNA fingerprinting of maize seed lots to establish genetic purity using SSR markers.

USDA-ARS?s Scientific Manuscript database

Most countries in sub-Saharan Africa (SSA) grow open pollinated maize varieties (OPVs) because seed of maize OPVs can be recycled for several seasons with minimal yield reduction due to inbreeding as compared to hybrids. However, OPVs are heterogeneous, and some local seed suppliers attempt to take ...

Multi-population selective genotyping to identify soybean (Glycine max (L.) Merr.) seed protein and oil QTLs

USDA-ARS?s Scientific Manuscript database

Plant breeders continually generate ever-higher yielding cultivars, but also want to improve seed constituent value, which in soybean [Glycine max (L.) Merr.] is seed protein and oil. Identification of genetic loci governing those two traits would facilitate that effort, and though genome-wide asso...

The transcriptome of the developing grain: a resource for understanding seed development and the molecular control of the functional and nutritional properties of wheat.

PubMed

Rangan, Parimalan; Furtado, Agnelo; Henry, Robert J

2017-10-11

Wheat is one of the three major cereals that have been domesticated to feed human populations. The composition of the wheat grain determines the functional properties of wheat including milling efficiency, bread making, and nutritional value. Transcriptome analysis of the developing wheat grain provides key insights into the molecular basis for grain development and quality. The transcriptome of 35 genotypes was analysed by RNA-Seq at two development stages (14 and 30 days-post-anthesis, dpa) corresponding to the mid stage of development (stage Z75) and the almost mature seed (stage Z85). At 14dpa, most of the transcripts were associated with the synthesis of the major seed components including storage proteins and starch. At 30dpa, a diverse range of genes were expressed at low levels with a predominance of genes associated with seed defence and stress tolerance. RNA-Seq analysis of changes in expression between 14dpa and 30dpa stages revealed 26,477 transcripts that were significantly differentially expressed at a FDR corrected p-value cut-off at ≤0.01. Functional annotation and gene ontology mapping was performed and KEGG pathway mapping allowed grouping based upon biochemical linkages. This analysis demonstrated that photosynthesis associated with the pericarp was very active at 14dpa but had ceased by 30dpa. Recently reported genes for flour yield in milling and bread quality were found to influence wheat quality largely due to expression patterns at the earlier seed development stage. This study serves as a resource providing an overview of gene expression during wheat grain development at the early (14dpa) and late (30dpa) grain filling stages for use in studies of grain quality and nutritional value and in understanding seed biology.

The Importance of Seed Characteristics in the Dispersal of Splash-Cup Plants

NASA Astrophysics Data System (ADS)

Eklof, Joel; Pepper, Rachel Pepper; Echternach, Juliana

2016-11-01

Splash-cup plants disperse their seeds by exploiting the kinetic energy of raindrops. When raindrops impact the splash-cup, a 3-5 mm vessel that holds seeds, the seeds are projected up to 1 m away from the parent plant. It has been established, using 3D printed models, that a 40°cone angle maximizes dispersal distance when seeds are not present in the cup. We therefore use 40°cups with the addition of different types of seeds to determine the effect that seeds of varying characteristics have on the dispersal and splash dynamics of splash-cup plants. Splash characteristics and dispersal distances of seeds with differing characteristics such as size, shape, texture, density, and hydrophobicity were compared to one another, as well as to the case of having no seeds present. We found that the presence of seeds dramatically decreased dispersal distance and changed splash characteristics (are measured by the angle and velocity of the resulting splash). In addition, different types of seeds yielded splashes with differing dispersal distance and splash characteristics. Splash characteristics and dispersal distances of glass beads of differing hydrophobicity were compared to determine the effect hydrophobicity has on dispersal and splash dynamics. These beads yielded some differences in dispersal distance, but no notable difference in splash dynamics. Models of the conical fruit bodies of the splash-cups were 3D printed and high-speed video was used to find splash characteristics, and dispersal distance was calculated by measuring the distance from the model to the final resting position of the seeds and droplets.

Distillation Time as Tool for Improved Antimalarial Activity and Differential Oil Composition of Cumin Seed Oil.

PubMed

Zheljazkov, Valtcho D; Gawde, Archana; Cantrell, Charles L; Astatkie, Tess; Schlegel, Vicki

2015-01-01

A steam distillation extraction kinetics experiment was conducted to estimate essential oil yield, composition, antimalarial, and antioxidant capacity of cumin (Cuminum cyminum L.) seed (fruits). Furthermore, regression models were developed to predict essential oil yield and composition for a given duration of the steam distillation time (DT). Ten DT durations were tested in this study: 5, 7.5, 15, 30, 60, 120, 240, 360, 480, and 600 min. Oil yields increased with an increase in the DT. Maximum oil yield (content, 2.3 g/100 seed), was achieved at 480 min; longer DT did not increase oil yields. The concentrations of the major oil constituents α-pinene (0.14-0.5% concentration range), β-pinene (3.7-10.3% range), γ-cymene (5-7.3% range), γ-terpinene (1.8-7.2% range), cumin aldehyde (50-66% range), α-terpinen-7-al (3.8-16% range), and β-terpinen-7-al (12-20% range) varied as a function of the DT. The concentrations of α-pinene, β-pinene, γ-cymene, γ-terpinene in the oil increased with the increase of the duration of the DT; α-pinene was highest in the oil obtained at 600 min DT, β-pinene and γ-terpinene reached maximum concentrations in the oil at 360 min DT; γ-cymene reached a maximum in the oil at 60 min DT, cumin aldehyde was high in the oils obtained at 5-60 min DT, and low in the oils obtained at 240-600 min DT, α-terpinen-7-al reached maximum in the oils obtained at 480 or 600 min DT, whereas β-terpinen-7-al reached a maximum concentration in the oil at 60 min DT. The yield of individual oil constituents (calculated from the oil yields and the concentration of a given compound at a particular DT) increased and reached a maximum at 480 or 600 min DT. The antimalarial activity of the cumin seed oil obtained during the 0-5 and at 5-7.5 min DT timeframes was twice higher than the antimalarial activity of the oils obtained at the other DT. This study opens the possibility for distinct marketing and utilization for these improved oils. The antioxidant capacity of the oil was highest in the oil obtained at 30 min DT and lowest in the oil from 360 min DT. The Michaelis-Menton and the Power nonlinear regression models developed in this study can be utilized to predict essential oil yield and composition of cumin seed at any given duration of DT and may also be useful to compare previous reports on cumin oil yield and composition. DT can be utilized to obtain cumin seed oil with improved antimalarial activity, improved antioxidant capacity, and with various compositions.

Camelina Seed Yield and Fatty Acids as Influenced by Genotype and Environment

DOE PAGES

Obour, Augustine K.; Obeng, Eric; Mohammed, Yesuf A.; ...

2017-05-05

Camelina (Camelina sativa L. Crantz) is an alternative oilseed crop with potential for fallow replacement in dryland cereal-based crop production systems in the semiarid Great Plains. The interaction between genotype and environment was investigated on camelina seed yield, oil content, and fatty acid composition across two locations in the U.S. Great Plains. Treatments were three spring camelina genotypes (cultivars Blaine Creek, Pronghorn, and Shoshone), three growing seasons (2013, 2014, and 2015) and two locations (at Hays, KS, and Moccasin, MT). Our results showed camelina grown at Hays yielded 54% less than that at Moccasin. Blaine Creek yielded 17 and 42%more » more than Pronghorn and Shoshone at Hays but yields were not different among genotypes at Moccasin. Oil content ranged from 262 g kg -1 at Hays to 359 g kg -1 at Moccasin. The proportion of polyunsaturated fatty acids (PUFAs) ranged from 51% at Hays to 55% at Moccasin, whereas monounsaturated fatty acid (MUFA) and saturated fatty acid (SFA) contents were greater at Hays. The linolenic acid content ranged from 26% when Pronghorn was planted at Hays to 35% when planted at Moccasin. In general, the variations in seed yield and fatty acid profile corresponded well with growing season precipitation and temperatures at each environment.« less

Camelina Seed Yield and Fatty Acids as Influenced by Genotype and Environment

DOE Office of Scientific and Technical Information (OSTI.GOV)

Obour, Augustine K.; Obeng, Eric; Mohammed, Yesuf A.

Camelina (Camelina sativa L. Crantz) is an alternative oilseed crop with potential for fallow replacement in dryland cereal-based crop production systems in the semiarid Great Plains. The interaction between genotype and environment was investigated on camelina seed yield, oil content, and fatty acid composition across two locations in the U.S. Great Plains. Treatments were three spring camelina genotypes (cultivars Blaine Creek, Pronghorn, and Shoshone), three growing seasons (2013, 2014, and 2015) and two locations (at Hays, KS, and Moccasin, MT). Our results showed camelina grown at Hays yielded 54% less than that at Moccasin. Blaine Creek yielded 17 and 42%more » more than Pronghorn and Shoshone at Hays but yields were not different among genotypes at Moccasin. Oil content ranged from 262 g kg -1 at Hays to 359 g kg -1 at Moccasin. The proportion of polyunsaturated fatty acids (PUFAs) ranged from 51% at Hays to 55% at Moccasin, whereas monounsaturated fatty acid (MUFA) and saturated fatty acid (SFA) contents were greater at Hays. The linolenic acid content ranged from 26% when Pronghorn was planted at Hays to 35% when planted at Moccasin. In general, the variations in seed yield and fatty acid profile corresponded well with growing season precipitation and temperatures at each environment.« less

Mathematical and statistical analysis of the effect of boron on yield parameters of wheat

DOE Office of Scientific and Technical Information (OSTI.GOV)

Rawashdeh, Hamzeh; Sala, Florin; Boldea, Marius

The main objective of this research is to investigate the effect of foliar applications of boron at different growth stages on yield and yield parameters of wheat. The contribution of boron in achieving yield parameters is described by second degree polynomial equations, with high statistical confidence (p<0.01; F theoretical < F calculated, according to ANOVA test, for Alfa = 0.05). Regression analysis, based on R{sup 2} values obtained, made it possible to evaluate the particular contribution of boron to the realization of yield parameters. This was lower for spike length (R{sup 2} = 0.812), thousand seeds weight (R{sup 2} =more » 0.850) and higher in the case of the number of spikelets (R{sup 2} = 0.936) and the number of seeds on a spike (R{sup 2} = 0.960). These results confirm that boron plays an important part in achieving the number of seeds on a spike in the case of wheat, as the contribution of this element to the process of flower fertilization is well-known. In regards to productivity elements, the contribution of macroelements to yield quantity is clear, the contribution of B alone being R{sup 2} = 0.868.« less

In vitro propagation of peanut (Arachis hypogaea L.) by shoot tip culture.

PubMed

Ozudogru, Elif Aylin; Kaya, Ergun; Lambardi, Maurizio

2013-01-01

Peanut (Arachis hypogaea L.), also known as groundnut, is the most important species of Arachis genus, originating from Brazil and Peru. Peanut seeds contain high seed oil, proteins, amino acids, and vitamin E, and are consumed worldwide as edible nut, peanut butter, or candy, and peanut oil extracted from the seeds. The meal remaining after oil extraction is also used for animal feed. However, its narrow germplasm base, together with susceptibility to diseases, pathogens, and weeds, decreases yield and seed quality and causes great economic losses annually. Hence, the optimization of efficient in vitro propagation procedures would be highly effective for peanut propagation, as it would raise yield and improve seed quality and flavor. Earlier reports on traditional micropropagation methods, based on axillary bud proliferation which guarantees the multiplication of true-to-type plants, are still limited. This chapter describes a micropropagation protocol to improve multiple shoot formation from shoot-tip explants by using AgNO(3) in combination with plant growth regulators.

The slow and fast pyrolysis of cherry seed.

PubMed

Duman, Gozde; Okutucu, Cagdas; Ucar, Suat; Stahl, Ralph; Yanik, Jale

2011-01-01

The slow and fast pyrolysis of cherry seeds (CWS) and cherry seeds shells (CSS) was studied in fixed-bed and fluidized bed reactors at different pyrolysis temperatures. The effects of reactor type and temperature on the yields and composition of products were investigated. In the case of fast pyrolysis, the maximum bio-oil yield was found to be about 44 wt% at pyrolysis temperature of 500 °C for both CWS and CSS, whereas the bio yields were of 21 and 15 wt% obtained at 500 °C from slow pyrolysis of CWS and CSS, respectively. Both temperature and reactor type affected the composition of bio-oils. The results showed that bio-oils obtained from slow pyrolysis of CWS and CSS can be used as a fuel for combustion systems in industry and the bio-oil produced from fast pyrolysis can be evaluated as a chemical feedstock. Copyright © 2010 Elsevier Ltd. All rights reserved.

Vapor Wall Deposition in Chambers: Theoretical Considerations

NASA Astrophysics Data System (ADS)

McVay, R.; Cappa, C. D.; Seinfeld, J.

2014-12-01

In order to constrain the effects of vapor wall deposition on measured secondary organic aerosol (SOA) yields in laboratory chambers, Zhang et al. (2014) varied the seed aerosol surface area in toluene oxidation and observed a clear increase in the SOA yield with increasing seed surface area. Using a coupled vapor-particle dynamics model, we examine the extent to which this increase is the result of vapor wall deposition versus kinetic limitations arising from imperfect accommodation of organic species into the particle phase. We show that a seed surface area dependence of the SOA yield is present only when condensation of vapors onto particles is kinetically limited. The existence of kinetic limitation can be predicted by comparing the characteristic timescales of gas-phase reaction, vapor wall deposition, and gas-particle equilibration. The gas-particle equilibration timescale depends on the gas-particle accommodation coefficient αp. Regardless of the extent of kinetic limitation, vapor wall deposition depresses the SOA yield from that in its absence since vapor molecules that might otherwise condense on particles deposit on the walls. To accurately extrapolate chamber-derived yields to atmospheric conditions, both vapor wall deposition and kinetic limitations must be taken into account.

Solvent Extraction and GC-MS Analysis of Sesame Seeds for Determination of Bioactive Antioxidant Fatty Acid/Fatty Oil Components.

PubMed

Qadir, Abdul; Ali, Athar; Arif, Muhammad; Al-Rohaimi, Abdulmohsen H; Singh, Satya Prakash; Ahmad, Usama; Khalid, Mohd; Kumar, Arun

2018-06-01

The seed kernels of Sesamum indicum L. (family: Pedaliaceae) were extracted with ethanol and yield of components determined by Gas Chromatography/Mass Spectrometry (GC/MS). The free radical scavenging activities of ethanolic extract against1, 1-Diphenyl-2-picrylhydrazyl (DPPH) were determined by UV spectrophotometer at 517 nm. Phytochemical screening revealed the presence of numerous bioactive compounds including steroids, phenolic, terpenoids, fatty acids and different types of ester compounds. The ethanolic extract was purified and analyzed by GC MS.The prevailing compounds found in ethanolic extract were Carvacrol (0.04%),Sesamol (0.11%), 4-Allyl-2-methoxy-phenol(0.04%),Palmitic acid (1.08%), cis-9-Hexadecenal (85.40%), Lineoleoyl chloride (0.52%), Palmitic acid β-monoglyceride (0.40%), Dihydro-aplotaxene (0.61%), Oleoyl chloride (1.11%), (+)-Sesamin (4.73%), 1,3-Benzodioxole, 5-[4-(1,3-benzodioxol-5-yloxy)tetrahydro-1 H,3 H-furo [3,4-c]furan-1-yl], [1 S-(1,3,4,6α.), (2.01%)], 6-Nitrocholest-5-en-3-yl acetate (0.22%), Ergost-5-en-3β-ol (2.35%) and 24-Propylidenecholesterol (0.16%). The presence ofsaturated and unsaturated fatty acids in ethanolicextract justifies the use of this plant to treat many ailments in folk and traditional medicine. Ethanolic extract have shown significant antioxidant activity(IC 50 120.38±2.8 µg/ml). The presence of phenolic (Sesamol), lignin (Sesamin) compounds and unsaturated fatty acids are reported as possible contributor for antioxidantactivity of seed extract. © Georg Thieme Verlag KG Stuttgart · New York.

Influence of atmospheric vapour pressure deficit on ozone responses of snap bean (Phaseolus vulgaris L.) genotypes

PubMed Central

Fiscus, Edwin L.; Booker, Fitzgerald L.; Sadok, Walid; Burkey, Kent O.

2012-01-01

Environmental conditions influence plant responses to ozone (O3), but few studies have evaluated individual factors directly. In this study, the effect of O3 at high and low atmospheric vapour pressure deficit (VPD) was evaluated in two genotypes of snap bean (Phaseolus vulgaris L.) (R123 and S156) used as O3 bioindicator plants. Plants were grown in outdoor controlled-environment chambers in charcoal-filtered air containing 0 or 60 nl l−1 O3 (12 h average) at two VPDs (1.26 and 1.96 kPa) and sampled for biomass, leaf area, daily water loss, and seed yield. VPD clearly influenced O3 effects. At low VPD, O3 reduced biomass, leaf area, and seed yield substantially in both genotypes, while at high VPD, O3 had no significant effect on these components. In clean air, high VPD reduced biomass and yield by similar fractions in both genotypes compared with low VPD. Data suggest that a stomatal response to VPD per se may be lacking in both genotypes and it is hypothesized that the high VPD resulted in unsustainable transpiration and water deficits that resulted in reduced growth and yield. High VPD- and water-stress-induced stomatal responses may have reduced the O3 flux into the leaves, which contributed to a higher yield compared to the low VPD treatment in both genotypes. At low VPD, transpiration increased in the O3 treatment relative to the clean air treatment, suggesting that whole-plant conductance was increased by O3 exposure. Ozone-related biomass reductions at low VPD were proportionally higher in S156 than in R123, indicating that differential O3 sensitivity of these bioindicator plants remained evident when environmental conditions were conducive for O3 effects. Assessments of potential O3 impacts on vegetation should incorporate interacting factors such as VPD. PMID:22268148

Yellow jackets may be an underestimated component of an ant-seed mutualism

USGS Publications Warehouse

Bale, M.T.; Zettler, J.A.; Robinson, B.A.; Spira, T.P.; Allen, Craig R.

2003-01-01

Yellow jackets (Hymenoptera: Vespidae) are attracted to the typically ant-dispersed seeds of trilliums and will take seeds from ants in the genus Aphaenogaster. To determine if yellow jacket, Vespula maculifrons (Buysson), presence interferes with seed foraging by ants, we presented seeds of Trillium discolor Wray to three species (A. texana carolinensis Wheeler, Formica schaufussi Mayr, and Solenopsis invicta Buren) of seed-carrying ants in areas where vespids were present or excluded. We found that interspecific aggression between yellow jackets and ants is species specific. Vespid presence decreased average foraging time and increased foraging efficiency of two of the three ant species studied, a situation that might reflect competition for a limited food source. We also found that yellow jackets removed more seeds than ants, suggestive that vespids are important, albeit underestimated, components of ant-seed mutualisms.

Yield and financial performance estimates of four elite loblolly pine seed sources planted in the Western Gulf Region

Treesearch

Michael A. Blazier; A. Gordon Holley

2015-01-01

Eastern seed sources of loblolly pine (Pinus taeda L.) have been planted in the Western Gulf region for nearly three decades because they often have higher growth rates than local seed sources. However, productivity gains for eastern families are sometimes offset by poorer survival rates relative to local families.

Study of optimal extraction conditions for achieving high yield and antioxidant activity of tomato seed oil

USDA-ARS?s Scientific Manuscript database

Tomato seeds resulting from tomato processing by-product have not been effectively utilized as value-added products. This study investigated the kinetics of oil extraction from tomato seeds and sought to optimize the oil extraction conditions. The oil was extracted by using hexane as solvent for 0 t...

Are seed and cone pathogens causing significant losses in Pacific Northwest seed orchards?

Treesearch

E.E. Nelson; W.G. Thies; C.Y. Li

1986-01-01

Cones systematically collected in 1983 from eight Douglas-fir seed orchards in western Washington and Oregon yielded large numbers of common molds. Fungi isolated from apparently healthy, developing cones were similar to those from necrotic cones. Necrosis in cones aborted in early stages of development was apparently not associated with pathogenic fungi or bacteria....

Effect of treated tannery effluent with domestic wastewater and amendments on growth and yield of cotton.

PubMed

Jagathjothi, N; Amanullah, M Mohamed; Muthukrishnan, P

2013-11-15

Pot culture and field experiments were carried out at the Common Effluent Treatment Plant (CETP), Dindigul during kharif 2011-12 to investigate the influence of irrigation of treated tannery effluent along with domestic wastewater on growth, yield attributes and yield of cotton. The pot culture was in a factorial completely randomized design and field experiment laid out in factorial randomized block design with four replications. The results revealed that the mixing proportion of 25% Treated Tannery Effluent (TTE)+75% domestic wastewater (DWW) application recorded taller plants, higher dry matter production, number of sympodial branches plant(-1), number of fruiting points plant(-1), number of bolls plant(-1) and seed cotton yield with yield reduction of 15.28 and 16.11% compared to normal water irrigation under pot culture and field experiment, respectively. Regarding amendments, gypsum application registered higher seed cotton yield followed by VAM.

Experimental Studies of the Formation/Deposition of Sodium Sulfate in/from Combustion Gases. [hot corrosion in gas turbine engines

NASA Technical Reports Server (NTRS)

Rosner, D. E.

1978-01-01

Processes related to the hot corrosion of gas turbine components were examined in two separate investigations. Monochromatic laser light was used to probe condensation onset and condensate film growth (via interference of reflected light) on electrically heated ribbons immersed in seeded, flat flame combustion product gases. Boron trichloride is used as the seed gas in these preliminary experiments conducted to obtain precise measurements of the dew point/deposition rates. Because of the importance of gaseous Na(g) as a precursor to NaSO4 formation, the kinetics and mechanisms of the heterogeneous reaction H(g) + NaCl(s) yields Na(g) + HCl(g) was studied using atomic absorption spectroscopy combined with microwave discharge-vacuum flow reactor techniques at moderate temperatures. Preliminary results indicate the H-atom attack of solid NaCl vaporization is negligible; hence the corresponding gas phase (homogeneous) reaction no role in the observed Na(g) production.

Influence of Harvest Aid Herbicides on Seed Germination, Seedling Vigor and Milling Quality Traits of Red Lentil (Lens culinaris L.).

PubMed

Subedi, Maya; Willenborg, Christian J; Vandenberg, Albert

2017-01-01

Most red lentil produced worldwide is consumed in dehulled form, and post-harvest milling and splitting qualities are major concerns in the secondary processing industry. Lentil producers in northern temperate regions usually apply pre-harvest desiccants as harvest aids to accelerate the lentil crop drying process and facilitate harvesting operations. This paper reports on field studies conducted at Scott and Saskatoon, Saskatchewan, Canada in the 2012 and 2013 cropping seasons to evaluate whether herbicides applied as harvest aids alone or tank mixed with glyphosate affect seed germination, seedling vigor, milling, and splitting qualities. The site-year by desiccant treatment interaction for seed germination, vigor, and milling recovery yields was significant. Glyphosate applied alone or as tank mix with other herbicides (except diquat) reduced seed germination and seedling vigor at Saskatoon and Scott in 2012 only. Pyraflufen-ethyl (20 g ai ha -1 ) applied with glyphosate as well as saflufenacil (36 g ai ha -1 ) decreased dehulling efficiency, while saflufenacil and/or glufosinate with glyphosate reduced milling recovery and football recovery, although these effects were inconsistent. Application of diquat alone or in combination with glyphosate exhibited more consistent dehulling efficiency gains and increases in milling recovery yield. Significant but negative associations were observed between glyphosate residue in seeds and seed germination ( r = -0.84, p < 0.001), seed vigor ( r = -0.62, p < 0.001), dehulling efficiency ( r = -0.55, p < 0.001), and milling recovery ( r = -0.62, p < 0.001). These results indicate application of diquat alone or in combination with glyphosate may be a preferred option for lentil growers to improve milling recovery yield.

Influence of Harvest Aid Herbicides on Seed Germination, Seedling Vigor and Milling Quality Traits of Red Lentil (Lens culinaris L.)

PubMed Central

Subedi, Maya; Willenborg, Christian J.; Vandenberg, Albert

2017-01-01

Most red lentil produced worldwide is consumed in dehulled form, and post-harvest milling and splitting qualities are major concerns in the secondary processing industry. Lentil producers in northern temperate regions usually apply pre-harvest desiccants as harvest aids to accelerate the lentil crop drying process and facilitate harvesting operations. This paper reports on field studies conducted at Scott and Saskatoon, Saskatchewan, Canada in the 2012 and 2013 cropping seasons to evaluate whether herbicides applied as harvest aids alone or tank mixed with glyphosate affect seed germination, seedling vigor, milling, and splitting qualities. The site-year by desiccant treatment interaction for seed germination, vigor, and milling recovery yields was significant. Glyphosate applied alone or as tank mix with other herbicides (except diquat) reduced seed germination and seedling vigor at Saskatoon and Scott in 2012 only. Pyraflufen-ethyl (20 g ai ha−1) applied with glyphosate as well as saflufenacil (36 g ai ha−1) decreased dehulling efficiency, while saflufenacil and/or glufosinate with glyphosate reduced milling recovery and football recovery, although these effects were inconsistent. Application of diquat alone or in combination with glyphosate exhibited more consistent dehulling efficiency gains and increases in milling recovery yield. Significant but negative associations were observed between glyphosate residue in seeds and seed germination (r = −0.84, p < 0.001), seed vigor (r = −0.62, p < 0.001), dehulling efficiency (r = −0.55, p < 0.001), and milling recovery (r = −0.62, p < 0.001). These results indicate application of diquat alone or in combination with glyphosate may be a preferred option for lentil growers to improve milling recovery yield. PMID:28352275

Synchronicity of pollination and inoculation with Claviceps africana and its effects on pollen-pistil compatibility and seed production in sorghum.

PubMed

Cisneros-López, Ma Eugenia; Mendoza-Onofre, Leopoldo E; González-Hernández, Víctor A; Zavaleta-Mancera, H Araceli; Mora-Aguilera, Gustavo; Hernández-Martínez, Miguel; Córdova-Téllez, Leobigildo

2010-04-01

Sorghum ergot (caused by Claviceps africana) is a disease that affects sorghum seed development and yield. The interaction between pollen tube growth and hyphal development determines whether ovaries will be fertilized or colonized. Thus their respective deposition times on the stigma are critical. The effect of the time interval between pollination and inoculation on stigma receptivity and seed production was measured under field conditions in the male-sterile line A9 at Montecillo, State of México (2240m altitude). Pollination and inoculation treatments, from simultaneous application to 2 and 4h difference, were imposed when all stigmas on the panicle had emerged. Control panicles were either only pollinated or only inoculated. Eighteen hours later, pollen grains that adhered to, and germinated within the stigma, pollen tubes in the style and ovary, and fertilized pistils were counted. Pistils showing some disease expression (germinated spores, mycelium growth, or tissue necrosis) at 18, 48, and 72h were recorded. The number of diseased florets was registered at the dough growth stage, while number of seeds, grain yield and 100-seeds weight was measured at the physiological maturity. The pathogen applied in a water suspension of macro and secondary conidia caused a decrease in stigma receptivity; the greatest decrease (40-60%) occurred when the pollen and the inoculum were deposited almost simultaneously, regardless of which was deposited first. The route of the pollen tube was also the route for fungal infection. On average, treatments first inoculated had 60% more diseased florets and 36% less grain yield, 30% fewer seeds and seed size decreased 8%, than those first pollinated. Copyright © 2010 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

Organic cultivation of Ashwagandha with improved biomass and high content of active Withanolides: Use of Vermicompost

PubMed Central

Kaur, Amandeep; Singh, Baldev; Ohri, Puja; Wang, Jia; Wadhwa, Renu; Pati, Pratap Kumar; Kaur, Arvinder

2018-01-01

Withania somnifera (Ashwagandha) has recently been studied extensively for its health-supplementing and therapeutic activities against a variety of ailments. Several independent studies have experimentally demonstrated pharmaceutical potential of its active Withanolides, Withaferin A (Wi-A), Withanone (Wi-N) and Withanolide A (Wil-A). However, to promote its use in herbal industry, an environmentally sustainable cultivation and high yield are warranted. In modern agriculture strategies, there has been indiscriminate use of chemical fertilizers to boost the crop-yield, however the practice largely ignored its adverse effect on the quality of soil and the environment. In view of these, we attempted to recruit Vermicompost (Vcom, 20–100%) as an organic fertilizer of choice during the sowing and growing phases of Ashwagandha plants. We report that (i) pre-soaking of seeds for 12 h in Vermicompost leachate (Vcom-L) and Vermicompost tea (Vcom-T) led to higher germination, (ii) binary combination of pre-soaking of seeds and cultivation in Vcom (up to 80%) resulted in further improvement both in germination and seedling growth, (iii) cultivated plants in the presence of Vcom+Vcom-L showed higher leaf and root mass, earlier onset of flowering and fruiting and (iv) leaves from the Vcom+Vcom-L cultivated plants showed higher level of active Withanolides, Withanone (Wi-N), Withanolide A (Wil-A) and Withaferin A (Wi-A) and showed anticancer activities in cell culture assays. Taken together, we report a simple and inexpensive method for improving the yield and pharmaceutical components of Ashwagandha leaves. PMID:29659590

Organic cultivation of Ashwagandha with improved biomass and high content of active Withanolides: Use of Vermicompost.

PubMed

Kaur, Amandeep; Singh, Baldev; Ohri, Puja; Wang, Jia; Wadhwa, Renu; Kaul, Sunil C; Pati, Pratap Kumar; Kaur, Arvinder

2018-01-01

Withania somnifera (Ashwagandha) has recently been studied extensively for its health-supplementing and therapeutic activities against a variety of ailments. Several independent studies have experimentally demonstrated pharmaceutical potential of its active Withanolides, Withaferin A (Wi-A), Withanone (Wi-N) and Withanolide A (Wil-A). However, to promote its use in herbal industry, an environmentally sustainable cultivation and high yield are warranted. In modern agriculture strategies, there has been indiscriminate use of chemical fertilizers to boost the crop-yield, however the practice largely ignored its adverse effect on the quality of soil and the environment. In view of these, we attempted to recruit Vermicompost (Vcom, 20-100%) as an organic fertilizer of choice during the sowing and growing phases of Ashwagandha plants. We report that (i) pre-soaking of seeds for 12 h in Vermicompost leachate (Vcom-L) and Vermicompost tea (Vcom-T) led to higher germination, (ii) binary combination of pre-soaking of seeds and cultivation in Vcom (up to 80%) resulted in further improvement both in germination and seedling growth, (iii) cultivated plants in the presence of Vcom+Vcom-L showed higher leaf and root mass, earlier onset of flowering and fruiting and (iv) leaves from the Vcom+Vcom-L cultivated plants showed higher level of active Withanolides, Withanone (Wi-N), Withanolide A (Wil-A) and Withaferin A (Wi-A) and showed anticancer activities in cell culture assays. Taken together, we report a simple and inexpensive method for improving the yield and pharmaceutical components of Ashwagandha leaves.

Effect of Sowing Quantity on Soil Temperature and Yield of Winter Wheat under Straw Strip Mulching in Arid Region of Northwest China

NASA Astrophysics Data System (ADS)

Lan, Xuemei; Chai, Yuwei; Li, Rui; Li, Bowen; Cheng, Hongbo; Chang, Lei; Chai, Shouxi

2018-01-01

In order to explore the characteristics and relationship between soil temperature and yield of winter wheat, under different sowing quantities conditions of straw mulching conventional drilling in Northwest China, this study took Lantian 26 as material, under the whole corn mulching conventional drilling in Changhe town and Pingxiang town, setting up 3 different seeding quantities of 270 kg/ha (SSMC1), 324 kg/ha (SSMC2) and 405 kg/ha (SSMC3), to study the difference of soil temperature during the growth period of winter wheat and its correlation with yield components. Results showed: the average soil temperature of 0∼25cm in two ecological zones in the whole growth period have a significant change with the increase of sowing quantities; too much seeding had a sharp drop in soil temperature; the highest temperature of SSMC in Changhe town was the middle quantity of SSMC 2; the highest temperature of SSMC in Pingxiang town was the lowest sowing quantity of SSMC1. Diurnal variation of soil temperature at all growth stages showed: with the increase of SSMC, in the morning it increased with the increase of soil depth, noon and evening reducing with the depth of the soil. The average soil temperature of SSMC2 was higher than that of in all the two ecological zones in the whole growth period of SSMC.The maximum day temperature difference of each treatment was at noon. With the increase of SSMC, the yield increase varied with two ecological zones. SSMC of the local conventional sowing quantity of 270kg/ha SSMC1 yield was the highest in Changhe Town. SSMC of the middle sowing quantity SSMC2 of 324kg/ha yield was the highest in Pingxiang town. The difference of grain number per spike was the main cause of yield difference among these 3 treatments. Correlation analysis showed: the correlation among the yield and yield components, growth index and soil temperature varied with different ecological zones; thousand kernel weight and grain number per ear (.964** and.891**) had a very significant positive correlation with the yields in Changhe Town, but thousand kernel weight and grain number per ear (.708* and.718*) had a significant positive correlation with yield in Pingxiang Town. There was a significant positive correlation between harvest index and 10cm soil temperature (.763*). But in Pingxiang Town grain number per ear and 15cm soil temperature showed a significant positive correlation (.671*); 15cm soil temperature and the average temperature of 0∼25cm soil layer in the whole growth period (-.687* and -.698*) had a significant negative correlation with the number of panicles per unit area; there was a very significant negative correlation between plant height and average temperature of 0∼25cm in the whole growth period (-.906**). Thus, the changes of soil temperature under SSMC different sowing quantity have indirect effect on the yield of winter wheat.

A comparative study on composition and antioxidant activities of supercritical carbon dioxide, hexane and ethanol extracts from blackberry (Rubus fruticosus) growing in Poland.

PubMed

Wajs-Bonikowska, Anna; Stobiecka, Agnieszka; Bonikowski, Radosław; Krajewska, Agnieszka; Sikora, Magdalena; Kula, Józef

2017-08-01

Large quantities of blackberry seeds are produced as a pomace during the processing of juice and jam production; this by-product is a very interesting raw material both for oil manufacturing and as a source of bioactive compounds. In this work the composition, yield and antioxidant activity of three types of Rubus fructicosus pomace extracts isolated by liquid extraction using solvents of different polarity, as well with supercritical CO 2 fluid extraction have been compared. The highest extract yield was reported for Soxhlet extraction using ethanol as a solvent (14.2%). Supercritical carbon dioxide and hexane extracts were characterised by the highest content of phytosterols (1445 and 1583 mg 100 g -1 of extract, respectively) among which β-sitosterol was the main one, while the concentration of tocopherols, with predominant γ-isomer, was the highest for both hexane and ethanol extracts, being 2364 and 2334 mg 100 g -1 , respectively. Using a GC-MS method 95 volatiles, in which non-saturated aldehydes were predominant, were identified in the essential oil of seed pomace and in the volatile oil isolated from supercritical extract. The ethanolic extract which is characterised by the highest phenolic content (9443 mg GAE 100 g -1 ) exhibited the highest antioxidant activity (according to the ABTS •+ and DPPH • assays). All pomace extracts examined were of high quality, rich in essential omega fatty acids and with a very high content of bioactive compounds, such as phytosterols and tocopherols. The high nutritional value of extracts from berry seed pomace could justify the commercialisation of specific extracts not only as food additives but also as cosmetic components. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Improving panicle exsertion of rice cytoplasmic male sterile line by combination of artificial microRNA and artificial target mimic.

PubMed

Chen, Hao; Jiang, Shan; Zheng, Jie; Lin, Yongjun

2013-04-01

The adoption of hybrid rice caused the second leap in rice yield after the 'green revolution' and contributes substantially to food security of China and the world. However, almost all cytoplasmic male sterile lines (A lines) as females of hybrid rice have a natural deficiency of 'panicle enclosure', which blocks pollination between the A line and the fertility restorer line as the male (R line) of hybrid rice and decreases seed yield. In hybrid rice seed production, exogenous '920' (the active ingredient is gibberellin A3 ) must be applied to eliminate or alleviate panicle enclosure of the A line; however, this not only increases production cost and pollutes the environment, it also decreases seed quality. In this study, we designed a transgenic approach to improve plant height and panicle exsertion of the A line to facilitate hybrid rice production and maintain the semi-dwarf plant type of the hybrid. This approach comprising two components-artificial microRNA (amiRNA) and artificial target mimicry-can manipulate the differential expression of the endogenous Eui1 gene that is associated with rice internode elongation in the A line and the hybrid. amiRNA is a recently developed gene silencing method with high specificity, while target mimicry is a natural mechanism inhibiting the miRNA function that was also recently characterized. This approach provides a paradigm to tune the expression of endogenous genes to achieve the desired phenotype by combining amiRNA and artificial target mimicry technologies. © 2012 The Authors Plant Biotechnology Journal © 2012 Society for Experimental Biology, Association of Applied Biologists and Blackwell Publishing Ltd.

Fall rice straw management and winter flooding treatment effects on a subsequent soybean crop

USGS Publications Warehouse

Anders, M.M.; Windham, T.E.; McNew, R.W.; Reinecke, K.J.

2005-01-01

The effects of fall rice (Oryza sativa L.) straw management and winter flooding on the yield and profitability of subsequent irrigated and dryland soybean [Glycine max (L.) Merr.] crops were studied for 3 years. Rice straw treatments consisted of disking, rolling, or standing stubble. Winter flooding treatments consisted of maintaining a minimum water depth of 10 cm by pumping water when necessary, impounding available rainfall, and draining fields to prevent flooding. The following soybean crop was managed as a conventional-tillage system or no-till system. Tillage system treatments were further divided into irrigated or dryland. Results indicated that there were no significant effects from either fall rice straw management or winter flooding treatments on soybean seed yields. Soybean seed yields for, the conventional tillage system were significantly greater than those for the no-till system for the first 2 yrs and not different in the third year. Irrigated soybean seed yields were significantly greater than those from dryland plots for all years. Net economic returns averaged over the 3 yrs were greatest ($390.00 ha-1) from the irrigated no-till system.

High-NOx Photooxidation of n-Dodecane: Temperature Dependence of SOA Formation.

PubMed

Lamkaddam, Houssni; Gratien, Aline; Pangui, Edouard; Cazaunau, Mathieu; Picquet-Varrault, Bénédicte; Doussin, Jean-François

2017-01-03

The temperature and concentration dependence of secondary organic aerosol (SOA) yields has been investigated for the first time for the photooxidation of n-dodecane (C 12 H 26 ) in the presence of NO x in the CESAM chamber (French acronym for "Chamber for Atmospheric Multiphase Experimental Simulation"). Experiments were performed with and without seed aerosol between 283 and 304.5 K. In order to quantify the SOA yields, a new parametrization is proposed to account for organic vapor loss to the chamber walls. Deposition processes were found to impact the aerosol yields by a factor from 1.3 to 1.8 between the lowest and the highest value. As with other photooxidation systems, experiments performed without seed and at low concentration of oxidant showed a lower SOA yield than other seeded experiments. Temperature did not significantly influence SOA formation in this study. This unforeseen behavior indicates that the SOA is dominated by sufficiently low volatility products for which a change in their partitioning due to temperature would not significantly affect the condensed quantities.

Seed oil extraction from red prickly pear using hexane and supercritical CO2 : assessment of phenolic compound composition, antioxidant and antibacterial activities.

PubMed

Koubaa, Mohamed; Mhemdi, Houcine; Barba, Francisco J; Angelotti, Armel; Bouaziz, Fatma; Chaabouni, Semia Ellouz; Vorobiev, Eugène

2017-01-01

Investigating Opuntia species for their seed oil content is of much importance owing to their potential use for food and in cosmetic applications. These oils have an important content in unsaturated fatty acids as well as antioxidant compounds (e.g. polyphenols, vitamin E), which have been associated with the prevention of some chronic diseases. Moreover, Opuntia stricta oils possess important antimicrobial activities. For instance, the main focus of this study was to compare the effectiveness of conventional (hexane extraction) and novel (supercritical (SC)-CO 2 ) extraction methods for the recovery of oil and phenolic compounds from O. stricta seeds. The oil yield of both extracts was then compared and the polyphenol content and composition of both extracts were determined by liquid chromatography-high-resolution mass spectrometry. Additionally, antioxidant (DPPH assay) and antimicrobial activities (disc diffusion method) of O. stricta seed oils were determined. The oil yield (based on Soxhlet's method) of O. stricta seeds was determined using SC-CO 2 (49.9 ± 2.2%), and hexane (49.0 ± 1.5%). Although obtaining similar oil extraction yields using the two methods, the extracted oil using SC-CO 2 was more enriched in polyphenols (172.2 ± 11.9 µg gallic acid equivalents (GAE) g -1 oil) than that extracted using hexane (76.0 ± 6.9 µg GAE g -1 of oil). Polyphenol profiles showed that the SC-CO 2 process led to the yield of more compounds (45) than that using hexane extraction (11). Moreover, the antioxidant and antimicrobial activities of SC-CO 2 extract showed a high percentage of inhibition. SC-CO 2 extraction of O. stricta seed oil led to extraction of oil with a similar yield to that with hexane extraction, but with higher polyphenol content. The extract containing polyphenols exhibited high antioxidant and antibacterial properties, demonstrating their great potential as feedstock for high-oil quality. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Repeated quick hot-and-chilling treatments for the inactivation of Escherichia coli O157:H7 in mung bean and radish seeds.

PubMed

Bari, Md Latiful; Sugiyama, Jun; Kawamoto, Shinnichi

2009-01-01

The majority of the seed sprout-related outbreaks have been associated with Escherichia coli O157:H7. Therefore, it is necessary to find an effective method to inactivate these organisms on the seeds prior to sprouting. This study was conducted to assess the effectiveness of repeated quick hot-and-chilling treatments with various chemicals to inactivate E. coli O157:H7 populations inoculated onto mung bean and radish seeds intended for sprout production and to determine the effect of these treatments on seed germination. The treatment time was 20 sec for quick hot and 20 sec for quick chilling in one repeat. Likewise up to five repeats were done throughout the experiments. The chemicals used for this study were electrolyzed acidic (EO) water, phytic acid (0.05%), oxalic acid (3%), surfcera(R), and alpha-torino water(R), and distilled water was used as control. The quick hot treatment was done with 75 degrees C, 70 degrees C, and 60 degrees C, and the chilling temperature was 0 degrees C. The treated seeds were then assessed for the efficacy of this treatment in reducing populations of the pathogens and the effects of repeated quick hot-and-chilling treatments on germination yield. It was found that repeating treatment at 75 degrees C for two or three repeats with phytic acid and oxalic acid could reduce 4.38-log colony-forming unit (CFU)/g of E. coli O157:H7 in mung bean seeds. EO water and distilled water were found equally effective at 75 degrees C for four or five repeats to inactivate E. coli O157:H7 in mung bean seeds. However, alpha-torino water(R) and surfcera(R) were not found effective in comparison to other sanitizers used in this experiment. Irrespective of sanitizer used, the germination yield of the mung bean seed was not affected significantly. On the other hand, distilled water, EO water, and alpha-torino water(R) at 75 degrees C for five repeats were found effective in reducing 5.80-log CFU/g of E. coli O157:H7 in radish seeds; however, the germination yield of the seed was affected significantly. Therefore, repeated quick hot-and-chilling treatments could be useful to decontaminate mung bean seeds intended for sprout production.

Production of high levels of poly-3-hydroxybutyrate in plastids of Camelina sativa seeds.

PubMed

Malik, Meghna R; Yang, Wenyu; Patterson, Nii; Tang, Jihong; Wellinghoff, Rachel L; Preuss, Mary L; Burkitt, Claire; Sharma, Nirmala; Ji, Yuanyuan; Jez, Joseph M; Peoples, Oliver P; Jaworski, Jan G; Cahoon, Edgar B; Snell, Kristi D

2015-06-01

Poly-3-hydroxybutyrate (PHB) production in plastids of Camelina sativa seeds was investigated by comparing levels of polymer produced upon transformation of plants with five different binary vectors containing combinations of five seed-specific promoters for expression of transgenes. Genes encoding PHB biosynthetic enzymes were modified at the N-terminus to encode a plastid targeting signal. PHB levels of up to 15% of the mature seed weight were measured in single sacrificed T1 seeds with a genetic construct containing the oleosin and glycinin promoters. A more detailed analysis of the PHB production potential of two of the best performing binary vectors in a Camelina line bred for larger seed size yielded lines containing up to 15% polymer in mature T2 seeds. Transmission electron microscopy showed the presence of distinct granules of PHB in the seeds. PHB production had varying effects on germination, emergence and survival of seedlings. Once true leaves formed, plants grew normally and were able to set seeds. PHB synthesis lowered the total oil but not the protein content of engineered seeds. A change in the oil fatty acid profile was also observed. High molecular weight polymer was produced with weight-averaged molecular weights varying between 600 000 and 1 500 000, depending on the line. Select lines were advanced to later generations yielding a line with 13.7% PHB in T4 seeds. The levels of polymer produced in this study are the highest reported to date in a seed and are an important step forward for commercializing an oilseed-based platform for PHB production. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

Vernonia galamensis, potential new crop source of epoxy acid

DOE Office of Scientific and Technical Information (OSTI.GOV)

Perdue, R.E. Jr.; Carlson, K.D.; Gilbert, M.G.

Vernonia galamensis is a good source of seed oil rich in epoxy acid, which can be used to manufacture plastic formulations, protective coatings, and other products. Seed from a natural stand in Ethiopia contained 31% epoxy acid. Under cultivation in Kenya, this unimproved germ plasm produced a substantial yield of seed with 32% epoxy acid. This African species has good natural seed retention and is a promising new crop for semiarid tropical areas. 11 references.

Insecticide use in hybrid onion seed production affects pre- and postpollination processes.

PubMed

Gillespie, Sandra; Long, Rachael; Seitz, Nicola; Williams, Neal

2014-02-01

Research on threats to pollination service in agro-ecosystems has focused primarily on the negative impacts of land use change and agricultural practices such as insecticide use on pollinator populations. Insecticide use could also affect the pollination process, through nonlethal impacts on pollinator attraction and postpollination processes such as pollen viability or pollen tube growth. Hybrid onion seed (Allium cepa L., Alliaceae) is an important pollinator-dependent crop that has suffered yield declines in California, concurrent with increased insecticide use. Field studies suggest that insecticide use reduces pollination service in this system. We conducted a field experiment manipulating insecticide use to examine the impacts of insecticides on 1) pollinator attraction, 2) pollen/stigma interactions, and 3) seed set and seed quality. Select insecticides had negative impacts on pollinator attraction and pollen/stigma interactions, with certain products dramatically reducing pollen germination and pollen tube growth. Decreased pollen germination was not associated with reduced seed set; however, reduced pollinator attraction was associated with lower seed set and seed quality, for one of the two female lines examined. Our results highlight the importance of pesticide effects on the pollination process. Overuse may lead to yield reductions through impacts on pollinator behavior and postpollination processes. Overall, in hybrid onion seed production, moderation in insecticide use is advised when controlling onion thrips, Thrips tabaci, on commercial fields.

Optimization for ultrasound-assisted extraction of polysaccharides with chemical composition and antioxidant activity from the Artemisia sphaerocephala Krasch seeds.

PubMed

Zheng, Quan; Ren, Daoyuan; Yang, Nana; Yang, Xingbin

2016-10-01

Artemisia sphaerocephala Krasch seeds polysaccharides have been reported to have a variety of important biological activities. However, effective extraction of Artemisia sphaerocephala Krasch seeds polysaccharides is still an unsolved issue. In this study, the orthogonal rotatable central composite design was employed to optimize ultrasound-assisted extraction conditions of Artemisia sphaerocephala Krasch seeds polysaccharides. Based on a single-factor analysis method, ultrasonic power, extraction time, solid-liquid ratio and extraction temperature were shown to significantly affect the yield of polysaccharides extracted from the A. sphaerocephala Krasch seeds. The optimal conditions for extraction of Artemisia sphaerocephala Krasch seeds polysaccharides were determined as following: ultrasonic power 243W, extraction time 125min, solid-liquid ratio 64:1 and extraction temperature 64°C, where the experimental yield was 14.78%, which was well matched with the predicted value of 14.81%. Furthermore, ASKP was identified as a typical heteropolysaccharide with d-galacturonic acid (38.8%) d-galactose (20.2%) and d-xylose (15.5%) being the main constitutive monosaccharides. Moreover, Artemisia sphaerocephala Krasch seeds polysaccharides exhibited high total reducing power and considerable scavenging activities on DPPH, hydroxyl and superoxide radicals, in a concentration-dependent manner in vitro. Copyright © 2016 Elsevier B.V. All rights reserved.

Engineering salt-tolerant Brassica plants: characterization of yield and seed oil quality in transgenic plants with increased vacuolar sodium accumulation.

PubMed

Zhang, H X; Hodson, J N; Williams, J P; Blumwald, E

2001-10-23

Transgenic Brassica napus plants overexpressing AtNHX1, a vacuolar Na(+)/H(+) antiport from Arabidopsis thaliana, were able to grow, flower, and produce seeds in the presence of 200 mM sodium chloride. Although the transgenic plants grown in high salinity accumulated sodium up to 6% of their dry weight, growth of the these plants was only marginally affected by the high salt concentration. Moreover, seed yields and the seed oil quality were not affected by the high salinity of the soil. Our results demonstrate the potential use of these transgenic plants for agricultural use in saline soils. Our findings, showing that the modification of a single trait significantly improved the salinity tolerance of this crop plant, suggest that with a combination of breeding and transgenic plants it could be possible to produce salt-tolerant crops with far fewer target traits than had been anticipated.

Comparison of Enzymatic and Ultrasonic Extraction of Albumin from Defatted Pumpkin (Cucurbita pepo)
Seed Powder

PubMed Central

Tu, Gia Loi; Bui, Thi Hoang Nga; Tran, Thi Thu Tra; Ton, Nu Minh Nguyet

2015-01-01

Summary In this study, ultrasound- and enzyme-assisted extractions of albumin (water-soluble protein group) from defatted pumpkin (Cucurbita pepo) seed powder were compared. Both advanced extraction techniques strongly increased the albumin yield in comparison with conventional extraction. The extraction rate was two times faster in the ultrasonic extraction than in the enzymatic extraction. However, the maximum albumin yield was 16% higher when using enzymatic extraction. Functional properties of the pumpkin seed albumin concentrates obtained using the enzymatic, ultrasonic and conventional methods were then evaluated. Use of hydrolase for degradation of cell wall of the plant material did not change the functional properties of the albumin concentrate in comparison with the conventional extraction. The ultrasonic extraction enhanced water-holding, oil-holding and emulsifying capacities of the pumpkin seed albumin concentrate, but slightly reduced the foaming capacity, and emulsion and foam stability. PMID:27904383

Comparison of Enzymatic and Ultrasonic Extraction of Albumin from Defatted Pumpkin (Cucurbita pepo)
Seed Powder.

PubMed

Tu, Gia Loi; Bui, Thi Hoang Nga; Tran, Thi Thu Tra; Ton, Nu Minh Nguyet; Man Le, Van Viet

2015-12-01

In this study, ultrasound- and enzyme-assisted extractions of albumin (water-soluble protein group) from defatted pumpkin ( Cucurbita pepo ) seed powder were compared. Both advanced extraction techniques strongly increased the albumin yield in comparison with conventional extraction. The extraction rate was two times faster in the ultrasonic extraction than in the enzymatic extraction. However, the maximum albumin yield was 16% higher when using enzymatic extraction. Functional properties of the pumpkin seed albumin concentrates obtained using the enzymatic, ultrasonic and conventional methods were then evaluated. Use of hydrolase for degradation of cell wall of the plant material did not change the functional properties of the albumin concentrate in comparison with the conventional extraction. The ultrasonic extraction enhanced water-holding, oil-holding and emulsifying capacities of the pumpkin seed albumin concentrate, but slightly reduced the foaming capacity, and emulsion and foam stability.

Minimum number of measurements for evaluating Bertholletia excelsa.

PubMed

Baldoni, A B; Tonini, H; Tardin, F D; Botelho, S C C; Teodoro, P E

2017-09-27

Repeatability studies on fruit species are of great importance to identify the minimum number of measurements necessary to accurately select superior genotypes. This study aimed to identify the most efficient method to estimate the repeatability coefficient (r) and predict the minimum number of measurements needed for a more accurate evaluation of Brazil nut tree (Bertholletia excelsa) genotypes based on fruit yield. For this, we assessed the number of fruits and dry mass of seeds of 75 Brazil nut genotypes, from native forest, located in the municipality of Itaúba, MT, for 5 years. To better estimate r, four procedures were used: analysis of variance (ANOVA), principal component analysis based on the correlation matrix (CPCOR), principal component analysis based on the phenotypic variance and covariance matrix (CPCOV), and structural analysis based on the correlation matrix (mean r - AECOR). There was a significant effect of genotypes and measurements, which reveals the need to study the minimum number of measurements for selecting superior Brazil nut genotypes for a production increase. Estimates of r by ANOVA were lower than those observed with the principal component methodology and close to AECOR. The CPCOV methodology provided the highest estimate of r, which resulted in a lower number of measurements needed to identify superior Brazil nut genotypes for the number of fruits and dry mass of seeds. Based on this methodology, three measurements are necessary to predict the true value of the Brazil nut genotypes with a minimum accuracy of 85%.

Estimation of genetic parameters and selection of high-yielding, upright common bean lines with slow seed-coat darkening.

PubMed

Alvares, R C; Silva, F C; Melo, L C; Melo, P G S; Pereira, H S

2016-11-21

Slow seed coat darkening is desirable in common bean cultivars and genetic parameters are important to define breeding strategies. The aims of this study were to estimate genetic parameters for plant architecture, grain yield, grain size, and seed-coat darkening in common bean; identify any genetic association among these traits; and select lines that associate desirable phenotypes for these traits. Three experiments were set up in the winter 2012 growing season, in Santo Antônio de Goiás and Brasília, Brazil, including 220 lines obtained from four segregating populations and five parents. A triple lattice 15 x 15 experimental design was used. The traits evaluated were plant architecture, grain yield, grain size, and seed-coat darkening. Analyses of variance were carried out and genetic parameters such as heritability, gain expected from selection, and correlations, were estimated. For selection of superior lines, a "weight-free and parameter-free" index was used. The estimates of genetic variance, heritability, and gain expected from selection were high, indicating good possibility for success in selection of the four traits. The genotype x environment interaction was proportionally more important for yield than for the other traits. There was no strong genetic correlation observed among the four traits, which indicates the possibility of selection of superior lines with many traits. Considering simultaneous selection, it was not possible to join high genetic gains for the four traits. Forty-four lines that combined high yield, more upright plant architecture, slow darkening grains, and commercial grade size were selected.

Pine seed tree growth and yield on the Crossett Experimental Forest

Treesearch

Don C. Bragg

2010-01-01

In late 2002, three small tracts of loblolly (Pinus taeda) and shortleaf (Pinus echinata) pine on the Crossett Experimental Forest in Ashley County, AR, were cut using a seed tree method. Immediately after harvest, these cutting units averaged 7.7 stems and 13.8 square feet of pine basal area per acre. By 2006, live seed tree...

Validation of high-quality potato seed production protocol under controlled conditions (CETS System) in cultivated potato species (Solanum tuberosum L.)

USDA-ARS?s Scientific Manuscript database

Low potato yield in Peru and other countries in the region are attributed to the use of low quality seeds and tuber recycling. Therefore, there is consensus on the need of incorporating seed production technologies that are effective and efficient but also consistent with the reality of potato in La...

COBRA-LIKE2, a Member of the Glycosylphosphatidylinositol-Anchored COBRA-LIKE Family, Plays a Role in Cellulose Deposition in Arabidopsis Seed Coat Mucilage Secretory Cells1,2[OPEN

PubMed Central

Ben-Tov, Daniela; Abraham, Yael; Stav, Shira; Thompson, Kevin; Loraine, Ann; Elbaum, Rivka; de Souza, Amancio; Pauly, Markus; Kieber, Joseph J.; Harpaz-Saad, Smadar

2015-01-01

Differentiation of the maternally derived seed coat epidermal cells into mucilage secretory cells is a common adaptation in angiosperms. Recent studies identified cellulose as an important component of seed mucilage in various species. Cellulose is deposited as a set of rays that radiate from the seed upon mucilage extrusion, serving to anchor the pectic component of seed mucilage to the seed surface. Using transcriptome data encompassing the course of seed development, we identified COBRA-LIKE2 (COBL2), a member of the glycosylphosphatidylinositol-anchored COBRA-LIKE gene family in Arabidopsis (Arabidopsis thaliana), as coexpressed with other genes involved in cellulose deposition in mucilage secretory cells. Disruption of the COBL2 gene results in substantial reduction in the rays of cellulose present in seed mucilage, along with an increased solubility of the pectic component of the mucilage. Light birefringence demonstrates a substantial decrease in crystalline cellulose deposition into the cellulosic rays of the cobl2 mutants. Moreover, crystalline cellulose deposition into the radial cell walls and the columella appears substantially compromised, as demonstrated by scanning electron microscopy and in situ quantification of light birefringence. Overall, the cobl2 mutants display about 40% reduction in whole-seed crystalline cellulose content compared with the wild type. These data establish that COBL2 plays a role in the deposition of crystalline cellulose into various secondary cell wall structures during seed coat epidermal cell differentiation. PMID:25583925

The struggles of jojoba

DOE Office of Scientific and Technical Information (OSTI.GOV)

Shani, A.

1995-05-01

In the 1950s jojoba oil was suggested as a substitute for sperm whale oil because of the similarities between the oils. The suggestion was accepted by US authorities, who were looking for ways to increase income for Native Americans on reservations. Unfortunately, the plantations were established without any botanical or agronomic preparation and proved unprofitable. The poor seed yields--barely 300--400 kg/ha--are ultimately traceable to the dioecious nature of the plant: one-half of the seeds yield male shrubs, which do not produce seeds and develop more rapidly than the females, taking over most of the field unless removed in time. Evenmore » after early culling of male shrubs and replacement with female shrubs was instituted, it was impossible to improve seed yields beyond 400--600 kg/ha. Disappointment in this new agroindustrial crop was so strong that today there is no US Federal support for research and development in jojoba. Only in Israel was there a gradual increase in jojoba cultivation, culminating in a great leap forward in the late 1980s and early 1990s. It took some 20--25 years of selection and improvement to obtain female plants and lines producing 3,000--3,500 kg/ha of seeds, close to twice the current rate of yield in the US. This botanical work was accompanied by agronomical studies of drip irrigation and fertilization regimes as well as agrotechnical studies, which eventually led to the design of a special mechanical harvester. Based on an almond pick-up system, the harvester collects up to 90% of the seeds from the ground. Chemical studies were also carried out on the raw wax, its derivatives, and potential applications. Extensive research and development as well as full domestication of the jojoba plant occurred in this 25-year period. The paper gives facts about jojoba, its chemical aspects, by-products from jojoba, the current marketplace and future trends.« less

Isolation and characterization of coagulant extracted from Moringa oleifera seed by salt solution.

PubMed

Okuda, T; Baes, A U; Nishijima, W; Okada, M

2001-02-01

It is known that M. oleifera contains a natural coagulant in the seeds. In our previous research, the method using salt water to extract the active coagulation component from M. oleifera seeds was developed and compared with the conventional method using water. In this research, the active coagulation component was purified from a NaCl solution crude extract of Moringa oleifera seeds. The active component was isolated and purified from the crude extract through a sequence of steps that included salting-out by dialysis, removal of lipids and carbohydrates by homogenization with acetone, and anion exchange. Specific coagulation activity of the active material increased up to 34 times more than the crude extract after the ion exchange. The active component was not the same as that of water extract. The molecular weight was about 3000 Da. The Lowry method and the phenol-sulfuric acid method indicated that the active component was neither protein nor polysaccharide. The optimum pH of the purified active component for coagulation of turbidity was pH 8 and above. Different from the conventional water extracts, the active component can be used for waters with low turbidity without increase in the dissolved organic carbon concentration.

Advances in disease-resistant varieties

USDA-ARS?s Scientific Manuscript database

Soybean yields worldwide are reduced by a variety of diseases that affect plant stands, seed development, and/or seed quality, but soybean breeders, pathologists, and genomicists have made considerable progress in the identification, characterization and utilization of sources of resistance genes. M...

Seed priming with iron and zinc in bread wheat: effects in germination, mitosis and grain yield.

PubMed

Reis, Sara; Pavia, Ivo; Carvalho, Ana; Moutinho-Pereira, José; Correia, Carlos; Lima-Brito, José

2018-07-01

Currently, the biofortification of crops like wheat with micronutrients such as iron (Fe) and zinc (Zn) is extremely important due to the deficiencies of these micronutrients in the human diet and in soils. Agronomic biofortification with Fe and Zn can be done through different exogenous strategies such as soil application, foliar spraying, and seed priming. However, the excess of these micronutrients can be detrimental to the plants. Therefore, in the last decade, a high number of studies focused on the evaluation of their phytotoxic effects to define the best strategies for biofortification of bread wheat. In this study, we investigated the effects of seed priming with different dosages (1 mg L -1 to 8 mg L -1 ) of Fe and/or Zn in germination, mitosis and yield of bread wheat cv. 'Jordão' when compared with control. Overall, our results showed that: micronutrient dosages higher than 4 mg L -1 negatively affect the germination; Fe and/or Zn concentrations higher than 2 mg L -1 significantly decrease the mitotic index and increase the percentage of dividing cells with anomalies; treatments performed with 8 mg L -1 of Fe and/or 8 mg L -1 Zn caused negative effects in germination, mitosis and grain yield. Moreover, seed priming with 2 mg L -1 Fe + 2 mg L -1 Zn has been shown to be non-cytotoxic, ensuring a high rate of germination (80%) and normal dividing cells (90%) as well as improving tillering and grain yield. This work revealed that seed priming with Fe and Zn micronutrients constitutes a useful and alternative approach for the agronomic biofortification of bread wheat.

Overexpression of phyA and appA Genes Improves Soil Organic Phosphorus Utilisation and Seed Phytase Activity in Brassica napus

PubMed Central

Wang, Yi; Ye, Xiangsheng; Ding, Guangda; Xu, Fangsen

2013-01-01

Phytate is the major storage form of organic phosphorus in soils and plant seeds, and phosphorus (P) in this form is unavailable to plants or monogastric animals. In the present study, the phytase genes phyA and appA were introduced into Brassica napus cv Westar with a signal peptide sequence and CaMV 35S promoter, respectively. Three independent transgenic lines, P3 and P11 from phyA and a18 from appA, were selected. The three transgenic lines exhibited significantly higher exuded phytase activity when compared to wild-type (WT) controls. A quartz sand culture experiment demonstrated that transgenic Brassica napus had significantly improved P uptake and plant biomass. A soil culture experiment revealed that seed yields of transgenic lines P11 and a18 increased by 20.9% and 59.9%, respectively, when compared to WT. When phytate was used as the sole P source, P accumulation in seeds increased by 20.6% and 46.9% with respect to WT in P11 and a18, respectively. The P3 line accumulated markedly more P in seeds than WT, while no significant difference was observed in seed yields when phytate was used as the sole P source. Phytase activities in transgenic canola seeds ranged from 1,138 to 1,605 U kg–1 seeds, while no phytase activity was detected in WT seeds. Moreover, phytic acid content in P11 and a18 seeds was significantly lower than in WT. These results introduce an opportunity for improvement of soil and seed phytate-P bioavailability through genetic manipulation of oilseed rape, thereby increasing plant production and P nutrition for monogastric animals. PMID:23573285

Distillation Time as Tool for Improved Antimalarial Activity and Differential Oil Composition of Cumin Seed Oil

PubMed Central

Zheljazkov, Valtcho D.; Gawde, Archana; Cantrell, Charles L.; Astatkie, Tess; Schlegel, Vicki

2015-01-01

A steam distillation extraction kinetics experiment was conducted to estimate essential oil yield, composition, antimalarial, and antioxidant capacity of cumin (Cuminum cyminum L.) seed (fruits). Furthermore, regression models were developed to predict essential oil yield and composition for a given duration of the steam distillation time (DT). Ten DT durations were tested in this study: 5, 7.5, 15, 30, 60, 120, 240, 360, 480, and 600 min. Oil yields increased with an increase in the DT. Maximum oil yield (content, 2.3 g/100 seed), was achieved at 480 min; longer DT did not increase oil yields. The concentrations of the major oil constituents α-pinene (0.14–0.5% concentration range), β-pinene (3.7–10.3% range), γ-cymene (5–7.3% range), γ-terpinene (1.8–7.2% range), cumin aldehyde (50–66% range), α-terpinen-7-al (3.8–16% range), and β-terpinen-7-al (12–20% range) varied as a function of the DT. The concentrations of α-pinene, β-pinene, γ-cymene, γ-terpinene in the oil increased with the increase of the duration of the DT; α-pinene was highest in the oil obtained at 600 min DT, β-pinene and γ-terpinene reached maximum concentrations in the oil at 360 min DT; γ-cymene reached a maximum in the oil at 60 min DT, cumin aldehyde was high in the oils obtained at 5–60 min DT, and low in the oils obtained at 240–600 min DT, α-terpinen-7-al reached maximum in the oils obtained at 480 or 600 min DT, whereas β-terpinen-7-al reached a maximum concentration in the oil at 60 min DT. The yield of individual oil constituents (calculated from the oil yields and the concentration of a given compound at a particular DT) increased and reached a maximum at 480 or 600 min DT. The antimalarial activity of the cumin seed oil obtained during the 0–5 and at 5–7.5 min DT timeframes was twice higher than the antimalarial activity of the oils obtained at the other DT. This study opens the possibility for distinct marketing and utilization for these improved oils. The antioxidant capacity of the oil was highest in the oil obtained at 30 min DT and lowest in the oil from 360 min DT. The Michaelis-Menton and the Power nonlinear regression models developed in this study can be utilized to predict essential oil yield and composition of cumin seed at any given duration of DT and may also be useful to compare previous reports on cumin oil yield and composition. DT can be utilized to obtain cumin seed oil with improved antimalarial activity, improved antioxidant capacity, and with various compositions. PMID:26641276

Genomic Tools in Pea Breeding Programs: Status and Perspectives

PubMed Central

Tayeh, Nadim; Aubert, Grégoire; Pilet-Nayel, Marie-Laure; Lejeune-Hénaut, Isabelle; Warkentin, Thomas D.; Burstin, Judith

2015-01-01

Pea (Pisum sativum L.) is an annual cool-season legume and one of the oldest domesticated crops. Dry pea seeds contain 22–25% protein, complex starch and fiber constituents, and a rich array of vitamins, minerals, and phytochemicals which make them a valuable source for human consumption and livestock feed. Dry pea ranks third to common bean and chickpea as the most widely grown pulse in the world with more than 11 million tons produced in 2013. Pea breeding has achieved great success since the time of Mendel's experiments in the mid-1800s. However, several traits still require significant improvement for better yield stability in a larger growing area. Key breeding objectives in pea include improving biotic and abiotic stress resistance and enhancing yield components and seed quality. Taking advantage of the diversity present in the pea genepool, many mapping populations have been constructed in the last decades and efforts have been deployed to identify loci involved in the control of target traits and further introgress them into elite breeding materials. Pea now benefits from next-generation sequencing and high-throughput genotyping technologies that are paving the way for genome-wide association studies and genomic selection approaches. This review covers the significant development and deployment of genomic tools for pea breeding in recent years. Future prospects are discussed especially in light of current progress toward deciphering the pea genome. PMID:26640470

Effects of arbuscular mycorrhizal fungi inoculation on carbon and nitrogen distribution and grain yield and nutritional quality in rice (Oryza sativa L.).

PubMed

Zhang, Xue; Wang, Li; Ma, Fang; Yang, Jixian; Su, Meng

2017-07-01

The importance of arbuscular mycorrhizal fungi (AMF) for nutrient uptake and growth in rice has been widely recognized. However, little is known about the distribution of carbon (C) and nitrogen (N) in rice under AMF inoculation, which can affect grain yield and quality. This study was conducted to investigate the distribution of C and N within rice plants under AMF inoculation and the effects on grain yield and quality. AMF inoculation significantly increased N accumulation and distribution in vegetative tissues at tillering, and N translocation into seeds from heading to maturity. Consequently, AMF inoculation more strongly impacted the distribution of N than that of C in seeds, with significantly reduced C:N ratios and increased protein content (by 7.4%). Additionally, AMF inoculation significantly increased grain yield by 28.2% through increasing the grain:straw ratio by 18.4%. In addition, the roots of inoculated rice exhibited greater change in C distribution, with significantly higher C concentrations, C accumulations, and C:N ratios at tillering and maturity. AMF inoculation affected the distribution of N in seeds and C in roots. As such, AMF inoculation may be a potential method for improving grain yield and quality. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Modeling the effects of ozone on soybean growth and yield.

PubMed

Kobayashi, K; Miller, J E; Flagler, R B; Heck, W W

1990-01-01

A simple mechanistic model was developed based on an existing growth model in order to address the mechanisms of the effects of ozone on growth and yield of soybean [Glycine max. (L.) Merr. 'Davis'] and interacting effects of other environmental stresses. The model simulates daily growth of soybean plants using environmental data including shortwave radiation, temperature, precipitation, irrigation and ozone concentration. Leaf growth, dry matter accumulation, water budget, nitrogen input and seed growth linked to senescence and abscission of leaves are described in the model. The effects of ozone are modeled as reduced photosynthate production and accelerated senescence. The model was applied to the open-top chamber experiments in which soybean plants were exposed to ozone under two levels of soil moisture regimes. After calibrating the model to the growth data and seed yield, goodness-of-fit of the model was tested. The model fitted well for top dry weight in the vegetative growth phase and also at maturity. The effect of ozone on seen yield was also described satisfactorily by the model. The simulation showed apparent interaction between the effect of ozone and soil moisture stress on the seed yield. The model revealed that further work is needed concerning the effect of ozone on the senescence process and the consequences of alteration of canopy microclimate by the open-top chambers.

Sicklepod (Senna obtusifolia) seed processing and potential utilization.

PubMed

Harry-O'kuru, Rogers E; Wu, Y Victor; Evangelista, Roque; Vaughn, Steven F; Rayford, Warren; Wilson, Richard F

2005-06-15

Sicklepod (Senna obtusifolia) is a leguminous plant that infests soybean fields in the southeastern United States. Its seeds contain a variety of toxic, highly colored compounds, mainly anthraquinones together with a small amount of fat. These compounds contaminate and lower the quality of soybean oil when inadequately cleaned soybean seed from this area is processed. The sorting of sicklepod seed from a soybean harvest is an additional economic burden on the farmer beyond the cost of proper disposal of the weed seed to avoid worsening field infestation. Fortunately, sicklepod seed also contains substantial amounts of carbohydrates and proteins. These edible components when freed from anthraquinones have a market in pet food as well as potential in human foods because of the high galactomannan ratio of the polysaccharides. Sicklepod seed was dehulled, and the ground endosperm was defatted, followed by sequential solvent extraction of the defatted seed meal to isolate the anthraquinones, carbohydrates, and protein components into their respective classes. Each class of isolate was spectroscopically identified.

Critical Period of Weed Control in Aerobic Rice

PubMed Central

Anwar, M. P.; Juraimi, A. S.; Samedani, B.; Puteh, A.; Man, A.

2012-01-01

Critical period of weed control is the foundation of integrated weed management and, hence, can be considered the first step to design weed control strategy. To determine critical period of weed control of aerobic rice, field trials were conducted during 2010/2011 at Universiti Putra Malaysia. A quantitative series of treatments comprising two components, (a) increasing duration of weed interference and (b) increasing length of weed-free period, were imposed. Critical period was determined through Logistic and Gompertz equations. Critical period varied between seasons; in main season, it started earlier and lasted longer, as compared to off-season. The onset of the critical period was found relatively stable between seasons, while the end was more variable. Critical period was determined as 7–49 days after seeding in off-season and 7–53 days in main season to achieve 95% of weed-free yield, and 23–40 days in off-season and 21–43 days in main season to achieve 90% of weed-free yield. Since 5% yield loss level is not practical from economic view point, a 10% yield loss may be considered excellent from economic view point. Therefore, aerobic rice should be kept weed-free during 21–43 days for better yield and higher economic return. PMID:22778701

Endophytic bacteria take the challenge to improve Cu phytoextraction by sunflower.

PubMed

Kolbas, Aliaksandr; Kidd, Petra; Guinberteau, Jacques; Jaunatre, Renaud; Herzig, Rolf; Mench, Michel

2015-04-01

Endophytic bacteria from roots and crude seed extracts of a Cu-tolerant population of Agrostis capillaris were inoculated to a sunflower metal-tolerant mutant line, and their influence on Cu tolerance and phytoextraction was assessed using a Cu-contaminated soil series. Ten endophytic bacterial strains isolated from surface-sterilized A. capillaris roots were mixed to prepare the root endophyte inoculant (RE). In parallel, surface-sterilized seeds of A. capillaris were crushed in MgSO4 to prepare a crude seed extract containing seed endophytes (SE). An aliquot of this seed extract was filtered at 0.2 μm to obtain a bacterial cell-free seed extract (SEF). After surface sterilization, germinated sunflower seeds were separately treated with one of five modalities: no treatment (C), immersion in MgSO4 (CMg) or SEF solutions and inoculation with RE or SE. All plants were cultivated on a Cu-contaminated soil series (13-1020 mg Cu kg(-1)). Cultivable RE strains were mostly members of the Pseudomonas genera, and one strain was closely related to Labrys sp. The cultivable SE strains belonged mainly to the Bacillus genera and some members of the Rhodococcus genera. The treatment effects depended on the soil Cu concentration. Both SE and SEF plants had a higher Cu tolerance in the 13-517 mg Cu kg(-1) soil range as reflected by increased shoot and root DW yields compared to control plants. This was accompanied by a slight decrease in shoot Cu concentration and increase in root Cu concentration. Shoot and root DW yields were more promoted by SE than SEF in the 13-114 mg Cu kg(-1) soil range, which could reflect the influence of seed-located bacterial endophytes. At intermediate soil Cu (416-818 mg Cu kg(-1) soil), the RE and CMg plants had lower shoot Cu concentrations than the control, SE and SEF plants. At high total soil Cu (617-1020 mg Cu kg(-1)), root DW yield of RE plants slightly increased and their root Cu concentration rose by up to 1.9-fold. In terms of phytoextraction efficiency, shoot Cu removal was increased for sunflower plants inoculated with crude and bacterial cell-free seed extracts by 1.3- to 2.2-fold in the 13-416 mg Cu kg(-1) soil range. Such increase was mainly driven by an enhanced shoot DW yield. The number and distribution of endophytic bacteria in the harvested sunflower tissues must be further examined.

Spectral considerations for modeling yield of canola

USDA-ARS?s Scientific Manuscript database

Conspicuous yellow flowers that are present in a Brassica oilseed crop such as canola require careful consideration when selecting a spectral index for yield estimation. This study evaluated spectral indices for multispectral sensors that correlate with the seed yield of Brassica oilseed crops. A ...

Seed origin and size of ponderosa pine planting stock grown at several California nurseries

Treesearch

Frank J. Baron; Gilbert H. Schubert

1963-01-01

Ponderosa pine planting stock (1-0 and 2-0) grown from five different seed collection zones in the California pine region differed noticeably in size. On the west side of the Sierra Nevada, seeds from zones above 4,000 feet yielded smaller seedlings than those from lower zones, but larger seedlings than those from east-side sources. Average dimensions (seedling weight...

Resistance mechanisms to toxin-mediated charcoal rot infection in maturity group III soybean: role of seed phenol lignin soflavones sugars and seed minerals in charcoal rot resistance

USDA-ARS?s Scientific Manuscript database

Charcoal rot is a disease caused by the fungus Macrophomina phaseolina (Tassi) Goid, and thought to infect the plants through roots by a toxin-mediated mechanism, resulting in yield loss and poor seed quality, especially under drought conditions. The mechanism by which this infection occurs is not y...

Bioethanol produced from Moringa oleifera seeds husk

NASA Astrophysics Data System (ADS)

Ali, E. N.; Kemat, S. Z.

2017-06-01

This paper presents the potential of bioethanol production from Moringa oleifera seeds husk which contains lignocellulosic through Simultaneous Saccharification and Fermentation (SSF) process by using Saccharomyces cerevisiae. This paper investigates the parameters which produce optimum bioethanol yield. The husk was hydrolyzed using NaOH and fermented using Saccharomyces cerevisiae yeast. Batch fermentation was performed with different yeast dosage of 1, 3, and 5 g/L, pH value was 4.5, 5.0 and 5.5, and fermentation time of 3, 6, 9 and 12 hours. The temperature of fermentation process in incubator shaker is kept constant at 32ºC. The samples are then filtered using a 0.20 μm nylon filter syringe. The yield of bioethanol produced was analysed using High Performance Liquid Chromatography (HPLC). The results showed that the highest yield of 29.69 g/L was obtained at 3 hours of fermentation time at pH of 4.5 and using 1g/L yeast. This research work showed that Moringa oleifera seeds husk can be considered to produce bioethanol.

Isolation and characterization of hydrophobic compounds from carbohydrate matrix of Pistacia atlantica.

PubMed

Samavati, Vahid; Adeli, Mostafa

2014-01-30

The present work is focused on the optimization of hydrophobic compounds extraction process from the carbohydrate matrix of Iranian Pistacia atlantica seed at laboratory level using ultrasonic-assisted extraction. Response surface methodology (RSM) was used to optimize oil seed extraction yield. Independent variables were extraction temperature (30, 45, 60, 75 and 90°C), extraction time (10, 15, 20, 25, 30 and 35 min) and power of ultrasonic (20, 40, 60, 80 and 100 W). A second order polynomial equation was used to express the oil extraction yield as a function of independent variables. The responses and variables were fitted well to each other by multiple regressions. The optimum extraction conditions were as follows: extraction temperature of 75°C, extraction time of 25 min, and power of ultrasonic of 80 W. A comparison between seed oil composition extracted by ultrasonic waves under the optimum operating conditions determined by RSM for oil yield and by organic solvent was reported. Copyright © 2013 Elsevier Ltd. All rights reserved.

Structural mechanics of seed deterioration: Standing the test of time

USDA-ARS?s Scientific Manuscript database

Seeds die unexpectedly during storage and current understanding of seed quality and storage conditions does not allow reliable means to predict or prevent this critical problem. Chemical degradation of seed components likely occurs through oxidative damage, but the rate of these reactions is domina...

COBRA-LIKE2, a member of the glycosylphosphatidylinositol-anchored COBRA-LIKE family, plays a role in cellulose deposition in arabidopsis seed coat mucilage secretory cells.

PubMed

Ben-Tov, Daniela; Abraham, Yael; Stav, Shira; Thompson, Kevin; Loraine, Ann; Elbaum, Rivka; de Souza, Amancio; Pauly, Markus; Kieber, Joseph J; Harpaz-Saad, Smadar

2015-03-01

Differentiation of the maternally derived seed coat epidermal cells into mucilage secretory cells is a common adaptation in angiosperms. Recent studies identified cellulose as an important component of seed mucilage in various species. Cellulose is deposited as a set of rays that radiate from the seed upon mucilage extrusion, serving to anchor the pectic component of seed mucilage to the seed surface. Using transcriptome data encompassing the course of seed development, we identified COBRA-LIKE2 (COBL2), a member of the glycosylphosphatidylinositol-anchored COBRA-LIKE gene family in Arabidopsis (Arabidopsis thaliana), as coexpressed with other genes involved in cellulose deposition in mucilage secretory cells. Disruption of the COBL2 gene results in substantial reduction in the rays of cellulose present in seed mucilage, along with an increased solubility of the pectic component of the mucilage. Light birefringence demonstrates a substantial decrease in crystalline cellulose deposition into the cellulosic rays of the cobl2 mutants. Moreover, crystalline cellulose deposition into the radial cell walls and the columella appears substantially compromised, as demonstrated by scanning electron microscopy and in situ quantification of light birefringence. Overall, the cobl2 mutants display about 40% reduction in whole-seed crystalline cellulose content compared with the wild type. These data establish that COBL2 plays a role in the deposition of crystalline cellulose into various secondary cell wall structures during seed coat epidermal cell differentiation. © 2015 American Society of Plant Biologists. All Rights Reserved.

Fuzzy Logic Particle Tracking

NASA Technical Reports Server (NTRS)

2005-01-01

A new all-electronic Particle Image Velocimetry technique that can efficiently map high speed gas flows has been developed in-house at the NASA Lewis Research Center. Particle Image Velocimetry is an optical technique for measuring the instantaneous two component velocity field across a planar region of a seeded flow field. A pulsed laser light sheet is used to illuminate the seed particles entrained in the flow field at two instances in time. One or more charged coupled device (CCD) cameras can be used to record the instantaneous positions of particles. Using the time between light sheet pulses and determining either the individual particle displacements or the average displacement of particles over a small subregion of the recorded image enables the calculation of the fluid velocity. Fuzzy logic minimizes the required operator intervention in identifying particles and computing velocity. Using two cameras that have the same view of the illumination plane yields two single exposure image frames. Two competing techniques that yield unambiguous velocity vector direction information have been widely used for reducing the single-exposure, multiple image frame data: (1) cross-correlation and (2) particle tracking. Correlation techniques yield averaged velocity estimates over subregions of the flow, whereas particle tracking techniques give individual particle velocity estimates. For the correlation technique, the correlation peak corresponding to the average displacement of particles across the subregion must be identified. Noise on the images and particle dropout result in misidentification of the true correlation peak. The subsequent velocity vector maps contain spurious vectors where the displacement peaks have been improperly identified. Typically these spurious vectors are replaced by a weighted average of the neighboring vectors, thereby decreasing the independence of the measurements. In this work, fuzzy logic techniques are used to determine the true correlation displacement peak even when it is not the maximum peak, hence maximizing the information recovery from the correlation operation, maintaining the number of independent measurements, and minimizing the number of spurious velocity vectors. Correlation peaks are correctly identified in both high and low seed density cases. The correlation velocity vector map can then be used as a guide for the particle-tracking operation. Again fuzzy logic techniques are used, this time to identify the correct particle image pairings between exposures to determine particle displacements, and thus the velocity. Combining these two techniques makes use of the higher spatial resolution available from the particle tracking. Particle tracking alone may not be possible in the high seed density images typically required for achieving good results from the correlation technique. This two-staged velocimetric technique can measure particle velocities with high spatial resolution over a broad range of seeding densities.

Two proteins for the price of one: Structural studies of the dual-destiny protein preproalbumin with sunflower trypsin inhibitor-1.

PubMed

Franke, Bastian; James, Amy M; Mobli, Mehdi; Colgrave, Michelle L; Mylne, Joshua S; Rosengren, K Johan

2017-07-28

Seed storage proteins are both an important source of nutrition for humans and essential for seedling establishment. Interestingly, unusual napin-type 2S seed storage albumin precursors in sunflowers contain a sequence that is released as a macrocyclic peptide during post-translational processing. The mechanism by which such peptides emerge from linear precursor proteins has received increased attention; however, the structural characterization of intact precursor proteins has been limited. Here, we report the 3D NMR structure of the Helianthus annuus PawS1 ( p repro a lbumin w ith s unflower trypsin inhibitor- 1 ) and provide new insights into the processing of this remarkable dual-destiny protein. In seeds, PawS1 is matured by asparaginyl endopeptidases (AEPs) into the cyclic peptide SFTI-1 ( s un f lower t rypsin i nhibitor- 1 ) and a heterodimeric 2S albumin. The structure of PawS1 revealed that SFTI-1 and the albumin are independently folded into well-defined domains separated by a flexible linker. PawS1 was cleaved in vitro with recombinant sunflower HaAEP1 and in situ using a sunflower seed extract in a way that resembled the expected in vivo cleavages. Recombinant HaAEP1 cleaved PawS1 at multiple positions, and in situ , its flexible linker was removed, yielding fully mature heterodimeric albumin. Liberation and cyclization of SFTI-1, however, was inefficient, suggesting that specific seed conditions or components may be required for in vivo biosynthesis of SFTI-1. In summary, this study has revealed the 3D structure of a macrocyclic precursor protein and provided important mechanistic insights into the maturation of sunflower proalbumins into an albumin and a macrocyclic peptide. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

Predicting guar seed splitting by compression between two plates using Hertz theory of contact stresses.

PubMed

Vishwakarma, R K; Shivhare, U S; Nanda, S K

2012-09-01

Hertz's theory of contact stresses was applied to predict the splitting of guar seeds during uni-axial compressive loading between 2 rigid parallel plates. The apparent modulus of elasticity of guar seeds varied between 296.18 and 116.19 MPa when force was applied normal to hilum joint (horizontal position), whereas it varied between 171.86 and 54.18 MPa when force was applied in the direction of hilum joint (vertical position) with in moisture content range of 5.16% to 15.28% (d.b.). At higher moisture contents, the seeds yielded after considerable deformation, thus showing ductile nature. Distribution of stresses below the point of contact were plotted to predict the location of critical point, which was found at 0.44 to 0.64 mm and 0.37 to 0.53 mm below the contact point in vertical and horizontal loading, respectively, depending upon moisture content. The separation of cotyledons from each other initiated before yielding of cotyledons and thus splitting of seed took place. The relationships between apparent modulus of elasticity, principal stresses with moisture content were described using second-order polynomial equations and validated experimentally. Manufacture of guar gum powder requires dehulling and splitting of guar seeds. This article describes splitting behavior of guar seeds under compressive loading. Results of this study may be used for design of dehulling and splitting systems of guar seeds. © 2012 Institute of Food Technologists®

Yield loss assessment due to Alternaria blight and its management in linseed.

PubMed

Singh, R B; Singh, H K; Parmar, Arpita

2014-04-01

Field experiments were conducted during 2010-11 and 2011-12 to assess the yield losses due to Alternaria blight disease caused by Alternaria lini and A. linicola in recently released cultivars and their management with the integration of Trichoderma viride, fungicides and plant extract. Disease severity on leaves varied from 41.07% (Parvati) to 65.01% (Chambal) while bud damage per cent ranged between 23.56% (Shekhar) to 46.12% (T-397), respectively in different cultivars. Maximum yield loss of 58.44% was recorded in cultivar Neelum followed by Parvati (55.56%), Meera (55.56%) and Chambal (51.72%), respectively while minimum loss was recorded in Kiran (19.99%) and Jeevan (22.22%). Minimum mean disease severity (19.47%) with maximum disease control (69.74%) was recorded with the treatment: seed treatment (ST) with vitavax power (2 g kg(-1) seed) + 2 foliar sprays (FS) of Saaf (a mixture of carbendazim+mancozeb) 0.2% followed by ST with Trichoderma viride (4g kg(-1) seed) + 2 FS of Saaf (0.2%). Minimum bud damage (13.75%) with maximum control (60.94%) was recorded with treatment of ST with vitavax power+2 FS of propiconazole (0.2%). Maximum mean seed yield (1440 kg ha(-1)) with maximum net return (Rs. 15352/ha) and benefit cost ratio (1:11.04) was obtained with treatment ST with vitavax power + 2 FS of Neem leaf extract followed by treatment ST with vitavax power+2 FS of Saaf (1378 kg ha(-1)).

Assessing the Fatty Acid, Carotenoid, and Tocopherol Compositions of Amaranth and Quinoa Seeds Grown in Ontario and Their Overall Contribution to Nutritional Quality.

PubMed

Tang, Yao; Li, Xihong; Chen, Peter X; Zhang, Bing; Liu, Ronghua; Hernandez, Marta; Draves, Jamie; Marcone, Massimo F; Tsao, Rong

2016-02-10

Various fatty acids, tocopherols, carotenoids, and their respective antioxidant contributions in 7 amaranth seed and 11 quinoa seed samples along with a new evaluation method are reported. The lipid yield was 6.98-7.22% in amaranth seeds and 6.03-6.74% in quinoa seeds, with unsaturated fatty acids (UFAs) being the predominant fatty acids, 71.58-72.44% in amaranth seeds and 81.44-84.49% in quinoa seeds, respectively. Carotenoids, mainly lutein and zeaxanthin, are confirmed for the first time in amaranth seeds, while β-carotene is reported first in quinoa seeds. The predominant tocopherols in amaranth seeds are δ- and α-tocopherol, whereas γ- and α-tocopherol are the primary tocopherols in quinoa seeds. UFAs, carotenoids, and tocopherols showed good correlation with antioxidant activity. All of the amaranth seeds demonstrated lower overall lipophilic quality than quinoa seeds, with the AS1 and QS10 cultivars providing the highest scores for amaranth and quinoa seeds, respectively. Results from this study will contribute to developing quinoa seeds and related functional foods with increased benefits.

Effects of Presowing Pulsed Electromagnetic Treatment of Tomato Seed on Growth, Yield, and Lycopene Content

PubMed Central

Efthimiadou, Aspasia; Katsenios, Nikolaos; Papastylianou, Panayiota; Triantafyllidis, Vassilios; Travlos, Ilias; Bilalis, Dimitrios J.

2014-01-01

The use of magnetic field as a presowing treatment has been adopted by researchers as a new environmental friendly technique. The aim of this study was to determine the effect of magnetic field exposure on tomato seeds covering a range of parameters such as transplanting percentage, plant height, shoot diameter, number of leaves per plant, fresh weight, dry weight, number of flowers, yield, and lycopene content. Pulsed electromagnetic field was used for 0, 5, 10, and 15 minutes as a presowing treatment of tomato seeds in a field experiment for two years. Papimi device (amplitude on the order of 12.5 mT) has been used. The use of pulsed electromagnetic field as a presowing treatment was found to enhance plant growth in tomato plants at certain duration of exposure. Magnetic field treatments and especially the exposure of 10 and 15 minutes gave the best results in all measurements, except plant height and lycopene content. Yield per plant was higher in magnetic field treatments, compared to control. MF-15 treatment yield was 80.93% higher than control treatment. Lycopene content was higher in magnetic field treatments, although values showed no statistically significant differences. PMID:25097875

Enhancement of yield, nutritional and nutraceutical properties of two common bean cultivars following the application of seaweed extract (Ecklonia maxima).

PubMed

Kocira, Anna; Świeca, Michał; Kocira, Sławomir; Złotek, Urszula; Jakubczyk, Anna

2018-03-01

In the present study, application of Ecklonia maxima extract (Kelpak SL - a water soluble concentrate) was optimized and its impact on yield, nutraceutical and nutritional potential of Phaseolus vulgaris L. (var. Aura and Toska) was measured. The study was carried out in 2012 and 2013 in Poland. During the growing season, 0.2% and 0.4% solution of Kelpak SL was applied by single and double spraying of plants. These four treatments with Kelpak SL were compared with the control, where no biostimulator was applied. Kelpak SL treatments stimulated the yield of both cultivars studied. The application of E. maxima extract had no effect on the content of starch, free sugars or proteins in seeds of either of the tested cultivars. The highest level of phenolics was found for double sprayed Toska plants. All the tested variants of Kelpak SL application significantly increased the content of anthocyanins in the seeds. Also, both the reducing power and antiradical ability of Aura seeds were elevated in all the studied treatments. E. maxima extract is a natural, environmentally friendly and safe preparation increasing the yield and nutraceutical quality of beans without any negative effect on their nutritional quality.

Perfusion seed cultures improve biopharmaceutical fed-batch production capacity and product quality.

PubMed

Yang, William C; Lu, Jiuyi; Kwiatkowski, Chris; Yuan, Hang; Kshirsagar, Rashmi; Ryll, Thomas; Huang, Yao-Ming

2014-01-01

Volumetric productivity and product quality are two key performance indicators for any biopharmaceutical cell culture process. In this work, we showed proof-of-concept for improving both through the use of alternating tangential flow perfusion seed cultures coupled with high-seed fed-batch production cultures. First, we optimized the perfusion N-1 stage, the seed train bioreactor stage immediately prior to the production bioreactor stage, to minimize the consumption of perfusion media for one CHO cell line and then successfully applied the optimized perfusion process to a different CHO cell line. Exponential growth was observed throughout the N-1 duration, reaching >40 × 10(6) vc/mL at the end of the perfusion N-1 stage. The cultures were subsequently split into high-seed (10 × 10(6) vc/mL) fed-batch production cultures. This strategy significantly shortened the culture duration. The high-seed fed-batch production processes for cell lines A and B reached 5 g/L titer in 12 days, while their respective low-seed processes reached the same titer in 17 days. The shortened production culture duration potentially generates a 30% increase in manufacturing capacity while yielding comparable product quality. When perfusion N-1 and high-seed fed-batch production were applied to cell line C, higher levels of the active protein were obtained, compared to the low-seed process. This, combined with correspondingly lower levels of the inactive species, can enhance the overall process yield for the active species. Using three different CHO cell lines, we showed that perfusion seed cultures can optimize capacity utilization and improve process efficiency by increasing volumetric productivity while maintaining or improving product quality. © 2014 American Institute of Chemical Engineers.

Salicylic acid deficiency in NahG transgenic lines and sid2 mutants increases seed yield in the annual plant Arabidopsis thaliana

PubMed Central

Abreu, Maria Elizabeth; Munné-Bosch, Sergi

2009-01-01

Salicylic acid-deficient NahG transgenic lines and sid2 mutants were used to evaluate the role of this compound in the development of the short-lived, annual plant Arabidopsis thaliana, with a particular focus on the interplay between salicylic acid and other phytohormones. Low salicylic acid levels led to increased growth, as well as to smaller abscisic acid levels and reduced damage to PSII (as indicated by Fv/Fm ratios) during the reproductive stages in rosette leaves of NahG transgenic lines and sid2 mutants, compared with wild-type plants. Furthermore, salicylic acid deficiency highly influenced seed yield and composition. Seed production increased by 4.4-fold and 3.5-fold in NahG transgenic lines and sid2 mutants, respectively, compared to the wild type. Salicylic acid deficiency also improved seed composition in terms of antioxidant vitamin concentrations, seeds of salicylic acid-deficient plants showing higher levels of α- and γ-tocopherol (vitamin E) and β-carotene (pro-vitamin A) than seeds of wild-type plants. Seeds of salicylic acid-deficient plants also showed higher nitrogen concentrations than seeds of wild-type plants. It is concluded that (i) the sid2 gene, which encodes for isochorismate synthase, plays a central role in salicylic acid biosynthesis during plant development in A. thaliana, (ii) salicylic acid plays a role in the regulation of growth, senescence, and seed production, (iii) there is a cross-talk between salicylic acid and other phytohormones during plant development, and (iv) the concentrations of antioxidant vitamins in seeds may be influenced by the endogenous levels of salicylic acid in plants. PMID:19188277

21 CFR 176.350 - Tamarind seed kernel powder.

Code of Federal Regulations, 2014 CFR

2014-04-01

... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Tamarind seed kernel powder. 176.350 Section 176... Paperboard § 176.350 Tamarind seed kernel powder. Tamarind seed kernel powder may be safely used as a component of articles intended for use in producing, manufacturing, packing, processing, preparing, treating...

[Seed vigor evaluation based on adversity resistance index of wheat seed germination under stress conditions.

PubMed

Chen, Lei Tai; Sun, Ai Qing; Yang, Min; Chen, Lu Lu; Ma, Xue Li; Li, Mei Ling; Yin, Yan Ping

2016-09-01

A total of 16 wheat cultivars were selected to detect seed vigor of different genotypes using standard germination test, seed germination test under stress conditions and field emergence test. The adversity resistance indices of seed vigor indices and field emergence percentage under different germination conditions were used as the indices to evaluate adversity resistance. Principal component analysis and cluster analysis were used for the comprehensive evaluation of seed vigor. Results showed that drought stress, artificial aging and cold soaking treatments affected seed vigor to some extent. The adversity resistance indices of the artificial aging and cold soaking tests were significantly positively correlated with the field emergence percentage, while the adversity resistance index of drought stress test had no significant correlation with the field emergence percentage. 16 wheat cultivars were classified as three groups based on the principal component analysis and cluster analysis. Yunong 949, Yumai 49-198, Luyuan 502, Zhengyumai 9987, Shimai 21, Shannong 23, and Shixin 828 belonged to high vigor seeds. Xunong 5, Yunong 982, Tangmai 8, Jimai 20, Jimai 22, Jinan 17, and Shannong 20 belonged to medium vigor seeds. The other two cultivars, Chang 4738 and Lunxuan 061, belonged to low vigor seeds.

On-farm research in Western Siberia: Potential of adapted management practices for sustainable intensification of crop production systems

NASA Astrophysics Data System (ADS)

Kühling, Insa; Trautz, Dieter

2015-04-01

Western Siberia is of global significance in terms of agricultural production, carbon sequestration and biodiversity preservation. Abandonment of arable land and changes in the use of permanent grasslands were triggered by the dissolution of the Soviet Union in and the following collapse of the state farm system. The peatlands, forests and steppe soils of Western Siberia are one of the most important carbon sinks worldwide. These carbon stocks are, if deteriorated, an important source of radiative forcing even in comparison to anthropogenic emissions. This situation is aggravated by recent and future developments in agricultural land use in the southern part of Western Siberia, in particular in Tyumen province. The increase of drought risk caused by climate change will led to more challenges in these water-limited agricultural production systems. The German-Russian interdisciplinary research project "SASCHA" aims to provide sustainable land management practices to cope with these far-reaching changes for Tyumen province. In particular, on farm scale agricultural strategies are being developed for increased efficiencies in crop production systems. Therefore a 3-factorial field trial with different tillage and seeding operations was installed with spring wheat on 10 ha under practical conditions in 2013. Within all combinations of tillage (no-till/conventional), seed rate (usual/reduced) and seed depth (usual/shallower) various soil parameters as well as plant development and yield components were intensively monitored during the growing seasons. Results after 2-years show significant impacts of the tillage operation on soil moisture and soil temperature. Also a higher trend in nitrogen mineralization could be observed without tillage. Plant development in terms of phenological growth stages took place simultaneously in all variants. Under no-till regime we measured slightly higher grain yields and significant advantages in protein yields. In conjunction with progressing climate change there seems to be high potential for enhanced production efficiency by no-till systems for the study region in Western Siberia. This way of sustainable intensification of agricultural production will also preserve carbon stocks and biodiversity as there is no need for expanding cropland area into currently natural ecosystems.

[Response of seed reproduction of two dominant lakeside species to experimental warming in a typical plateau wetland in Northwestern Yunnan Plateau, China].

PubMed

Wang, Zhi Bao; Sun, Mei; Liu, Zhen Ya; Zhang, Xiao Ning; Wang, Hang; Zhang, Yun; Xiao, De Rong

2018-03-01

Based on the forecasted warming scenarios by IPCC, we studied the impacts of warming (increased by 2.0 and 3.5 ℃) on seed reproduction of two lakeside dominant species (Schoeno-plectus tabernaemontani and Sparganium stoloniferum) in a typical plateau wetland (Napahai) in Northwestern Yunnan, by using "open-top chamber" technique. The results showed that warming had significant effects on the seed setting rate of both species, though with interspecific variation. The seed setting rate of S. tabernaemontani was significantly increased under two warming treatments, while that of S. stoloniferum was significantly decreased under the 2.0 ℃ warming treatment and had no variation under the 3.5 ℃ warming treatment. Warming promoted the spike growth of both species. For S. tabernaemontani, under the warming of 2.0 and 3.5 ℃ treatments, the spike length was increased by 82.9% and 89.0%, the spikelet number was increased by 133.3% and 150.0%, the biomass of each individual was increased by 10.1% and 89.6%, and the rate between biomass of per plant panicle and total biomass was increased by 79.5% and 409.3%, respectively. For S. stoloniferum, under the warming of 2.0 and 3.5 ℃ treatments, the spike length was increased by 66.1% and 95.2%, and the rate between biomass of per plant panicle and total biomass was increased by 878.8% and 1052.6%, respectively. Warming significantly increased seed yield of both species. Under the warming of 2.0 and 3.5 ℃ treatments, the seed yield per panicle of S. tabernaemontani was increased by 33.7% and 58.3%, respectively. For S. stoloniferum, the seed yield was increased by 3.4% and 69.5%, respectively. Under the warming of 2.0 and 3.5 ℃ treatments, the seed length of S. tabernaemontani was increased by 5.4% and 6.9%, and the seed length/width was increased by 9.1% and 5.3%, respectively. Warming had no significant effects on the seed shape of S. stoloniferum. The maximum and minimum temperatures were dominant factors affecting seed reproductions of both species. The advance of growing season, the prolonging of nutrition growing period, and accumulation of organic matter induced by warming would provide sufficient nutrient and energy accumulation for the reproduction and development of plants, which would promote seed reproduction capability of both species under the warming conditions.

Effects of a controlled-release fertilizer on yield, nutrient uptake, and fertilizer usage efficiency in early ripening rapeseed (Brassica napus L.)*

PubMed Central

Tian, Chang; Zhou, Xuan; Liu, Qiang; Peng, Jian-wei; Wang, Wen-ming; Zhang, Zhen-hua; Yang, Yong; Song, Hai-xing; Guan, Chun-yun

2016-01-01

Background: Nitrogen (N), phosphorous (P), and potassium (K) are critical nutrient elements necessary for crop plant growth and development. However, excessive inputs will lead to inefficient usage and cause excessive nutrient losses in the field environment, and also adversely affect the soil, water and air quality, human health, and biodiversity. Methods: Field experiments were conducted to study the effects of controlled-release fertilizer (CRF) on seed yield, plant growth, nutrient uptake, and fertilizer usage efficiency for early ripening rapeseed (Xiangzayou 1613) in the red-yellow soil of southern China during 2011–2013. It was grown using a soluble fertilizer (SF) and the same amounts of CRF, such as SF1/CRF1 (3750 kg/hm2), SF2/CRF2 (3000 kg/hm2), SF3/CRF3 (2250 kg/hm2), SF4/CRF4 (1500 kg/hm2), SF5/CRF5 (750 kg/hm2), and also using no fertilizer (CK). Results: CRF gave higher seed yields than SF in both seasons by 14.51%. CRF4 and SF3 in each group achieved maximum seed yield (2066.97 and 1844.50 kg/hm2, respectively), followed by CRF3 (1929.97 kg/hm2) and SF4 (1839.40 kg/hm2). There were no significant differences in seed yield among CK, SF1, and CRF1 (P>0.05). CRF4 had the highest profit (7126.4 CNY/hm2) and showed an increase of 12.37% in seed yield, and it decreased by 11.01% in unit fertilizer rate compared with SF4. The branch number, pod number, and dry matter weight compared with SF increased significantly under the fertilization of CRF (P<0.05). The pod number per plant was the major contributor to seed yield. On the other hand, the N, P, and K uptakes increased at first and then decreased with increasing the fertilizer rate at maturity, and the N, P, and K usage efficiency decreased with increasing the fertilizer rate. The N, P, and K uptakes and usage efficiencies of the CRF were significantly higher than those of SF (P<0.05). The N accumulation and N usage efficiency of CRF increased by an average of 13.66% and 9.74 percentage points, respectively, compared to SF. In conclusion, CRF significantly promoted the growth of rapeseed with using total N as the base fertilizer, by providing sufficient N in the later growth stages, and last by reducing the residual N in the soil and increasing the N accumulation and N usage efficiency. PMID:27704747

Effects of a controlled-release fertilizer on yield, nutrient uptake, and fertilizer usage efficiency in early ripening rapeseed (Brassica napus L.).

PubMed

Tian, Chang; Zhou, Xuan; Liu, Qiang; Peng, Jian-Wei; Wang, Wen-Ming; Zhang, Zhen-Hua; Yang, Yong; Song, Hai-Xing; Guan, Chun-Yun

Nitrogen (N), phosphorous (P), and potassium (K) are critical nutrient elements necessary for crop plant growth and development. However, excessive inputs will lead to inefficient usage and cause excessive nutrient losses in the field environment, and also adversely affect the soil, water and air quality, human health, and biodiversity. Field experiments were conducted to study the effects of controlled-release fertilizer (CRF) on seed yield, plant growth, nutrient uptake, and fertilizer usage efficiency for early ripening rapeseed (Xiangzayou 1613) in the red-yellow soil of southern China during 2011-2013. It was grown using a soluble fertilizer (SF) and the same amounts of CRF, such as SF1/CRF1 (3750 kg/hm 2 ), SF2/CRF2 (3000 kg/hm 2 ), SF3/CRF3 (2250 kg/hm 2 ), SF4/CRF4 (1500 kg/hm 2 ), SF5/CRF5 (750 kg/hm 2 ), and also using no fertilizer (CK). CRF gave higher seed yields than SF in both seasons by 14.51%. CRF4 and SF3 in each group achieved maximum seed yield (2066.97 and 1844.50 kg/hm 2 , respectively), followed by CRF3 (1929.97 kg/hm 2 ) and SF4 (1839.40 kg/hm 2 ). There were no significant differences in seed yield among CK, SF1, and CRF1 (P>0.05). CRF4 had the highest profit (7126.4 CNY/hm 2 ) and showed an increase of 12.37% in seed yield, and it decreased by 11.01% in unit fertilizer rate compared with SF4. The branch number, pod number, and dry matter weight compared with SF increased significantly under the fertilization of CRF (P<0.05). The pod number per plant was the major contributor to seed yield. On the other hand, the N, P, and K uptakes increased at first and then decreased with increasing the fertilizer rate at maturity, and the N, P, and K usage efficiency decreased with increasing the fertilizer rate. The N, P, and K uptakes and usage efficiencies of the CRF were significantly higher than those of SF (P<0.05). The N accumulation and N usage efficiency of CRF increased by an average of 13.66% and 9.74 percentage points, respectively, compared to SF. In conclusion, CRF significantly promoted the growth of rapeseed with using total N as the base fertilizer, by providing sufficient N in the later growth stages, and last by reducing the residual N in the soil and increasing the N accumulation and N usage efficiency.

Distinguishing plant population and variety with UAV-derived vegetation indices

NASA Astrophysics Data System (ADS)

Oakes, Joseph; Balota, Maria

2017-05-01

Variety selection and seeding rate are two important choice that a peanut grower must make. High yielding varieties can increase profit with no additional input costs, while seeding rate often determines input cost a grower will incur from seed costs. The overall purpose of this study was to examine the effect that seeding rate has on different peanut varieties. With the advent of new UAV technology, we now have the possibility to use indices collected with the UAV to measure emergence, seeding rate, growth rate, and perhaps make yield predictions. This information could enable growers to make management decisions early in the season based on low plant populations due to poor emergence, and could be a useful tool for growers to use to estimate plant population and growth rate in order to help achieve desired crop stands. Red-Green-Blue (RGB) and near-infrared (NIR) images were collected from a UAV platform starting two weeks after planting and continued weekly for the next six weeks. Ground NDVI was also collected each time aerial images were collected. Vegetation indices were derived from both the RGB and NIR images. Greener area (GGA- the proportion of green pixels with a hue angle from 80° to 120°) and a* (the average red/green color of the image) were derived from the RGB images while Normalized Differential Vegetative Index (NDVI) was derived from NIR images. Aerial indices were successful in distinguishing seeding rates and determining emergence during the first few weeks after planting, but not later in the season. Meanwhile, these aerial indices are not an adequate predictor of yield in peanut at this point.

Characteristics of a Direct-Seeded Eastern White Pine Plantation on the Mid-Cumberland Plateau at Four Ages

Treesearch

Glendon W. Smalley; James M. Hollingsworth

1997-01-01

Growth and yield of a direct-seeded eastern white pine (Pinus strobus L.) plantation established in 1959 on a broad undulating sandstone upland (Landtype 1) are summarized. Average heights of dominant and codominant pines were 35,56,65, and 76 ft at ages 15,25,30, and 34 years, respectively. Equivalent site indices (base age 25 years from seed)...

Evidence for Proteomic and Metabolic Adaptations Associated with Alterations of Seed Yield and Quality in Sulfur-limited Brassica napus L*

PubMed Central

D'Hooghe, Philippe; Dubousset, Lucie; Gallardo, Karine; Kopriva, Stanislav; Avice, Jean-Christophe; Trouverie, Jacques

2014-01-01

In Brassica napus, seed yield and quality are related to sulfate availability, but the seed metabolic changes in response to sulfate limitation remain largely unknown. To address this question, proteomics and biochemical studies were carried out on mature seeds obtained from plants grown under low sulfate applied at the bolting (LS32), early flowering (LS53), or start of pod filling (LS70) stage. The protein quality of all low-sulfate seeds was reduced and associated with a reduction of S-rich seed storage protein accumulation (as Cruciferin Cru4) and an increase of S-poor seed storage protein (as Cruciferin BnC1). This compensation allowed the protein content to be maintained in LS70 and LS53 seeds but was not sufficient to maintain the protein content in LS32 seeds. The lipid content and quality of LS53 and LS32 seeds were also affected, and these effects were primarily associated with a reduction of C18-derivative accumulation. Proteomics changes related to lipid storage, carbohydrate metabolism, and energy (reduction of caleosins, phosphoglycerate kinase, malate synthase, ATP-synthase β-subunit, and thiazole biosynthetic enzyme THI1 and accumulation of β-glucosidase and citrate synthase) provide insights into processes that may contribute to decreased oil content and altered lipid composition (in favor of long-chain fatty acids in LS53 and LS32 seeds). These data indicate that metabolic changes associated with S limitation responses affect seed storage protein composition and lipid quality. Proteins involved in plant stress response, such as dehydroascorbate reductase and Cu/Zn-superoxide dismutase, were also accumulated in LS53 and LS32 seeds, and this might be a consequence of reduced glutathione content under low S availability. LS32 treatment also resulted in (i) reduced germination vigor, as evidenced by lower germination indexes, (ii) reduced seed germination capacity, related to a lower seed viability, and (iii) a strong decrease of glyoxysomal malate synthase, which is essential for the use of fatty acids during seedling establishment. PMID:24554741

How early can the seeding dates of spring wheat be under current and future climate in Saskatchewan, Canada?

PubMed

He, Yong; Wang, Hong; Qian, Budong; McConkey, Brian; DePauw, Ron

2012-01-01

Shorter growing season and water stress near wheat maturity are the main factors that presumably limit the yield potential of spring wheat due to late seeding in Saskatchewan, Canada. Advancing seeding dates can be a strategy to help producers mitigate the impact of climate change on spring wheat. It is unknown, however, how early farmers can seed while minimizing the risk of spring frost damage and the soil and machinery constraints. This paper explores early seeding dates of spring wheat on the Canadian Prairies under current and projected future climate. To achieve this, (i) weather records from 1961 to 1990 were gathered at three sites with different soil and climate conditions in Saskatchewan, Canada; (ii) four climate databases that included a baseline (treated as historic weather climate during the period of 1961-1990) and three climate change scenarios (2040-2069) developed by the Canadian global climate model (GCM) with the forcing of three greenhouse gas (GHG) emission scenarios (A2, A1B and B1); (iii) seeding dates of spring wheat (Triticum aestivum L.) under baseline and projected future climate were predicted. Compared with the historical record of seeding dates, the predicted seeding dates were advanced under baseline climate for all sites using our seeding date model. Driven by the predicted temperature increase of the scenarios compared with baseline climate, all climate change scenarios projected significantly earlier seeding dates than those currently used. Compared to the baseline conditions, there is no reduction in grain yield because precipitation increases during sensitive growth stages of wheat, suggesting that there is potential to shift seeding to an earlier date. The average advancement of seeding dates varied among sites and chosen scenarios. The Swift Current (south-west) site has the highest potential for earlier seeding (7 to 11 days) whereas such advancement was small in the Melfort (north-east, 2 to 4 days) region. The extent of projected climate change in Saskatchewan indicates that growers in this region have the potential of earlier seeding. The results obtained in this study may be used for adaptation assessments of seeding dates under possible climate change to mitigate the impact of potential warming.

Increasing seed size and quality by manipulating BIG SEEDS1 in legume species

PubMed Central

Ge, Liangfa; Yu, Jianbin; Wang, Hongliang; Luth, Diane; Bai, Guihua; Wang, Kan

2016-01-01

Plant organs, such as seeds, are primary sources of food for both humans and animals. Seed size is one of the major agronomic traits that have been selected in crop plants during their domestication. Legume seeds are a major source of dietary proteins and oils. Here, we report a conserved role for the BIG SEEDS1 (BS1) gene in the control of seed size and weight in the model legume Medicago truncatula and the grain legume soybean (Glycine max). BS1 encodes a plant-specific transcription regulator and plays a key role in the control of the size of plant organs, including seeds, seed pods, and leaves, through a regulatory module that targets primary cell proliferation. Importantly, down-regulation of BS1 orthologs in soybean by an artificial microRNA significantly increased soybean seed size, weight, and amino acid content. Our results provide a strategy for the increase in yield and seed quality in legumes. PMID:27791139

Agrobacterium tumefaciens-mediated transformation of the soybean pathogen Phomopsis longicolla

USDA-ARS?s Scientific Manuscript database

Phomopsis seed decay (PSD) of soybean is caused primarily by the fungal pathogen Phomopsis longicolla. PSD impairs seed germination, reduces seedling vigor, and can substantially reduce stand establishment. In hot and humid conditions, PSD can cause significant yield losses. Few studies have explore...

Environmental Risks and Challenges Associated with Neonicotinoid Insecticides.

PubMed

Hladik, Michelle L; Main, Anson R; Goulson, Dave

2018-03-20

Neonicotinoid use has increased rapidly in recent years, with a global shift toward insecticide applications as seed coatings rather than aerial spraying. While the use of seed coatings can lessen the amount of overspray and drift, the near universal and prophylactic use of neonicotinoid seed coatings on major agricultural crops has led to widespread detections in the environment (pollen, soil, water, honey). Pollinators and aquatic insects appear to be especially susceptible to the effects of neonicotinoids with current research suggesting that chronic sublethal effects are more prevalent than acute toxicity. Meanwhile, evidence of clear and consistent yield benefits from the use of neonicotinoids remains elusive for most crops. Future decisions on neonicotinoid use will benefit from weighing crop yield benefits versus environmental impacts to nontarget organisms and considering whether there are more environmentally benign alternatives.

Genomic Prediction of Testcross Performance in Canola (Brassica napus)

PubMed Central

Jan, Habib U.; Abbadi, Amine; Lücke, Sophie; Nichols, Richard A.; Snowdon, Rod J.

2016-01-01

Genomic selection (GS) is a modern breeding approach where genome-wide single-nucleotide polymorphism (SNP) marker profiles are simultaneously used to estimate performance of untested genotypes. In this study, the potential of genomic selection methods to predict testcross performance for hybrid canola breeding was applied for various agronomic traits based on genome-wide marker profiles. A total of 475 genetically diverse spring-type canola pollinator lines were genotyped at 24,403 single-copy, genome-wide SNP loci. In parallel, the 950 F1 testcross combinations between the pollinators and two representative testers were evaluated for a number of important agronomic traits including seedling emergence, days to flowering, lodging, oil yield and seed yield along with essential seed quality characters including seed oil content and seed glucosinolate content. A ridge-regression best linear unbiased prediction (RR-BLUP) model was applied in combination with 500 cross-validations for each trait to predict testcross performance, both across the whole population as well as within individual subpopulations or clusters, based solely on SNP profiles. Subpopulations were determined using multidimensional scaling and K-means clustering. Genomic prediction accuracy across the whole population was highest for seed oil content (0.81) followed by oil yield (0.75) and lowest for seedling emergence (0.29). For seed yieId, seed glucosinolate, lodging resistance and days to onset of flowering (DTF), prediction accuracies were 0.45, 0.61, 0.39 and 0.56, respectively. Prediction accuracies could be increased for some traits by treating subpopulations separately; a strategy which only led to moderate improvements for some traits with low heritability, like seedling emergence. No useful or consistent increase in accuracy was obtained by inclusion of a population substructure covariate in the model. Testcross performance prediction using genome-wide SNP markers shows considerable potential for pre-selection of promising hybrid combinations prior to resource-intensive field testing over multiple locations and years. PMID:26824924

Monoterpene oxidation in an oxidative flow reactor: SOA yields and the relationship between bulk gas-phase properties and organic aerosol growth

NASA Astrophysics Data System (ADS)

Friedman, B.; Link, M.; Farmer, D.

2016-12-01

We use an oxidative flow reactor (OFR) to determine the secondary organic aerosol (SOA) yields of five monoterpenes (alpha-pinene, beta-pinene, limonene, sabinene, and terpinolene) at a range of OH exposures. These OH exposures correspond to aging timescales of a few hours to seven days. We further determine how SOA yields of beta-pinene and alpha-pinene vary as a function of seed particle type (organic vs. inorganic) and seed particle mass concentration. We hypothesize that the monoterpene structure largely accounts for the observed variance in SOA yields for the different monoterpenes. We also use high-resolution time-of-flight chemical ionization mass spectrometry to calculate the bulk gas-phase properties (O:C and H:C) of the monoterpene oxidation systems as a function of oxidant concentrations. Bulk gas-phase properties can be compared to the SOA yields to assess the capability of the precursor gas-phase species to inform the SOA yields of each monoterpene oxidation system. We find that the extent of oxygenated precursor gas-phase species corresponds to SOA yield.

Crotonic acid as a bioactive factor in carrot seeds (Daucus carota L.).

PubMed

Jasicka-Misiak, Izabela; Wieczorek, Piotr P; Kafarski, Paweł

2005-06-01

Water extracts from the carrot seed (Daucus carota L.) var. Perfekcja exhibit plant growth inhibitory properties against cress, cucumber, onion and carrot in a dose-dependant manner. This property results from the action of low-and high-molecular components of the extract. The low-molecular component was identified as crotonic acid ((E)-2-butenoic acid). Its presence was also confirmed in other late varieties of carrot. The determined strong herbicidal properties of crotonic acid and its availability after release to soil combined with its high level in seeds suggest that it might be considered as an allelopathic and autotoxic factor in the seeds.

Selection and Clonal Propagation of High Artemisinin Genotypes of Artemisia annua

PubMed Central

Wetzstein, Hazel Y.; Porter, Justin A.; Janick, Jules; Ferreira, Jorge F. S.; Mutui, Theophilus M.

2018-01-01

Artemisinin, produced in the glandular trichomes of Artemisia annua L. is a vital antimalarial drug effective against Plasmodium falciparum resistant to quinine-derived medicines. Although work has progressed on the semi-synthetic production of artemisinin, field production of A. annua remains the principal commercial source of the compound. Crop production of artemisia must be increased to meet the growing worldwide demand for artemisinin combination therapies (ACTs) to treat malaria. Grower artemisinin yields rely on plants generated from seeds from open-pollinated parents. Although selection has considerably increased plant artemisinin concentration in the past 15 years, seed-generated plants have highly variable artemisinin content that lowers artemisinin yield per hectare. Breeding efforts to produce improved F1 hybrids have been hampered by the inability to produce inbred lines due to self-incompatibility. An approach combining conventional hybridization and selection with clonal propagation of superior genotypes is proposed as a means to enhance crop yield and artemisinin production. Typical seed-propagated artemisia plants produce less than 1% (dry weight) artemisinin with yields below 25 kg/ha. Genotypes were identified producing high artemisinin levels of over 2% and possessing improved agronomic characteristics such as high leaf area and shoot biomass production. Field studies of clonally-propagated high-artemisinin plants verified enhanced plant uniformity and an estimated gross primary productivity of up to 70 kg/ha artemisinin, with a crop density of one plant m-2. Tissue culture and cutting protocols for the mass clonal propagation of A. annua were developed for shoot regeneration, rooting, acclimatization, and field cultivation. Proof of concept studies showed that both tissue culture-regenerated plants and rooted cutting performed better than plants derived from seed in terms of uniformity, yield, and consistently high artemisinin content. Use of this technology to produce plants with homogeneously-high artemisinin can help farmers markedly increase the artemisinin yield per cultivated area. This would lead to increased profit to farmers and decreased prices of ACT. PMID:29636758

Fuzzy inference enhanced information recovery from digital PIV using cross-correlation combined with particle tracking

NASA Technical Reports Server (NTRS)

Wernet, Mark P.

1995-01-01

Particle Image Velocimetry provides a means of measuring the instantaneous 2-component velocity field across a planar region of a seeded flowfield. In this work only two camera, single exposure images are considered where both cameras have the same view of the illumination plane. Two competing techniques which yield unambiguous velocity vector direction information have been widely used for reducing the single exposure, multiple image data: cross-correlation and particle tracking. Correlation techniques yield averaged velocity estimates over subregions of the flow, whereas particle tracking techniques give individual particle velocity estimates. The correlation technique requires identification of the correlation peak on the correlation plane corresponding to the average displacement of particles across the subregion. Noise on the images and particle dropout contribute to spurious peaks on the correlation plane, leading to misidentification of the true correlation peak. The subsequent velocity vector maps contain spurious vectors where the displacement peaks have been improperly identified. Typically these spurious vectors are replaced by a weighted average of the neighboring vectors, thereby decreasing the independence of the measurements. In this work fuzzy logic techniques are used to determine the true correlation displacement peak even when it is not the maximum peak on the correlation plane, hence maximizing the information recovery from the correlation operation, maintaining the number of independent measurements and minimizing the number of spurious velocity vectors. Correlation peaks are correctly identified in both high and low seed density cases. The correlation velocity vector map can then be used as a guide for the particle tracking operation. Again fuzzy logic techniques are used, this time to identify the correct particle image pairings between exposures to determine particle displacements, and thus velocity. The advantage of this technique is the improved spatial resolution which is available from the particle tracking operation. Particle tracking alone may not be possible in the high seed density images typically required for achieving good results from the correlation technique. This two staged approach offers a velocimetric technique capable of measuring particle velocities with high spatial resolution over a broad range of seeding densities.

Genetic variation and seed transfer guidelines for ponderosa pine in the Ochoco and Malheur National Forests of central Oregon.

Treesearch

Frank C. Sorensen; John C. Weber

1994-01-01

Adaptive genetic variation in seed and seedling traits was evaluated for 280 families from 220 locations. Factor scores from three principal components were related by multiple regression to latitude, longitude, elevation, slope, and aspect of the seed source, and by classification analysis to seed zone and elevation band in seed zone. Location variance was significant...

Generalized provisional seed zones for native plants

Treesearch

Andrew D. Bower; J. Bradley St.Clair; Vicky Erickson

2014-01-01

Deploying well-adapted and ecologically appropriate plant materials is a core component of successful restoration projects. We have developed generalized provisional seed zones that can be applied to any plant species in the United States to help guide seed movement. These seed zones are based on the intersection of high-resolution climatic data for winter minimum...

Cultivation and irrigation of fernleaf biscuitroot (Lomatium dissectum) for seed production

Treesearch

Myrtle P. Shock; Clinton C. Shock; Erik G. B. Feibert; Nancy L. Shaw; Lamont D. Saunders; Ram K. Sampangi

2012-01-01

Native grass, forb, and shrub seed is needed to restore rangelands of the U.S. Intermountain West. Fernleaf biscuitroot [Lomatium dissectum (Nutt.) Mathias & Constance] is a desirable component of rangelands. Commercial seed production is necessary to provide the quantity and quality of seed needed for rangeland restoration and reclamation efforts. Fernleaf...

Strategies for Seed Propagation of Native Forbs

Treesearch

Susan E. Meyer

2006-01-01

Native forbs are an increasingly important component of container production for many public and private nurseries. Propagators are often called upon to grow species with unknown requirements. A systematic approach is required to obtain plants from seeds of these species, beginning with determining what is a propagule and evaluating seed quality. Next, seed dormancy...

Phenotypic Stability of Zea mays Grain Yield and Its Attributing Traits under Drought Stress

PubMed Central

Ali, Fawad; Ahsan, Muhammad; Ali, Qurban; Kanwal, Naila

2017-01-01

Phenotypic stability under stress environment facilitate the fitness of genotype and opens new horizons to explore the cryptic genetic variation. Variation in tolerance to drought stress, a major grain yield constraint to global maize production, was identified, at the phenotypic and genotypic level. Here we found a prominent hybrid H9 that showed fitness over four growing seasons for grain yield under water stress conditions. Genotypic and phenotypic correlation of yield attributing traits over four seasons demonstrated that cobs per plant, 100 seed weight, number of grains rows per cob, total dry matter, cob diameter had positive association (r2 = 0.3–0.9) to grain yield. The perturbation was found for chlorophyll content as it showed moderate to strong association (P < 0.01) over four seasons, might be due to environment or genotype dependent. Highest heritability (95%) and genetic advance (79%) for grain yield was found in H9 over four consecutive crop growing seasons. Combined analysis over four seasons showed that studied variables together explained 85% of total variation in dependent structure (grain yield) obtained by Principal component analysis. This significant finding is the best example of phenotypic stability of grain yield in H9 and made it best fitted for grain yield under drought stress scenario. Detailed genetic analysis of H9 will help us to identify significant loci and alleles that made H9 the best fitted and it could serve as a potential source to generate novel transgressive levels of tolerance for drought stress in arid/semiarid regions. PMID:28878785

Phenotypic Stability of Zea mays Grain Yield and Its Attributing Traits under Drought Stress.

PubMed

Ali, Fawad; Ahsan, Muhammad; Ali, Qurban; Kanwal, Naila

2017-01-01

Phenotypic stability under stress environment facilitate the fitness of genotype and opens new horizons to explore the cryptic genetic variation. Variation in tolerance to drought stress, a major grain yield constraint to global maize production, was identified, at the phenotypic and genotypic level. Here we found a prominent hybrid H 9 that showed fitness over four growing seasons for grain yield under water stress conditions. Genotypic and phenotypic correlation of yield attributing traits over four seasons demonstrated that cobs per plant, 100 seed weight, number of grains rows per cob, total dry matter, cob diameter had positive association ( r 2 = 0.3-0.9) to grain yield. The perturbation was found for chlorophyll content as it showed moderate to strong association ( P < 0.01) over four seasons, might be due to environment or genotype dependent. Highest heritability (95%) and genetic advance (79%) for grain yield was found in H 9 over four consecutive crop growing seasons. Combined analysis over four seasons showed that studied variables together explained 85% of total variation in dependent structure (grain yield) obtained by Principal component analysis. This significant finding is the best example of phenotypic stability of grain yield in H 9 and made it best fitted for grain yield under drought stress scenario. Detailed genetic analysis of H 9 will help us to identify significant loci and alleles that made H 9 the best fitted and it could serve as a potential source to generate novel transgressive levels of tolerance for drought stress in arid/semiarid regions.

Feeding damage to plants increases with plant size across 21 Brassicaceae species.

PubMed

Schlinkert, Hella; Westphal, Catrin; Clough, Yann; Ludwig, Martin; Kabouw, Patrick; Tscharntke, Teja

2015-10-01

Plant size is a major predictor of ecological functioning. We tested the hypothesis that feeding damage to plants increases with plant size, as the conspicuousness of large plants makes resource finding and colonisation easier. Further, large plants can be attractive to herbivores, as they offer greater amounts and ranges of resources and niches, but direct evidence from experiments testing size effects on feeding damage and consequently on plant fitness is so far missing. We established a common garden experiment with a plant size gradient (10-130 cm height) using 21 annual Brassicaceae species, and quantified plant size, biomass and number of all aboveground components (flowers, fruits, leaves, stems) and their proportional feeding damage. Plant reproductive fitness was measured using seed number, 1000 seed weight and total seed weight. Feeding damage to the different plant components increased with plant size or component biomass, with mean damage levels being approximately 30 % for flowers, 5 % for fruits and 1 % for leaves and stems. Feeding damage affected plant reproductive fitness depending on feeding damage type, with flower damage having the strongest effect, shown by greatly reduced seed number, 1000 seed weight and total seed weight. Finally, we found an overall negative effect of plant size on 1000 seed weight, but not on seed number and total seed weight. In conclusion, being conspicuous and attractive to herbivores causes greater flower damage leading to higher fitness costs for large plants, which might be partly counterbalanced by benefits such as enhanced competitive/compensatory abilities or more mutualistic pollinator visits.

Developmental Differences in Embryos of High and Low Protein Wheat Seeds during Germination 1

PubMed Central

Ching, Te May; Rynd, Lori

1978-01-01

Developmental patterns of embryos from high and low protein wheat (Triticum aestivum) grain produced under varied fertilizer conditions were compared. High protein grain produced seedlings 25% heavier with 25% more total RNA, 30% more DNA, 40% more amino acids, 60% more ribosomes, and 80% more soluble protein content than that of low protein seed. Consistently higher glutamine synthetase and α-amylase and lower acid phosphatase activities were observed in high protein seeds, though the isozyme pattern of α-amylase was not different in the two kinds of seeds. The high total ribosomes and particularly, polysome content observed in high protein seeds may be responsible for the rapid growth and high yield of these seeds. PMID:16660627

Fewer not more leaves - Key to obtaining the needed jump in crop yield potential and water use efficiency

NASA Astrophysics Data System (ADS)

Srinivasan, V.; Kumar, P.; Long, S.

2013-12-01

Word food and feed supply needs to increase by 75% by 2050 to meet the increasing demands of our growing population. Soybean which is the world`s fourth most important crop in terms of total production at 250 million Mt/yr is a key protein source, and together with rice and wheat, are experiencing declining global yield increases year on year. At present rates of improvement, 2050 targets cannot be reached without new innovations. In this study we demonstrate an innovative approach that could provide a yield jump. While, natural selection favors individual plants to maximize leaf production to maximize light interception and shade competitors, the presence of this trait in domestic crops could be disadvantageous. In addition, rising CO2 causes increased leaf production further exacerbating the problem. Here, we show by mathematical model and field experiment that, a modern cultivar growing at the center of US soy cultivation produces too many leaves and reduction to an optimal level would increase yield. Our model results indicate that an LAI of 3.5 and 3.8 produces maximal rates of net canopy assimilation under ambient and elevated CO2 conditions respectively. However, observed peak LAI values are 6.9 and 7.5 under ambient and elevated CO2 conditions respectively. This results in a NPP loss of 30% and 20% under ambient and elevated CO2 conditions respectively. Furthermore, the optimal LAI results in a decreased transpiration of up to 30% thus increasing water use efficiency. We show that as LAI increases, the tradeoffs between diminishing day time gains in NPP, and increasing losses in respiration is responsible for this effect. By designing a more optimum canopy, we can increase NPP and this potentially translates to increased seed yield. To test this model result, we perform canopy manipulation experiments on soybean plants, where we artificially decrease LAI by periodically removing young and emerging leaves throughout the growing season (after pod onset), and measure the seed yield under ambient and elevated CO2 conditions. Our experimental results show that an LAI reduction of 0.5 results in an increased seed yield of 8.1% validating our model results. We propose that, by achieving a stronger LAI reduction, we can improve seed yields by up to 24% providing the much needed jump in yield to achieve future food security.

Searching for genetic tolerance to choke in orchardgrass germplasm

USDA-ARS?s Scientific Manuscript database

The sexual cycle of the endophyte Epichloe typhina can 'choke' seed production in certain forage and turf grasses. Orchardgrass is susceptible to choke in Oregon's Willamette Valley, with seed yield losses several years ago reported at 9%, but now much higher in older fields. Although development ...

Hydrodistillation time affects dill seed essential oil yield, composition, and bioactivity

USDA-ARS?s Scientific Manuscript database

Dill (Anethum graveolens L.) essential oil is widely used by the food and pharmaceutical industries. We hypothesized that the chemical constituents of dill seed essential oil are eluted at different times during the hydrodistillation process, resulting in oils with different composition and bioactiv...

Adsorption of methylene blue onto activated carbon produced from tea (Camellia sinensis L.) seed shells: kinetics, equilibrium, and thermodynamics studies.

PubMed

Gao, Jun-Jie; Qin, Ye-Bo; Zhou, Tao; Cao, Dong-Dong; Xu, Ping; Hochstetter, Danielle; Wang, Yue-Fei

2013-07-01

Tea (Camellia sinensis L.) seed shells, the main byproduct of the manufacture of tea seed oil, were used as precursors for the preparation of tea activated carbon (TAC) in the present study. A high yield (44.1%) of TAC was obtained from tea seed shells via a one-step chemical method using ZnCl2 as an agent. The Brunauer-Emmett-Teller (BET) surface area and the total pore volumes of the obtained TAC were found to be 1530.67 mg(2)/g and 0.7826 cm(3)/g, respectively. The equilibrium adsorption results were complied with Langmuir isotherm model and its maximum monolayer adsorption capacity was 324.7 mg/g for methylene blue. Adsorption kinetics studies indicated that the pseudo-second-order model yielded the best fit for the kinetic data. An intraparticle diffusion model suggested that the intraparticle diffusion was not the only rate-controlling step. Thermodynamics studies revealed the spontaneous and exothermic nature of the sorption process. These results indicate that tea seed shells could be utilized as a renewable resource to develop activated carbon which is a potential adsorbent for methylene blue.

Adsorption of methylene blue onto activated carbon produced from tea (Camellia sinensis L.) seed shells: kinetics, equilibrium, and thermodynamics studies*

PubMed Central

Gao, Jun-jie; Qin, Ye-bo; Zhou, Tao; Cao, Dong-dong; Xu, Ping; Hochstetter, Danielle; Wang, Yue-fei

2013-01-01

Tea (Camellia sinensis L.) seed shells, the main byproduct of the manufacture of tea seed oil, were used as precursors for the preparation of tea activated carbon (TAC) in the present study. A high yield (44.1%) of TAC was obtained from tea seed shells via a one-step chemical method using ZnCl2 as an agent. The Brunauer-Emmett-Teller (BET) surface area and the total pore volumes of the obtained TAC were found to be 1 530.67 mg2/g and 0.782 6 cm3/g, respectively. The equilibrium adsorption results were complied with Langmuir isotherm model and its maximum monolayer adsorption capacity was 324.7 mg/g for methylene blue. Adsorption kinetics studies indicated that the pseudo-second-order model yielded the best fit for the kinetic data. An intraparticle diffusion model suggested that the intraparticle diffusion was not the only rate-controlling step. Thermodynamics studies revealed the spontaneous and exothermic nature of the sorption process. These results indicate that tea seed shells could be utilized as a renewable resource to develop activated carbon which is a potential adsorbent for methylene blue. PMID:23825151

Overexpression of MYB115, AAD2, or AAD3 in Arabidopsis thaliana seeds yields contrasting omega-7 contents

PubMed Central

To, Alexandra; Barthole, Guillaume; Lepiniec, Loïc

2018-01-01

Omega-7 monoenoic fatty acids (ω-7 FAs) are increasingly exploited both for their positive effects on health and for their industrial potential. Some plant species produce fruits or seeds with high amounts of ω-7 FAs. However, the low yields and poor agronomic properties of these plants preclude their commercial use. As an alternative, the metabolic engineering of oilseed crops for sustainable ω-7 FA production has been proposed. Two palmitoyl-ACP desaturases (PADs) catalyzing ω-7 FA biosynthesis were recently identified and characterized in Arabidopsis thaliana, together with MYB115 and MYB118, two transcription factors that positively control the expression of the corresponding PAD genes. In the present research, we examine the biotechnological potential of these new actors of ω-7 metabolism for the metabolic engineering of plant-based production of ω-7 FAs. We placed the PAD and MYB115 coding sequences under the control of a promoter strongly induced in seeds and evaluated these different constructs in A. thaliana. Seeds were obtained that exhibit ω-7 FA contents ranging from 10 to >50% of the total FAs, and these major compositional changes have no detrimental effect on seed germination. PMID:29381741

Effects of prolonged exposure of lettuce seeds to HZE particles on orbital stations

NASA Astrophysics Data System (ADS)

Nevzgodina, L. V.; Maksimova, E. N.; Kaminskaya, E. V.

In a study of the biological effects of cosmic HZE particles, lettuce (Lactuca sativa) seeds were flown on the orbital stations Salyut 6 and 7 for varying periods of time (from 40 to 457 days). The dependence of the biological damage on flight duration, physical parameters and the fact of passage of an HZE particle through the seed was estimated using the criterion of the frequency of aberrant cells. The arrangement of the flight biological container Biobloc made it possible to trace the location of tracks of individual HZE particles with Z>=6 and LET 200 keV/um. In seeds hit by HZE particles, for all exposure times, a statistically significant much higher yield of aberrant cells and also of cells containing multiple chromosome aberrations was observed than in the control material. The frequency of aberrant cells is markedly higher (by a factor of 1,5) in seeds hit than in non-hit ones. The changes of the yield of aberrant cells as a function of the absorbed dose (3.2-63.4 mGy) and the fluence (4.8-44.2 particles/cm2) are linear for the exposure duration ranging from 40 to 457 days.

OsGRF4 controls grain shape, panicle length and seed shattering in rice

PubMed Central

Sun, Pingyong; Zhang, Wuhan; Wang, Yihua; He, Qiang; Shu, Fu; Liu, Hai; Wang, Jie; Wang, Jianmin; Yuan, Longping

2016-01-01

Abstract Traits such as grain shape, panicle length and seed shattering, play important roles in grain yield and harvest. In this study, the cloning and functional analysis of PANICLE TRAITS 2 (PT2), a novel gene from the Indica rice Chuandali (CDL), is reported. PT2 is synonymous with Growth‐Regulating Factor 4 (OsGRF4), which encodes a growth‐regulating factor that positively regulates grain shape and panicle length and negatively regulates seed shattering. Higher expression of OsGRF4 is correlated with larger grain, longer panicle and lower seed shattering. A unique OsGRF4 mutation, which occurs at the OsmiRNA396 target site of OsGRF4, seems to be associated with high levels of OsGRF4 expression, and results in phenotypic difference. Further research showed that OsGRF4 regulated two cytokinin dehydrogenase precursor genes (CKX5 and CKX1) resulting in increased cytokinin levels, which might affect the panicle traits. High storage capacity and moderate seed shattering of OsGRF4 may be useful in high‐yield breeding and mechanized harvesting of rice. Our findings provide additional insight into the molecular basis of panicle growth. PMID:26936408

Nutritional quality and essential oil compositions of Thaumatococcus danielli (Benn.) tissue and seed.

PubMed

Abiodun, O A; Akinoso, R; Olosunde, O O; Adegbite, J A; Omolola, O A

2014-10-01

Nutritional quality and essential oil compositions of Thaumatococcus danielli (Benn.) tissue and seed were determined. Oil was extracted from the seed using standard methods while the fatty acids of the oil, chemical and anti-nutritional properties of defatted seed flour were determined. Total fat yield of the seed flour was 12.20%. Defatted seed flour had higher crude fibre (36.92%), carbohydrate (40.07%) and ash (8.17%) contents. Major mineral contents were potassium, calcium, sodium and magnesium. The tissue contain appreciable amount of vitamin C (8.10 mg/100 g). Oleic acid (42.59%) was the major fatty acid in the seed oil and the total unsaturated fatty acid was 62.38%. The seed oil had higher acid and saponification values and low iodine value. Oxalate (11.09 mg/100 g) content was the major anti-nutrient in the defatted seed flour. Defatted T. danielli seed flour serves as good source of dietary fibre and energy. Copyright © 2014 Elsevier Ltd. All rights reserved.

Proximate Composition of Seed and Biomass from Soybean Plants Grown at Different Carbon Dioxide (CO2) Concentrations

NASA Technical Reports Server (NTRS)

Wheeler, R. M.; Mackowiak, C. L.; Sager, J. C.

1990-01-01

Soybean plants were grown for 90 days at 500, 1000, 2000, and 5000 ubar (ppm) carbon dioxide (CO2) and compared for proximate nutritional value. For both cultivars (MC and PX), seed protein levels were highest at 1000 (39.3 and 41.9 percent for MC and PX) and lowest at 2000 (34.7 and 38.9 percent for MC and PX). Seed fat (oil) levels were highest at 2000 (21.2 and 20.9 percent for MC and PX) and lowest at 5000 (13.6 and 16.6 percent for MC and PX). Seed carbohydrate levels were highest at 500 (31.5 and 28.4 percent for MC and PX) and lowest at 2000 (20.9 and 20.8 percent for MC and PX). When adjusted for total seed yield per unit growing area, the highest production of protein and carbohydrate occurred with MC at 1000, while equally high amounts of fat were produced with MC at 1000 and 2000. Seed set and pod development at 2000 were delayed in comparison to other CO2 treatments; thus the proportionately high fat and low protein at 2000 may have been a result of the delay in plant maturity rather than CO2 concentration. Stem crude fiber and carbohydrate levels for both cultivars increased with increased CO2. Leaf protein and crude fiber levels also tended to rise with increased CO2 but leaf carbohydrate levels decreased as CO2 was increased. The results suggest that CO2 effects on total seed yield out-weighed any potential advantages to changes in seed composition.

A transgene design for enhancing oil content in Arabidopsis and Camelina seeds

DOE PAGES

Zhu, Yerong; Xie, Linan; Chen, Grace Q.; ...

2018-02-21

Background: Increasing the oil yield is a major objective for oilseed crop improvement. Oil biosynthesis and accumulation are influenced by multiple genes involved in embryo and seed development. The leafy cotyledon1 (LEC1) is a master regulator of embryo development that also enhances the expression of genes involved in fatty acid biosynthesis. We speculated that seed oil could be increased by targeted overexpression of a master regulating transcription factor for oil biosynthesis, using a downstream promoter for a gene in the oil biosynthesis pathway. To verify the effect of such a combination on seed oil content, we made constructs with maizemore » (Zea mays) ZmLEC1 driven by serine carboxypeptidase-like (SCPL17) and acyl carrier protein (ACP5) promoters, respectively, for expression in transgenic Arabidopsis thaliana and Camelina sativa. Results: Agrobacterium-mediated transformation successfully generated Arabidopsis and Camelina lines that overexpressed ZmLEC1 under the control of a seed-specific promoter. This overexpression does not appear to be detrimental to seed vigor under laboratory conditions and did not cause observable abnormal growth phenotypes throughout the life cycle of the plants. Overexpression of ZmLEC1 increased the oil content in mature seeds by more than 20% in Arabidopsis and 26% in Camelina. In conclusion: The findings suggested that the maize master regulator, ZmLEC1, driven by a downstream seed-specific promoter, can be used to increase oil production in Arabidopsis and Camelina and might be a promising target for increasing oil yield in oilseed crops.0« less

A transgene design for enhancing oil content in Arabidopsis and Camelina seeds

DOE Office of Scientific and Technical Information (OSTI.GOV)

Zhu, Yerong; Xie, Linan; Chen, Grace Q.

Background: Increasing the oil yield is a major objective for oilseed crop improvement. Oil biosynthesis and accumulation are influenced by multiple genes involved in embryo and seed development. The leafy cotyledon1 (LEC1) is a master regulator of embryo development that also enhances the expression of genes involved in fatty acid biosynthesis. We speculated that seed oil could be increased by targeted overexpression of a master regulating transcription factor for oil biosynthesis, using a downstream promoter for a gene in the oil biosynthesis pathway. To verify the effect of such a combination on seed oil content, we made constructs with maizemore » (Zea mays) ZmLEC1 driven by serine carboxypeptidase-like (SCPL17) and acyl carrier protein (ACP5) promoters, respectively, for expression in transgenic Arabidopsis thaliana and Camelina sativa. Results: Agrobacterium-mediated transformation successfully generated Arabidopsis and Camelina lines that overexpressed ZmLEC1 under the control of a seed-specific promoter. This overexpression does not appear to be detrimental to seed vigor under laboratory conditions and did not cause observable abnormal growth phenotypes throughout the life cycle of the plants. Overexpression of ZmLEC1 increased the oil content in mature seeds by more than 20% in Arabidopsis and 26% in Camelina. In conclusion: The findings suggested that the maize master regulator, ZmLEC1, driven by a downstream seed-specific promoter, can be used to increase oil production in Arabidopsis and Camelina and might be a promising target for increasing oil yield in oilseed crops.0« less

[Seed geography: its concept and basic scientific issues].

PubMed

Yu, Shun-Li; Wang, Zong-Shuai; Zeren, Wangmu

2010-01-01

In this paper, a new concept 'seed geography' was provided, and its definition, research contents, and scientific issues were put forward. Seed geography is a newly developed interdisciplinary science from plant geography, seed ecology, and phytosociology, which studies the geographic variation patterns of seed biological traits as well as their relationships with environmental factors from macroscopic to microscopic, and the seed formation, development, and change trends. The main research contents would include geography of seed mass, geography of seed chemical components, geography of seed morphology, geography of seed cell biological characteristics, geography of seed physiological characteristics, geography of seed genetic characteristics, and geography of flower and fruit. To explore the scientific issues in seed geography would help us to better understand the long-term adaptation and evolution of seed characteristics to natural environments.

Hemp ( Cannabis sativa L.) seed oil: analytical and phytochemical characterization of the unsaponifiable fraction.

PubMed

Montserrat-de la Paz, S; Marín-Aguilar, F; García-Giménez, M D; Fernández-Arche, M A

2014-02-05

Non-drug varieties of Cannabis sativa L., collectively namely as "hemp", have been an interesting source of food, fiber, and medicine for thousands of years. The ever-increasing demand for vegetables oils has made it essential to characterize additional vegetable oil through innovative uses of its components. The lipid profile showed that linoleic (55%), α-linolenic (16%), and oleic (11%) were the most abundant fatty acids. A yield (1.84-1.92%) of unsaponifiable matter was obtained, and the most interesting compounds were β-sitosterol (1905.00 ± 59.27 mg/kg of oil), campesterol (505.69 ± 32.04 mg/kg of oil), phytol (167.59 ± 1.81 mg/kg of oil), cycloartenol (90.55 ± 3.44 mg/kg of oil), and γ-tocopherol (73.38 ± 2.86 mg/100 g of oil). This study is an interesting contribution for C. sativa L. consideration as a source of bioactive compounds contributing to novel research applications for hemp seed oil in the pharmaceutical, cosmetic food, and other non-food industries.

Optimization of Submerged Fermentation Medium for Matrine Production by Aspergillus terreus, an Endophytic Fungus Harboring Seeds of Sophora flavescens, Using Response Surface Methodology

PubMed Central

Zhang, Qiang; Li, Yujuan; Xu, Fangxue; Zheng, Mengmeng; Xi, Xiaozhi

2017-01-01

Different endophytes isolated from the seeds of Sophora flavescens were tested for their ability to produce matrine production. Response surface methodology (RSM) was applied to optimize the medium components for the endophytic fungus. Results indicated that endophyte Aspergillus terreus had the ability to produce matrine. The single factor tests demonstrated that potato starch was the best carbon source and the combination of peptone and NH4NO3 was the optimal nitrogen source for A. terreus. The model of RSM predicted to gain the maximal matrine production at 20.67 µg/L, when the potato starch was 160.68 g/L, peptone was 24.96 g/L and NH4NO3 was 2.11 g/L. When cultured in the optimal medium, the matrine yield was an average of 20.63 ± 0.11 µg/L, which was consistent with the model prediction. This study offered an alternative source for the matrine production by endophytic fungus fermentation and may have far-reaching prospect and value. PMID:28781541

Optimization of Submerged Fermentation Medium for Matrine Production by Aspergillus terreus, an Endophytic Fungus Harboring Seeds of Sophora flavescens, Using Response Surface Methodology.

PubMed

Zhang, Qiang; Li, Yujuan; Xu, Fangxue; Zheng, Mengmeng; Xi, Xiaozhi; Zhang, Xuelan; Han, Chunchao

2017-06-01

Different endophytes isolated from the seeds of Sophora flavescens were tested for their ability to produce matrine production. Response surface methodology (RSM) was applied to optimize the medium components for the endophytic fungus. Results indicated that endophyte Aspergillus terreus had the ability to produce matrine. The single factor tests demonstrated that potato starch was the best carbon source and the combination of peptone and NH 4 NO 3 was the optimal nitrogen source for A. terreus . The model of RSM predicted to gain the maximal matrine production at 20.67 µg/L, when the potato starch was 160.68 g/L, peptone was 24.96 g/L and NH 4 NO 3 was 2.11 g/L. When cultured in the optimal medium, the matrine yield was an average of 20.63 ± 0.11 µg/L, which was consistent with the model prediction. This study offered an alternative source for the matrine production by endophytic fungus fermentation and may have far-reaching prospect and value.

Bio-energy Alliance High-Tonnage Bio-energy Crop Production and Conversion into Conventional Fuels

DOE Office of Scientific and Technical Information (OSTI.GOV)

Capareda, Sergio; El-Halwagi, Mahmoud; Hall, Kenneth R.

2012-11-30

Maintaining a predictable and sustainable supply of feedstock for bioenergy conversion is a major goal to facilitate the efficient transition to cellulosic biofuels. Our work provides insight into the complex interactions among agronomic, edaphic, and climatic factors that affect the sustainability of bioenergy crop yields. Our results provide science-based agronomic response measures that document how to better manage bioenergy sorghum production from planting to harvest. We show that harvest aids provide no significant benefit as a means to decrease harvest moisture or improve bioenergy yields. Our efforts to identify optimal seeding rates under varied edaphic and climatological conditions reinforce previousmore » findings that sorghum is a resilient plant that can efficiently adapt to changing population pressures by decreasing or increasing the numbers of additional shoots or tillers – where optimal seeding rates for high biomass photoperiod sensitive sorghum is 60,000 to 70,000 seeds per acre and 100,000 to 120,000 seeds per acre for sweet varieties. Our varietal adaptability trials revealed that high biomass photoperiod sensitive energy sorghum consistently outperforms conventional photoperiod insensitive sweet sorghum and high biomass forage sorghum as the preferred bioenergy sorghum type, with combined theoretical yields of both cellulosic and fermentable water-soluble sugars producing an average yield of 1,035 gallons of EtOH per acre. Our nitrogen trials reveal that sweet sorghums produce ample amounts of water-soluble sugars with minimal increases in nitrogen inputs, and that excess nitrogen can affect minor increases in biomass yields and cellulosic sugars but decrease bioenergy quality by decreasing water-soluble sugar concentrations and increasing ash content, specifically when plant tissue nitrogen concentrations exceed 0.6 %, dry weight basis. Finally, through our growth and re-growth trials, we show that single-cut high biomass sorghum bioenergy yields significantly exceed those of multiple-cut high biomass sorghum systems. Our agronomic yield and quality data will be uploaded to the Bioenergy KDF Website before the end of February 2013, with a date for public access to be determined pending peer-reviewed publication of our findings.« less

Tomato seeds maturity detection system based on chlorophyll fluorescence

NASA Astrophysics Data System (ADS)

Li, Cuiling; Wang, Xiu; Meng, Zhijun

2016-10-01

Chlorophyll fluorescence intensity can be used as seed maturity and quality evaluation indicator. Chlorophyll fluorescence intensity of seed coats is tested to judge the level of chlorophyll content in seeds, and further to judge the maturity and quality of seeds. This research developed a detection system of tomato seeds maturity based on chlorophyll fluorescence spectrum technology, the system included an excitation light source unit, a fluorescent signal acquisition unit and a data processing unit. The excitation light source unit consisted of two high power LEDs, two radiators and two constant current power supplies, and it was designed to excite chlorophyll fluorescence of tomato seeds. The fluorescent signal acquisition unit was made up of a fluorescence spectrometer, an optical fiber, an optical fiber scaffolds and a narrowband filter. The data processing unit mainly included a computer. Tomato fruits of green ripe stage, discoloration stage, firm ripe stage and full ripe stage were harvested, and their seeds were collected directly. In this research, the developed tomato seeds maturity testing system was used to collect fluorescence spectrums of tomato seeds of different maturities. Principal component analysis (PCA) method was utilized to reduce the dimension of spectral data and extract principal components, and PCA was combined with linear discriminant analysis (LDA) to establish discriminant model of tomato seeds maturity, the discriminant accuracy was greater than 90%. Research results show that using chlorophyll fluorescence spectrum technology is feasible for seeds maturity detection, and the developed tomato seeds maturity testing system has high detection accuracy.

Variation in the fatty-acid content in seeds of various black, red, and white currant varieties.

PubMed

Šavikin, Katarina P; Ðorđević, Boban S; Ristić, Mihailo S; Krivokuća-Ðokić, Dragana; Pljevljakušić, Dejan S; Vulić, Todor

2013-01-01

Currant seeds, a by-product of juice production, are recognized as a valuable source of oil rich in polyunsaturated fatty acids. We have evaluated 28 currant varieties for their oil content and fatty-acid composition. The oil content in the seeds ranged from 18.2-27.7%, and no statistical difference between varieties of different fruit color were recorded. Furthermore, the estimated oil yields in the field production ranged from 26.4-212.4 kg/ha. The GC and GC/MS chemical profiles of the seed oils extracted from all examined varieties were common for currants. Linoleic acid (LA) was the major component, with contents ranging from 32.7-46.9% of total fatty acids, followed by α-linolenic acid (ALA; 2.9-32.0 %), oleic acid (OA; 9.8-19.9%), γ-linolenic acid (GLA; 3.3-18.5%), palmitic acid (PA; 4.4-8.1%), stearidonic acid (SDA; 2.2-4.7%), and stearic acid (SA; 1.2-2.4%). Quantitative differences in the fatty-acid profiles between varieties of different fruit color were observed. Blackcurrant varieties showed significantly higher contents of LA, GLA, and PA than red and white currant varieties, whereas significantly higher amounts of ALA and OL were detected in the red and white varieties. Cluster analysis based on the chemical oil profiles joined the blackcurrants in one group, while most of the red and white cultivars joined in a second group at the same linkage distance. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.

Application of Hyperspectral Imaging and Chemometric Calibrations for Variety Discrimination of Maize Seeds

PubMed Central

Zhang, Xiaolei; Liu, Fei; He, Yong; Li, Xiaoli

2012-01-01

Hyperspectral imaging in the visible and near infrared (VIS-NIR) region was used to develop a novel method for discriminating different varieties of commodity maize seeds. Firstly, hyperspectral images of 330 samples of six varieties of maize seeds were acquired using a hyperspectral imaging system in the 380–1,030 nm wavelength range. Secondly, principal component analysis (PCA) and kernel principal component analysis (KPCA) were used to explore the internal structure of the spectral data. Thirdly, three optimal wavelengths (523, 579 and 863 nm) were selected by implementing PCA directly on each image. Then four textural variables including contrast, homogeneity, energy and correlation were extracted from gray level co-occurrence matrix (GLCM) of each monochromatic image based on the optimal wavelengths. Finally, several models for maize seeds identification were established by least squares-support vector machine (LS-SVM) and back propagation neural network (BPNN) using four different combinations of principal components (PCs), kernel principal components (KPCs) and textural features as input variables, respectively. The recognition accuracy achieved in the PCA-GLCM-LS-SVM model (98.89%) was the most satisfactory one. We conclude that hyperspectral imaging combined with texture analysis can be implemented for fast classification of different varieties of maize seeds. PMID:23235456

In Vitro Inhibition of Cholera Toxin Production in Vibrio cholerae by Methanol Extract of Sweet Fennel Seeds and Its Components.

PubMed

Chatterjee, Shruti; Zahid, M Shamim Hasan; Awasthi, Sharda Prasad; Chowdhury, Nityananda; Asakura, Masahiro; Hinenoya, Atsushi; Ramamurthy, T; Iwaoka, Emiko; Aoki, Shunji; Yamasaki, Shinji

2016-09-21

A newly emerged Vibrio cholerae O1 El Tor variant strain with multidrug resistance is considered a threat to public health. Recent strategies to suppress virulence factors production instead of bacterial growth may lead to less selective pressure for the emergence of resistant strains. The use of spices and their active constituents as the inhibitory agents against cholera toxin (CT) production in V. cholerae may be an alternative approach to treat cholera. In this study, we examined the potential of sweet fennel seed (Foeniculum vulgare Miller var. dulce) methanol extract to inhibit CT production in V. cholerae without affecting viability. The methanol extract of sweet fennel seeds significantly inhibited CT production in various V. cholerae strains, regardless of serogroup or biotype. Interestingly, trans-anethole and 4-allylanisole, essential oil components of sweet fennel seeds, also demonstrated similar effects. Here, we report that sub-bactericidal concentrations of sweet fennel seed methanol extract and its major components can drastically inhibit CT production in various V. cholerae strains.

Activity of meadowfoam (Limnanthes alba) seed meal glucolimnanthin degradation products against soilborne pathogens

USDA-ARS?s Scientific Manuscript database

Meadowfoam (Limnanthes alba L.) is a herbaceous winter-spring annual grown as a commercial oilseed crop. The meal remaining after oil extraction from the seed contains up to 4% of the glucosinolate glucolimnanthin. Degradation of glucolimnanthin yields toxic breakdown products, and therefore the mea...

Reaction of Diaporthe longicolla to a strain of Sarocladium kiliense

USDA-ARS?s Scientific Manuscript database

Phomopsis seed decay (PSD) of soybean [Glycine max (L.) Merr.] is a seedborne fungal disease caused by Diaporthe (syn. Phomopsis) longicolla that causes yield losses and reduced seed quality. Biocontrol of this pathogen by a strain of Acremonium strictum isolated from a culture of D. longicolla was ...

Thiamethoxam seed treatments hav no impact on pest numbers or yield in cultivated sunflowers

USDA-ARS?s Scientific Manuscript database

The use of neonicotinoid seed treatments is a nearly ubiquitous practice in sunflower (Helianthus annuus) pest management. Sunflowers have a speciose pest complex, but also harbor a diverse and abundant community of beneficial, non-target organisms which may be negatively affected by pest management...

Effect of Fungicide Seed Treatments on Fusarium virguliforme and Sudden Death Syndrome of Soybean

USDA-ARS?s Scientific Manuscript database

Sudden death syndrome (SDS) is a yield reducing disease increasing in prevalence across soybean producing states. Recent research indicates the SDS pathogen, Fusarium virguliforme, can infect as early as initial radicle emergence. This suggests fungicide seed treatments could offer some protection a...

7 CFR 407.15 - Group risk plan for sorghum.

Code of Federal Regulations, 2012 CFR

2012-01-01

... expected county yield and calculate indemnities. Planted acreage. Land in which the sorghum seed has been... subsequent mechanical incorporation of the sorghum seed is not allowed. 2. Crop Insured (a) The insured crop... application; (2) Properly planted and reported by the acreage reporting date; (3) Planted with the intent to...

7 CFR 407.15 - Group risk plan for sorghum.

Code of Federal Regulations, 2011 CFR

2011-01-01

... expected county yield and calculate indemnities. Planted acreage. Land in which the sorghum seed has been... subsequent mechanical incorporation of the sorghum seed is not allowed. 2. Crop Insured (a) The insured crop... application; (2) Properly planted and reported by the acreage reporting date; (3) Planted with the intent to...

Impact of ground speed and varying seeding rates on meter performance

USDA-ARS?s Scientific Manuscript database

Achieving optimum planter performance is an important requirement for obtaining higher crop yields. Planter performance depends on several factors but meter speed is an important one which is a function of ground speed, seeding rate and row spacing. A study was conducted to evaluate the influence of...

Effects of nitrogen and planting seed size on cotton growth, development, and yield

USDA-ARS?s Scientific Manuscript database

A standardized experiment was conducted during 2009 and 2010 at 20 location-years across U.S. cotton (Gossypium hirsutum L.)-producing states to compare the N use requirement of contemporary cotton cultivars based on their planting seed size. Treatments consisted of three cotton varieties with plant...

Comparison of oilseed yields: a preliminary review

DOE Office of Scientific and Technical Information (OSTI.GOV)

Duke, J.A.; Bagby, M.O.

It was assumed that for most oilseed crops, 90% of the oil yield might be considered as profit. To compare oil seeds, pertinent portions of the yield and energy paragraphs from a summary published by Dr. Duke for DOE Grant No. 59-2246-1-6-054-0 with Dr. Bagby as ADODR were reproduced. The seed yields ranged from 200 to 14,000 kg/ha, the low one too low to consider and the high one suspiciously high. The yield of 14,000 kg oil per hectare is equivalent to more than 30 barrels of oil per hectare. The energy species included ambrette, tung-oil tree, cashew, wood-oil tree,more » mu-oil tree, peanut, mustard greens; rape, colza; black mustard, turnip, safflower, colocynth, coconut, crambe, African oil palm, soybean, cotton, sunflower, Eastern black walnut, Engligh walnut, meadow foam, flax, macadamia nuts, opium poppy, perilla, almond, castorbean, Chinese tallow tree, sesame, jojoba, yellow mustard, stokes' aster, and Zanzibar oilvine. 1 table. (DP)« less

Effect of domestication on microorganism diversity and anaerobic digestion of food waste.

PubMed

Bi, S J; Hong, X J; Wang, G X; Li, Y; Gao, Y M; Yan, L; Wang, Y J; Wang, W D

2016-08-19

To accomplish the rapid start-up and stable operation of biogas digesters, an efficient inoculum is required. To obtain such an inoculum for food waste anaerobic digestion, we domesticated dairy manure anaerobic digestion residue by adding food waste every day. After 36 days, the pH and biogas yield stabilized signifying the completion of domestication. During domestication, the microbial communities in the inocula were investigated by constructing 16S rDNA clone libraries. We evaluated the effect of the domesticated inoculum by testing batch food waste anaerobic digestion with a non-domesticated inoculum as a control. The pH and methane yield of the digestion systems were determined as measurement indices. Domestication changed the composition and proportion of bacteria and archaea in the inocula. Of the bacteria, Clostridia (49.3%), Bacteroidales (19.5%), and Anaerolinaceae (8.1%) species were dominant in the seed sludge; Anaerolinaceae (49.0%), Clostridia (28.4%), and Bacteroidales (9.1%), in domestication sludge. Methanosaeta was the dominant genus in both of the seed (94.3%) and domestication (74.3%) sludge. However, the diversity of methanogenic archaea was higher in the domestication than in seed sludge. Methanoculleus, which was absent from the seed sludge, appeared in the domestication sludge (21.7%). When the domesticated inoculum was used, the digestion system worked stably (organic loading rate: 20 gVS/L; methane yield: 292.2 ± 9.8 mL/gVS; VS = volatile solids), whereas the digestion system inoculated with seed sludge failed to generate biogas. The results indicate that inoculum domestication ensures efficient and stable anaerobic digestion by enriching the methanogenic strains.

Genetic evaluation of Jatropha curcas: an important oilseed for biodiesel production.

PubMed

Freitas, R G; Missio, R F; Matos, F S; Resende, M D V; Dias, L A S

2011-01-01

Jatropha curcas, internationally and locally known, respectively, as physic nut and pinhão manso, is a highly promising species for biodiesel production in Brazil and other countries in the tropics. It is rustic, grows in warm regions and is easily cultivated. These characteristics and high-quality oil yields from the seeds have made this plant a priority for biodiesel programs in Brazil. Consequently, this species merits genetic investigations aimed at improving yields. Some studies have detected genetic variability in accessions in Africa and Asia. We have made the first genetic evaluation of J. curcas collected from Brazil. Our objective was to quantify genetic diversity and to estimate genetic parameters for growth and production traits and seed oil content. We evaluated 75 J. curcas progenies collected from Brazil and three from Cambodia. The mean oil content in the seeds was 31%, ranging from 16 to 45%. No genetic correlation between growth traits and seed oil content was found. However, high coefficients of genetic variation were found for plant height, number of branches, height of branches, and stem diameter. The highest individual narrow-sense heritabilities were found for leaf length (0.35) and width (0.34), stem diameter (0.24) and height of branches (0.21). We used a clustering algorithm to genetically identify the closest and most distant progenies, to assist in the development of new cultivars. Geographical diversity did not necessarily represent the genetic diversity among the accessions collected. These results are important for the continuity of breeding programs, aimed at obtaining cultivars with high grain yield and high oil content in seeds.

Screening of polysaccharides from tamarind, fenugreek and jackfruit seeds as pharmaceutical excipients.

PubMed

Nayak, Amit Kumar; Pal, Dilipkumar; Santra, Kousik

2015-08-01

The paper describes the isolation and screening of plant polysaccharides namely tamarind seed polysaccharide (TSP), fenugreek seed mucilage (FSM) and jackfruit seed starch (JFSS) from tamarind (Tamarindus indica L.) seeds, fenugreek (Trigonella foenum-graecum L.) seeds and jackfruit (Artocarpus heterophyllus L.) seeds, respectively. The yields of isolated dried TSP, FSM and JFSS were 47.00%, 17.36% and 18.86%, respectively. Various physicochemical properties like colour, odour, taste, solubility in water, pH and viscosity of these isolated plant polysaccharides were assessed. Isolated polysaccharide samples were subjected to some phytochemical identification tests. FTIR and (1)H NMR analyses of isolated polysaccharides were performed, which suggest the presence of sugar residues. Isolated TSP, FSM and JFSS can be used as pharmaceutical excipients in various pharmaceutical formulations. Copyright © 2015 Elsevier B.V. All rights reserved.

Striga Biocontrol on a Toothpick: A Readily Deployable and Inexpensive Method for Smallholder Farmers.

PubMed

Nzioki, Henry S; Oyosi, Florence; Morris, Cindy E; Kaya, Eylul; Pilgeram, Alice L; Baker, Claire S; Sands, David C

2016-01-01

Striga hermonthica (witchweed) is a parasitic weed that attacks and significantly reduces the yields of maize, sorghum, millet, and sugarcane throughout sub-Saharan Africa. Low cost management methods such as hand weeding, short crop rotations, trap cropping, or conventional biocontrol have not been effective. Likewise, Striga-tolerant or herbicide-resistant maize cultivars are higher yielding, but are often beyond the economic means of sustenance farmers. The fungal pathogen, Fusarium oxysporum f.sp. strigae, has been the object of numerous studies to develop Striga biocontrol. Under experimental conditions this pathogen can reduce the incidence of Striga infestation but field use is not extensive, perhaps because it has not been sufficiently effective in restoring crop yield and reducing the soil Striga seed bank. Here we brought together Kenyan and US crop scientists with smallholder farmers to develop and validate an effective biocontrol strategy for management of Striga on smallholder farms. Key components of this research project were the following: (1) Development of a two-step method of fungal delivery, including laboratory coating of primary inoculum on toothpicks, followed by on-farm production of secondary field inoculum in boiled rice enabling delivery of vigorous, fresh inoculum directly to the seedbed; (2) Training of smallholder farmers (85% women), to produce the biocontrol agent and incorporate it into their maize plantings in Striga-infested soils and collect agronomic data. The field tests expanded from 30 smallholder farmers to a two-season, 500-farmer plot trial including paired plus and minus biocontrol plots with fertilizer and hybrid seed in both plots and; (3) Concerted selection of variants of the pathogen identified for enhanced virulence, as has been demonstrated in other host parasite systems were employed here on Striga via pathogen excretion of the amino acids L-leucine and L-tyrosine that are toxic to Striga but innocuous to maize. This overall strategy resulted in an average of >50% increased maize yield in the March to June rains season and >40% in the September to December rains season. Integration of this enhanced plant pathogen to Striga management in maize can significantly increase the maize yield of smallholder farmers in Kenya.

Striga Biocontrol on a Toothpick: A Readily Deployable and Inexpensive Method for Smallholder Farmers

PubMed Central

Nzioki, Henry S.; Oyosi, Florence; Morris, Cindy E.; Kaya, Eylul; Pilgeram, Alice L.; Baker, Claire S.; Sands, David C.

2016-01-01

Striga hermonthica (witchweed) is a parasitic weed that attacks and significantly reduces the yields of maize, sorghum, millet, and sugarcane throughout sub-Saharan Africa. Low cost management methods such as hand weeding, short crop rotations, trap cropping, or conventional biocontrol have not been effective. Likewise, Striga-tolerant or herbicide-resistant maize cultivars are higher yielding, but are often beyond the economic means of sustenance farmers. The fungal pathogen, Fusarium oxysporum f.sp. strigae, has been the object of numerous studies to develop Striga biocontrol. Under experimental conditions this pathogen can reduce the incidence of Striga infestation but field use is not extensive, perhaps because it has not been sufficiently effective in restoring crop yield and reducing the soil Striga seed bank. Here we brought together Kenyan and US crop scientists with smallholder farmers to develop and validate an effective biocontrol strategy for management of Striga on smallholder farms. Key components of this research project were the following: (1) Development of a two-step method of fungal delivery, including laboratory coating of primary inoculum on toothpicks, followed by on-farm production of secondary field inoculum in boiled rice enabling delivery of vigorous, fresh inoculum directly to the seedbed; (2) Training of smallholder farmers (85% women), to produce the biocontrol agent and incorporate it into their maize plantings in Striga-infested soils and collect agronomic data. The field tests expanded from 30 smallholder farmers to a two-season, 500-farmer plot trial including paired plus and minus biocontrol plots with fertilizer and hybrid seed in both plots and; (3) Concerted selection of variants of the pathogen identified for enhanced virulence, as has been demonstrated in other host parasite systems were employed here on Striga via pathogen excretion of the amino acids L-leucine and L-tyrosine that are toxic to Striga but innocuous to maize. This overall strategy resulted in an average of >50% increased maize yield in the March to June rains season and >40% in the September to December rains season. Integration of this enhanced plant pathogen to Striga management in maize can significantly increase the maize yield of smallholder farmers in Kenya. PMID:27551284

Food waste composting: its use as a peat replacement.

PubMed

Farrell, M; Jones, D L

2010-01-01

We successfully co-composted catering waste with green waste and shredded paper to yield two high-nitrogen composts for use in horticulture. Sunflowers (Helianthus annuus L.) were grown in various mixtures of the compost and a commercially available peat-based compost to assess the efficacy of catering waste-based composts for peat replacement. Height, head diameter, seed mass and above-ground biomass were measured, with all mixtures giving a significant increase in yield or size over the commercially available peat-free control compost. We conclude that differences in physical structure governed sunflower growth over substrate chemistry, and none of the compost mixtures were nutrient deficient. We recommend that catering waste co-compost can be substituted to at least 75% within Sphagnum-based traditional growing media, providing a viable replacement for a large proportion of peat used as a growth medium in the horticulture industry. Our catering waste compost yielded similar seed head, seed mass and above-ground biomass values to 100% peat-based compost in all food waste compost blends tested in this study. 2010 Elsevier Ltd. All rights reserved.

Artificial neural network optimization of Althaea rosea seeds polysaccharides and its antioxidant activity.

PubMed

Liu, Feng; Liu, Wenhui; Tian, Shuge

2014-09-01

A combination of an orthogonal L16(4)4 test design and a three-layer artificial neural network (ANN) model was applied to optimize polysaccharides from Althaea rosea seeds extracted by hot water method. The highest optimal experimental yield of A. rosea seed polysaccharides (ARSPs) of 59.85 mg/g was obtained using three extraction numbers, 113 min extraction time, 60.0% ethanol concentration, and 1:41 solid-liquid ratio. Under these optimized conditions, the ARSP experimental yield was very close to the predicted yield of 60.07 mg/g and was higher than the orthogonal test results (40.86 mg/g). Structural characterizations were conducted using physicochemical property and FTIR analysis. In addition, the study of ARSP antioxidant activity demonstrated that polysaccharides exhibited high superoxide dismutase activity, strong reducing power, and positive scavenging activity on superoxide anion, hydroxyl radical, 2,2-diphenyl-1-picrylhydrazyl, and reducing power. Our results indicated that ANNs were efficient quantitative tools for predicting the total ARSP content. Copyright © 2014 Elsevier B.V. All rights reserved.

Epichloë uncinata Infection and Loline Content Protect Festulolium Grasses From Crickets (Orthoptera: Gryllidae).

PubMed

Barker, Gary M; Patchett, Brian J; Cameron, Nicholas E

2015-04-01

Experiments with artificial diets demonstrated that black field cricket (Teleogryllus commodus (Walker)) and Lepidogryllus sp. were highly responsive to presence of lolines in their diet-quantities of diet consumed declined exponentially with increasing loline concentration. Amount consumed by black field cricket and Lepidogryllus sp. on diet containing 5,600 µg/g lolines was only 8 and 2% relative to those on loline-free diet, respectively. Additional experiments with Festulolium seeds demonstrated that both cricket species predated heavily on endophyte-free seed but largely avoided Epichloë uncinata-infected seed. By 12 h, black field cricket had destroyed 98.8% of endophyte-free but only 24.8% of E. uncinata-infected, loline-containing seed. By 36 h, Lepidogryllus sp. crickets had destroyed 40% of endophyte-free but had not fed on E. uncinata-infected, loline-containing seed. Glasshouse experiments demonstrated this aversion to lolines greatly reduces the damage potential of black field cricket in E. uncinata-infected Festulolium. When microswards were sown with E. uncinata-infected Festulolium, seedling numbers were reduced 25-26%, and yields 29-40%, by black field crickets relative to microswards sown without insect infestation. This contrasts with 70-78% reduction in seedling numbers and 67-80% reduction in yields in microswards sown to either endophyte-free Festulolium, endophyte-free perennial ryegrass, or Epichloë festucae var. lolii-infected Festulolium. Yields of mature E. uncinata-infected Festulolium plants were not adversely affected by black field crickets, irrespective of the presence of the endophyte-free standard Festulolium sown as a companion. In contrast, yields of endophyte-free Festulolium, endophyte-free perennial ryegrass, and E. festucae var. lolii-infected Festulolium plants were reduced by 56-61% by crickets. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Regulated partitioning of fixed carbon (14C), sodium (Na+), potassium (K+) and glycine betaine determined salinity stress tolerance of gamma irradiated pigeonpea [Cajanus cajan (L.) Millsp].

PubMed

Kumar, Pankaj; Sharma, Vasundhara; Atmaram, Chobhe Kapil; Singh, Bhupinder

2017-03-01

Soil salinity is a major constraint that limits legume productivity. Pigeonpea is a salt sensitive crop. Seed gamma irradiation at a very low dose (2.5 Gy) is known to enhance seedling establishment, plant growth and yield of cereals and other crops. The present study conducted using two genetically diverse varieties of pigeonpea viz., Pusa-991 and Pusa-992 aimed at establishing the role of pre-sowing seed gamma irradiation at 0, 0.0025, 0.005, 0.01, 0.02, 0.05 and 0.1 kGy on plant growth, seed yield and seed quality under salt stress at 0, 80 and 100 mM NaCl (soil solution EC equivalent 1.92, 5.86 and 8.02 dS/m, respectively) imposed right from the beginning of the experiment. Changes in carbon flow dynamics between shoot and root and concentration of osmolyte, glycine betaine, plant uptake and shoot and root partitioning of Na + and K + and activity of protein degrading enzyme protease were measured under the combined effect of gamma irradiation and salt stress. Positive affect of pre-sowing exposure of seed to low dose of gamma irradiation (<0.01 kGy) under salt stress was evident in pigeonpea. Pigeonpea variety, Pusa-992 showed a better salt tolerance response than Pusa-991 and that the radiated plants performed better than the unirradiated plants even at increasing salinity level. Seed yield and seed protein and iron content were also positively affected by the low dose gamma irradiation under NaCl stress. Multiple factors interacted to determine physiological salt tolerance response of pigeonpea varieties. Gamma irradiation caused a favourable alteration in the source-sink (shoot-root) partitioning of recently fixed carbon ( 14 C) under salt stress in pigeonpea. Gamma irradiation of seeds prior to sowing enhanced glycine betaine content and reduced protease activity at 60-day stage under various salt stress regimes. Lower partitioning of Na + and relatively higher accumulation of K + under irradiation treatment was the other important determinants that differentiated between salt-tolerant and salt-susceptible variety of pigeonpea. The study provides evidence and physiological basis for exploring exploitation of pre-sowing exposure of seeds with low-dose gamma ray for enhancing the salt tolerance response of crop plants.

Extraction of kiwi seed oil: Soxhlet versus four different non-conventional techniques.

PubMed

Cravotto, Giancarlo; Bicchi, Carlo; Mantegna, Stefano; Binello, Arianna; Tomao, Valerie; Chemat, Farid

2011-06-01

Kiwi seed oil has a nutritionally interesting fatty acid profile, but a rather low oxidative stability, which requires careful extraction procedures and adequate packaging and storage. For these reasons and with the aim to achieve process intensification with shorter extraction time, lower energy consumption and higher yields, four different non-conventional techniques were experimented. Kiwi seeds were extracted in hexane using classic Soxhlet as well as under power ultrasound (US), microwaves (MWs; closed vessel) and MW-integrated Soxhlet. Supercritical CO₂ was also employed and compared to the other techniques in term of yield, extraction time, fatty acid profiles and organoleptic properties. All these non-conventional techniques are fast, effective and safe. A sensory evaluation test showed the presence of off-flavours in oil samples extracted by Soxhlet and US, an indicator of partial degradation.

Environmental risks and challenges associated with neonicotinoid insecticides

USGS Publications Warehouse

Hladik, Michelle L.; Main, Anson; Goulson, Dave

2018-01-01

Neonicotinoid use has increased rapidly in recent years, with a global shift towards insecticide applications as seed coatings rather than aerial spraying. While the use of seed coatings can lessen the amount of overspray and drift, the near universal and prophylactic use of neonicotinoid seed coatings on major agricultural crops has led to widespread detections in the environment (pollen, soil, water, honey). Pollinators and aquatic insects appear to be especially susceptible to the effects of neonicotinoids with current research suggesting that chronic sub-lethal effects are more prevalent than acute toxicity. Meanwhile, evidence of clear and consistent yield benefits from the use of neonicotinoids remains elusive for most crops. Future decisions on neonicotinoid use will benefit from weighing crop yield benefits versus environmental impacts to non-target organisms and considering whether there are more environmentally benign alternatives.

Control of plant virus diseases in cool-season grain legume crops.

PubMed

Makkouk, Khaled M; Kumari, Safaa G; van Leur, Joop A G; Jones, Roger A C

2014-01-01

Cool-season grain legume crops become infected with a wide range of viruses, many of which cause serious diseases and major yield losses. This review starts by discussing which viruses are important in the principal cool-season grain legume crops in different parts of the world, the losses they cause and their economic impacts in relation to control. It then describes the main types of control measures available: host resistance, phytosanitary measures, cultural measures, chemical control, and biological control. Examples are provided of successful deployment of the different types of measures to control virus epidemics in cool-season grain legume crops. Next it emphasizes the need for integrated approaches to control because single control measures used alone rarely suffice to adequately reduce virus-induced yield losses in these crops. Development of effective integrated disease management (IDM) strategies depends on an interdisciplinary team approach to (i) understand the ecological and climatic factors which lead to damaging virus epidemics and (ii) evaluate the effectiveness of individual control measures. In addition to using virus-resistant cultivars, other IDM components include sowing virus-tested seed stocks, selecting cultivars with low seed transmission rates, using diverse phytosanitary or cultural practices that minimize the virus source or reduce its spread, and using selective pesticides in an environmentally responsible way. The review finishes by briefly discussing the implications of climate change in increasing problems associated with control and the opportunities to control virus diseases more effectively through new technologies.

Tracking multi-walled carbon nanotubes inside oat (Avena sativa L.) plants and assessing their effect on growth, yield, and mammalian (human) cell viability

NASA Astrophysics Data System (ADS)

Joshi, Anjali; Kaur, Simranjeet; Singh, Pargat; Dharamvir, Keya; Nayyar, Harsh; Verma, Gaurav

2018-05-01

Our findings show that oxidized multi-walled carbon nanotubes (MWCNT) having serpent-like morphology and smaller sizes (diameter of 35 nm and lengths of 200-300 nm) are compatible with oat plant tissues. Applied by seed-priming method as 90 µg/ml concentration, these serpentine MWCNT (having open-end caps) enter the oat plant and traverse the cells. Tracking of MWCNT inside sections and tissues during growth of oat plant has been done using special sample preparation. We present clear images of MWCNT inside the primed seeds and vascular bundles, the conducting tissues of root and shoot of oat. A dye fluorescein isothiocyanate non-covalently bonded to MWCNT also helped in detecting the path through circumferential perimeters of the oat channels, using fluorescence and confocal microscopy. The presence of MWCNT inside oat enhanced the growth of xylem cells by about 1.85-fold in vasculature of shoots. Compared to controls, the chlorophyll content increased by 57%, while photosynthetic activity enhanced by 15% for the same sample in MWCNT-primed plants. Overall, the growth factors were also augmented leading to significant increase in yield components. No toxic effects of MWCNT were observed in the DNA of the primed plants, and in the human cell lines treated with grains harvested from the MWCNT-primed plants. Our study provides some new insights about the role of MWCNT in plants and their potential benefits in agriculture.

Response of rice genotypes to weed competition in dry direct-seeded rice in India.

PubMed

Mahajan, Gulshan; Ramesha, Mugalodi S; Chauhan, Bhagirath S

2014-01-01

The differential weed-competitive abilities of eight rice genotypes and the traits that may confer such attributes were investigated under partial weedy and weed-free conditions in naturally occurring weed flora in dry direct-seeded rice during the rainy seasons of 2011 and 2012 at Ludhiana, Punjab, India. The results showed genotypic differences in competitiveness against weeds. In weed-free plots, grain yield varied from 6.6 to 8.9 t ha(-1) across different genotypes; it was lowest for PR-115 and highest for the hybrid H-97158. In partial weedy plots, grain yield and weed biomass at flowering varied from 3.6 to 6.7 t ha(-1) and from 174 to 419 g m(-2), respectively. In partial weedy plots, grain yield was lowest for PR-115 and highest for PR-120. Average yield loss due to weed competition ranged from 21 to 46% in different rice genotypes. The study showed that early canopy closure, high leaf area index at early stage, and high root biomass and volume correlated positively with competitiveness. This study suggests that some traits (root biomass, leaf area index, and shoot biomass at the early stage) could play an important role in conferring weed competitiveness and these traits can be explored for dry-seeded rice.

Response of Rice Genotypes to Weed Competition in Dry Direct-Seeded Rice in India

PubMed Central

Mahajan, Gulshan; Ramesha, Mugalodi S.; Chauhan, Bhagirath S.

2014-01-01

The differential weed-competitive abilities of eight rice genotypes and the traits that may confer such attributes were investigated under partial weedy and weed-free conditions in naturally occurring weed flora in dry direct-seeded rice during the rainy seasons of 2011 and 2012 at Ludhiana, Punjab, India. The results showed genotypic differences in competitiveness against weeds. In weed-free plots, grain yield varied from 6.6 to 8.9 t ha−1 across different genotypes; it was lowest for PR-115 and highest for the hybrid H-97158. In partial weedy plots, grain yield and weed biomass at flowering varied from 3.6 to 6.7 t ha−1 and from 174 to 419 g m−2, respectively. In partial weedy plots, grain yield was lowest for PR-115 and highest for PR-120. Average yield loss due to weed competition ranged from 21 to 46% in different rice genotypes. The study showed that early canopy closure, high leaf area index at early stage, and high root biomass and volume correlated positively with competitiveness. This study suggests that some traits (root biomass, leaf area index, and shoot biomass at the early stage) could play an important role in conferring weed competitiveness and these traits can be explored for dry-seeded rice. PMID:25093205

Seed bank characteristics of the Nymphoides peltata population in Lake Taihu

NASA Astrophysics Data System (ADS)

Huang, Wei; Chen, Qiuwen; Chen, Kaining

2015-08-01

The Nymphoides peltata (N. peltata) population has shown rapid expansion in Lake Taihu, China, in recent years. The core question is whether N. peltata seeds have contributed to the expansion. To address this, we randomly selected three N. peltata stands to investigate the seed bank characteristics of N. peltata in Lake Taihu. Results showed that N. peltata had high seed production, with a maximum seed yield of 1763 seeds per m2. Density of intact and fragmented seeds decreased rapidly with sediment depth. Few intact or fragmented seeds were distributed at depths greater than 4 cm in the sediment. Spatial distribution of the seed bank indicated that most seeds sank to the sediment within the N. peltata stands, and few seeds took advantage of their floating ability. Seeds recovered from the sediment during April to June had a low germination rate, and no seeds germinated during October to April. Cold exposure treatment increased the germination rate remarkably. No seedlings were found in the field from January 2012 to December 2012, indicating that few seeds were successfully established in the surveyed area. The results suggested that sexual reproduction had little direct contribution to the N. peltata expansion in this large shallow lake.

Analysis of Peanut Seed Oil by NIR

USDA-ARS?s Scientific Manuscript database

Near infrared reflectance spectra (NIRS) were collected from Arachis hypogaea seed samples and used in predictive models to rapidly identify varieties with high oleic acid. The method was developed for shelled peanut seeds with intact testa. Spectra were evaluated initially by principal component an...

Grain Yield and Water Use Efficiency in Extremely-Late Sown Winter Wheat Cultivars under Two Irrigation Regimes in the North China Plain.

PubMed

Wang, Bin; Zhang, Yinghua; Hao, Baozhen; Xu, Xuexin; Zhao, Zhigan; Wang, Zhimin; Xue, Qingwu

2016-01-01

Wheat production is threatened by water shortages and groundwater over-draft in the North China Plain (NCP). In recent years, winter wheat has been increasingly sown extremely late in early to mid-November after harvesting cotton or pepper. To improve water use efficiency (WUE) and guide the extremely late sowing practices, a 3-year field experiment was conducted under two irrigation regimes (W1, one-irrigation, 75 mm at jointing; W2, two-irrigation, 75 mm at jointing and 75 mm at anthesis) in 3 cultivars differing in spike size (HS4399, small spike; JM22, medium spike; WM8, large spike). Wheat was sown in early to mid-November at a high seeding rate of 800-850 seeds m(-2). Average yields of 7.42 t ha(-1) and WUE of 1.84 kg m(-3) were achieved with an average seasonal evapotranspiration (ET) of 404 mm. Compared with W2, wheat under W1 did not have yield penalty in 2 of 3 years, and had 7.9% lower seasonal ET and 7.5% higher WUE. The higher WUE and stable yield under W1 was associated with higher 1000-grain weight (TGW) and harvest index (HI). Among the 3 cultivars, JM22 had 5.9%-8.9% higher yield and 4.2%-9.3% higher WUE than WM8 and HS4399. The higher yield in JM22 was attributed mainly to higher HI and TGW due to increased post-anthesis biomass and deeper seasonal soil water extraction. In conclusion, one-irrigation with a medium-sized spike cultivar JM22 could be a useful strategy to maintain yield and high WUE in extremely late-sown winter wheat at a high seeding rate in the NCP.

Extraction and characterization of triglycerides from coffeeweed and switchgrass seeds as potential feedstocks for biodiesel production.

PubMed

Armah-Agyeman, Grace; Gyamerah, Michael; Biney, Paul O; Woldesenbet, Selamawit

2016-10-01

Although switchgrass has been developed as a biofuel feedstock and its potential for bioethanol and bio-oil from fast pyrolysis reported in the literature, the use of the seeds of switchgrass as a source of triglycerides for biodiesel production has not been reported. Similarly, the potential for extracting triglycerides from coffeeweed (an invasive plant of no current economic value) needs to be investigated to ascertain its potential economic use for biodiesel production. The results show that coffeeweed and switchgrass seeds contain known triglycerides which are 983 and 1000 g kg(-1) respectively of the fatty acids found in edible vegetable oils such as sunflower, corn and soybean oils. In addition, the triglyceride yields of 53-67 g kg(-1) of the seed samples are in the range of commercial oil-producing seeds such as corn (42 g kg(-1) ). The results also indicate that the two non-edible oils could be used as substitutes for edible oil for biodiesel production. In addition, the use of seeds of switchgrass for non-edible oil production (as a feedstock for the production of biodiesel) further increases the total biofuel yield when switchgrass is cultivated for use as energy feedstock for pyrolysis oil and biodiesel production. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

A Quick-Test for Biochar Effects on Seed Germination ...

EPA Pesticide Factsheets

Biochar is being globally evaluated as a soil amendment to improve soil characteristics (e.g. soil water holding, nutrient exchange, microbiology, pesticides and chemical availability) to increase crop yields. Unfortunately, there are no quick tests to determine what biochar types are most effective at improving soil characteristics amenable for higher crop yields. Seed germination is a critical parameter for plant establishment and may be a quick indicator of biochar quality. We adapted Oregon State University Seed Laboratory procedures to develop a “quick-test” for screening the effects of biochar on seed germination. We used 11.0 cm rectangular x 3.5 cm deep containers fitted with blotter paper. The paper was premoistened with reverse-osmosis water, followed by placement of seeds (25 in a uniform 5 x 5 vacuum-assisted pattern, and biochar mixtures). A Norfolk and Coxville soil series from South Carolina were used. A total of 18 biochars were evaluated that were produced from 6 feedstocks (pine chips, poultry litter, swine solids, switchgrass, and two blends of pine chips and poultry litter); with biochar from each feedstock made by pyrolysis at 350, 500 and 700 ̊ C. Crops were cabbage, cucumber, onion, ryegrass and tomato. Preliminary results from the test indicated differences in seed germination due to soil type and possibly soil x biochar feedstock interactions. Other measurements including shoot dry weight per plate and pH of the soil+ biochar mixtur

Shrinkage and growth compensation in common sunflowers: refining estimates of damage

USGS Publications Warehouse

Sedgwick, James A.; Oldemeye, John L.; Swenson, Elizabeth L.

1986-01-01

Shrinkage and growth compensation of artificially damaged common sunflowers (Helianthus annuus) were studied in central North Dakota during 1981-1982 in an effort to increase accuracy of estimates of blackbird damage to sunflowers. In both years, as plants matured damaged areas on seedheads shrank at a greater rate than the sunflower heads themselves. This differential shrinkage resulted in an underestimation of the area damaged. Sunflower head and damaged-area shrinkage varied widely by time and degree of damage and by size of the seedhead damaged. Because variation in shrinkage by time of damage was so large, predicting when blackbird damage occurs may be the most important factor in estimating seed loss. Yield'occupied seed area was greater (P < 0.05) for damaged than undamaged heads and tended to increase as degree of damage inflicted increased, indicating growth compensation was occurring in response to lost seeds. Yields of undamaged seeds in seedheads damaged during early seed development were higher than those of heads damaged later. This suggested that there was a period of maximal response to damage when plants were best able to redirect growth to seeds remaining in the head. Sunflowers appear to be able to compensate for damage of ≤ 15% of the total hear area. Estimates of damage can be improved by applying empirical results of differential shrinkage and growth compensations.

Acclimatization study of Tagetes lucida L. in Egypt and the chemical characterization of its essential oils.

PubMed

Omer, Elasyed A; Hendawy, Saber F; Ismail, Rasha F; Petretto, Giacomo L; Rourke, Jonathan P; Pintore, Giorgio

2017-07-01

Seeds of Tagetes lucida were imported to Egypt from Canada and propagated under greenhouse conditions in peat moss media. Soil was sandy in texture and the irrigation system was dripping irrigation. The growth parameters were determined at five successive plant ages, fresh and dry weights of herb were determined at three successive plant ages. The yield of aerial parts after 175 days, was about 7.5 Mg/ha. The essential oil (EO) was extracted by hydro-distillation for three hours with a yield of about 0.5% (w/v). The EO of each sample was subjected to gas-chromatography/mass spectrometry analyses to study the chemical composition. The main component of the EO was identified as methyl chavicol which matched over 90% of the whole composition. Chlorophyll a and carotenes increased with increasing plant age in both sites and seasons. Flavonoids decreased with the development of plant age, while the opposite was true with coumarines content.

A Cascade of Sequentially Expressed Sucrose Transporters in the Seed Coat and Endosperm Provides Nutrition for the Arabidopsis Embryo[OPEN

PubMed Central

Chen, Li-Qing; Lin, I Winnie; Qu, Xiao-Qing; Sosso, Davide; McFarlane, Heather E.; Londoño, Alejandra; Samuels, A. Lacey; Frommer, Wolf B.

2015-01-01

Developing plant embryos depend on nutrition from maternal tissues via the seed coat and endosperm, but the mechanisms that supply nutrients to plant embryos have remained elusive. Sucrose, the major transport form of carbohydrate in plants, is delivered via the phloem to the maternal seed coat and then secreted from the seed coat to feed the embryo. Here, we show that seed filling in Arabidopsis thaliana requires the three sucrose transporters SWEET11, 12, and 15. SWEET11, 12, and 15 exhibit specific spatiotemporal expression patterns in developing seeds, but only a sweet11;12;15 triple mutant showed severe seed defects, which include retarded embryo development, reduced seed weight, and reduced starch and lipid content, causing a “wrinkled” seed phenotype. In sweet11;12;15 triple mutants, starch accumulated in the seed coat but not the embryo, implicating SWEET-mediated sucrose efflux in the transfer of sugars from seed coat to embryo. This cascade of sequentially expressed SWEETs provides the feeding pathway for the plant embryo, an important feature for yield potential. PMID:25794936

Improved Resistance to Controlled Deterioration in Transgenic Seeds1[W][OA

PubMed Central

Prieto-Dapena, Pilar; Castaño, Raúl; Almoguera, Concepción; Jordano, Juan

2006-01-01

We show that seed-specific overexpression of the sunflower (Helianthus annuus) HaHSFA9 heat stress transcription factor (HSF) in tobacco (Nicotiana tabacum) enhances the accumulation of heat shock proteins (HSPs). Among these proteins were HSP101 and a subset of the small HSPs, including proteins that accumulate only during embryogenesis in the absence of thermal stress. Levels of late embryogenesis abundant proteins or seed oligosaccharides, however, were not affected. In the transgenic seeds, a high basal thermotolerance persisted during the early hours of imbibition. Transgenic seeds also showed significantly improved resistance to controlled deterioration in a stable and transgene-dependent manner. Furthermore, overexpression of HaHSFA9 did not have detrimental effects on plant growth or development, including seed morphology and total seed yield. Our results agree with previous work tentatively associating HSP gene expression with phenotypes important for seed longevity. These findings might have implications for improving seed longevity in economically important crops. PMID:16998084

New observations on gametogenic development and reproductive experimental tools to support seed yield improvement in cowpea [Vigna unguiculata (L.) Walp].

PubMed

Salinas-Gamboa, Rigel; Johnson, Susan D; Sánchez-León, Nidia; Koltunow, Anna M G; Vielle-Calzada, Jean-Philippe

2016-06-01

Cowpea reproductive tools. Vigna unguiculata L. Walp. (cowpea) is recognized as a major legume food crop in Africa, but seed yields remain low in most varieties adapted to local conditions. The development of hybrid cowpea seed that could be saved after each generation, enabling significant yield increases, will require manipulation of reproductive development from a sexual to an asexual mode. To develop new technologies that could support the biotechnological manipulation of reproductive development in cowpea, we examined gametogenesis and seed formation in two transformable, African-adapted, day-length-insensitive varieties. Here, we show that these two varieties exhibit distinct morphological and phenological traits but share a common developmental sequence in terms of ovule formation and gametogenesis. We present a reproductive calendar that allows prediction of male and female gametogenesis on the basis of sporophytic parameters related to floral bud size and reproductive organ development, determining that gametogenesis occurs more rapidly in the anther than in the ovule. We also show that the mode of megagametogenesis is of the Polygonum-type and not Oenothera-type, as previously reported. Finally, we developed a whole-mount immunolocalization protocol and applied it to detect meiotic proteins in the cowpea megaspore mother cell, opening opportunities for comparing the dynamics of protein localization during male and female meiosis, as well as other reproductive events in this emerging legume model system.

Gas chromatography-mass spectrometry study of sterols from Pinus elliotti tissues.

NASA Technical Reports Server (NTRS)

Laseter, J. L.; Evans, R.; Weete, J. D.; Walkinshaw, C. H.

1973-01-01

A comparative study of the sterol components of slash pine (Pinus elliotti) callus tissue cultures, seeds, and seedlings was carried out using GC-MS techniques. Cholesterol, desmosterol, campesterol, stigmasterol, sitosterol and cycloeucalenol were identified in all tissues while lophenol and 24-methylenelophenol were identified in only the seed and seedlings. 24-Ethylidenelophenol was detected in trace concentrations in only the seedlings. Sitosterol was the predominant sterol component, i.e., 80.8, 38.1 and 47.8% of the tissue culture, seed and seedling sterols, respectively.

The MYB107 Transcription Factor Positively Regulates Suberin Biosynthesis

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gou, Mingyue; Hou, Guichuan; Yang, Huijun

Suberin, a lipophilic polymer deposited in the outer integument of the Arabidopsis ( Arabidopsis thaliana) seed coat, represents an essential sealing component controlling water and solute movement and protecting seed from pathogenic infection. Although many genes responsible for suberin synthesis are identified, the regulatory components controlling its biosynthesis have not been definitively determined. Here, we show that the Arabidopsis MYB107 transcription factor acts as a positive regulator controlling suberin biosynthetic gene expression in the seed coat. MYB107 coexpresses with suberin biosynthetic genes in a temporal manner during seed development. Disrupting MYB107 particularly suppresses the expression of genes involved in suberinmore » but not cutin biosynthesis, lowers seed coat suberin accumulation, alters suberin lamellar structure, and consequently renders higher seed coat permeability and susceptibility to abiotic stresses. Furthermore, MYB107 directly binds to the promoters of suberin biosynthetic genes, verifying its primary role in regulating their expression. Identifying MYB107 as a positive regulator for seed coat suberin synthesis offers a basis for discovering the potential transcriptional network behind one of the most abundant lipid-based polymers in nature.« less

The MYB107 Transcription Factor Positively Regulates Suberin Biosynthesis

DOE PAGES

Gou, Mingyue; Hou, Guichuan; Yang, Huijun; ...

2016-12-13

Suberin, a lipophilic polymer deposited in the outer integument of the Arabidopsis ( Arabidopsis thaliana) seed coat, represents an essential sealing component controlling water and solute movement and protecting seed from pathogenic infection. Although many genes responsible for suberin synthesis are identified, the regulatory components controlling its biosynthesis have not been definitively determined. Here, we show that the Arabidopsis MYB107 transcription factor acts as a positive regulator controlling suberin biosynthetic gene expression in the seed coat. MYB107 coexpresses with suberin biosynthetic genes in a temporal manner during seed development. Disrupting MYB107 particularly suppresses the expression of genes involved in suberinmore » but not cutin biosynthesis, lowers seed coat suberin accumulation, alters suberin lamellar structure, and consequently renders higher seed coat permeability and susceptibility to abiotic stresses. Furthermore, MYB107 directly binds to the promoters of suberin biosynthetic genes, verifying its primary role in regulating their expression. Identifying MYB107 as a positive regulator for seed coat suberin synthesis offers a basis for discovering the potential transcriptional network behind one of the most abundant lipid-based polymers in nature.« less

The MYB107 Transcription Factor Positively Regulates Suberin Biosynthesis1[OPEN

PubMed Central

Yang, Huijun; Cai, Yuanheng; Kai, Guoyin

2017-01-01

Suberin, a lipophilic polymer deposited in the outer integument of the Arabidopsis (Arabidopsis thaliana) seed coat, represents an essential sealing component controlling water and solute movement and protecting seed from pathogenic infection. Although many genes responsible for suberin synthesis are identified, the regulatory components controlling its biosynthesis have not been definitively determined. Here, we show that the Arabidopsis MYB107 transcription factor acts as a positive regulator controlling suberin biosynthetic gene expression in the seed coat. MYB107 coexpresses with suberin biosynthetic genes in a temporal manner during seed development. Disrupting MYB107 particularly suppresses the expression of genes involved in suberin but not cutin biosynthesis, lowers seed coat suberin accumulation, alters suberin lamellar structure, and consequently renders higher seed coat permeability and susceptibility to abiotic stresses. Furthermore, MYB107 directly binds to the promoters of suberin biosynthetic genes, verifying its primary role in regulating their expression. Identifying MYB107 as a positive regulator for seed coat suberin synthesis offers a basis for discovering the potential transcriptional network behind one of the most abundant lipid-based polymers in nature. PMID:27965303

Plasma and hepatic cholesterol-lowering in hamsters by tomato pomace, tomato seed oil and defatted tomato seed supplemented in high fat diets

USDA-ARS?s Scientific Manuscript database

We determined the cholesterol-lowering effects of tomato pomace (TP), a byproduct of tomato processing, and its components such as tomato seed oil (TSO) and defatted tomato seed (DTS) in hamsters, a widely used animal model for cholesterol metabolism. Male Syrian Golden hamsters were fed high-fat di...

Composition of soil seed banks in southern California coastal sage scrub and adjacent exotic grassland

Treesearch

Robert D. Cox; Edith B. Allen

2008-01-01

Soil seed banks are important to many plant communities and are recognized as an important component of management plans. Understanding seed bank composition and density is especially important when communities have been invaded by exotic species and must be managed to promote desirable species. We examined germinable soil seed banks in southern California coastal sage...

Antibacterial activity of essential oil components and their potential use in seed disinfection.

PubMed

Lo Cantore, Pietro; Shanmugaiah, Vellasamy; Iacobellis, Nicola Sante

2009-10-28

Among the main (> or = 0.7%) components of some essential oils, considerable antibacterial activity was shown by terpenoid and phenylpropanoid derivatives containing phenol and alcohol functionalities. A reduced or no activity was shown by those derivatives containing ketones, aldehydes, ethers, and ester functionalities as well as the remaining terpenoids. Eugenol emulsion treatments (1-8 mg/mL) of bean seeds bearing about 2.6 x 10(6) cfu/seed of strain ICMP239 of Xanthomonas campestris pv. phaseoli var. fuscans determined a highly significant reduction of the bacteria on seeds. In particular, eugenol at 4 mg/mL disinfect seeds bearing about 7.0 x 10(2) cfu/seed and lower densities. However, after 72 h, incubation treatments with 2, 4, and 8 mg/mL of eugenol caused germination reduction of 3%, 7%, and 16%, respectively, which was significantly different from the controls. No effect on germination was observed with 1 mg/mL eugenol emulsion treatment. These data indicate eugenol as potentially useful for bean seed disinfection from X. campestris pv. phaseoli var. fuscans. Further studies on the effects on seed vitality and on formulation of essential oils are needed.

A Novel Acoustic Sensor Approach to Classify Seeds Based on Sound Absorption Spectra

PubMed Central

Gasso-Tortajada, Vicent; Ward, Alastair J.; Mansur, Hasib; Brøchner, Torben; Sørensen, Claus G.; Green, Ole

2010-01-01

A non-destructive and novel in situ acoustic sensor approach based on the sound absorption spectra was developed for identifying and classifying different seed types. The absorption coefficient spectra were determined by using the impedance tube measurement method. Subsequently, a multivariate statistical analysis, i.e., principal component analysis (PCA), was performed as a way to generate a classification of the seeds based on the soft independent modelling of class analogy (SIMCA) method. The results show that the sound absorption coefficient spectra of different seed types present characteristic patterns which are highly dependent on seed size and shape. In general, seed particle size and sphericity were inversely related with the absorption coefficient. PCA presented reliable grouping capabilities within the diverse seed types, since the 95% of the total spectral variance was described by the first two principal components. Furthermore, the SIMCA classification model based on the absorption spectra achieved optimal results as 100% of the evaluation samples were correctly classified. This study contains the initial structuring of an innovative method that will present new possibilities in agriculture and industry for classifying and determining physical properties of seeds and other materials. PMID:22163455

In vitro antifungal activity of different components of Centratherum anthelminticum and Ocimum sanctum seed oils and their synergism against oral pathogenic fungi

PubMed Central

H Gopalkrishna, Aparna; M, Seshagiri; Muddaiah, Sunil; R, Shashidara

2016-01-01

Background. Opportunistic fungal infections like candidiasis are common in the oral cavity. In recent years Candida species have shown resistance against a number of synthetic drugs. This study assessed the antifungal activity of Centratherum anthelminticum and Ocimum sanctum seed oils against six common pathogenic Candida strains. Synergistic activity of the major oil components was also studied. Methods. Antifungal activity of Centratherum anthelminticum and Ocimum sanctum seed oils were tested against six oral fungal pathogens, Candida albicans ATCC 90028, Candida krusei 6258, Candida tropicalis 13803, Candida parapsilosis22019, Candida glabrata 90030 and Candida dubliniensis MYA 646, by disc diffusion and broth microdilution methods to determine the diameter of inhibition zone (DIZ) and minimum inhibitory concentration (MIC), respectively. The oil was extracted using Soxhlet apparatus from seeds subjected to columnchromatography (CC) and thin layer chromatography (TLC) and major components were separated and quantified. Results. All the six Candida strains showed growth inhibition to a variable degree when tested with both seed oils. Both seed oils showed antifungal activity. For Centratherum anthelminticum seed oil maximum DIZ at 7 μL was recorded at 75.7 mm for Candida albicans ATCC 90028, and the least DIZ was 45.7 mm for Candida dubliniensis MYA 646. For Ocimum sanctum seed oil maximum DIZ at 7 μL was 61.0 mm for Candida krusei ATCC 6258 and the least DIZ was 46.7 mm for Candida tropicalis ATCC 13803. The mixtures of phospholipids and unsaponifiable matter exhibitedMIC values at 1.25 μL for both oils, whereas neutral lipids fraction and unsaponifiable matter exhibited similar MIC at 2.5 μL against Candida albicans and Candida krusei. Conclusion.Centratherum anthelminticum and Ocimum sanctumseed oils exhibited strong antifungal activity against six different species of Candida and this may be attributed to various active components in the oil and their synergistic activity. PMID:27429725

Seed birth to death: dual functions of reactive oxygen species in seed physiology.

PubMed

Jeevan Kumar, S P; Rajendra Prasad, S; Banerjee, Rintu; Thammineni, Chakradhar

2015-09-01

Reactive oxygen species (ROS) are considered to be detrimental to seed viability. However, recent studies have demonstrated that ROS have key roles in seed germination particularly in the release of seed dormancy and embryogenesis, as well as in protection from pathogens. This review considers the functions of ROS in seed physiology. ROS are present in all cells and at all phases of the seed life cycle. ROS accumulation is important in breaking seed dormancy, and stimulating seed germination and protection from pathogens. However, excessive ROS accumulation can be detrimental. Therefore, knowledge of the mechanisms by which ROS influence seed physiology will provide insights that may not only allow the development of seed quality markers but also help us understand how dormancy can be broken in several recalcitrant species. Reactive oxygen species have a dual role in seed physiology. Understanding the relative importance of beneficial and detrimental effects of ROS provides great scope for the improvement and maintenance of seed vigour and quality, factors that may ultimately increase crop yields. © The Author 2015. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Heterologous Expression of ATG8c from Soybean Confers Tolerance to Nitrogen Deficiency and Increases Yield in Arabidopsis

PubMed Central

Liu, Dong; Chai, Wenting; Gong, Qingqiu; Wang, Ning Ning

2012-01-01

Nitrogen is an essential element for plant growth and yield. Improving Nitrogen Use Efficiency (NUE) of crops could potentially reduce the application of chemical fertilizer and alleviate environmental damage. To identify new NUE genes is therefore an important task in molecular breeding. Macroautophagy (autophagy) is an intracellular process in which damaged or obsolete cytoplasmic components are encapsulated in double membraned vesicles termed autophagosomes, then delivered to the vacuole for degradation and nutrient recycling. One of the core components of autophagosome formation, ATG8, has been shown to directly mediate autophagosome expansion, and the transcript of which is highly inducible upon starvation. Therefore, we postulated that certain homologs of Saccharomyces cerevisiae ATG8 (ScATG8) from crop species could have potential for NUE crop breeding. A soybean (Glycine max, cv. Zhonghuang-13) ATG8, GmATG8c, was selected from the 11 family members based on transcript analysis upon nitrogen deprivation. GmATG8c could partially complement the yeast atg8 mutant. Constitutive expression of GmATG8c in soybean callus cells not only enhanced nitrogen starvation tolerance of the cells but accelerated the growth of the calli. Transgenic Arabidopsis over-expressing GmATG8c performed better under extended nitrogen and carbon starvation conditions. Meanwhile, under optimum growth conditions, the transgenic plants grew faster, bolted earlier, produced larger primary and axillary inflorescences, eventually produced more seeds than the wild-type. In average, the yield was improved by 12.9%. We conclude that GmATG8c may serve as an excellent candidate for breeding crops with enhanced NUE and better yield. PMID:22629371

Effect of fungicide seed treatments on Fusarium virguliforme infection of soybean and development of sudden death syndrome

USDA-ARS?s Scientific Manuscript database

Sudden death syndrome (SDS), caused by Fusarium virguliforme (Fv), is a major yield-limiting disease of soybean in North America. Infection of soybean seedling roots by Fv results in severe root damage; therefore, fungicide seed treatments could potentially reduce these early-season infections and r...

Managing phosphorus fertilizer to reduce algae, maintain water quality, and sustain yields in water-seeded rice

USDA-ARS?s Scientific Manuscript database

In water-seeded rice systems blue-green algae (cyanobacteria) hinder early-season crop growth by dislodging rice seedlings and reducing light. Since algae are often phosphorus (P) limited, we investigated whether changing the timing of P fertilizer application could reduce algae without reducing cro...

Grain dormancy and light quality effects on germination in the model grass Brachypodium distachyon

USDA-ARS?s Scientific Manuscript database

Lack of seed dormancy in cereal crops such as barley and wheat is a common problem affecting farming areas around the world, causing losses in yield and quality due to pre-harvest sprouting. Control of seed dormancy has been investigated extensively using various approaches in different species incl...

Cone and Seed Maturation of Southern Pines

Treesearch

James P. Barnett

1976-01-01

If slightly reduced yields and viability are acceptable, loblolly and slash cone collections can begin 2 to 3 weeks before maturity if the cones are stored before processing. Longleaf(P. palestris Mill.) pine cones should be collected only when mature, as storage decreased germination of seeds from immature cones. Biochemical analyses to determine reducing sugar...

Relationship between piercing-sucking insect control and internal lint and seed rot in Southeastern cotton (Gossypium hirsutum)

USDA-ARS?s Scientific Manuscript database

In 1999 crop consultants scouting for stink bugs (several Hemiptera spp.) in South Carolina discovered a formerly unobserved seed rot of cotton that caused yield losses ranging from 10 to 15% in certain fields. The same symptoms were subsequently reported in fields throughout the southeastern Cotto...

A transgene design for enhancing oil content in Arabidopsis and Camelina seeds

USDA-ARS?s Scientific Manuscript database

Increasing the oil yield is a major objective for oilseed crop improvement. Oil biosynthesis and accumulation are influenced by multiple genes involved in embryo and seed development. The LEAFY COTYLEDON1 (LEC1) is a master regulator of embryo development that also enhances the expression of genes i...

Effect of gypsum application on mineral composition in peanut pod walls and seeds

USDA-ARS?s Scientific Manuscript database

Alleviation of soil-Ca deficiency through gypsum amendment increases the yield potential and ensures high seed quality in peanut (Arachis hypogaea L.). The effects of gypsum treatment, plant life cycle stage, and the fruit development stages on the accrual of several essential minerals (Ca, S, Mg, P...

Lesquerella seed yield estimation using color image segmentation to track flowering dynamics under water and nitrogen limitation

USDA-ARS?s Scientific Manuscript database

Seed oil from lesquerella (Physaria fendleri (Gray) O'Kane & Al-Shehbaz) can potentially supplement castor oil as a non-petroleum-based chemical feedstock in the production of many industrial products. However, before lesquerella will become commercially viable, further efforts are needed to address...

Development of sunflower oil and composition with respect to seed moisture and physiological maturity

USDA-ARS?s Scientific Manuscript database

Desiccants/harvest aids are becoming more commonly used to hasten sunflower harvest. The current recommendation is to apply a desiccant (e.g., glyphosate and paraquat) at 35% or less seed moisture at physiological maturity (PM). Desiccating as early as possible without sacrificing yield may be a des...

Test of pressure transducer for measuring cotton-mass flow

USDA-ARS?s Scientific Manuscript database

In this study, a cotton harvester yield monitor was developed based on the relationship between air pressure and the mass of seed cotton conveyed. The sensor theory was verified by laboratory tests. The sensor was tested on a cotton picker with seed cotton at two moisture contents, 5.9% and 8.5% we...

Seed production and establishment of western Oregon native grasses

Treesearch

Dale C. Darris

2005-01-01

It is well understood that native grasses are ecologically important and provide numerous benefits. However, unfavorable economics, low seed yields for some species, genetic issues, and a lack of experience behind the production and establishment of most western Oregon native grasses remain significant impediments for their expanded use. By necessity, adaptation of...

Neonicotinoid Seed Treatments and Foliar Sprays on Sugarbeet for Control of Severe Curly Top

USDA-ARS?s Scientific Manuscript database

Sugarbeet production in semiarid regions is hindered by yield loss caused with Beet severe curly top virus and other closely related species vectored by the beet leafhopper. In 2010, a study was established to investigate the level of control from seed treatments and supplemental foliar insecticide...

Management of curly top in sugarbeet with seed and foliar insecticides

USDA-ARS?s Scientific Manuscript database

Curly top in sugarbeet can result in severe yield losses and is caused by Beet severe curly top virus (BSCTV) and other closely related Curtovirus spp. which are vectored by the beet leafhopper. Neonicotinoid seed treatments (Cruiser, NipsIt, and Poncho) have been shown to be an effective supplemen...

Management of curly top in sugar beet with seed and foliar insecticides

USDA-ARS?s Scientific Manuscript database

Curly top in sugar beet can result in severe yield losses and is caused by Beet severe curly top virus (BSCTV) and other closely related Curtovirus spp. which are vectored by the beet leafhopper. Neonicotinoid seed treatments (Cruiser, NipsIt, and Poncho) have been shown to be an effective suppleme...

Effect of salinity and sodicity stresses on physiological response and productivity in Helianthus annuus.

PubMed

Farghaly, Fatma Aly; Radi, Abeer Ahmed; Abdel-Wahab, Dalia Ahmed; Hamada, Afaf Mohamed

2016-06-01

Soil salinity and sodicity (alkalinity) are serious land degradation issues worldwide that are predicted to increase in the future. The objective of the present study is to distinguish the effects of NaCl and Na(2)CO(3) salinity in two concentrations on the growth, lipoxygenase (LOX) activity, membrane integrity, total lipids, yield parameters and fatty acids (FAs) composition of seeds of sunflower cultivar Sakha 53. Plant growth, LOX activity and malondialdehyde (MDA) content were reduced by salts stresses. On the contrary, salinity and alkalinity stress induced stimulatory effects on membrane permeability, leakage of UV-metabolites from leaves and total lipids of sunflower shoots and roots. Crop yield (plant height, head diameter, seed index and number of seeds for each head) that is known as a hallmark of plant stress was decreased by increasing concentrations of NaCl and Na(2)CO(3) in the growth media. Fatty acid methyl esters (FAME) composition of salt-stressed sunflower seeds varied with different levels of NaCl and Na(2)CO(3).

Development of a Rapid Point-of-Use DNA Test for the Screening of Genuity® Roundup Ready 2 Yield® Soybean in Seed Samples.

PubMed

Chandu, Dilip; Paul, Sudakshina; Parker, Mathew; Dudin, Yelena; King-Sitzes, Jennifer; Perez, Tim; Mittanck, Don W; Shah, Manali; Glenn, Kevin C; Piepenburg, Olaf

2016-01-01

Testing for the presence of genetically modified material in seed samples is of critical importance for all stakeholders in the agricultural industry, including growers, seed manufacturers, and regulatory bodies. While rapid antibody-based testing for the transgenic protein has fulfilled this need in the past, the introduction of new variants of a given transgene demands new diagnostic regimen that allows distinguishing different traits at the nucleic acid level. Although such molecular tests can be performed by PCR in the laboratory, their requirement for expensive equipment and sophisticated operation have prevented its uptake in point-of-use applications. A recently developed isothermal DNA amplification technique, recombinase polymerase amplification (RPA), combines simple sample preparation and amplification work-flow procedures with the use of minimal detection equipment in real time. Here, we report the development of a highly sensitive and specific RPA-based detection system for Genuity Roundup Ready 2 Yield (RR2Y) material in soybean (Glycine max) seed samples and present the results of studies applying the method in both laboratory and field-type settings.

Changes in growth and antioxidant status of alfalfa sprouts during sprouting as affected by gamma irradiation of seeds.

PubMed

Fan, Xuetong; Thayer, Donald W; Sokorai, Kimberly J B

2004-03-01

Viking 3000 alfalfa seeds irradiated with gamma rays to doses of 0, 1, 2, 3, or 4 kGy were sprouted and allowed to grow for up to 8 days at 23 degrees C. Germination, growth (yield and length), antioxidant capacity, and ascorbic acid (AA) were measured during sprouting. Results showed percent germination of the seeds and the rates of growth of the sprouts were inversely related to the radiation dose absorbed by the seeds. Both antioxidant capacity and AA content expressed on a fresh weight basis decreased during growth of the sprouts. Sprouts grown from irradiated seeds had greater antioxidant capacity and AA content on a fresh weight basis than those grown from nonirradiated seeds. However, when the nutritive values were expressed on a per gram of seed basis, irradiation had no effect on the nutritive values of sprouts.

Hydroperoxide Lyase and Other Hydroperoxide-Metabolizing Activity in Tissues of Soybean, Glycine max

PubMed Central

Gardner, Harold W.; Weisleder, David; Plattner, Ronald D.

1991-01-01

Hydroperoxide lyase (HPLS) activity in soybean (Glycine max) seed/seedlings, leaves, and chloroplasts of leaves required detergent solubilization for maximum in vitro activity. On a per milligram of protein basis, more HPLS activity was found in leaves, especially chloroplasts, than in seeds or seedlings. The total yield of hexanal from 13(S)-hydroperoxy-cis-9,trans-11-octadecadienoic acid (13S-HPOD) from leaf or chloroplast preparations was 58 and 66 to 85%, respectively. Because of significant competing hydroperoxide-metabolizing activities from other enzymes in seed/seedling preparations, the hexanal yields from this source were lower (36-56%). Some of the products identified from the seed or seedling preparations indicated that the competing activity was mainly due to both a hydroperoxide peroxygenase and reactions catalyzed by lipoxygenase. Different HPLS isozyme compositions in the seed/seedling versus the leaf/chloroplast preparations were indicated by differences in the activity as a function of pH, the Km values, relative Vmax with 13S-HPOD and 13(S)-hydroperoxy-cis-9,trans-11,cis-15-octadecatrienoic acid (13S-HPOT), and the specificity with different substrates. With regard to the latter, both seed/seedling and chloroplast HPLS utilized the 13S-HPOD and 13S-HPOT substrates, but only seeds/seedlings were capable of metabolizing 9(S)-hydroperoxy-trans-10,cis-12-octadecadienoic acid into 9-oxononanoic acid, isomeric nonenals, and 4-hydroxynonenal. From 13S-HPOD and 13S-HPOT, the products were identified as 12-oxo-cis-9-dodecenoic acid, as well as hexanal from 13S-HPOD and cis-3-hexenal from 13S-HPOT. In seed preparations, there was partial isomerization of the cis-3 or cis-9 into trans-2 or trans-10 double bonds, respectively. PMID:16668490

Biological Networks Underlying Soybean Seed Oil Composition and Content

USDA-ARS?s Scientific Manuscript database

Soybean is the most important oil crop in the United States. Production of soybean seed oil requires coordinated expression of many biological components and pathways, which is further regulated by seed development and phyto-hormones. A new research project is initiated in my laboratory to delineat...

Whiskers, cones and pyramids created in sputtering by ion bombardment

NASA Technical Reports Server (NTRS)

Wehner, G. K.

1979-01-01

A thorough study of the role which foreign atoms play in cone formation during sputtering of metals revealed many experimental facts. Two types of cone formation were distinquished, deposit cones and seed cones. Twenty-six combinations of metals for seed cone formation were tested. The sputtering yield variations with composition for combinations which form seed cones were measured. It was demonstrated that whisker growth becomes a common occurrence when low melting point material is sputter deposited on a hot nonsputtered high melting point electrode.

The proteins of the grape (Vitis vinifera L.) seed endosperm: fractionation and identification of the major components.

PubMed

Gazzola, Diana; Vincenzi, Simone; Gastaldon, Luca; Tolin, Serena; Pasini, Gabriella; Curioni, Andrea

2014-07-15

In the present study, grape (Vitis vinifera L.) seed endosperm proteins were characterized after sequential fractionation, according to a modified Osborne procedure. The salt-soluble fraction (albumins and globulins) comprised the majority (58.4%) of the total extracted protein. The protein fractions analysed by SDS-PAGE showed similar bands, indicating different solubility of the same protein components. SDS-PAGE in non-reducing and reducing conditions revealed the polypeptide composition of the protein bands. The main polypeptides, which were similar in all the grape varieties analysed, were identified by LC-MS/MS as homologous to the 11S globulin-like seed storage proteins of other plant species, while a monomeric 43 kDa protein presented high homology with the 7S globulins of legume seeds. The results provide new insights about the identity, structure and polypeptide composition of the grape seed storage proteins. Copyright © 2014 Elsevier Ltd. All rights reserved.

Combining satellite remote sensing and surveys to understand persistent yield variation--- a case study in North China Plain

NASA Astrophysics Data System (ADS)

Zhao, Y.; Lobell, D. B.; Chen, X.

2015-12-01

A large gap between maize yields on average farmers' fields and the highest yields achieved by either experiment or farmers is typical throughout the developing world, including in the North China Plain (NCP). This maize yield gap as identified by previous studies indicates large opportunities for raising yield by improving agronomy. Quzhou county is typical of the winter-wheat summer-maize system in NCP where the average plot size is as small as 0.25 hectares. To analyze this cropping system amidst the challenge of substantial heterogeneity, we identified fields that were either persistently higher or lower yielding according to the remote sensing yield estimates, and then conducted detailed field surveys. We found irrigation facility to be a major constraint to yield both in terms of irrigation water quality and farmers' access to wells. In total, improving the access to unsalty water would be associated with a 0.32t/ha (4.2%) increase in multi-year average yield. In addition, farmers' method of choosing cultivar, which likely relates to their overall knowledge level, significantly explained yield variation. In particular, those choosing cultivars according to technician advice, personal experiences and high yielding neighbors' advice had on average higher yield than farmers that either followed seed sellers' advice or collectively purchased seeds. Overall, the study presents a generalizable methodology of assessing yield gap as well as its persistent factors using a combination of satellite and survey data.

Cowpeas and pinto beans: yields and light efficiency of candidate space crops in the Laboratory Biosphere closed ecological system

NASA Astrophysics Data System (ADS)

Nelson, M.; Dempster, W. F.; Silverstone, S.; Alling, A.; Allen, J. P.; van Thillo, M.

An experiment utilizing cowpeas Vigna unguiculata pinto beans Phaseolus vulgaris L and Apogee ultra-dwarf wheat was conducted in the soil-based closed ecological facility Laboratory Biosphere from February to May 2005 The lighting regime was 13 hours light 11 hours dark at a light intensity of 960 mu mol m -2 s -1 45 moles m -2 day -1 supplied by high-pressure sodium lamps The pinto beans and cowpeas were grown at two different plant densities The pinto bean produced 710 g m -2 total aboveground biomass and 341 g m -2 at 33 5 plants per m 2 and at 37 5 plants per m 2 produced 1092 g m -2 total biomass and 537 g m -2 of dry seed an increase of almost 50 Cowpeas at 28 plants m -2 yielded 1060 g m -2 of total biomass and 387 g seed m -2 outproducing the less dense planting by more than double 209 in biomass and 86 more seed as the planting of 21 plants m -2 produced 508 g m-2 of total biomass and 209 g m-2 of seed Edible yield rate EYR for the denser cowpea bean was 4 6 g m -2 day -1 vs 2 5 g m -2 day -1 for the less dense stand average yield was 3 5 g m -2 day -1 EYR for the denser pinto bean was 8 5 g m -2 day -1 vs 5 3 g m -2 day -1 average EYR for the pinto beans was 7 0 g m -2 day -1 Yield efficiency rate YER the ratio of edible to non-edible biomass was 0 97 for the dense pinto bean 0 92 for the less dense pinto bean and average 0 94 for the entire crop The cowpeas

Effect of ground poppy seed as a fat replacer on meat burgers.

PubMed

Gök, Veli; Akkaya, Levent; Obuz, Ersel; Bulut, Sait

2011-12-01

Poppy seed paste was used in koefte production as an animal fat replacer and efficacy of using poppy seed was investigated. The use of ground poppy seed in formulation of meat burgers had no effect on the moisture content of uncooked meat burgers; however, it did have a significant effect (p<0.05) on the fat content of meat burgers. Ground poppy seed addition significantly affected (p<0.05) cooking yield, moisture retention, and fat retention of meat burgers. Ground poppy seed addition significantly decreased (p<0.05) saturated fatty acid contents as the amount of ground poppy seed increased in meat burgers. A strong significant decrease (p<0.05) on the cholesterol content of meat burgers with ground poppy seed addition was observed. Samples having 20% ground poppy seed had significantly better texture and juiciness score (p<0.05) than any other sample which could be explained by increased moisture retention. Replacing animal fat with ground poppy seed paste is effective and may pave the way for an innovative meat product. Copyright © 2011 Elsevier Ltd. All rights reserved.

Seed weight - seedling size correlation in coastal Douglas-fir: genetic and environmental components.

Treesearch

Frank C. Sorensen; Robert K. Campbell

1992-01-01

The effect of seed weight on nursery seedling height was analyzed in two experiments. In expt. 1, 16 seeds per family from 111 families were individually weighed and sown in autumn. In expt. 2, a second group of 16 seeds were individually weighed and stratified and sown in spring. Four-tree noncontiguous family plots were randomly assigned to two densities in two...

Residual effects of applied chemical fertilisers on growth and seed yields of sunflower (Helianthus annuus cv. high sun 33) after the harvests of initial main crops of maize (Zea mays L.), soybean (Glycine max L.) and sunflower (Helianthus annuus).

PubMed

Srisa-ard, K

2007-03-15

The experiments consisted of two locations, i.e., the first one was carried out on a growers's upland area at Saraburi Province, Central Plane region of Thailand with the use of Chatturat soil series (Typic Haplustalfs, fine, mixed) and the second experiment was carried out at Suranaree Technology university Experimental Farm, Suranaree Technology University Northeast Thailand with the use of Korat soil series (Oxic Paleustults). The experiments aimed to investigate the effect of residual effects of applied chemical fertilisers on growth and seed yields of sunflower (Helianthus annuus) after the harvests of initial main crops of maize, soybean and sunflower. The experiments consisted of four cultural methods being practiced by growers in both regions. For Methods 1 and 2, each had four fertiliser treatments; Method 3 consisted of two fertiliser treatments and Method 4 was used as a control treatment. The results showed that soil pH, organic matter and nutrients of Korat soil series were most suited soil conditions for growth of sunflower plants, whilst that of Chatturat soil series at Saraburi province was an alkaline soil with a mean value of soil pH of 7.8. Chatturat soil series, in most cases, gave higher amounts of seed yields (1,943.75 kg ha(-1)) than Korat soil series. Residual effects of applied chemical fertilisers to main crops of soybean gave better growth and seed yields of sunflower plants and it is considered to be the first choice. The use of sunflower and maize as main crops gave a second choice for subsequent crop of sunflower.

The nuclear protein Poly(ADP-ribose) polymerase 3 (AtPARP3) is required for seed storability in Arabidopsis thaliana.

PubMed

Rissel, D; Losch, J; Peiter, E

2014-11-01

The deterioration of seeds during prolonged storage results in a reduction of viability and germination rate. DNA damage is one of the major cellular defects associated with seed deterioration. It is provoked by the formation of reactive oxygen species (ROS) even in the quiescent state of the desiccated seed. In contrast to other stages of seed life, DNA repair during storage is hindered through the low seed water content; thereby DNA lesions can accumulate. To allow subsequent seedling development, DNA repair has thus to be initiated immediately upon imbibition. Poly(ADP-ribose) polymerases (PARPs) are important components in the DNA damage response in humans. Arabidopsis thaliana contains three homologues to the human HsPARP1 protein. Of these three, only AtPARP3 was very highly expressed in seeds. Histochemical GUS staining of embryos and endosperm layers revealed strong promoter activity of AtPARP3 during all steps of germination. This coincided with high ROS activity and indicated a role of the nuclear-localised AtPARP3 in DNA repair during germination. Accordingly, stored parp3-1 mutant seeds lacking AtPARP3 expression displayed a delay in germination as compared to Col-0 wild-type seeds. A controlled deterioration test showed that the mutant seeds were hypersensitive to unfavourable storage conditions. The results demonstrate that AtPARP3 is an important component of seed storability and viability. © 2014 German Botanical Society and The Royal Botanical Society of the Netherlands.

OsGRF4 controls grain shape, panicle length and seed shattering in rice.

PubMed

Sun, Pingyong; Zhang, Wuhan; Wang, Yihua; He, Qiang; Shu, Fu; Liu, Hai; Wang, Jie; Wang, Jianmin; Yuan, Longping; Deng, Huafeng

2016-10-01

Traits such as grain shape, panicle length and seed shattering, play important roles in grain yield and harvest. In this study, the cloning and functional analysis of PANICLE TRAITS 2 (PT2), a novel gene from the Indica rice Chuandali (CDL), is reported. PT2 is synonymous with Growth-Regulating Factor 4 (OsGRF4), which encodes a growth-regulating factor that positively regulates grain shape and panicle length and negatively regulates seed shattering. Higher expression of OsGRF4 is correlated with larger grain, longer panicle and lower seed shattering. A unique OsGRF4 mutation, which occurs at the OsmiRNA396 target site of OsGRF4, seems to be associated with high levels of OsGRF4 expression, and results in phenotypic difference. Further research showed that OsGRF4 regulated two cytokinin dehydrogenase precursor genes (CKX5 and CKX1) resulting in increased cytokinin levels, which might affect the panicle traits. High storage capacity and moderate seed shattering of OsGRF4 may be useful in high-yield breeding and mechanized harvesting of rice. Our findings provide additional insight into the molecular basis of panicle growth. © 2016 The Authors. Journal of Integrative Plant Biology Published by John Wiley & Sons Australia, Ltd on behalf of Institute of Botany, Chinese Academy of Sciences.

Temporal dynamics of iris yellow spot virus and its vector, Thrips tabaci (Thysanoptera: Thripidae), in seeded and transplanted onion fields.

PubMed

Hsu, Cynthia L; Hoepting, Christine A; Fuchs, Marc; Shelton, Anthony M; Nault, Brian A

2010-04-01

Onion thrips, Thrips tabaci (Lindeman) (Thysanoptera: Thripidae), can reduce onion bulb yield and transmit iris yellow spot virus (IYSV) (Bunyaviridae: Tospovirus), which can cause additional yield losses. In New York, onions are planted using seeds and imported transplants. IYSV is not seed transmitted, but infected transplants have been found in other U.S. states. Transplants are also larger than seeded onions early in the season, and thrips, some of which may be viruliferous, may preferentially colonize larger plants. Limited information is available on the temporal dynamics of IYSV and its vector in onion fields. In 2007 and 2008, T. tabaci and IYSV levels were monitored in six seeded and six transplanted fields. We found significantly more thrips in transplanted fields early in the season, but by the end of the season seeded fields had higher levels of IYSV. The percentage of sample sites with IYSV-infected plants remained low (<12%) until August, when infection levels increased dramatically in some fields. The densities of adult and larval thrips in August and September were better predictors of final IYSV levels than early season thrips densities. For 2007 and 2008, the time onions were harvested may have been more important in determining IYSV levels than whether the onions were seeded or transplanted. Viruliferous thrips emigrating from harvested onion fields into nonharvested ones may be increasing the primary spread of IYSV in late-harvested onions. Managing T. tabaci populations before harvest, and manipulating the spatial arrangement of fields based on harvest date could mitigate the spread of IYSV.

Comparison of waste pumpkin material and its potential use in extruded snack foods.

PubMed

Norfezah, M N; Hardacre, A; Brennan, C S

2011-08-01

Material was produced from Crown pumpkin (Cucurbita maxima) processed from fractions of the fruit which are regarded as waste stream products (peel, flesh and seed). The flour from the three different fractions (peel, flesh and seed) of Crown pumpkin flour was incorporated into an extruded snack product formulation at levels 10%, 30% and 50% (w/w with corn grit) and processed in a twin-screw extruder to make 10 expanded snack products. Proximate analysis was carried out to determine the nutritional value of the raw pumpkin and pumpkin flour. A physical analysis of the product was used to determine its color, the expansion ratio, bulk density and texture. Inclusion of waste stream material (peel and seed) at 10%, yielded extruded products with similar expansion and density characteristics to the control sample; however, an inclusion of greater than 10% yielded significant challenges to product quality (hardness of the product).

Semicontinuous production of ethanol from agricultural wastes by immobilised coculture in a two stage bioreactor.

PubMed

Dey, Sabita

2002-10-01

The seed testing laboratories of Maharashtra discard 10 tonnes of grains and oil seeds treated with pesticides per annum. These agricultural wastes could be converted to reducing sugar and ethanol in a two stage semicontinuous fluidised bed bioreactor containing immobilised, Bacillus sp. and Zymomonas mobilis in the 1st stage and Saccharomyces diastaticus and S. cerevisae in the 2nd stage. The optimum temperature and pH for fermentation in both the stages were 30 degrees C and 7.2 respectively. In this process 600 g (approximately 400 g starch) waste seeds could yield 402 g of reducing sugar in the 1st stage after 20 h and 205 g ethanol in the 2nd stage after 40 h incubation with a yield factor 0.51. Using these system 10 tonnes of agricultural wastes could be converted to 3.4 x 107 g of ethanol.

Improvement of plant growth and seed yield in Jatropha curcas by a novel nitrogen-fixing root associated Enterobacter species

PubMed Central

2013-01-01

Background Jatropha curcas L. is an oil seed producing non-leguminous tropical shrub that has good potential to be a fuel plant that can be cultivated on marginal land. Due to the low nutrient content of the targeted plantation area, the requirement for fertilizer is expected to be higher than other plants. This factor severely affects the commercial viability of J. curcas. Results We explored the feasibility to use endophytic nitrogen-fixing bacteria that are native to J. curcas to improve plant growth, biomass and seed productivity. We demonstrated that a novel N-fixing endophyte, Enterobacter sp. R4-368, was able to colonize in root and stem tissues and significantly promoted early plant growth and seed productivity of J. curcas in sterilized and non-sterilized soil. Inoculation of young seedling led to an approximately 57.2% increase in seedling vigour over a six week period. At 90 days after planting, inoculated plants showed an average increase of 25.3%, 77.7%, 27.5%, 45.8% in plant height, leaf number, chlorophyll content and stem volume, respectively. Notably, inoculation of the strain led to a 49.0% increase in the average seed number per plant and 20% increase in the average single seed weight when plants were maintained for 1.5 years in non-sterilized soil in pots in the open air. Enterobacter sp. R4-368 cells were able to colonize root tissues and moved systemically to stem tissues. However, no bacteria were found in leaves. Promotion of plant growth and leaf nitrogen content by the strain was partially lost in nifH, nifD, nifK knockout mutants, suggesting the presence of other growth promoting factors that are associated with this bacterium strain. Conclusion Our results showed that Enterobacter sp. R4-368 significantly promoted growth and seed yield of J. curcas. The application of the strains is likely to significantly improve the commercial viability of J. curcas due to the reduced fertilizer cost and improved oil yield. PMID:24083555

Individual and combined application of dry heat with high hydrostatic pressure to inactivate Salmonella and Escherichia coli O157:H7 on alfalfa seeds.

PubMed

Neetoo, Hudaa; Chen, Haiqiang

2011-02-01

Alfalfa sprouts are recurrently implicated in outbreaks of food-borne illnesses as a result of contamination with Salmonella or Escherichia coli O157:H7. In the majority of these outbreaks, the seeds themselves have been shown to be the most likely source of contamination. The aims of this study were to comparatively assess the efficacy of dry heat treatments alone or in conjunction with high hydrostatic pressure (HHP) to eliminate a ∼5 log CFU/g load of Salmonella and E. coli O157:H7 on alfalfa seeds. Dry heat treatments at mild temperatures of 55 and 60 °C achieved ≤1.6 and 2.2 log CFU/g reduction in the population of Salmonella spp. after a 10-d treatment, respectively. However, subjecting alfalfa seeds to more aggressive temperatures of 65 °C for 10 days or 70 °C for 24 h eliminated a ∼5 log population of Salmonella and E. coli O157:H7. We subsequently showed that the sequential application of dry heating followed by HHP could substantially reduce the dry heating exposure time while achieving equivalent decontamination results. Dry heating at 55, 60, 65 and 70 °C for 96, 24, 12 and 6 h, respectively followed by a pressure treatment of 600 MPa for 2 min at 35 °C were able to eliminate a ∼5 log CFU/g initial population of both pathogens. Finally, we evaluated the impact of selected treatments on the seed germination percentages and yield ratios and showed that dry heating at 65 °C for 10 days did not bring about any considerable decrease in the germination percentage. However, the sprout yield of treated alfalfa seeds was reduced by 21%. Dry heating at 60 and 65 °C for 24 and 12 h respectively followed by the pressure treatment of 600 MPa for 2 min at 35 °C did not significantly (P > 0.05) affect the germination percentage of alfalfa seeds although a reduction in the sprouting yield was observed. Copyright © 2010 Elsevier Ltd. All rights reserved.

Effects of seed mixture sowing with resistant and susceptible rice on population dynamics of target planthoppers and non-target stemborers and leaffolders.

PubMed

Li, Zhuo; Wan, Guijun; Wang, Long; Parajulee, Megha N; Zhao, Zihua; Chen, Fajun

2018-07-01

The widespread planting of insect-resistant crops has caused a dramatic shift in agricultural landscapes, thus raising concerns about the potential impact on both target and non-target pests worldwide. In this study, we examined the potential effects of six seed mixture ratios of insect-resistance dominance [100% (R100), 95% (S05R95), 90% (S10R90), 80% (S20R80), 60% (S40R60), and 0% (S100)] on target and non-target pests in a 2-year field trial in southern China. The occurrence of the target pests Nilaparvata lugens and Sogatella furcifera decreased with an increase in the ratio of resistant rice, and mixture ratios with ≥90% resistant rice significantly increased the pest suppression efficiency, with the lowest occurrences of the non-target pests Sesamia inferens, Chilo suppressalis and Cnaphalocrocis medinalis for S100 and S10R90 seed mixture ratios. Furthermore, there were no significant differences in the 1000-grain dry weight and grain yield between R100 and other treatments with ≥80% resistant seeds in the mixture (S20R80, S10R90 and S05R95). S10R90 produced a good yield and provided the most effective control of both target and non-target pests, with the potential to significantly reduce the application of chemical pesticides for integrated pest management in paddy fields. It is further presumed that the strategy of seed mixture with resistant and susceptible rice would be advantageous for rice yield stability. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

Aerosol-chamber study of the α-pinene/O 3 reaction: influence of particle acidity on aerosol yields and products

NASA Astrophysics Data System (ADS)

Iinuma, Yoshiteru; Böge, Olaf; Gnauk, Thomas; Herrmann, Hartmut

α-Pinene ozonolysis was carried out in the presence of ammonium sulfate or sulfuric acid seed particles in a 9 m 3 Teflon chamber at the mixing ratios of 100 ppbv for α-pinene and about 70 ppbv for ozone. The evolution of size distribution was measured by means of a differential mobility particle sizer (DMPS). The resulting secondary organic aerosol (SOA) was sampled by a denuder/quartz fiber filter combination for the determination of the total organic carbon concentration (TOC) in the particle phase, using a thermographic method and by a denuder/PTFE filter combination for the analysis of individual chemical species in the particle phase using capillary electrophoresis-electrospray ionization-mass spectrometry (CE-ESI-MS). cis-Pinic acid ( m/ z 185) and another species tentatively identified at m/ z 171 and 199 were the major particle phase species for both seed particles although the product yields were different, indicating the influence of seed particle acidity. A thermographic method for the determination of TOC showed an increase of particle phase organics by 40% for the experiments with higher acidity. CE-ESI-MS analysis showed a large increase in the concentration of compounds with Mw>300 from the experiments with sulfuric acid seed particles. These results suggest that the seed particle acidity enhances the yield of SOA and plays an important role in the formation of larger molecules in the particle phase. Our results from direct particle phase chemical analysis suggest for the first time that condensation of smaller organics takes place by polymerization or aldol condensation following the formation of aldehydes, such as pinonaldehyde from the terpene ozonolysis.

Raman Hyperspectral Imaging for Detection of Watermelon Seeds Infected with Acidovorax citrulli.

PubMed

Lee, Hoonsoo; Kim, Moon S; Qin, Jianwei; Park, Eunsoo; Song, Yu-Rim; Oh, Chang-Sik; Cho, Byoung-Kwan

2017-09-23

The bacterial infection of seeds is one of the most important quality factors affecting yield. Conventional detection methods for bacteria-infected seeds, such as biological, serological, and molecular tests, are not feasible since they require expensive equipment, and furthermore, the testing processes are also time-consuming. In this study, we use the Raman hyperspectral imaging technique to distinguish bacteria-infected seeds from healthy seeds as a rapid, accurate, and non-destructive detection tool. We utilize Raman hyperspectral imaging data in the spectral range of 400-1800 cm -1 to determine the optimal band-ratio for the discrimination of watermelon seeds infected by the bacteria Acidovorax citrulli using ANOVA. Two bands at 1076.8 cm -1 and 437 cm -1 are selected as the optimal Raman peaks for the detection of bacteria-infected seeds. The results demonstrate that the Raman hyperspectral imaging technique has a good potential for the detection of bacteria-infected watermelon seeds and that it could form a suitable alternative to conventional methods.

Herbicidal Activity of Glucosinolate Degradation Products in Fermented Meadowfoam (Limnanthes alba) Seed Meal

PubMed Central

STEVENS, JAN F.; REED, RALPH L.; ALBER, SUSAN; PRITCHETT, LARRY; MACHADO, STEPHEN

2009-01-01

Meadowfoam (Limnanthes alba) is an oilseed crop grown in western Oregon. After extraction of the oil from the seeds, the remaining seed meal contains 2-4% of the glucosinolate, glucolimnanthin. We investigated the effect of fermentation of seed meal on its chemical composition and the effect of the altered composition on downy brome (Bromus tectorum) coleoptile emergence. Incubation of enzyme-inactive seed meal with enzyme-active seeds (1% by weight) resulted in complete degradation of glucolimnanthin and formation of 3-methoxybenzyl isothiocyanate in 28% yield. Fermentation in the presence of an aqueous solution of FeSO4 (10 mM) resulted in the formation of 3-methoxyphenylacetonitrile and 2-(3-methoxyphenyl)ethanethioamide, a novel natural product. The formation of the isothiocyanate, the nitrile and the thioamide, as a total, correlated with an increase of herbicidal potency of seed meal (r2 = 0.96). The results of this study open new possibilities for the refinement of glucosinolate-containing seed meals for use as bioherbicides. PMID:19170637

Herbicidal activity of glucosinolate degradation products in fermented meadowfoam ( Limnanthes alba ) seed meal.

PubMed

Stevens, Jan F; Reed, Ralph L; Alber, Susan; Pritchett, Larry; Machado, Stephen

2009-03-11

Meadowfoam ( Limnanthes alba ) is an oilseed crop grown in western Oregon. After extraction of the oil from the seeds, the remaining seed meal contains 2-4% of the glucosinolate glucolimnanthin. This study investigated the effect of fermentation of seed meal on its chemical composition and the effect of the altered composition on downy brome ( Bromus tectorum ) coleoptile emergence. Incubation of enzyme-inactive seed meal with enzyme-active seeds (1% by weight) resulted in complete degradation of glucolimnanthin and formation of 3-methoxybenzyl isothiocyanate in 28% yield. Fermentation in the presence of an aqueous solution of FeSO(4) (10 mM) resulted in the formation of 3-methoxyphenylacetonitrile and 2-(3-methoxyphenyl)ethanethioamide, a novel natural product. The formation of the isothiocyanate, the nitrile, and the thioamide, as a total, correlated with an increase of herbicidal potency of the seed meal (r(2) = 0.96). The results of this study open new possibilities for the refinement of glucosinolate-containing seed meals for use as bioherbicides.

Raman Hyperspectral Imaging for Detection of Watermelon Seeds Infected with Acidovorax citrulli

PubMed Central

Lee, Hoonsoo; Kim, Moon S.; Qin, Jianwei; Park, Eunsoo; Song, Yu-Rim; Oh, Chang-Sik

2017-01-01

The bacterial infection of seeds is one of the most important quality factors affecting yield. Conventional detection methods for bacteria-infected seeds, such as biological, serological, and molecular tests, are not feasible since they require expensive equipment, and furthermore, the testing processes are also time-consuming. In this study, we use the Raman hyperspectral imaging technique to distinguish bacteria-infected seeds from healthy seeds as a rapid, accurate, and non-destructive detection tool. We utilize Raman hyperspectral imaging data in the spectral range of 400–1800 cm−1 to determine the optimal band-ratio for the discrimination of watermelon seeds infected by the bacteria Acidovorax citrulli using ANOVA. Two bands at 1076.8 cm−1 and 437 cm−1 are selected as the optimal Raman peaks for the detection of bacteria-infected seeds. The results demonstrate that the Raman hyperspectral imaging technique has a good potential for the detection of bacteria-infected watermelon seeds and that it could form a suitable alternative to conventional methods. PMID:28946608

Analysis of Large Seeds from Three Different Medicago truncatula Ecotypes Reveals a Potential Role of Hormonal Balance in Final Size Determination of Legume Grains

PubMed Central

Bandyopadhyay, Kaustav; Uluçay, Orhan; Şakiroğlu, Muhammet; Udvardi, Michael K.; Verdier, Jerome

2016-01-01

Legume seeds are important as protein and oil source for human diet. Understanding how their final seed size is determined is crucial to improve crop yield. In this study, we analyzed seed development of three accessions of the model legume, Medicago truncatula, displaying contrasted seed size. By comparing two large seed accessions to the reference accession A17, we described mechanisms associated with large seed size determination and potential factors modulating the final seed size. We observed that early events during embryogenesis had a major impact on final seed size and a delayed heart stage embryo development resulted to large seeds. We also observed that the difference in seed growth rate was mainly due to a difference in embryo cell number, implicating a role of cell division rate. Large seed accessions could be explained by an extended period of cell division due to a longer embryogenesis phase. According to our observations and recent reports, we observed that auxin (IAA) and abscisic acid (ABA) ratio could be a key determinant of cell division regulation at the end of embryogenesis. Overall, our study highlights that timing of events occurring during early seed development play decisive role for final seed size determination. PMID:27618017

Classification of cucumber green mottle mosaic virus (CGMMV) infected watermelon seeds using Raman spectroscopy

NASA Astrophysics Data System (ADS)

Lee, Hoonsoo; Lim, Hyoun-Sub; Cho, Byoung-Kwan

2016-05-01

The Cucumber Green Mottle Mosaic Virus (CGMMV) is a globally distributed plant virus. CGMMV-infected plants exhibit severe mosaic symptoms, discoloration, and deformation. Therefore, rapid and early detection of CGMMV infected seeds is very important for preventing disease damage and yield losses. Raman spectroscopy was investigated in this study as a potential tool for rapid, accurate, and nondestructive detection of infected seeds. Raman spectra of healthy and infected seeds were acquired in the 400 cm-1 to 1800 cm-1 wavenumber range and an algorithm based on partial least-squares discriminant analysis was developed to classify infected and healthy seeds. The classification model's accuracies for calibration and prediction data sets were 100% and 86%, respectively. Results showed that the Raman spectroscopic technique has good potential for nondestructive detection of virus-infected seeds.

Release of Esterase Following Germination of Lettuce Seed (Lactuca sativa L.)

PubMed Central

Chandra, G. Ram; Toole, Vivian K.

1977-01-01

Light-insensitive lettuce seeds, Lactuca sativa L. cv. Great Lakes, release esterases for a period following radicle protrusion. Very little or no enzymes are released prior to 24 hours or after 48 hours of germination. As compared to intact seeds, half-seeds readily release esterases and the release is not affected by far red irradiation. Bulk of the released esterases are derived from the endosperm tissue and presumably exists in the intact seed as a component of the extraembryonic fluid. PMID:16659992

Impact of Seed Exudates on Growth and Biofilm Formation of Bacillus amyloliquefaciens ALB629 in Common Bean

PubMed Central

Martins, Samuel J.; Medeiros, Flávio H. V.; Lakshmanan, Venkatachalam; Bais, Harsh P.

2018-01-01

We aimed to unravel the events which favor the seed-rhizobacterium Bacillus amyloliquefaciens strain ALB629 (hereafter ALB629) interaction and which may interfere with the rhizobacterium colonization and growth on the spermosphere of common bean. Seed exudates from common bean were tested in vitro for ALB629 biofilm formation and bacterial growth. Furthermore, the performance of ALB629 on plant-related variables under drought stress was checked. Seed exudates (1 and 5% v/v) increased ALB629 biofilm formation. Additionally, the colony forming units for ALB629 increased both in culture and on the bean seed surface. The bean seed exudates up-regulated biofilm operons in ALB629 TasA and EpsD by ca. two and sixfold, respectively. The high-performance liquid chromatography (HPLC)-coupled with MS showed that malic acid is present as a major organic acid component in the seed exudates. Seeds treated with ALB629 and amended with malic acid resulted in seedlings with a higher bacterial concentration, induced plant drought tolerance, and promoted plant growth. We showed that seed exudates promote growth of ALB629 and malic acid was identified as a major organic acid component in the bean seed exudates. Our results also show that supplementation of ALB629 induced drought tolerance and growth in plants. The research pertaining to the biological significance of seed exudates in plant–microbe interaction is unexplored field and our work shows the importance of seed exudates in priming both growth and tolerance against abiotic stress. PMID:29375501

Antifungal activities of ethanolic extract from Jatropha curcas seed cake.

PubMed

Saetae, Dolaporn; Suntornsuk, Worapot

2010-02-01

Phorbol ester extraction was carried out from Jatropha curcas seed cake, a by-product from the bio-diesel fuel industry. Four repeated extractions from 5 g J. curcas seed cake using 15 ml of 90% (v/v) ethanol and a shaking speed of 150 rev/min gave the highest yield of phosbol esters. The ethanolic extract of J. curcas seed cake showed antifungal activities against important phytofungal pathogens: Fusarium oxysporum, Pythium aphanidermatum, Lasiodiplodia theobromae, Curvularia lunata, Fusarium semitectum, Colletotrichum capsici and Colletotrichum gloeosporiodes. The extract contained phorbol esters mainly responsible for antifungal activities. The extract could therefore be used as an antifungal agent for agricultural applications.

Effect of salinity stress on phenotypic plasticity, yield stability, and signature of stable isotopes of carbon and nitrogen in safflower.

PubMed

Hussain, Muhammad Iftikhar; Al-Dakheel, Abdullah J

2018-06-05

Salinity is one of the major factors contributing in land degradation, disturbance of soil biology, a structure that leads to unproductive land with low crop yield potential especially in arid and semiarid regions of the world. Appropriate crops with sufficient stress tolerance capacity and non-conventional water resources should have to be managed in a sustainable way to bring these marginal lands under cultivation for future food security. The goal of the present study was to evaluate salinity tolerant potential (0, 7, and 14 dS m -1 ) of six safflower genotypes that can be adapted to the hyper arid climate of UAE and its marginal soil. Several agro-morphological and physiological traits such as plant dry biomass (PDM), number of branches (BN), number of capitula (CN), seed yield (SY), stable isotope composition of nitrogen (δ 15 N) and carbon (δ 13 C), intercellular CO 2 concentration from inside to ambient air (Ci/Ca), intrinsic water use efficiency (iWUE), carbon (C%) and nitrogen (N %), and harvest index (HI) were evaluated as indicative of the functional performance of safflower genotypes under salt stress. Results indicated that salinity significantly affected the seed yield at all levels and varied significantly among genotypes. The BN, PDM, CN, and δ 13 C attributes showed clear differentiation between tolerant and susceptible genotypes. The δ 13 C results indicate that the tolerant genotypes suffer less from stress, may be due to better rooting. Tolerant genotypes showed lower iWUE values but possess higher yield. Safflower genotypes (PI248836 and PI167390) proved to be salt tolerant, stable, and higher seed and biomass yielder. There was no G × E interaction but the genotypes that produce higher yield under control were still best even under salt stress conditions. Although salinity reduced crop yield, some tolerant genotypes demonstrate adaptation and good yield potential under saline marginal environment.

Distinct Cell Wall Architectures in Seed Endosperms in Representatives of the Brassicaceae and Solanaceae1[C][W][OA

PubMed Central

Lee, Kieran J.D.; Dekkers, Bas J.W.; Steinbrecher, Tina; Walsh, Cherie T.; Bacic, Antony; Bentsink, Leónie; Leubner-Metzger, Gerhard; Knox, J. Paul

2012-01-01

In some species, a crucial role has been demonstrated for the seed endosperm during germination. The endosperm has been shown to integrate environmental cues with hormonal networks that underpin dormancy and seed germination, a process that involves the action of cell wall remodeling enzymes (CWREs). Here, we examine the cell wall architectures of the endosperms of two related Brassicaceae, Arabidopsis (Arabidopsis thaliana) and the close relative Lepidium (Lepidium sativum), and that of the Solanaceous species, tobacco (Nicotiana tabacum). The Brassicaceae species have a similar cell wall architecture that is rich in pectic homogalacturonan, arabinan, and xyloglucan. Distinctive features of the tobacco endosperm that are absent in the Brassicaceae representatives are major tissue asymmetries in cell wall structural components that reflect the future site of radicle emergence and abundant heteromannan. Cell wall architecture of the micropylar endosperm of tobacco seeds has structural components similar to those seen in Arabidopsis and Lepidium endosperms. In situ and biomechanical analyses were used to study changes in endosperms during seed germination and suggest a role for mannan degradation in tobacco. In the case of the Brassicaceae representatives, the structurally homogeneous cell walls of the endosperm can be acted on by spatially regulated CWRE expression. Genetic manipulations of cell wall components present in the Arabidopsis seed endosperm demonstrate the impact of cell wall architectural changes on germination kinetics. PMID:22961130

The fatty acid and tocopherol constituents of the seed oil extracted from 21 grape varieties (Vitis spp.).

PubMed

Sabir, Ali; Unver, Ahmet; Kara, Zeki

2012-07-01

Fatty acids and tocopherols in appropriate quantities are invaluable attributes that are desirable in seeds of agricultural products. Studies have generally focused on the evaluation of the oil and tocopherol components of oil crops. Recently, investigations revealed that the grape seed has robust potential in the production of healthy fatty acids as well as tocopherols. This study was thus conducted to determine the oil and tocopherol components of grape seeds, obtained from various grape cultivars of different species, including two rootstock varieties. The grape seed oil concentration of the studied varieties ranged from 7.3 to 22.4%. The determined fatty acid profiles of the genotypes conformed to the pattern described in the literature for grapes. Linoleic acid is the major component comprising 53.6-69.6% of the total, followed by oleic (16.2-31.2%), palmitic (6.9-12.9%) and stearic (1.44-4.69%). The oils of all the seeds analysed showed a preponderance of α-tocopherol (ranging from 260.5 to 153.1 mg kg⁻¹ oil extract). β-Tocopherol, γ-tocopherol and δ-tocopherol were also detected with the general means of 0.98, 22.2 and 0.92 mg kg⁻¹, respectively. Linoleic acid showed a significantly negative correlation with all the fatty acids analysed. The strongest negative correlation existed between linoleic and oleic acids (r = -0.834, P < 0.01). Present investigations indicated that oil content, fatty acid composition and tocopherol constituents of grape seed show great variation among the genotypes. Markedly higher proportions of linoleic acid with considerable amounts of tocopherols found in the oil samples suggest that grape seed is a good source for culinary, pharmaceutical and cosmetic uses. Copyright © 2012 Society of Chemical Industry.

Variations in seed protein content of cotton (Gossypium hirsutum L.) mutant lines by in vivo and in vitro mutagenesis.

PubMed

Muthusamy, Annamalai; Jayabalan, Narayanasamy

2013-01-01

The present work describes the influence of gamma irradiation (GR), ethyl methane sulphonate (EMS) and sodium azide (SA) treatment on yield and protein content of selected mutant lines of cotton. Seeds of MCU 5 and MCU 11 were exposed to gamma rays (GR), ethyl methane sulphonate (EMS) and sodium azide (SA). Lower dose of gamma irradiation (100-500 Gy), 10-50 mM EMS and SA at lower concentration effectively influences in improving the yield and protein content. Significant increase in yield (258.9 g plant(-1)) and protein content (18.63 mg g(-1) d. wt.) as compared to parental lines was noted in M2 generations. During the subsequent field trials, number of mutant lines varied morphologically in terms of yield as well as biochemical characters such as protein. The selected mutant lines were bred true to their characters in M3 and M4 generations. The significant increase in protein content and profiles of the mutant lines with range of 10.21-18.63 mg g(-1). The SDS-PAGE analysis of mutant lines revealed 9 distinct bands of different intensities with range of 26-81 kDa. The difference in intensity of bands was more (41, 50 and 58 kDa) in the mutant lines obtained from in vitro mutation than in vivo mutation. Significance of such stimulation in protein content correlated with yielding ability of the mutant lines of cotton in terms of seed weight per plant. The results confirm that in cotton it is possible to enhance the both yield and biochemical characters by in vivo and in vitro mutagenic treatments.

Elevated CO2 alters distribution of nodal leaf area and enhances nitrogen uptake contributing to yield increase of soybean cultivars grown in Mollisols.

PubMed

Jin, Jian; Li, Yansheng; Liu, Xiaobing; Wang, Guanghua; Tang, Caixian; Yu, Zhenhua; Wang, Xiaojuan; Herbert, Stephen J

2017-01-01

Understanding how elevated CO2 affects dynamics of nodal leaf growth and N assimilation is crucial for the construction of high-yielding canopy via breeding and N management to cope with the future climate change. Two soybean cultivars were grown in two Mollisols differing in soil organic carbon (SOC), and exposed to ambient CO2 (380 ppm) or elevated CO2 (580 ppm) throughout the growth stages. Elevated CO2 induced 4-5 more nodes, and nearly doubled the number of branches. Leaf area duration at the upper nodes from R5 to R6 was 4.3-fold greater and that on branches 2.4-fold higher under elevated CO2 than ambient CO2, irrespective of cultivar and soil type. As a result, elevated CO2 markedly increased the number of pods and seeds at these corresponding positions. The yield response to elevated CO2 varied between the cultivars but not soils. The cultivar-specific response was likely attributed to N content per unit leaf area, the capacity of C sink in seeds and N assimilation. Elevated CO2 did not change protein concentration in seeds of either cultivar. These results indicate that elevated CO2 increases leaf area towards the upper nodes and branches which in turn contributes yield increase.

Effects of shading on spike differentiation and grain yield formation of summer maize in the field

NASA Astrophysics Data System (ADS)

Cui, Haiyan; Camberato, James J.; Jin, Libin; Zhang, Jiwang

2015-09-01

A field experiment was conducted to study the effects of shading on tassel and ear development and yield formation of three summer maize hybrids Zhenjie 2 (ZJ2), Denghai 605 (DH605), and Zhengdan 958 (ZD958). The ambient sunlight treatment was used as control (CK) and shading treatments (40 % of ambient sunlight) were applied at different growth stages from silking stage (R1) to physiological maturity stage (R6) (treatment S1), from the sixth extended leaf stage (V6) to R1 (treatment S2) and from seeding to R6 (treatment S3). Shading had no significant effect on the time from seeding to shoot emergence (VE); however, subsequent growth and development were delayed with shading beyond this point. The differentiation time of both tassel and ear delayed, and female spike (tassel) floret differentiation, sexual organ formation time, and anthesis-silking interval (ASI) were lengthened. After shading, the total number of floret, silk, and fertilization floret reduced significantly; the number of abortive seeds increased, and the total setting percentage among different treatments showed that CK>S2>S1>S3; and the total setting percentages in S1, S2, and S3 of ZD958 were 44, 72, and 15 % respectively. The total floret number of tassel primordium differentiation, fertility rate, and seed setting rate of florets in S3 treatment was the minimum; kernels per ear decreased seriously and single ear setting percentage was only 16 %; although floret degeneration number of S2 during ear differentiation stages increased and floret fertility rate reduced than that of CK, fertilization flower seed production increased and abortive seed decreased after canceling shading. Aborted kernel of S1 increased and kernel dry weight reduced, resulting in a significant decrease of kernel number per ear and kernel weight, and the grain abortive rate of 40-62 %. In conclusion, shading changed the growth and development process and caused infertility of tassel and ear; tassel branches decreased, reducing pollen vitality and silks differentiation cut down; and grain dry matter accumulation and setting percentage decreased, causing yield reduction. Grain yield and biomass reduced 66, 36, and 93 % compared to the control by shading treatments of S1, S2, and S3, respectively.

Switchgrass cultivar

DOEpatents

Wu, Yanqi; Taliaferro, Charles M.

2012-10-02

A new cultivar of switchgrass `Cimarron` (SL93 2001-1) having increased biomass yield is provided. The switchgrass comprises all the morphological and physiological properties of the cultivar grown from a seed deposited under American Type Culture Collection (ATCC) No. PTA-10116. The invention also provides seeds, progeny, parts and methods of use of Cimarron, such as for the production of biofuels.

Weed control in organic rice using plastic mulch and water seeding methods in addition to cover crops

USDA-ARS?s Scientific Manuscript database

Weeds are a major yield limiting factor in organic rice farming and are more problematic than in conventional production systems. Water seeding is a common method of reducing weed pressure in rice fields as many weeds connot tolerate flooded field conditions. The use of cover crops is another method...

Cutleafgroundcherry (physalis angulata) density, biomass and seed production in peanut (arachis hypogaea L.) following regrowth due to inadequate control

USDA-ARS?s Scientific Manuscript database

A field experiment was conducted to evaluate herbicide and application timing on cutleaf groundcherry density, biomass, seed production, and crop yield in a peanut system. Treatments included: 1) a non-treated control; 2) hand pruning; 3) diclosulam applied preemergence (PRE) alone at 0.027 kg ai h...

Somatic embryogenesis tissue culture for applying varietal forestry to conifer species

Treesearch

Steven C. Grossnickle; John Pait

2008-01-01

The use of tree improvement practices to enhance the genetic characteristics of planted seedlings is a forestry practice that consistently shows a high return on investment by increasing yields obtained from planted forests. The use of improved seeds is an effective way of bringing genetic improvement to forest regeneration programs. Seed orchards are currently used to...

Uncovering the genetic architecture of seed weight and size in intermediate wheatgrass through linkage and association mapping

USDA-ARS?s Scientific Manuscript database

Intermediate wheatgrass (IWG); Thinopyrum intermedium) is being developed as a new perennial grain crop that has a large allohexaploid genome similar to that of wheat (Triticum aestivum). Breeding for increased seed weight is one of the primary goals for improving grain yield of IWG. As a new crop, ...

Unravling Key metabolomic alterations of embryos derived from water-imbibed seeds of two wheat cultivars contrasting with contrasting dormancy status

USDA-ARS?s Scientific Manuscript database

Untimely rains in wheat fields during harvest season can cause pre-harvest sprouting (PHS) which deteriorates yield and quality of the crop. Metabolic homeostasis of embryo and endosperm plays a role in seed dormancy, and determines the status of the maturing grains either as dormant (PHS-tolerant) ...

The merits of artificial selection for the development of restoration-ready plant materials of native perennial grasses

USDA-ARS?s Scientific Manuscript database

While seed harvested from remnant stands of grass can be used for restoration in temperate regions, seed recovery in semi-arid and arid environments is often unreliable and of low yield and quality. In addition, ongoing harvest of indigenous populations can be unsustainable, especially for those th...

Limited seed and seed yield response of calendula to applied nitrogen does not justify risk of environmental damage from high urea application rates

USDA-ARS?s Scientific Manuscript database

Calendula (Calendula officinalis L.) is a source of industrial oil, which can serve as a domestic substitute for petroleum or imported specialty crop oils. Traditionally, calendula has been grown for medicinal or ornamental properties. However, little is known about nitrogen (N) requirement of growi...