Sample records for seti message designs

  1. The art and science of interstellar message composition: a report on international workshops to encourage multidisciplinary discussion

    NASA Astrophysics Data System (ADS)

    Vakoch, Douglas A.

    2011-02-01

    Throughout the history of the Search for Extraterrestrial Intelligence (SETI), there has been widespread recognition of the profound societal implications of detecting intelligence beyond Earth. At the SETI Institute, interstellar message construction serves as the focus of a multidisciplinary attempt to prepare for the cultural impact of signal detection and the critical events that would follow. Interstellar message construction at the SETI Institute builds upon the recommendations of the 1991-1992 Workshops on the Cultural Aspects of SETI, while also exploring opportunities for multidisciplinary contributions on new topics. Through a series of international workshops in Toulouse, Paris, Zagreb, Washington, and Bremen, the SETI Institute and partner organizations have fostered broad-based discussion about some of the most important decisions that would follow detection of extraterrestrial intelligence, including "should we reply?" and if so, " what should we say, and how might we say it?". Several of the themes addressed at these workshops will be highlighted, including the relationship between art and science in designing messages, the value of interactive messages, and the importance of better understanding the nature of language.

  2. Representing culture in interstellar messages

    NASA Astrophysics Data System (ADS)

    Vakoch, Douglas A.

    2008-09-01

    As scholars involved with the Search for Extraterrestrial Intelligence (SETI) have contemplated how we might portray humankind in any messages sent to civilizations beyond Earth, one of the challenges they face is adequately representing the diversity of human cultures. For example, in a 2003 workshop in Paris sponsored by the SETI Institute, the International Academy of Astronautics (IAA) SETI Permanent Study Group, the International Society for the Arts, Sciences and Technology (ISAST), and the John Templeton Foundation, a varied group of artists, scientists, and scholars from the humanities considered how to encode notions of altruism in interstellar messages . Though the group represented 10 countries, most were from Europe and North America, leading to the group's recommendation that subsequent discussions on the topic should include more globally representative perspectives. As a result, the IAA Study Group on Interstellar Message Construction and the SETI Institute sponsored a follow-up workshop in Santa Fe, New Mexico, USA in February 2005. The Santa Fe workshop brought together scholars from a range of disciplines including anthropology, archaeology, chemistry, communication science, philosophy, and psychology. Participants included scholars familiar with interstellar message design as well as specialists in cross-cultural research who had participated in the Symposium on Altruism in Cross-cultural Perspective, held just prior to the workshop during the annual conference of the Society for Cross-cultural Research . The workshop included discussion of how cultural understandings of altruism can complement and critique the more biologically based models of altruism proposed for interstellar messages at the 2003 Paris workshop. This paper, written by the chair of both the Paris and Santa Fe workshops, will explore the challenges of communicating concepts of altruism that draw on both biological and cultural models.

  3. Breakthrough Listen - A New Search for Life in the Universe

    NASA Astrophysics Data System (ADS)

    Worden, Pete

    On July 20, 2015 Yuri Milner and Stephen Hawking announced a new set of scientific initiatives - a SETI search called Breakthrough Listen and a contest to devise potential messages in response to a detection entitled Breakthrough Message. These are the first of several privately-funded Breakthrough Initiatives, designed to answer the fundamental science questions surrounding the origin, extent and nature of life in the universe. The initiatives are managed by the Breakthrough Prize Foundation. With Breakthrough Listen, Radio SETI observations have begun at the Green Bank Radio Telescope (GBT) and optical SETI at the Lick Observatory Automated Planet Finder (APF). Observations will soon commence at the CSIRO Parkes Radio Telescope. Other SETI instruments and observations are under consideration. In addition, several other initiatives are under development including an expanded search for life in the universe.

  4. SETI-EC: SETI Encryption Code

    NASA Astrophysics Data System (ADS)

    Heller, René

    2018-03-01

    The SETI Encryption code, written in Python, creates a message for use in testing the decryptability of a simulated incoming interstellar message. The code uses images in a portable bit map (PBM) format, then writes the corresponding bits into the message, and finally returns both a PBM image and a text (TXT) file of the entire message. The natural constants (c, G, h) and the wavelength of the message are defined in the first few lines of the code, followed by the reading of the input files and their conversion into 757 strings of 359 bits to give one page. Each header of a page, i.e. the little-endian binary code translation of the tempo-spatial yardstick, is calculated and written on-the-fly for each page.

  5. The Search for Extraterrestrial Intelligence (SETI) and Whether to send 'Messages' (METI): A Case for Conversation, Patience and Due Diligence

    NASA Astrophysics Data System (ADS)

    Brin, D.

    Understanding the controversy over "Messages to Extra Terrestrial Intelligence" or METI requires a grounding in the history and rationale of SETI (Search for ETI). Insights since the turn of the century have changed SETI's scientific basis. Continued null results from the radio search do not invalidate continuing effort, but they do raise questions about long-held assumptions. Modified search strategies are discussed. The Great Silence or Fermi Paradox is appraised, along with the disruptive plausibility of interstellar travel. Psychological motivations for METI are considered. With this underpinning, we consider why a small cadre of SETI-ist radio astronomers have resisted the notion of international consultations before humanity takes a brash and irreversible step into METI, shouting our presence into the cosmos.

  6. Responsibility, capability, and Active SETI: Policy, law, ethics, and communication with extraterrestrial intelligence

    NASA Astrophysics Data System (ADS)

    Vakoch, Douglas A.

    2011-02-01

    With recently growing interest in the Active Search for Extraterrestrial Intelligence (SETI), in which humankind would send intentional signals to extraterrestrial civilizations, there have been increased concerns about appropriate policy, as well as the role of space law and ethics in guiding such activities. Implicit in these discussions are notions of responsibility and capability that affect judgments about whether humans or other civilizations should initiate transmissions. Existing protocols that guide SETI research address transmissions from Earth, but there is debate over whether these guidelines should inform de novo transmissions as well. Relevant responsibilities to address include (1) looking out for the interests of humankind as a whole, (2) being truthful in interstellar messages, and (3) benefiting extraterrestrial civilizations. Our capabilities as a species and a civilization affect how well we can fulfill responsibilities, as seen when we consider whether we will be able to reach consensus about message contents (and whether that would be desirable), and whether we have the capacity to decode messages from beings that rely on different sensory modalities. The interplay of these responsibilities and capabilities suggests that humankind should place increased emphasis on Active SETI.

  7. A human language corpus for interstellar message construction

    NASA Astrophysics Data System (ADS)

    Elliott, John

    2011-02-01

    The aim of HuLCC (the human language chorus corpus), is to provide a resource of sufficient size to facilitate inter-language analysis by incorporating languages from all the major language families: for the first time all aspects of typology will be incorporated within a single corpus, adhering to a consistent grammatical classification and granularity, which historically adopt a plethora of disparate schemes. An added feature will be the inclusion of a common text element, which will be translated across all languages, to provide a precise comparable thread for detailed linguistic analysis for translation strategies and a mechanism by which these mappings can be explicitly achieved. Methods developed to solve unambiguous mappings across these languages can then be adopted for any subsequent message authored by the SETI community. Initially, it is planned to provide at least 20,000 words for each chosen language, as this amount of text exceeds the point where randomly generated text can be disambiguated from natural language and is of sufficient size useful for message transmission [1] (Elliot, 2002). This paper details the design of this resource, which ultimately will be made available to SETI upon its completion, and discusses issues 'core' to any message construction.

  8. SETI: Spreading the net

    NASA Astrophysics Data System (ADS)

    Carstairs, Ian R.

    2002-12-01

    Ian R Carstairs reports on efforts to extend the search for extraterrestrial intelligence to X and γ-ray regions. Traditional Search for Extra-Terrestrial Intelligence (SETI) strategies have used radio, microwave and, to a limited extent, optical searches. But this ignores the higher energy X and γ-ray regions that a technologically advanced extraterrestrial civilization might use to attract our attention - using messages encoded in discrete photon-counting exchange, much like the signals seen from pulsars. Here, the methods used in high-energy pulsar detection and analysis are reviewed and applied to this new SETI initiative.

  9. Do potential SETI signals need to be decontaminated?

    NASA Astrophysics Data System (ADS)

    Carrigan, Richard A., Jr.

    2006-01-01

    Biological contamination from space samples is a remote but accepted possibility. Signals received by searches for extraterrestrial intelligence (SETI) could also contain harmful information in the spirit of a computer virus, the so-called "SETI Hacker" hypothesis. Over the last four decades extraterrestrial intelligence searches have given little consideration to this possibility. Some argue that information in an extraterrestrial signal could not attack a terrestrial computer because the computer logic and code is idiosyncratic and constitutes an impenetrable firewall. Suggestions are given on how to probe these arguments. Measures for decontaminating extraterrestrial intelligence signals (ETI) are discussed. Modifications to the current SETI detection protocol may be appropriate. Beyond that, the potential character of ETI message content requires much broader discussion.

  10. Half a century of SETI in the USSR and Russia

    NASA Astrophysics Data System (ADS)

    Gindilis, Lev; Gurvits, Leonid

    SETI studies in the USSR ascend back to the beginning of the 1960s. The stage for these studies have been set by the publication of the first edition of the book “The Universe, Life and Intelligence” by I.S. Shklovsky in 1962. Important milestones of early decades of the studies were the First All-Union Conference on extraterrestrial civilisations (Byurakan, 1964), the First International Symposium on CETI (Byurakan, 1971), the Zelenchukskaya Workshop (1975), Tallinn (1981) and Vilnius (1987) symposia, the Decennial US-USSR Conference on SETI (Santa Cruz, CA, 1991). The studies discussed at these forums ranged from developing criteria of “artificiality” of signals, analysing possible strategies of communication and broadcasting of messages on cosmic distances, methodology of search for artificial signals in various domains of the electro-magnetic spectrum, optimisation of frequency bands for search of and communication with ETI. A number of exploratory search projects have been conducted in radio and optical domains in the 1960s-80s. Theoretical studies were focused at developing optimal techniques for coding and decoding of interstellar messages, evaluation of astro-engineering dimension of the extraterrestrial intelligent activities, advancing philosophical aspects of the SETI problem. Later, in the 1990s and first decade of the third millennium, despite of general difficulties confronting scientific activities in Russia, SETI-oriented studies continued in the area of surveys of sun-like stars in Milky Way, search for Dyson spheres and optical signals with indications on artificiality. Several programmes of cosmic broadcasting were conducted too, including radio transmission toward selected stars. Serious re-thinking was given to incentives for passive and active involvement in SETI and CETI by cosmic civilisations. In our presentation, we will give a brief review of the past activities mentioned above and offer an outlook for further steps in advancing SETI. This outlook will be based on the advances of relevant scientific and technological areas, especially in astronomy. These developments are characterised by invention of new ultra-sensitive instruments and ability to process enormous amounts of experimental (observing) data, unthinkable in the recent past. All that would create a new basis for the continuation of SETI in the foreseeable future.

  11. Costs and Difficulties of Interstellar 'Messaging' and the Need for International Debate on Potential Risks

    NASA Astrophysics Data System (ADS)

    Billingham, J.; Benford, James

    We advocate international consultations on societal and technical issues to address the risk of Messaging to Extraterrestrial Intelligence (METI) transmissions, and a moratorium on future transmissions until such issues are resolved. Instead, we recommend continuing to conduct SETI by listening, with no innate risk, while using powerful new search systems to give a better total probability of detection of beacons and messages than METI for the same cost, and with no need for a long obligatory wait for a response. Realistically, beacons are costly. In light of recent work on the economics of contact by radio, we offer alternatives to the current standard methods of SETI searches. METI transmissions to date are faint and very unlikely to be detected, even by nearby stars. We show that historical leakage from Earth has been undetectable for Earth-scale receiver systems. Future space microwave and laser power systems will likely be more detectable.

  12. Introduction to the METI Issues

    NASA Astrophysics Data System (ADS)

    Benford, J.

    Understanding the controversy over "Messages to Extra Terrestrial Intelligence" or METI requires a grounding in the history and rationale of SETI (Search for ETI). Insights since the turn of the century have changed SETI's scientific basis. Continued null results from the radio search do not invalidate continuing effort, but they do raise questions about long-held assumptions. Modified search strategies are discussed. The Great Silence or Fermi Paradox is appraised, along with the disruptive plausibility of interstellar travel. Psychological motivations for METI are considered. With this underpinning, we consider why a small cadre of SETI-ist radio astronomers have resisted the notion of international consultations before humanity takes a brash and irreversible step into METI, shouting our presence into the cosmos.

  13. Messages from Space: The Solar System and Beyond. Grades 508. Teacher's Guide. Great Explorations in Science (GEMS).

    ERIC Educational Resources Information Center

    Beals, Kevin; Erickson, John; Sneider, Cary

    Building on collaborative work between the Search for Extraterrestrial Intelligence (SETI) Institute and the Lawrence Hall of Science, this curriculum takes advantage of humans' fascination with extraterrestrials to catalyze the study of the solar system and beyond. The unit begins when students attempt to decode a fictitious message from outer…

  14. What should we say to extraterrestrial intelligence?: An analysis of responses to “Earth Speaks”

    NASA Astrophysics Data System (ADS)

    Vakoch, Douglas A.; Lower, Timothy A.; Niles, Britton A.; Rast, Katrina A.; DeCou, Christopher

    2013-05-01

    If scientists engaged in the Search for Extraterrestrial Intelligence (SETI) detect a signal from an extraterrestrial civilization, one of the most pressing issues facing humankind will be "Should we reply, and if so, what should we say?" Building on an infrastructure that the SETI Institute used to gather over 50,000 messages from around the world to send onboard the Kepler mission, Earth Speaks invites people to submit online their text messages, pictures, and sounds, as they ponder what they would want to say to an extraterrestrial civilization. Participants for the study have been recruited from 68 nations, from all walks of life. By tracking demographic variables for each person submitting a message, we have identified commonalities and differences in message content that are related to such factors as age and gender. Similarly, by tracking the date on which messages were submitted and the location from which the message was sent, we have also identified the way in which message content is related to time and geographic location. Furthermore, when we compare previous themes derived from textual messages to our current categorical analysis of submitted images, we find our textual themes to be concurrently validated. In doing so, we find the Earth Speaks Website not only allows for the construction of interstellar messages, but also functions as a projective psychological assessment of species-level human identity. We next proceed to demonstrate the generative power of our method by showing how we can synthesize artificial messages from the Earth Speaks messages. We then discuss how these artificially generated messages can be tailored to represent both commonality and diversity in human thought as it is revealed through our data. We end by discussing our method's utility for cross-disciplinary research in the social sciences and humanities.

  15. A language based on analogy to communicate cultural concepts in SETI

    NASA Astrophysics Data System (ADS)

    Musso, Paolo

    2011-02-01

    The present paper is a synthesis of three presentation given by myself at the Toulouse IAC 2001 ( Analogy as a tool to communicate abstract concepts in SETI), the Bremen IAC 2003 ( From maths to culture: towards an effective message), and the Vancouver IAC 2004 ( Philosophical and religious implications of extraterrestrial intelligent life). Its aim is to find a way to make our cultural concepts understandable to hypothetical extraterrestrials (ETs) in a SETI communication. First of all, I expose the reasons why I think that analogy could be a good tool for this purpose. Then, I try to show that this is possible only in the context of an integrated language, using both abstract symbols and pictures, also sketching two practical examples about some basic concepts of our moral and religious tradition. Further studies are required to determine whether this method could be extended to the higher-level abstract concepts in the other fields of our culture. Finally, I discuss the possible role of mathematics, logic and natural science in the construction of an analogy-based language for interstellar messages with a cultural content and a possible way of managing this matter from a social point of view.

  16. Shouting in the Jungle - The SETI Transmission Debate

    NASA Astrophysics Data System (ADS)

    Schuch, H. P.; Almar, I.

    The prudence of transmitting deliberate messages from Earth into interstellar space remains controversial. Reasoned risk- benefit analysis is needed, to inform policy recommendations by such bodies as the International Academy of Astronautics SETI Permanent Study Group. As a first step, at the 2005 International Astronautical Congress in Fukuoka, we discussed the San Marino Scale, a new analytical tool for assessing transmission risk. That Scale was updated, and a revised version presented at the 2006 IAC in Valencia. We are now in a position to recommend specific improvements to the scale we proposed for quantifying terrestrial transmissions. Our intent is to make this tool better reflect the detectability and potential impact of recent and proposed messages beamed from Earth. We believe the changes proposed herein strengthen the San Marino Scale as an analytical tool, and bring us closer to its eventual adoption.

  17. Toward understanding the active SETI debate: Insights from risk communication and perception

    NASA Astrophysics Data System (ADS)

    Korbitz, Adam

    2014-12-01

    Insights from the robust field of risk communication and perception have to date been almost totally absent from the policy debate regarding the relative risks and merits of Active SETI or Messaging to Extraterrestrial Intelligence (METI). For many years, the practice (or proposed practice) of Active SETI has generated a vigorous and sometimes heated policy debate within the scientific community. There have also been some negative reactions in the media toward the activities of those engaged in Active SETI. Risk communication is a scientific approach to communication regarding situations involving potentially sensitive or controversial situations in which there may be high public concern and low public trust. The discipline has found wide acceptance and utility in fields such as public health, industrial regulation and environmental protection. Insights from the scientific field of risk communication (such as omission bias, loss aversion, the availability heuristic, probability neglect, and the general human preference for voluntary over involuntary risks) may help those who have participated in either side of the debate over Active SETI to better understand why the debate has taken on this posture. Principles of risk communication and risk perception may also help those engaged in Active SETI to communicate more effectively with other scientists, the public, with the media, and with policy makers regarding their activities and to better understand and respond to concerns expressed regarding the activity.

  18. Alien Mindscapes-A Perspective on the Search for Extraterrestrial Intelligence.

    PubMed

    Cabrol, Nathalie A

    2016-09-01

    Advances in planetary and space sciences, astrobiology, and life and cognitive sciences, combined with developments in communication theory, bioneural computing, machine learning, and big data analysis, create new opportunities to explore the probabilistic nature of alien life. Brought together in a multidisciplinary approach, they have the potential to support an integrated and expanded Search for Extraterrestrial Intelligence (SETI (1) ), a search that includes looking for life as we do not know it. This approach will augment the odds of detecting a signal by broadening our understanding of the evolutionary and systemic components in the search for extraterrestrial intelligence (ETI), provide more targets for radio and optical SETI, and identify new ways of decoding and coding messages using universal markers. SETI-Astrobiology-Coevolution of Earth and life-Planetary habitability and biosignatures. Astrobiology 16, 661-676.

  19. Hello Out There.

    ERIC Educational Resources Information Center

    Giberson, Karl; Brown, Laura

    1997-01-01

    Presents an activity that begins with a discussion that leads into the rationale behind the techniques used in the Search for Extraterrestrial Intelligence (SETI) program. Students decode a message intended for extraterrestrials and consider a number of topics related to the possible existence of extraterrestrials. (DDR)

  20. Which colors would extraterrestrial civilizations use to transmit signals?: The ;magic wavelengths; for optical SETI

    NASA Astrophysics Data System (ADS)

    Narusawa, Shin-ya; Aota, Tatusya; Kishimoto, Ryo

    2018-04-01

    In the case of radio SETI, there are predicted frequencies which extraterrestrial beings select to send messages to other civilizations. Those are called ;magic frequencies. Considering the optical region, terrestrial technologies can not transmit arbitrary wavelengths of high-power optical lasers, easily. In this article, we discuss communications among civilizations with the same level of technology as us to enhance the persuasive power. It might be possible to make a reasonable assumption about the laser wavelengths transmitted by extraterrestrial intelligences to benefit optical SETI (OSETI) methods. Therefore, we propose some ;magic wavelengths; for spectroscopic OSETI observations in this article. From the senders point of view, we argue that the most favorable wavelength used for interstellar communication would be the one of YAG lasers, at 1.064 μm or its Second Harmonic Generation (532.1 nm). On the contrary, there are basic absorption lines in the optical spectra, which are frequently observed by astrophysicists on Earth. It is possible that the extraterrestrials used lasers, which wavelengths are tuned to such absorption lines for sending messages. In that case, there is a possibility that SHG and/or Sum Frequency Generation of YAG and YLF lasers are used. We propose three lines at, 393.8 nm (near the Ca K line), 656.5 nm (near the Hα line) and 589.1 nm (Na D2 line) as the magic wavelengths.

  1. Cultural aspects of SETI

    NASA Technical Reports Server (NTRS)

    Billingham, John

    1991-01-01

    The paper presents a broad range of issues that raise important questions about the search for exterrestrial life forms or intelligence. The history of the concept of plurality of inhabited worlds is reviewed, and disciplinary areas are cited that are considered crucial for SETI. Such issues involve analogs of the discovery of ETI, immediate responses to such detections, and the significance of journalistic and media response. The responses of religion is also considered, and it is suggested that humankind respond to the discovery of ETI with a single voice and message. The issues discussed demonstrate the need for explicit protocols that would be followed after any discovery of the types discussed.

  2. The Search for Extraterrestrial Intelligence.

    ERIC Educational Resources Information Center

    Jones, Barrie W.

    2003-01-01

    Traces the efforts of Searching for Extraterrestrial Technological Intelligence (SETI) since 1960 when a radio-telescope was used to see if any messages were being sent from the vicinity of two nearby stars. Describes attempts to detect microwave/optical signals and technological modification of the cosmic environment. (Author/KHR)

  3. Project Haystack: The Search for Life in the Galaxy.

    ERIC Educational Resources Information Center

    Search for Extraterrestrial Intelligence Inst., Mountain View, CA.

    Produced by the Search for Extraterrestrial Intelligence (SETI), Project Haystack presents scenarios that depict various aspects of the search for extraterrestrial intelligence. Students conduct hands-on and minds-on activities while exploring what it means to send and receive a message across interstellar distances. Students explore and map vast…

  4. Searching for alien artifacts on the moon

    NASA Astrophysics Data System (ADS)

    Davies, P. C. W.; Wagner, R. V.

    2013-08-01

    The Search for Extraterrestrial Intelligence (SETI) has a low probability of success, but it would have a high impact if successful. Therefore it makes sense to widen the search as much as possible within the confines of the modest budget and limited resources currently available. To date, SETI has been dominated by the paradigm of seeking deliberately beamed radio messages. However, indirect evidence for extraterrestrial intelligence could come from any incontrovertible signatures of non-human technology. Existing searchable databases from astronomy, biology, earth and planetary sciences all offer low-cost opportunities to seek a footprint of extraterrestrial technology. In this paper we take as a case study one particular new and rapidly-expanding database: the photographic mapping of the Moon's surface by the Lunar Reconnaissance Orbiter (LRO) to 0.5 m resolution. Although there is only a tiny probability that alien technology would have left traces on the moon in the form of an artifact or surface modification of lunar features, this location has the virtue of being close, and of preserving traces for an immense duration. Systematic scrutiny of the LRO photographic images is being routinely conducted anyway for planetary science purposes, and this program could readily be expanded and outsourced at little extra cost to accommodate SETI goals, after the fashion of the SETI@home and Galaxy Zoo projects.

  5. Alien Mindscapes—A Perspective on the Search for Extraterrestrial Intelligence

    NASA Astrophysics Data System (ADS)

    Cabrol, Nathalie A.

    2016-09-01

    Advances in planetary and space sciences, astrobiology, and life and cognitive sciences, combined with developments in communication theory, bioneural computing, machine learning, and big data analysis, create new opportunities to explore the probabilistic nature of alien life. Brought together in a multidisciplinary approach, they have the potential to support an integrated and expanded Search for Extraterrestrial Intelligence (SETI1), a search that includes looking for life as we do not know it. This approach will augment the odds of detecting a signal by broadening our understanding of the evolutionary and systemic components in the search for extraterrestrial intelligence (ETI), provide more targets for radio and optical SETI, and identify new ways of decoding and coding messages using universal markers.

  6. The game of active search for extra-terrestrial intelligence: breaking the `Great Silence'

    NASA Astrophysics Data System (ADS)

    de Vladar, Harold P.

    2013-01-01

    The search for extra-terrestrial intelligence (SETI) has been performed principally as a one-way survey, listening of radio frequencies across the Milky Way and other galaxies. However, scientists have engaged in an active messaging only rarely. This suggests the simple rationale that if other civilizations exist and take a similar approach to ours, namely listening but not broadcasting, the result is a silent universe. A simple game theoretical model, the prisoner's dilemma, explains this situation: each player (civilization) can passively search (defect), or actively search and broadcast (cooperate). In order to maximize the payoff (or, equivalently, minimize the risks) the best strategy is not to broadcast. In fact, the active search has been opposed on the basis that it might be dangerous to expose ourselves. However, most of these ideas have not been based on objective arguments, and ignore accounting of the possible gains and losses. Thus, the question stands: should we perform an active search? I develop a game-theoretical framework where civilizations can be of different types, and explicitly apply it to a situation where societies are either interested in establishing a two-way communication or belligerent and in urge to exploit ours. The framework gives a quantitative solution (a mixed-strategy), which is how frequent we should perform the active SETI. This frequency is roughly proportional to the inverse of the risk, and can be extremely small. However, given the immense amount of stars being scanned, it supports active SETI. The model is compared with simulations, and the possible actions are evaluated through the San Marino scale, measuring the risks of messaging.

  7. The Benefits of Adding SETI to the University Curriculum and What We Have Learned from a SETI Course Recently Offered at UCLA

    NASA Astrophysics Data System (ADS)

    Lesyna, Larry; Margot, Jean-Luc; Greenberg, Adam; Shinde, Akshay; Alladi, Yashaswi; Prasad MN, Srinivas; Bowman, Oliver; Fisher, Callum; Gyalay, Szilard; McKibbin, William; Miles, Brittany E.; Nguyen, Donald; Power, Conor; Ramani, Namrata; Raviprasad, Rashmi; Santana, Jesse

    2017-01-01

    We advocate for the inclusion of a full-term course entirely devoted to SETI in the university curriculum. SETI usually warrants only a few lectures in a traditional astronomy or astrobiology course. SETI’s rich interdisciplinary character serves astronomy students by introducing them to scientific and technological concepts that will aid them in their dissertation research or later in their careers. SETI is also an exciting topic that draws students from other disciplines and teaches them astronomical concepts that they might otherwise never encounter in their university studies. We have composed syllabi that illustrate the breadth and depth that SETI courses provide for advanced undergraduate or graduate students. The syllabi can also be used as a guide for an effective SETI course taught at a descriptive level.After a pilot course in 2015, UCLA formally offered a course titled "EPSS C179/279 - Search for Extraterrestrial Intelligence: Theory and Applications" in Spring 2016. The course was designed for advanced undergraduate students and graduate students in the science, technical, engineering, and mathematical fields. In 2016, 9 undergraduate students and 5 graduate students took the course. Students designed an observing sequence for the Arecibo and Green Bank telescopes, observed known planetary systems remotely, wrote a sophisticated and modular data processing pipeline, analyzed the data, and presented the results. In the process, they learned radio astronomy fundamentals, software development, signal processing, and statistics. The instructor believes that the students were eager to learn because of the engrossing nature of SETI. The students rated the course highly, in part because of the observing experience and the teamwork approach. The next offering will be in Spring 2017.See lxltech.com and seti.ucla.edu

  8. Starry Messages - Searching for Signatures of Interstellar Archaeology

    NASA Astrophysics Data System (ADS)

    Carrigan, R. A., Jr.

    Searching for signatures of cosmic-scale archaeological artefacts such as Dyson spheres or Kardashev civilizations is an interesting alternative to conventional SETI. Uncovering such an artifact does not require the intentional transmission of a signal on the part of the originating civilization. This type of search is called interstellar archaeology or sometimes cosmic archaeology . The detection of intelligence elsewhere in the Universe with interstellar archaeology or SETI would have broad implications for science. For example, the constraints of the anthropic principle would have to be loosened if a different type of intelligence was discovered elsewhere. A variety of interstellar archaeology signatures are discussed including non-natural planetary atmospheric constituents, stellar doping with isotopes of nuclear wastes, Dyson spheres, as well as signatures of stellar and galactic-scale engineering. The concept of a Fermi bubble due to interstellar migration is introduced in the discussion of galactic signatures. These potential interstellar archaeological signatures are classified using the Kardashev scale. A modified Drake equation is used to evaluate the relative challenges of finding various sources. With few exceptions interstellar archaeological signatures are clouded and beyond current technological capabilities. However SETI for so-called cultural transmissions and planetary atmosphere signatures are within reach.

  9. Starry messages: Searching for signatures of interstellar archaeology

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Carrigan, Richard A., Jr.; /Fermilab

    2009-12-01

    Searching for signatures of cosmic-scale archaeological artifacts such as Dyson spheres or Kardashev civilizations is an interesting alternative to conventional SETI. Uncovering such an artifact does not require the intentional transmission of a signal on the part of the original civilization. This type of search is called interstellar archaeology or sometimes cosmic archaeology. The detection of intelligence elsewhere in the Universe with interstellar archaeology or SETI would have broad implications for science. For example, the constraints of the anthropic principle would have to be loosened if a different type of intelligence was discovered elsewhere. A variety of interstellar archaeology signaturesmore » are discussed including non-natural planetary atmospheric constituents, stellar doping with isotopes of nuclear wastes, Dyson spheres, as well as signatures of stellar and galactic-scale engineering. The concept of a Fermi bubble due to interstellar migration is introduced in the discussion of galactic signatures. These potential interstellar archaeological signatures are classified using the Kardashev scale. A modified Drake equation is used to evaluate the relative challenges of finding various sources. With few exceptions interstellar archaeological signatures are clouded and beyond current technological capabilities. However SETI for so-called cultural transmissions and planetary atmosphere signatures are within reach.« less

  10. Alien Mindscapes—A Perspective on the Search for Extraterrestrial Intelligence

    PubMed Central

    2016-01-01

    Abstract Advances in planetary and space sciences, astrobiology, and life and cognitive sciences, combined with developments in communication theory, bioneural computing, machine learning, and big data analysis, create new opportunities to explore the probabilistic nature of alien life. Brought together in a multidisciplinary approach, they have the potential to support an integrated and expanded Search for Extraterrestrial Intelligence (SETI1), a search that includes looking for life as we do not know it. This approach will augment the odds of detecting a signal by broadening our understanding of the evolutionary and systemic components in the search for extraterrestrial intelligence (ETI), provide more targets for radio and optical SETI, and identify new ways of decoding and coding messages using universal markers. Key Words: SETI—Astrobiology—Coevolution of Earth and life—Planetary habitability and biosignatures. Astrobiology 16, 661–676. PMID:27383691

  11. A near-infrared SETI experiment: instrument overview

    NASA Astrophysics Data System (ADS)

    Wright, Shelley A.; Werthimer, Dan; Treffers, Richard R.; Maire, Jérôme; Marcy, Geoffrey W.; Stone, Remington P. S.; Drake, Frank; Meyer, Elliot; Dorval, Patrick; Siemion, Andrew

    2014-07-01

    We are designing and constructing a new SETI (Search for Extraterrestrial Intelligence) instrument to search for direct evidence of interstellar communications via pulsed laser signals at near-infrared wavelengths. The new instrument design builds upon our past optical SETI experiences, and is the first step toward a new, more versatile and sophisticated generation of very fast optical and near-infrared pulse search devices. We present our instrumental design by giving an overview of the opto-mechanical design, detector selection and characterization, signal processing, and integration procedure. This project makes use of near-infrared (950 - 1650 nm) discrete amplification Avalanche Photodiodes (APD) that have > 1 GHz bandwidths with low noise characteristics and moderate gain (~104). We have investigated the use of single versus multiple detectors in our instrument (see Maire et al., this conference), and have optimized the system to have both high sensitivity and low false coincidence rates. Our design is optimized for use behind a 1m telescope and includes an optical camera for acquisition and guiding. A goal is to make our instrument relatively economical and easy to duplicate. We describe our observational setup and our initial search strategies for SETI targets, and for potential interesting compact astrophysical objects.

  12. VLSI processors for signal detection in SETI

    NASA Technical Reports Server (NTRS)

    Duluk, J. F.; Linscott, I. R.; Peterson, A. M.; Burr, J.; Ekroot, B.; Twicken, J.

    1989-01-01

    The objective of the Search for Extraterrestrial Intelligence (SETI) is to locate an artificially created signal coming from a distant star. This is done in two steps: (1) spectral analysis of an incoming radio frequency band, and (2) pattern detection for narrow-band signals. Both steps are computationally expensive and require the development of specially designed computer architectures. To reduce the size and cost of the SETI signal detection machine, two custom VLSI chips are under development. The first chip, the SETI DSP Engine, is used in the spectrum analyzer and is specially designed to compute Discrete Fourier Transforms (DFTs). It is a high-speed arithmetic processor that has two adders, one multiplier-accumulator, and three four-port memories. The second chip is a new type of Content-Addressable Memory. It is the heart of an associative processor that is used for pattern detection. Both chips incorporate many innovative circuits and architectural features.

  13. VLSI processors for signal detection in SETI.

    PubMed

    Duluk, J F; Linscott, I R; Peterson, A M; Burr, J; Ekroot, B; Twicken, J

    1989-01-01

    The objective of the Search for Extraterrestrial Intelligence (SETI) is to locate an artificially created signal coming from a distant star. This is done in two steps: (1) spectral analysis of an incoming radio frequency band, and (2) pattern detection for narrow-band signals. Both steps are computationally expensive and require the development of specially designed computer architectures. To reduce the size and cost of the SETI signal detection machine, two custom VLSI chips are under development. The first chip, the SETI DSP Engine, is used in the spectrum analyzer and is specially designed to compute Discrete Fourier Transforms (DFTs). It is a high-speed arithmetic processor that has two adders, one multiplier-accumulator, and three four-port memories. The second chip is a new type of Content-Addressable Memory. It is the heart of an associative processor that is used for pattern detection. Both chips incorporate many innovative circuits and architectural features.

  14. Design of interstellar digital communication links: Some insights from communication engineering

    NASA Astrophysics Data System (ADS)

    Messerschmitt, David G.; Morrison, Ian S.

    2012-09-01

    The design of an end-to-end digital interstellar communication system at radio frequencies is discussed, drawing on the disciplines of digital communication engineering and computer network engineering in terrestrial and near-space applications. One goal is a roadmap to the design of such systems, aimed at future designers of either receivers (SETI) or transmitters (METI). In particular we emphasize the implications arising from the impossibility of coordination between transmitter and receiver prior to a receiver's search for a signal. A system architecture based on layering, as commonly used in network and software design, assists in organizing and categorizing the various design issues and identifying dependencies. Implications of impairments introduced in the interstellar medium, such as dispersion, scattering, Doppler, noise, and signal attenuation are discussed. Less fundamental (but nevertheless influential) design issues are the motivations of the transmitter designers and associated resource requirements at both transmitter and receiver. Unreliability is inevitably imposed by non-idealities in the physical communication channel, and this unreliability will have substantial implications for those seeking to convey interstellar messages.

  15. JPL's role in the SETI program

    NASA Technical Reports Server (NTRS)

    Klein, M. J.

    1986-01-01

    The goal of the JPL SETI Team is to develop the strategies and the instrumentation required to carry out an effective, yet affordable, SETI Microwave Observing Program. The primary responsibility for JPL is the development and implementation of the Sky Survey component of the bimodal search program recommended by the SETI Science Working Group (NASA Technical Paper 2244, 1983). JPL is also responsible for the design and implementation of microwave analog instrumentation (including antenna feed systems, low noise RF amplifiers, antenna monitor and control interfaces, etc.) to cover the microwave window for the Sky Survey and the Target Search observations. The primary site for the current SETI Field Test activity is the Venus Station of the Goldstone Deep Space Communication Complex. A SETI controller was constructed and installed so that pre-programmed and real time SETI monitor and control data can be sent to and from the station controller. This unit will be interfaced with the MCSA. A SETI Hardware Handbook was prepared to describe the various systems that will be used by the project at the Venus Station; the handbook is frequently being expanded and updated. The 65,000 channel FFT Spectrum analyzer in the RFI Surveillance System was modified to permit operation with variable resolutions (300 Hz to less than 1 Hz) and with real-time accumulation, which will enhance the capability of the system for testing Sky Survey search strategies and signal detection algorithms.

  16. The NASA SETI sky survey: Recent developments

    NASA Technical Reports Server (NTRS)

    Klein, M. J.; Gulkis, S.; Olsen, E. T.; Renzetti, N. A.

    1989-01-01

    NASA's Search for Extraterrestrial Intelligence (SETI) project utilizes two complementary search strategies: a sky survey and a targeted search. The SETI team at the Jet Propulsion Laboratory (JPL) in Pasadena, California, has primary responsibility to develop and carry out the sky survey part. Described here is progress that has been made developing the major elements of the survey including a 2-million channel wideband spectrum analyzer system that is being designed and constructed by JPL for the Deep Space Network (DSN). The system will be a multiuser instrument; it will serve as a prototype for the SETI sky survey processor. This prototype system will be used to test the signal detection and observational strategies on DSN antennas in the near future.

  17. Technical considerations on using the large Nancay radio telescope for SETI

    NASA Technical Reports Server (NTRS)

    Gulkis, S.; Biraud, F.; Heidmann, J.; Tarter, J.

    1990-01-01

    The Nancay decimetric Radio Telescope (NRT) in Nancay, France, is described, and its potential use for Search for Extraterrestrial Intelligence (SETI) observations is discussed. The conclusion reached is that the NRT is well suited for SETI observations because of its large collecting area, its large sky coverage, and its wideband frequency capability. However, a number of improvements are necessary in order to take full advantage of the system in carrying out an efficient SETI program. In particular, system sensitivity should be increased. This can be achieved through a series of improvements to the system, including lowering the ground pickup noise through the use of ground reflectors and more efficient feed design, and by using low-noise amplifier front ends.

  18. Signal processing in SETI.

    PubMed

    Cullers, D K; Linscott, I R; Oliver, B M

    1985-11-01

    The development of a multi-channel spectrum analyzer (MCSA) for the SETI program is described. The spectrum analyzer is designed for both all-sky surveys and targeted searches. The mechanisms of the MCSA are explained and a diagram is provided. Detection of continuous wave signals, pulses, and patterns is examined.

  19. The Fear of Contact

    NASA Astrophysics Data System (ADS)

    Dumas, S.

    The search for intelligent alien civilisation is one of the great challenges for mankind. The project to explore the thousand of nearby stars has just begun and may take a long time to be completed. It is not certain that a civilisation at a communication distance exists but the search has to be done. Another similar activity is concerned by the transmission of messages to alien civilisation. It is not an answer to a detected message by SETI but a transmission of messages to potential candidates. Over the past years, questions have been raised to the potential danger for Earth of such activity. It is not a secret that METI goal is to attract attention and invite an answer from a nearby civilisation. It is not a physical answer such as a visiting star ship but a simple radio signal. This paper will present arguments to support METI and refute the idea of danger.

  20. Computational problems and signal processing in SETI

    NASA Technical Reports Server (NTRS)

    Deans, Stanley R.; Cullers, D. K.; Stauduhar, Richard

    1991-01-01

    The Search for Extraterrestrial Intelligence (SETI), currently being planned at NASA, will require that an enormous amount of data (on the order of 10 exp 11 distinct signal paths for a typical observation) be analyzed in real time by special-purpose hardware. Even though the SETI system design is not based on maximum entropy and Bayesian methods (partly due to the real-time processing constraint), it is expected that enough data will be saved to be able to apply these and other methods off line where computational complexity is not an overriding issue. Interesting computational problems that relate directly to the system design for processing such an enormous amount of data have emerged. Some of these problems are discussed, along with the current status on their solution.

  1. Corpus Linguistics and the Design of a Response Message

    NASA Astrophysics Data System (ADS)

    Atwell, E.

    2002-01-01

    Most research related to SETI, the Search for Extra-Terrestrial Intelligence, is focussed on techniques for detection of possible incoming signals from extra-terrestrial intelligent sources (e.g. Turnbull et al. 1999), and algorithms for analysis of these signals to identify intelligent language-like characteristics (e.g. Elliott and Atwell 1999, 2000). However, another issue for research and debate is the nature of our response, should a signal arrive and be detected. The design of potentially the most significant communicative act in history should not be decided solely by astrophysicists; the Corpus Linguistics research community has a contribution to make to what is essentially a Corpus design and implementation project. (Vakoch 1998) advocated that the message constructed to transmit to extraterrestrials should include a broad, representative collection of perspectives rather than a single viewpoint or genre; this should strike a chord with Corpus Linguists for whom a central principle is that a corpus must be "balanced" to be representative (Meyer 2001). One idea favoured by SETI researchers is to transmit an encyclopaedia summarising human knowledge, such as the Encyclopaedia Britannica, to give ET communicators an overview and "training set" key to analysis of subsequent messages. Furthermore, this should be sent in several versions in parallel: the text; page-images, to include illustrations left out of the text-file and perhaps some sort of abstract linguistic representation of the text, using a functional or logic language (Ollongren 1999, Freudenthal 1960). The idea of "enriching" the message corpus with annotations at several levels should also strike a chord with Corpus Linguists who have long known that Natural language exhibits highly complex multi-layering sequencing, structural and functional patterns, as difficult to model as sequences and structures found in more traditional physical and biological sciences. Some corpora have been annotated with several levels or layers of linguistic knowledge, for example the SEC corpus (Taylor and Knowles 1988), the ISLE corpus (Menzel et al. 2000). Tagged and parsed corpus can be used by corpus linguists as a testbed to guide their development of grammars (e.g. Souter and Atwell 1994); and they can be used to train Natural Language Learning or data-mining models of complex sequence data (e.g. Brill 1993, Hughes 1993, Atwell 1996). Corpus linguists have a range of standards and tools for design and annotation of representative corpus resources, and experience of which annotation types are more amenable to Natural Language Learning algorithms. An Advisory panel of corpus linguists could help design and implement an extended Multi-annotated Interstellar Corpus of English, incorporating ideas from Corpus Linguistics such as: - Augment the Encyclopaedia Britannica with a collection of samples representing the diversity of language in real use. - As an additional "key", transmit a dictionary aimed at language learners which has also been a rich source for NLP - Supply our ET communicators with several levels of linguistic annotation, to give them a richer training set for their - Add translations of the English text into other human languages: Humanity should not be represented by English alone, This calls for a large-scale corpus annotation project, requiring an Interstellar Corpus Advisory Panel, analogous to the BNC or MATE advisory panels, to include experts in English grammar and semantics, English language learning, computational Natural language Learning algorithms, and corpus design, implementation, annotation, standardisation, and analysis.

  2. SETI prototype system for NASA's Sky Survey microwave observing project - A progress report

    NASA Technical Reports Server (NTRS)

    Klein, M. J.; Gulkis, S.; Wilck, H. C.

    1990-01-01

    Two complementary search strategies, a Targeted Search and a Sky Survey, are part of NASA's SETI microwave observing project scheduled to begin in October of 1992. The current progress in the development of hardware and software elements of the JPL Sky Survey data processing system are presented. While the Targeted Search stresses sensitivity allowing the detection of either continuous or pulsed signals over the 1-3 GHz frequency range, the Sky Survey gives up sensitivity to survey the 99 percent of the sky that is not covered by the Targeted Search. The Sky Survey spans a larger frequency range from 1-10 GHz. The two searches will deploy special-purpose digital signal processing equipment designed and built to automate the observing and data processing activities. A two-million channel digital wideband spectrum analyzer and a signal processor system will serve as a prototype for the SETI Sky Survey processor. The design will permit future expansion to meet the SETI requirement that the processor concurrently search for left and right circularly polarized signals.

  3. A Half-century of SETI Science

    NASA Astrophysics Data System (ADS)

    Shuch, H. Paul

    We begin our journey with a brief review of half a century of SETI science. The material in this introductory chapter is offered for the benefit of those educated laypersons whose enthusiasm for the Search for Extraterrestrial Intelligence exceeds their detailed knowledge of the relevant technologies. It is my hope that readers of this volume will better appreciate the material which follows if they first have a basic understanding of SETI concepts. Hence, I offer an overview, which is intended not to be exhaustive, but rather representative. Together, we will explore the nature of radio telescopes, experimental design strategies, SETI instrumentation, signal analysis, and the hallmarks of artificiality that allow us to differentiate between natural astrophysical emissions and intelligent interstellar transmissions. If you are already a technical specialist in these areas, feel free to bypass this introduction, and proceed directly to the subsequent chapters.

  4. A conceptual 34-meter antenna feed configuration for joint DSN/SETI use from 1 to 10 GHz

    NASA Technical Reports Server (NTRS)

    Slobin, S. D.

    1986-01-01

    The very satisfactory performance of a conceptual 34-m DSS-12 type HA-Dec antenna feed sysem over the frequency range of 1 to 10 GHz is demonstrated. A seven-feedhorn baseline design is developed which will allow Search for Extra-Terrestrial Intelligence (SETI) investigations using each horn over a 1.4:1 frequency range. A gain/system noise temperature (G/T) figure of merit is calculated for the frequency range of each horn; it is found that system performance down to 20 deg elevation is possible with a G/T degradation of less than 3 dB at every frequency. The design presented here will allow shared but independent antenna use by the Deep Space Network (DSN) and SETI with a minimum of operational impacts to DSN functions and no intrusions into the DSN microwave equipment configuration.

  5. SETI and the media: Views from inside and out

    NASA Astrophysics Data System (ADS)

    Tarter, Donald E.

    Results are presented from a detailed questionnaire sent to members of the international SETI (Search for Extraterrestrial Intelligence) community and the international science media. Both groups are compared on the following dimensions: perceived importance of SETI, perceived level of information about SETI available to the media and public, perceived credibility of SETI, and attitudes toward information policy options to govern an announcement of a SETI discovery. The results indicate that SETI is perceived to be an extremely important endeavor, but it enjoys only marginal credibility among the public and the SETI community's professional constituencies. Both the SETI community and the media agree that an erroneous announcement of a discovery of extraterrestrial intelligence could be very damaging. In order to minimize the dangers of false announcement and to bring a degree of order to SETI, a scientific protocol agreement and the establishment of a contact verification committee have been recommended. Both received endorsement from the SETI community and the international science media. The science media feels that from its viewpoint, a contact verification committee would be a more effective way of assuring accurate information about SETI programs and discoveries.

  6. Teaching Planetary Science as Part of the Search for Extraterrestrial Intelligence (SETI)

    NASA Astrophysics Data System (ADS)

    Margot, Jean-Luc; Greenberg, Adam H.

    2017-10-01

    In Spring 2016 and 2017, UCLA offered a course titled "EPSS C179/279 - Search for Extraterrestrial Intelligence: Theory and Applications". The course is designed for advanced undergraduate students and graduate students in the science, technical, engineering, and mathematical fields. Each year, students designed an observing sequence for the Green Bank telescope, observed known planetary systems remotely, wrote a sophisticated and modular data processing pipeline, analyzed the data, and presented their results. In 2016, 15 students participated in the course (9U, 5G; 11M, 3F) and observed 14 planetary systems in the Kepler field. In 2017, 17 students participated (15U, 2G; 10M, 7F) and observed 10 planetary systems in the Kepler field, TRAPPIST-1, and LHS 1140. In order to select suitable targets, students learned about planetary systems, planetary habitability, and planetary dynamics. In addition to planetary science fundamentals, students learned radio astronomy fundamentals, collaborative software development, signal processing techniques, and statistics. Evaluations indicate that the course is challenging but that students are eager to learn because of the engrossing nature of SETI. Students particularly value the teamwork approach, the observing experience, and working with their own data. The next offering of the course will be in Spring 2018. Additional information about our SETI work is available at seti.ucla.edu.

  7. SETI as an educational tool

    NASA Astrophysics Data System (ADS)

    Vaile, R. A.

    SETI offers an extraordinary catalyst in our search for a better education. While the glamour of movie images increased the general public awareness of the term "SETI", we are challenged to improve the level of public understanding of the fundamental scientific and technological issues involved in SETI. It is also critical to keep in mind the reality of human existence. No country seems entirely at peace, whether one considers cultural, trade, military, or heritage issues; no country seems content with the breadth and standards of education for following generations. However, SETI requires generations to participate across cultures, and this long-term human involvement must be sustained through both education and communication across many disciplines and different cultures. For both these major roles, SETI appears to offer a tantalising range and depth, both in educational tools, and in superb tests of communication skills. This paper considers the educational influence of roles evoked by SETI issues. We will briefly consider the range in expertise needed in SETI, the means of improving the public SETI awareness, and mechanisms through which such education may explore the consequences of any SETI result (whether judged as successful or not). Examples of the use of SETI in formal secondary and University education are briefly reviewed.

  8. From Ozma to Cyclops: The Beginnings of American SETI, 1959-70

    NASA Astrophysics Data System (ADS)

    Sullivan, W. T.

    2002-12-01

    The modern era in SETI (Search for Extraterrstrial Intelligence) began with two independent proposals in the late 1950s. In 1959 Phillip Morrison and Guiseppe Cocconi at Cornell published a short theoretical paper in ``Nature," while simultaneously Frank Drake at the brand-new NRAO in West Virginia developed a receiver for the first radio observations, called Project Ozma. In 1960 Drake monitored two nearby solar-like stars, Tau Ceti and Epsilon Eridani, for several months with a scanning one-channel radiometer at 21-cm on an 85-ft diameter dish. Drake's interest, along with that of his boss Otto Struve, then led to a remarkable small meeting at Green Bank in 1961, at which time the Drake Equation was first put forth as an organizing concept for estimating the possible number of extraterrestrial civilizations. The next milestone was the appearance of ``Intelligent Life in the Universe" by Iosif Shklovsky and Carl Sagan (1966), which widely circulated the idea of SETI. The growth of NASA's exobiology program (although primarily focused on microbial life and the origin of life) throughout the 1960s also legitimized the field and culminated in the Viking mission to Mars in 1976. In 1970 NASA sponsored a large summer workshop charged with the task of designing a feasible radio telescope for SETI. The resulting report, ``Project Cyclops: A Design Study of a System for Detecting Extraterrestrial Intelligent Life" (1971), was the first detailed look at all aspects of the problem, and set the tone for future NASA involvement in SETI. This talk will briefly cover this history, in particular the radio astronomy aspects, and will include a portion of a tape recording of a talk given by Drake in 1960 even as Project Ozma was in progress.

  9. The transcension hypothesis: Sufficiently advanced civilizations invariably leave our universe, and implications for METI and SETI

    NASA Astrophysics Data System (ADS)

    Smart, John M.

    2012-09-01

    The emerging science of evolutionary developmental ("evo devo") biology can aid us in thinking about our universe as both an evolutionary system, where most processes are unpredictable and creative, and a developmental system, where a special few processes are predictable and constrained to produce far-future-specific emergent order, just as we see in the common developmental processes in two stars of an identical population type, or in two genetically identical twins in biology. The transcension hypothesis proposes that a universal process of evolutionary development guides all sufficiently advanced civilizations into what may be called "inner space," a computationally optimal domain of increasingly dense, productive, miniaturized, and efficient scales of space, time, energy, and matter, and eventually, to a black-hole-like destination. Transcension as a developmental destiny might also contribute to the solution to the Fermi paradox, the question of why we have not seen evidence of or received beacons from intelligent civilizations. A few potential evolutionary, developmental, and information theoretic reasons, mechanisms, and models for constrained transcension of advanced intelligence are briefly considered. In particular, we introduce arguments that black holes may be a developmental destiny and standard attractor for all higher intelligence, as they appear to some to be ideal computing, learning, forward time travel, energy harvesting, civilization merger, natural selection, and universe replication devices. In the transcension hypothesis, simpler civilizations that succeed in resisting transcension by staying in outer (normal) space would be developmental failures, which are statistically very rare late in the life cycle of any biological developing system. If transcension is a developmental process, we may expect brief broadcasts or subtle forms of galactic engineering to occur in small portions of a few galaxies, the handiwork of young and immature civilizations, but constrained transcension should be by far the norm for all mature civilizations. The transcension hypothesis has significant and testable implications for our current and future METI and SETI agendas. If all universal intelligence eventually transcends to black-hole-like environments, after which some form of merger and selection occurs, and if two-way messaging (a send-receive cycle) is severely limited by the great distances between neighboring and rapidly transcending civilizations, then sending one-way METI or probes prior to transcension becomes the only real communication option. But one-way messaging or probes may provably reduce the evolutionary diversity in all civilizations receiving the message, as they would then arrive at their local transcensions in a much more homogenous fashion. If true, an ethical injunction against one-way messaging or probes might emerge in the morality and sustainability systems of all sufficiently advanced civilizations, an argument known as the Zoo hypothesis in Fermi paradox literature, if all higher intelligences are subject to an evolutionary attractor to maximize their local diversity, and a developmental attractor to merge and advance universal intelligence. In any such environment, the evolutionary value of sending any interstellar message or probe may simply not be worth the cost, if transcension is an inevitable, accelerative, and testable developmental process, one that eventually will be discovered and quantitatively described by future physics. Fortunately, transcension processes may be measurable today even without good physical theory, and radio and optical SETI may each provide empirical tests. If transcension is a universal developmental constraint, then without exception all early and low-power electromagnetic leakage signals (radar, radio, television), and later, optical evidence of the exoplanets and their atmospheres should reliably cease as each civilization enters its own technological singularities (emergence of postbiological intelligence and life forms) and recognizes that they are on an optimal and accelerating path to a black-hole-like environment. Furthermore, optical SETI may soon allow us to map an expanding area of the galactic habitable zone we may call the galactic transcension zone, an inner ring that contains older transcended civilizations, and a missing planets problem as we discover that planets with life signatures occur at a much lower frequencies in this inner ring than in the remainder of the habitable zone.

  10. SETI data controllers

    NASA Technical Reports Server (NTRS)

    Gosline, R. M.

    1988-01-01

    Three data controllers developed for the SETI project are described. Two are used primarily for recording and playback of SETI data from the Radio Science Surveillance System (RSSS). The third is used as a SETI station controller for DSS 13.

  11. Mutual help in SETIs

    NASA Astrophysics Data System (ADS)

    Melia, F.; Frisch, D. H.

    1985-06-01

    Techniques to establish communication between earth and extraterrestrial intelligent beings are examined analytically, emphasizing that the success of searches for extraterrestrial intelligence (SETIs) depends on the selection by both sender and receiver of one of a few mutually helpful SETI strategies. An equation for estimating the probability that an SETI will result in the recognition of an ETI signal is developed, and numerical results for various SETI strategies are presented in tables. A minimum approach employing 10 40-m 20-kW dish antennas for a 30-yr SETI in a 2500-light-year disk is proposed.

  12. Positive consequences of SETI before detection

    NASA Astrophysics Data System (ADS)

    Tough, A.

    Even before a signal is detected, six positive consequences will result from the scientific search for extraterrestrial intelligence, usually called SETI. (1) Humanity's self-image: SETI has enlarged our view of ourselves and enhanced our sense of meaning. Increasingly, we feel a kinship with the civilizations whose signals we are trying to detect. (2) A fresh perspective: SETI forces us to think about how extraterrestrials might perceive us. This gives us a fresh perspective on our society's values, priorities, laws and foibles. (3) Questions: SETI is stimulating thought and discussion about several fundamental questions. (4) Education: some broad-gage educational programs have already been centered around SETI. (5) Tangible spin-offs: in addition to providing jobs for some people, SETI provides various spin-offs, such as search methods, computer software, data, and international scientific cooperation. (6) Future scenarios: SETI will increasingly stimulate us to think carefully about possible detection scenarios and their consequences, about our reply, and generally about the role of extraterrestrial communication in our long-term future. Such thinking leads, in turn, to fresh perspectives on the SETI enterprise itself.

  13. Power Beaming Leakage Radiation as A SETI Observable

    NASA Technical Reports Server (NTRS)

    Benford, James N.; Benford, Dominic J.

    2016-01-01

    The most observable leakage radiation from an advanced civilization may well be from the use of power beam-ing to transfer energy and accelerate spacecraft. Applications suggested for power beaming involve launching spacecraft to orbit, raising satellites to a higher orbit, and interplanetary concepts involving space-to-space transfers of cargo or passengers. We also quantify beam-driven launch to the outer solar system, interstellar precursors and ultimately starships. We estimate the principal observable parameters of power beaming leak-age. Extraterrestrial civilizations would know their power beams could be observed, and so could put a message on the power beam and broadcast it for our receipt at little additional energy or cost. By observing leakage from power beams we may find a message embedded on the beam. Recent observations of the anomalous star KIC8462852 by the Allen Telescope Array (ATA) set some limits on extraterrestrial power beaming in that system.We show that most power beaming applications commensurate with those suggested for our solar system would be detectable if using the frequency range monitored by the ATA, and so the lack of detection is a meaningful,if modest, constraint on extraterrestrial power beaming in that system. Until more extensive observations are made, the limited observation time and frequency coverage are not sufficiently broad in frequency and duration to produce firm conclusions. Such beams would be visible over large interstellar distances. This implies a new approach to the SETI search: Instead of focusing on narrowband beacon transmissions generated by another civilization, look for more powerful beams with much wider bandwidth. This requires a new approach for their discovery by telescopes on Earth. Further studies of power beaming applications should be done, which could broaden the parameter space of observable features we have discussed here.

  14. Power Beaming Leakage Radiation as a SETI Observable

    NASA Astrophysics Data System (ADS)

    Benford, James N.; Benford, Dominic J.

    2016-07-01

    The most observable leakage radiation from an advanced civilization may well be from the use of power beaming to transfer energy and accelerate spacecraft. Applications suggested for power beaming involve launching spacecraft to orbit, raising satellites to a higher orbit, and interplanetary concepts involving space-to-space transfers of cargo or passengers. We also quantify beam-driven launch to the outer solar system, interstellar precursors, and ultimately starships. We estimate the principal observable parameters of power beaming leakage. Extraterrestrial civilizations would know their power beams could be observed, and so could put a message on the power beam and broadcast it for our receipt at little additional energy or cost. By observing leakage from power beams we may find a message embedded on the beam. Recent observations of the anomalous star KIC 8462852 by the Allen Telescope Array (ATA) set some limits on extraterrestrial power beaming in that system. We show that most power beaming applications commensurate with those suggested for our solar system would be detectable if using the frequency range monitored by the ATA, and so the lack of detection is a meaningful, if modest, constraint on extraterrestrial power beaming in that system. Until more extensive observations are made, the limited observation time and frequency coverage are not sufficiently broad in frequency and duration to produce firm conclusions. Such beams would be visible over large interstellar distances. This implies a new approach to the SETI search: instead of focusing on narrowband beacon transmissions generated by another civilization, look for more powerful beams with much wider bandwidth. This requires a new approach for their discovery by telescopes on Earth. Further studies of power beaming applications should be performed, potentially broadening the parameter space of the observable features that we have discussed here.

  15. Amino acid sequence of a trypsin inhibitor from a Spirometra (Spirometra erinaceieuropaei).

    PubMed

    Sanda, A; Uchida, A; Itagaki, T; Kobayashi, H; Inokuchi, N; Koyama, T; Iwama, M; Ohgi, K; Irie, M

    2001-12-01

    A trypsin inhibitor that is highly homologous with bovine pancreatic trypsin inhibitor (BPTI) was co-purified along with RNase from Spirometra (Spirometra erinaceieuropaei). The amino acid sequence of this inhibitor (SETI) and the nucleotide sequence of the cDNA encoding this protein were determined by protein chemistry and gene technology. SETI contains 68 amino acid residues and has a molecular mass of 7,798 Da. SETI has 31 amino acid residues that are identical with BPTI's sequence, including 6 half-cystine and 5 aromatic amino acid residues. The active site Lys residue in BPTI is replaced by an Arg residue in SETI. SETI is an effective inhibitor of trypsin and moderately inhibits a-chymotrypsin, but less inhibits elastase or subtilisin. SETI was expressed by E. coli containing a PelB vector carrying the SETI encoding cDNA; an expression yield of 0.68 mg/l was obtained. The phylogenetic relationship of SETI and the other BPTI-like trypsin inhibitors was analyzed using most likelihood inference methods.

  16. A near-infrared SETI experiment: commissioning, data analysis, and performance results

    NASA Astrophysics Data System (ADS)

    Maire, Jérôme; Wright, Shelley A.; Dorval, Patrick; Drake, Frank D.; Duenas, Andres; Isaacson, Howard; Marcy, Geoffrey W.; Siemion, Andrew; Stone, Remington P. S.; Tallis, Melisa; Treffers, Richard R.; Werthimer, Dan

    2016-08-01

    Over the last two decades, Optical Search for Extra-Terrestrial Intelligence experiments have been conducted to search for either continuous or pulsed visible-light laser beacons that could be used for interstellar communication or energy transmission. Near-infrared offers a compelling window for signal transmission since there is a decrease in interstellar extinction and Galactic background compared to optical wavelengths. An innovative Near-InfraRed and Optical SETI (NIROSETI) instrument has been designed and constructed to take advantage of a new generation of fast (> 1 Ghz) low-noise near-infrared avalanche photodiodes to search for nanosecond pulsed near-infrared (850 - 1650 nm) pulses. The instrument was successfully installed and commissioned at the Nickel (1m) telescope at Lick Observatory in March 2015. We will describe the overall design of the instrument with a focus on methods developed for data acquisition and reduction for near-infrared SETI. Time and height analyses of the pulses produced by the detectors are performed to search for periodicity and coincidences in the signals. We will further discuss our NIROSETI survey plans.

  17. On the design of a postprocessor for a search for extraterrestrial intelligence /SETI/ system

    NASA Technical Reports Server (NTRS)

    Healy, T. J.; Seeger, C. L.; Stull, M. A.

    1979-01-01

    The design of an on-line postprocessor for a search for extraterrestrial intelligence (SETI) system is described. Signal processing tasks of the postprocessor include: (1) analysis of power level, phase coherence, and state of polarization of single-channel signals in a search for significant signals; (2) grouping or aggregation of adjacent channel data, time averaging of data; and (3) the detection of drifting and modulated signals. Control functions include multichannel spectrum analyzer frequency and clock control, system calibration and selfdiagnostic, control of data flow to and from short-term and long-term (archival) memories, and operation of detection subsystems, such as a visual display and a tunable receiver.

  18. Who are the SETI sceptics?

    NASA Astrophysics Data System (ADS)

    Ćirković, Milan M.

    2013-08-01

    Search for ExtraTerrestrial Intelligence (SETI) is now more than half a century old and has provoked enough discussion on technical, philosophical, and popular level, much of it critical. Historically, the criticism of SETI has been strong enough to heavily influence the course of research, so that there is a significant interest in discerning the nuances and fine points of critical argumentation. In this paper, I outline the two major forms of SETI scepticism, "fundamentalist" and "instrumentalist," which are often conflated in the published literature, both technical and popular. Precise delineation between these two types of scepticism is important for future research as a part of a wider taxonomic project, the build-up of SETI theory, as well as for smooth joining of SETI with the ongoing astrobiological revolution. Resolving the confusion in this respect is likely to lead to an improved atmosphere and heightened public image of future SETI searches and related activities.

  19. The Order of the Dolphin: Origins of SETI

    NASA Astrophysics Data System (ADS)

    Temming, Maria; Crider, Anthony

    2016-01-01

    In 1961, the National Academy of Sciences organized a meeting on the search for extraterrestrial intelligence (SETI) at the National Radio Astronomy Observatory in Green Bank, West Virginia. The ten scientists who attended, including future SETI icons such as Frank Drake and Carl Sagan, represented a variety of scientific fields. At the conclusion of the meeting, the attendees adopted the moniker "The Order of the Dolphin," in honor of participant John Lilly's work on interspecies communication. Since this seminal meeting, researchers in each of the attendees' fields have contributed in some way to the search for intelligent life. This study investigates the circumstances that led to each attendee's invitation to Green Bank and explores SETI as the legacy of this meeting. We will focus in this talk on the SETI connections of two attendees, astronomer Otto Struve and physicist Philip Morrison, both in regards to their personal contributions to SETI and the influence of their work on subsequent SETI research. Specifically, we will examine proposals by Otto Struve for exoplanet discovery methods, and Philip Morrison for radio searches that laid the groundwork for modern SETI.

  20. Strategic considerations in SETI, and a microwave approach. [Search for ExtraTerrestrial Intelligence

    NASA Technical Reports Server (NTRS)

    Seeger, C. L.

    1977-01-01

    Plausible options in the search for extraterrestrial intelligence (SETI), and the need to reserve a suitable portion of the EM (microwave) spectrum for SETI research, are discussed. Reasons for selection of a portion of the spectrum, specifically the 'water hole' near 1.5 GHz in the terrestrial microwave window (1-25 GHz), are presented, and competition with various emitters for that band (existing satellite downlink transmissions) is discussed. SETI search policies and options are summarized in a table. Speculative considerations guiding initial phases of the SETI pursuit are discussed.

  1. Searching for ET with Help from Three Million Volunteers: The SETI@Home, Serendip, Sevendip and Spck SETI Programs

    NASA Astrophysics Data System (ADS)

    Werthimer, Dan; Anderson, David; Bowyer, Stuart; Cobb, Jeff; Demorest, Paul

    2002-01-01

    We summarize results from two radio and two optical SETI programs based at the University of California, Berkeley. We discuss the most promising candidate signals from these searches and present plans for future SETI searches, including SERENDIP V and SETI@home II. The ongoing SERENDIP sky survey searches for radio signals at the 300 meter Arecibo Observatory. SERENDIP IV uses a 168 million channel spectrum analyser and a dedicated receiver to take data 24 hours a day, year round. The sky survey covers a 100 MHz band centered at the 21 cm line (1420 MHz) and declinations from -2 to +38 degrees. SETI@home uses desktop computers of 3.5 million volunteers to analyse 50 Terabytes of data taken at Arecibo. The SETI@home sky survey is 10 times more sensitive and searches a much wider variety of signal types than SERRENDIP IV but covers only a 2.5 MHz band. SETI@home is the planet's largest supercomputer, averaging 25 Tflops. SETI@home participants have contributed over a million years of computing time so far. The SEVENDIP optical pulse search looks for nS time scale pulses at optical wavelengths. It utilizes an automated 30 inch telescope, three ultra fast photo multiplier tubes and a coincidence detector. The target list includes F,G,K and M stars, globular cluster and galaxies. The SPOCK optical SETI program searches for narrow band continuous signals using spectra taken by Marcy and his colleagues in their planet search at Keck observatory.

  2. Dysonian SETI as a "Shortcut" to Detecting Habitable Planets

    NASA Astrophysics Data System (ADS)

    Wright, J. T.

    2016-12-01

    The search for habitable planets is ultimately motivated by the search for inhabited planets. On Earth, the most telling signature of life is that of humanity's technology. The Search for Extraterrestrial Intelligence (SETI) is thus the "ultimate" search for habitable planets.In 1960 two seminal papers in SETI were published, providing two visions for SETI. Giuseppe Cocconi and Philip Morrison's proposed detecting deliberate radio signals ("communication SETI"), while Freeman Dyson ("artifact SETI"), proposed detecting the inevitable effects of massive energy supplies and artifacts on their surroundings. While communication SETI has now had many career-long practitioners and major efforts, artifact SETI has, until recently, not been a vibrant field of study. The launch of the Kepler and WISE satellites have greatly renewed interest in the field, however, and the recent Breakthrough Listen Initiative has provided new motivation for finding good targets for communication SETI. I will discuss the progress of the Ĝ Search for Extraterrestrial Civilizations with Large Energy Supplies, including its justification and motivation, waste heat search strategy and first results, and the framework for a search for megastructures via transit light curves. The last of these led to the identification of KIC 8462852 (a.k.a. "Tabby's Star") as a candidate ETI host. This star, discovered by Boyajian and the Zooniverse Planet Hunters, exhibits several apparently unique and so-far unexplained photometric properties, and continues to confound natural explanation.

  3. SETI science working group report

    NASA Technical Reports Server (NTRS)

    Drake, F.; Wolfe, J. H.; Seeger, C. L.

    1984-01-01

    This report covers the initial activities and deliberations of a continuing working group asked to assist the SETI Program Office at NASA. Seven chapters present the group's consensus on objectives, strategies, and plans for instrumental R&D and for a microwave search for extraterrestrial in intelligence (SETI) projected for the end of this decade. Thirteen appendixes reflect the views of their individual authors. Included are discussions of the 8-million-channel spectrum analyzer architecture and the proof-of-concept device under development; signal detection, recognition, and identification on-line in the presence of noise and radio interference; the 1-10 GHz sky survey and the 1-3 GHz targeted search envisaged; and the mutual interests of SETI and radio astronomy. The report ends with a selective, annotated SETI reading list of pro and contra SETI publications.

  4. SETI-Italia 2003 status report and first results of a KL transform algorithm for ETI signal detection

    NASA Astrophysics Data System (ADS)

    Montebugnoli, S.; Bortolotti, C.; Cattani, A.; Maccaferri, A.; Orlati, A.; Poloni, M.; Poppi, S.; Monari, J.; Roma, M.; Pari, P. P.; Teodorani, M.; Righini, S.; Maccone, C.; Caliendo, D.; Cosmovici, C. B.; D'Amico, N.

    2006-02-01

    SETI-Italia is the Italian national SETI Program. It is run as a part of the Italian Bioastronomy Project, by IRA (Istituto di Radioastronomia) a subsidiary of the Istituto Nazionale di Astrofisica. At the moment, Italy is the only European country conducting a continuous SETI “listening” program, while occasional SETI searches may be conducted in France and the Ukraine. Outside Europe, continuous SETI programs are conducted in the USA, Australia and Argentina. The SETI-Italia activities started early in 1998 with a Serendip IV system connected in piggy-back mode to the Medicina VLBI 32-m antenna dish. In the years 2002/2003, considerable efforts were devoted to set up a fast computational system capable of computing the KLT (Karhunen Loève transform). This is a virtually new mathematical procedure in SETI, and is much more general than the FFT. It can search for the presence of signals both narrow-band and wide-band embedded in noise both coloured and white. The mathematical features the KLT have already been described in this Conference by Claudio Maccone [Innovative SETI by the KLT, Pešek Lecture 2003, paper # IAA.9.1.01 presented in Bremen, in this 2003 International Astronautical Congress [1]; Telecommunications, KLT and Relativity, vol. 1, IPI Press, Colorado Springs, CO, 1994, ISBN #1-880930-04-8 [2].]. Our software implementation of the KLT follows these lines and also is indebted to some basic ideas put forward by Robert S. Dixon [On the detection of unknown signals, in: G. Seth Shostak (Ed.), Third Decennial US USSR Conference on SETI, Astronomical Society of the Pacific Conference Series, vol. 47, 1993, pp. 128 140] of the Ohio State Radio Observatory as early as 1993.

  5. Risk and value analysis of SETI

    NASA Technical Reports Server (NTRS)

    Billingham, J.

    1990-01-01

    This paper attempts to apply a traditional risk and value analysis to the Search for Extraterrestrial Intelligence--SETI. In view of the difficulties of assessing the probability of success, a comparison is made between SETI and a previous search for extraterrestrial life, the biological component of Project Viking. Our application of simple Utility Theory, given some reasonable assumptions, suggests that SETI is at least as worthwhile as the biological experiment on Viking.

  6. Risk and value analysis of SETI.

    PubMed

    Billingham, J

    1990-01-01

    This paper attempts to apply a traditional risk and value analysis to the Search for Extraterrestrial Intelligence--SETI. In view of the difficulties of assessing the probability of success, a comparison is made between SETI and a previous search for extraterrestrial life, the biological component of Project Viking. Our application of simple Utility Theory, given some reasonable assumptions, suggests that SETI is at least as worthwhile as the biological experiment on Viking.

  7. Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

    PubMed

    Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

    2006-02-01

    Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

  8. Status of the NASA SETI Sky Survey microwave observing project

    NASA Technical Reports Server (NTRS)

    Klein, M. J.; Gulkis, S.; Wilck, H. C.; Olsen, E. T.; Garyantes, M. F.; Burns, D. J.; Asmar, P. R.; Brady, R. B.; Deich, W. T. S.; Renzetti, N. A.

    1992-01-01

    The Sky Survey observing program is one of two complementary strategies that NASA plans to use in its microwave Search for Extraterrestrial Intelligence (SETI). The primary objective of the Sky Survey is to search the entire sky over the frequency range 1000-10,000 MHz for evidence of narrow band signals of extraterrestrial, intelligent origin. Spectrum analyzers with upwards of 10 million channels and data rates in excess of 10 gigabits per second are required to complete the survey in less than 7 years. To lay the foundation for the operational SETI Sky Survey, a prototype system has been built to test and refine real time signal detection algorithms, to test scan strategies and observatory control functions, and to test algorithms designed to reject radio frequency interference. This paper presents a high level description of the prototype hardware and reports on the preparations to deploy the system to the 34-m antenna at the research and development station of NASA's Deep Space Communication Complex, Goldstone, California.

  9. Status of the NASA SETI Sky Survey microwave observing project.

    PubMed

    Klein, M J; Gulkis, S; Wilck, H C; Olsen, E T; Garyantes, M F; Burns, D J; Asmar, P R; Brady, R B; Deich, W T; Renzetti, N A

    1992-01-01

    The Sky Survey observing program is one of two complementary strategies that NASA plans to use in its microwave Search for Extraterrestrial Intelligence (SETI). The primary objective of the Sky Survey is to search the entire sky over the frequency range 1000-10,000 MHz for evidence of narrow band signals of extraterrestrial, intelligent origin. Spectrum analyzers with upwards of 10 million channels and data rates in excess of 10 gigabits per second are required to complete the survey in less than 7 years. To lay the foundation for the operational SETI Sky Survey, a prototype system has been built to test and refine real time signal detection algorithms, to test scan strategies and observatory control functions, and to test algorithms designed to reject radio frequency interference. This paper presents a high level description of the prototype hardware and software and reports on the preparations to deploy the system to the 34-m antenna at the research and development station of NASA's Deep Space Communication Complex, Goldstone, California.

  10. SETI observational program in Argentina

    NASA Astrophysics Data System (ADS)

    Raúl Colomb, F.; Cristina Martín, M.; Lemarchand, Guillermo A.

    Due to the scarce SETI research in the Southern Hemisphere, we decided to begin an observation of a series of southern stars at 21 cm and 18 cm, using the facilities of the Instituto Argentino de Radioastronomía (IAR). One of the two 30 m radiotelescopes was used since October 1986, for a search of narrow frequency (2.2 kHz resolution) band signal in the direction of nearby stars. We have selected for this plan 78 stars between -40° and -90° of declination and distances less than 50 l.y. In this paper we present the first results of this program at HI and OH line. We describe a 320 h parasitic program at OH line using the data of Comet Halley observations. Following a suggestion of Dr I. Almár we began in November 1987, a series of observations around the SETI Ellipsoid originated in the SN1987A at 18 cm. We describe the observations around the stars HD21899 and HD100623, following a suggestion of Alexei Arkhipov. We have initiated contacts with The Planetary Society to expand our SETI activities. It is our hope that at the time of this Symposium we can announce the details of this agreement, which could include the construction of a 8.4 million channel ultranarrowband spectrum analyzer, designed by Professor Paul Horowitz of Harvard University. This agreement was announced on 8 October 1988 at The Planetary Society Toronto SETI Conference. The 8.4 million channel spectrum analyzer called META II, was built during 1989, at Harvard University by J. C. Olalde and E. Hurrell, under the supervision of Professor Paul Horowitz. META II was officially dedicated on 12 October 1990 and is in operation with the antenna 2 of the Instituto Argentino de Radioastronomía.

  11. Status of the UC-Berkeley SETI efforts

    NASA Astrophysics Data System (ADS)

    Korpela, E. J.; Anderson, D. P.; Bankay, R.; Cobb, J.; Howard, A.; Lebofsky, M.; Siemion, A. P. V.; von Korff, J.; Werthimer, D.

    2011-10-01

    We summarize radio and optical SETI programs based at the University of California, Berkeley. The SEVENDIP optical pulse search looks for ns time scale pulses at visible wavelengths. It utilizes an automated 30 inch telescope, three ultra fast photo multiplier tubes and a coincidence detector. The target list includes F, G, K and M stars, globular cluster and galaxies. The ongoing SERENDIP V.v sky survey searches for radio signals at the 300 meter Arecibo Observatory. The currently installed configuration supports 128 million channels over a 200 MHz bandwidth with ~1.6 Hz spectral resolution. Frequency stepping allows the spectrometer to cover the full 300MHz band of the Arecibo L-band receivers. The final configuration will allow data from all 14 receivers in the Arecibo L-band Focal Array to be monitored simultaneously with over 1.8 billion channels. SETI@home uses the desktop computers of volunteers to analyze over 160 TB of data at taken at Arecibo. Over 6 million volunteers have run SETI@home during its 10 year history. The SETI@home sky survey is 10 times more sensitive than SERENDIP V.v but it covers only a 2.5 MHz band, centered on 1420 MHz. SETI@home searches a much wider parameter space, including 14 octaves of signal bandwidth and 15 octaves of pulse period with Doppler drift corrections from -100 Hz/s to +100 Hz/s. SETI@home is being expanded to analyze data collected during observations of Kepler objects of interest in May 2011. The Astropulse project is the first SETI search for μs time scale pulses in the radio spectrum. Because short pulses are dispersed by the interstellar medium, and the amount of dispersion is unknown, Astropulse must search through 30,000 possible dispersions. Substantial computing power is required to conduct this search, so the project uses volunteers and their personal computers to carry out the computation (using distributed computing similar to SETI@home). Keywords: radio instrumentation, FPGA spectrometers, SETI, optical SETI, Search for Extraterrestrial Intelligence, volunteer computing, radio transients, optical transients.

  12. Imaging the Alien - The Portrayal of Extraterrestrial Intelligence and SETI in Science Fiction

    NASA Astrophysics Data System (ADS)

    Baxter, S.

    Concepts of extraterrestrial intelligence as explored in science fiction are reviewed. In particular, modern fiction based on the scenarios envisaged in SETI methodologies is described. The intention is to help make this work accessible to specialists such as the SETI and astrobiology communities. While SF is primarily fiction and is meant to entertain, the more thoughtful of such works may serve as a bank of thought experiments to assist in the development of future SETI strategies and policies.

  13. SETI with Help from Five Million Volunteers: The Berkeley SETI Efforts

    NASA Astrophysics Data System (ADS)

    Korpela, E. J.; Anderson, D. P.; Bankay, R.; Cobb, J.; Foster, G.; Howard, A.; Lebofsky, M.; Marcy, G.; Parsons, A.; Siemion, A.; von Korff, J.; Werthimer, D.; Douglas, K. A.

    2009-12-01

    We summarize radio and optical SETI programs based at the University of California, Berkeley. The ongoing SERENDIP V sky survey searches for radio signals at the 300 meter Arecibo Observatory. The currently installed configuration supports 128 million channels over a 200 MHz bandwidth with 1.6 Hz spectral resolution. Frequency stepping allows the spectrometer to cover the full 300 MHz band of the Arecibo L-band receivers. The final configuration will allow data from all 14 receivers in the Arecibo L-band Focal Array to be monitored simultaneously with over 1.8 billion simultaneous channels. SETI@home uses desktop computers volunteers to analyze over 100 TB of at taken at Arecibo. Over 5 million volunteers have run SETI@home during its 10 year history. The SETI@home sky survey is 10 times more sensitive than SERENDIP V but it covers only a 2.5 MHz band, centered on 1420 MHz. SETI@home searches a much wider parameter space, including 14 octaves of signal bandwidth and 15 octaves of pulse period with Doppler drift corrections from -100 Hz/s to +100 Hz/s. The ASTROPULSE project is the first SETI search for μs time scale pulses in the radio spectrum. Because short pulses are dispersed by the interstellar medium, and amount of dispersion is unknown, ASTROPULSE must search through 30,000 possible dispersions. Substantial computing power is required to conduct this search, so the project will use volunteers and their personal computers to carry out the computation (using distributed computing similar to SETI@home). The SEVENDIP optical pulse search looks for ns time scale pulses at visible wavelengths. It utilizes an automated 30 inch telescope, three ultra fast photo multiplier tubes and a coincidence detector. The target list includes F,G,K and M stars, globular cluster and galaxies.

  14. Space missions for SETI.

    PubMed

    Drake, F

    1999-01-01

    Radio Telescopes for SETI searches are less demanding than general purpose astronomical radio telescopes. This provides an opportunity to exploit economical approaches in designing SETI systems. Radio Telescopes in low Earth orbit offer no discernible advantages to SETI; indeed, they probably would perform more poorly than a telescope in any other location. Telescopes in geosynchronous orbits would be sufficiently far from Earth to mitigate greatly the deleterious effect of human radio transmissions. Telescopes on the far side of the moon would be superb both from a radio interference standpoint, and from a civil engineering standpoint. Single-reflector telescopes as large as 50 kilometers in diameter could be constructed with conventional materials. However, their costs appear prohibitive. The asteroid belt and the outer solar system are unpromising places to place a large radio telescope. Perhaps the ultimate radio telescope would utilize the sun as a gravitational lens, focusing radiation on free-flying 10-meter class or possibly larger radio telescopes located at distances of the order of 1000 A.U. from the sun. Such a combination has an energy collecting area at 10 centimeters wavelength equivalent to that of a radio telescope about 11 kilometers in diameter, or of the order of 3000 Arecibo radio telescopes. Such a system could detect transmitters with EIRP of the order of a gigawatt at a distance of the order of the distance to the galactic center.

  15. The Search for Extraterrestrial Intelligence (SETI)

    NASA Astrophysics Data System (ADS)

    Tarter, Jill

    The search for evidence of extraterrestrial intelligence is placed in the broader astronomical context of the search for extrasolar planets and biomarkers of primitive life elsewhere in the universe. A decision tree of possible search strategies is presented as well as a brief history of the search for extraterrestrial intelligence (SETI) projects since 1960. The characteristics of 14 SETI projects currently operating on telescopes are discussed and compared using one of many possible figures of merit. Plans for SETI searches in the immediate and more distant future are outlined. Plans for success, the significance of null results, and some opinions on deliberate transmission of signals (as well as listening) are also included. SETI results to date are negative, but in reality, not much searching has yet been done.

  16. Dysonian Approach to SETI: A Fruitful Middle Ground?

    NASA Astrophysics Data System (ADS)

    Bradbury, R. J.; Cirkovic, M. M.; Dvorsky, G.

    We critically assess the prevailing currents in the Search for Extraterrestrial Intelligence (SETI), embodied in the notion of radio-searches for intentional artificial signals as envisioned by pioneers such as Frank Drake, Philip Morrison, Michael Papagiannis and others. In particular, we emphasize (1) the necessity of integrating SETI into a wider astrobiological and future studies context, (2) the relevance of and lessons to be learnt from the anti-SETI arguments, in particular Fermi's paradox, and (3) a need for complementary approach which we dub the Dysonian SETI. It is meaningfully derived from the inventive and visionary ideas of Freeman J. Dyson and his imaginative precursors, like Konstantin E. Tsiolkovsky, Olaf Stapledon, Nikola Tesla or John B. S. Haldane, who suggested macro-engineering projects as the focal points in the context of extrapolations about the future of humanity and, by analogy, other intelligent species. We consider practical ramifications of the Dysonian SETI and indicate some of the promising directions for future work.

  17. [An encounter with extraterrestrial intelligence].

    PubMed

    Hisabayashi, Hisashi

    2003-12-01

    It is much easier to find extraterrestrial intelligence than to detect simple organisms living on other planets. However, it is hard to communicate with such intelligence without the mutual understanding of inter-stellar communication protocol. The radio SETI (The Search for Extra-Terrestrial Intelligence) was initiated with the pioneering work of F. Drake in 1960, one year after the historical SETI paper by Cocconi and Morrison. This talk explains that SETI evolves with two bases of science; the understanding of our universe and the development of technology. Since SETI has had strong connection with radio astronomy from its early beginning, the impacts of radio astronomical findings and technological breakthrough can be seen in many aspects of the SETI history. Topics of this talk include the detection of microwave 3 K background radiation in the universe. Interstellar atomic and molecular lines found in radio-wave spectra provide the evidence of pre-biotic chemical evolution in such region. Radio telescope imaging and spectral technique are closely associated with methodology of SETI. Topics of the talk extend to new Allen Telescope Array and projected Square Kilometer Array. Recent optical SETI and the discoveries of extra solar planets are also explained. In the end, the recent understanding of our universe is briefly introduced in terms of matter, dark matter and dark energy. Even our understanding of the universe has been evolutionarily revolved and accumulated after 1960, we must recognize that our universe is still poorly understood and that astronomy and SETI are required to proceed hand in hand.

  18. Climate Change Impacts on the Cryosphere of Mountain Regions: Validation of a Novel Model Using the Alaska Range

    NASA Astrophysics Data System (ADS)

    Mosier, T. M.; Hill, D. F.; Sharp, K. V.

    2015-12-01

    Mountain regions are natural water towers, storing water seasonally as snowpack and for much longer as glaciers. Understanding the response of these systems to climate change is necessary in order to make informed decisions about prevention or mitigation measures. Yet, mountain regions are often data sparse, leading many researchers to implement simple or enhanced temperature index (ETI) models to simulate cryosphere processes. These model structures do not account for the thermal inertia of snowpack and glaciers and do not robustly capture differences in system response to climate regimes that differ from those the model was calibrated for. For instance, a temperature index calibration parameter will differ substantially in cold-dry conditions versus warm-wet ones. To overcome these issues, we have developed a cryosphere hydrology model, called the Significantly Enhanced Temperature Index (SETI), which uses an energy balance structure but parameterizes energy balance components in terms of minimum, maximum and mean temperature, precipitation, and geometric inputs using established relationships. Additionally, the SETI model includes a glacier sliding model and can therefore be used to estimate long-term glacier response to climate change. Sensitivity of the SETI model to changing climate is compared with an ETI and a simple temperature index model for several partially-glaciated watersheds within Alaska, including Wolverine glacier where multi-decadal glacier stake measurements are available, to highlight the additional fidelity attributed to the increased complexity of the SETI structure. The SETI model is then applied to the entire Alaska Range region for an ensemble of global climate models (GCMs), using representative concentration pathways 4.5 and 8.5. Comparing model runs based on ensembles of GCM projections to historic conditions, total annual snowfall within the Alaska region is not expected to change appreciably, but the spatial distribution of snow shifts towards higher elevations and for a large portion of the region the duration of snow cover decreases. The changes in temperature and snow distribution also lead to spatially heterogeneous responses by glaciers within the region. The SETI model is designed to be easy to apply for any mountain region where cryospheric processes dominate.

  19. SETI-3: the Search for ExtraTerrestrial Intelligence. A selection of papers from 1987-1990 Symposia of the International Academy of Astronautics held during the 38th-41st Congress (Brighton, Bangalore, Malaga, Dresden) of the International Astronautical Federation.

    PubMed

    1992-01-01

    This special issue of Acta Astronautica is a compilation of selected papers presented at Review Meetings on SETI at the 1987-1990 International Academy of Astronautics Congresses. Papers are drawn from seven areas: bioastronomical context, SETI technology, SETI searches, radio frequency interferences, possibilities for newer instrumentation, interdisciplinary connections, and public relations. Two papers presented at the Pesek Lecture are included.

  20. All Over the World: Mid-Twentieth Century Radio Astronomy and the Origin of the International SETI Network

    NASA Astrophysics Data System (ADS)

    Charbonneau, Rebecca

    2018-01-01

    Cold War mythology is rife with stories about secrecy, competition, espionage, and animosity. Yet the history behind the myth-- the overlooked scientists collaborating outside of the aims of the state-- also tells an interesting story. This paper examines the challenges of international scientific collaboration during the Cold War, focusing especially on a case study concerning Soviet radio astronomer Iosif Samuilovich Shklovskii and U.S. astrophysicist Carl Sagan, and their collaborative work on the search for extraterrestrial intelligence (SETI). Despite the hyper-politics that instigated and fueled the Space Race, SETI was held up as an ideal internationalist science, with the lofty goal of uniting all of humanity by situating it within a cosmic community. Although the internationalism of SETI discourse is not entirely unfounded due to its roots in international collaboration, further research indicates that such internationalism was in reality instilled with geopolitics, international conflict, and even espionage. That said, however, the cultural and philosophical perspectives of individual SETI scientists led them to operate within the tensions between national and ideological restraints and their own personal philosophical perspectives. In reviewing the letters of correspondence, conference proceedings, interviews, transcripts of lectures, and autobiographical writings of early-SETI radio astronomers, this paper ultimately argues that, although SETI was not the ideal internationalist science it was portrayed as, SETI pioneers were able to connect and form international networks within a contentious system which often centred on the restriction of free information and international collaboration through their mutual unconventional scientific interests, and facilitated by their personal utopian futurist philosophies.

  1. Objectives and first results of the NASA SETI sky survey field tests at Goldstone

    NASA Technical Reports Server (NTRS)

    Gulkis, S.; Klein, M. J.; Olsen, E. T.; Crow, R. B.; Gosline, R. M.; Downs, G. S.; Quirk, M. P.; Lokshin, A.; Solomon, J.

    1986-01-01

    Field tests of SETI (Search for Extraterrestrial Intelligence) prototype hardware and software began in March 1985 at Goldstone. With emphasis on the sky survey component of the NASA SETI search strategy, the article describes the survey characteristics, the detection strategy, and preliminary results of system tests.

  2. Writing Parallel Parameter Sweep Applications with pMatlab

    DTIC Science & Technology

    2011-01-01

    formulate this type of problem in a leader-worker paradigm. The SETI @Home project is a well- known leader-worker parallel application [1]. The SETI ...their results back to the SETI @Home servers when they are done computing the job. Because each job is independent, it does not matter if the 415th job

  3. The problem of active SETI: An overview

    NASA Astrophysics Data System (ADS)

    Musso, Paolo

    2012-09-01

    In the present paper (originally presented at the First IAA Symposium on Searching for Life Signatures hold at the UNESCO on 22-26 September 2008) I try to summarize the results of all my previous studies on active SETI and its possible dangers for us, also considering some new topics, in order to provide a possibly complete overview of the whole matter. First, I try to evaluate the possible risks of an indirect contact with aliens, from the social, cultural, and religious point of view; then, the possible risks related with receiving information about alien science and technology; finally, the risk that active SETI could increase the probability of a physical contact with hostile aliens. My conclusion is that active SETI is very unlikely to be dangerous for us, but, at present, such a possibility cannot be completely excluded. Surprisingly, it turns out that a very important point to be assessed in order to improve our evaluation of active SETI is the pace of our technological progress. Some suggestions about the policy that international community should adopt towards active SETI are also included.

  4. Project OASIS: The Design of a Signal Detector for the Search for Extraterrestrial Intelligence

    NASA Technical Reports Server (NTRS)

    Lord, S. (Editor); Dixon, R. (Editor); Healy, T. (Editor)

    1981-01-01

    An 8 million channel spectrum analyzer (MCSA) was designed the meet to meet the needs of a SETI program. The MCSA puts out a very large data base at very high rates. The development of a device which follows the MCSA, is presented.

  5. Innovative SETI by the KLT

    NASA Astrophysics Data System (ADS)

    Maccone, C.

    SETI searches are, by definition, the extraction of very weak radio signals out of the cosmic background noise. When SETI was born in 1959, it was "natural" to attempt this extraction by the only detection algorithm well known at the time: the Fourier Transform (FT). In fact: 1) SETI radio astronomers had adopted the viewpoint that a candidate ET signal would necessarily be a sinusoidal carrier, i.e. a very narrow-band signal. Over such a narrow band, the background noise is necessarily white. And so, the basic assumption behind the FT that the background noise must be white was "perfectly matched" to SETI for the next fifty years! 2) In addition, the Americans, J. W. Cooley and J. W. Tukey discovered in April 1965 that all the FT computations could be speeded up to N*ln(N) (rather than N2) (N is the number of numbers to be processed) by their own Fast Fourier Transform (FFT). Then, SETI radio astronomers all over the world gladly and unquestioningly adopted the new FFT forever. In 1983, however, the French SETI radio astronomer, François Biraud, dared to challenge this view (ref. [6]). He argued that we only can make guesses about ET's telecommunication systems, and that the shifting trend on Earth was from narrow-band to wide-band telecommunications. Thus, a new transform, other than the FFT, was needed that could detect signals over both narrow and wide bands, regardless of the colored noise distribution over any finite bandwidth. Such a transform had actually been pointed out as early as 1946 by the Finn mathematician, Kari Karhunen, and the French mathematician, Michel Loève, and is thus named KLT for them. In conclusion, François Biraud suggested to "look for the unknown in SETI" by adopting the KLT rather than the FFT. The same ideas were reached independently by this author also, and starting 1987, he too was "preaching the KLT": first at the SETI Institute, then (since 1990) at the Italian CNR (now called INAF) SETI facilities at Medicina, near Bologna. Their director, Stelio Montebugnoli, was willing to pay attention to him. Little by little, bright students succeeded in programming the KLT algorithm for the Medicina radio telescopes. Finally, by the year 2000, the advent of programmable cards, mastered by Montebugnoli, made the "miracle" happen. The KLT for SETI is now a reality at the SETI-Italia facilities and for the first time in history. This paper describes the KLT with a final section devoted to the advantages of installing the KLT on LOFAR and the SKA, i.e. to detecting leakage from nearby stars. Bursts, Pulses and Flickering: Wide-field monitoring of the dynamic radio sky Kerastari, Tripolis, Greece 12-15 June, 2007

  6. Evolution of a Planetary System. SETI Academy Planet Project.

    ERIC Educational Resources Information Center

    Search for Extraterrestrial Intelligence Inst., Mountain View, CA.

    The SETI Academy Planet Project provides an exciting, informative, and creative series of activities for elementary students (grades 5-6) in these activities each student plays the role of a cadet at the SETI Academy, a fictitious institution. This unit examines the evolution of stars and planets which is an important aspect of the search for…

  7. Promoting SETI in the UK

    NASA Astrophysics Data System (ADS)

    Penny, Alan

    2013-10-01

    MEETING REPORT What does the UK presently do in the search for extraterrestrial intelligence and what are the plans for the future? Alan Penny reports on a meeting of UK academics active in SETI, held as sessions in the recent National Astronomy Meeting in Scotland - and the formation of the UK SETI Research Network to promote UK academic work.

  8. Optical SETI: Moving Toward the Light

    NASA Astrophysics Data System (ADS)

    Ross, Monte; Kingsley, Stuart

    In 2009, the SETI community celebrated a half-century since the classic paper by Giuseppe Cocconi and Philip Morrison in Nature, that described how we might look for radio transmissions from extraterrestrial civilizations. It is propitious that the publication of this book in 2010 marks both the 50th anniversary of Frank Drake's Project Ozma, and the 50th anniversary of the demonstration of the first (ruby) laser by Theodore Maiman. The invention of the laser was based on the maser work by Arthur Schawlow and Charles Townes and the simultaneous work of Gordon Gould. During this first half-century of SETI, most observing has been carried out in the radio spectrum, during which time there have been enormous developments in laser technology. Only during the past two decades has the optical approach to SETI, otherwise known as optical SETI, been given the attention it deserves.

  9. Spin-Off Successes of SETI Research at Berkeley

    NASA Astrophysics Data System (ADS)

    Douglas, K. A.; Anderson, D. P.; Bankay, R.; Chen, H.; Cobb, J.; Korpela, E. J.; Lebofsky, M.; Parsons, A.; von Korff, J.; Werthimer, D.

    2009-12-01

    Our group contributes to the Search for Extra-Terrestrial Intelligence (SETI) by developing and using world-class signal processing computers to analyze data collected on the Arecibo telescope. Although no patterned signal of extra-terrestrial origin has yet been detected, and the immediate prospects for making such a detection are highly uncertain, the SETI@home project has nonetheless proven the value of pursuing such research through its impact on the fields of distributed computing, real-time signal processing, and radio astronomy. The SETI@home project has spun off the Center for Astronomy Signal Processing and Electronics Research (CASPER) and the Berkeley Open Infrastructure for Networked Computing (BOINC), both of which are responsible for catalyzing a smorgasbord of new research in scientific disciplines in countries around the world. Futhermore, the data collected and archived for the SETI@home project is proving valuable in data-mining experiments for mapping neutral galatic hydrogen and for detecting black-hole evaporation.

  10. Life in the Universe: Foundation for exciting multidisciplinary science activities for middle and elementary school classes

    NASA Technical Reports Server (NTRS)

    Milne, D.; O'Sullivan, K.

    1994-01-01

    Young students find extra-terrestrial life one of the most intriguing of all topics. A project funded by the National Science Foundation and NASA, and administered by the SETI Institute, is underway to devise science lessons for grades 3-9 that draw upon this fascination. The lessons are designed by teachers and persons with long experience at curriculum design, tested in classrooms, revised and retested. Six guides, each containing some 6-10 science lessons, will be finished by summer, 1994.The theme Life in the Universe lends itself naturally to integrated treatment of facts and concepts from many scientific disciplines. The lessons for two completed guides span the origin of planet systems, evolution of complex life, chemical makeup of life, astronomy, spectroscopy, continental drift, mathematics and SETI (Search for Extra-Terrestrial Intelligence). All lessons are hands-on, interesting, and successful.

  11. Life in the universe: foundation for exciting multidisciplinary science activities for middle and elementary school classes.

    PubMed

    Milne, D; O'Sullivan, K

    1994-01-01

    Young students find extra-terrestrial life one of the most intriguing of all topics. A project funded by the National Science Foundation and NASA, and administered by the SETI Institute, is underway to devise science lessons for grades 3-9 that draw upon this fascination. The lessons are designed by teachers and persons with long experience at curriculum design, tested in classrooms, revised and retested. Six guides, each containing some 6-10 science lessons, will be finished by summer, 1994. The theme Life in the Universe lends itself naturally to integrated treatment of facts and concepts from many scientific disciplines. The lessons for two completed guides span the origin of planet systems, evolution of complex life, chemical makeup of life, astronomy, spectroscopy, continental drift, mathematics and SETI (Search for Extra-Terrestrial Intelligence). All lessons are hands-on, interesting, and successful.

  12. Pulsar-aided SETI experimental observations

    NASA Technical Reports Server (NTRS)

    Heidmann, J.; Biraud, F.; Tarter, J.

    1989-01-01

    The rotational frequencies of pulsars are used to select preferred radio frequencies for SETI. Pulsar rotational frequencies are converted into SETI frequencies in the 1-10 GHz Galactic radio window. Experimental observations using the frequencies are conducted for target stars closer than 25 parsecs, unknown targets in a globular cluster, and unknown targets in the Galaxy closer than 2.5 kpc. The status of these observations is discussed.

  13. The Telecommunications and Data Acquisition Report

    NASA Technical Reports Server (NTRS)

    Posner, E. C. (Editor)

    1985-01-01

    Developments in programs managed by the Jet Propulsion Laboratory's Office of Telecommunications and Data acquisition are discussed. Space communications, radio antennas, the Deep Space Network, antenna design, Project SETI, seismology, coding, very large scale integration, downlinking, and demodulation are among the topics covered.

  14. Innovation in Primary School Construction: Community Participation in Seti Zone, Nepal. Educational Building Report 20. A Case Study.

    ERIC Educational Resources Information Center

    Tamang, H. D.; Dharam, K. C.

    Nepal is one of the poorest countries in the world. In 1981 the Education for Rural Development in Seti Zone Project--more commonly known as the "Seti Project"--was part of the Nepalese government's effort to develop a system of basic education in that far western region of Nepal. The early success of the project provided the impetus for…

  15. M855A1 Enhanced Performance Round (EPR) Media Day

    DTIC Science & Technology

    2011-05-04

    Distribution is unlimited. Other requests shall be referred to the Office of the Project Manager for Maneuver Ammunition Systems, ATTN: SFAE-AMO-MAS- SETI ... SETI ,Picatinny,NJ,07806-5000 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10. SPONSOR/MONITOR’S...the Project Manager for Maneuver Ammunition Systems, ATTN: SFAE- AMO-MAS- SETI , Picatinny, NJ Distribution Statement A: Approved for Public Release

  16. Mindmodeling@Home. . . and Anywhere Else You Have Idle Processors

    DTIC Science & Technology

    2009-07-01

    the continuous growth rate of end-user processing capability around the world. The first volunteer computing project was SETI @Home. It was... SETI @Home remains the longest running and one of the most popular volunteer computing projects in the world. This actually is an impressive feat...volunteer computing projects available to those interested in donating their idle processor time to scientific pursuits. Most of them, including SETI

  17. Models@Home: distributed computing in bioinformatics using a screensaver based approach.

    PubMed

    Krieger, Elmar; Vriend, Gert

    2002-02-01

    Due to the steadily growing computational demands in bioinformatics and related scientific disciplines, one is forced to make optimal use of the available resources. A straightforward solution is to build a network of idle computers and let each of them work on a small piece of a scientific challenge, as done by Seti@Home (http://setiathome.berkeley.edu), the world's largest distributed computing project. We developed a generally applicable distributed computing solution that uses a screensaver system similar to Seti@Home. The software exploits the coarse-grained nature of typical bioinformatics projects. Three major considerations for the design were: (1) often, many different programs are needed, while the time is lacking to parallelize them. Models@Home can run any program in parallel without modifications to the source code; (2) in contrast to the Seti project, bioinformatics applications are normally more sensitive to lost jobs. Models@Home therefore includes stringent control over job scheduling; (3) to allow use in heterogeneous environments, Linux and Windows based workstations can be combined with dedicated PCs to build a homogeneous cluster. We present three practical applications of Models@Home, running the modeling programs WHAT IF and YASARA on 30 PCs: force field parameterization, molecular dynamics docking, and database maintenance.

  18. Searching for Extraterrestrial Intelligence with the Square Kilometre Array

    NASA Astrophysics Data System (ADS)

    Siemion, A.; Benford, J.; Cheng-Jin, J.; Chennamangalam, J.; Cordes, J. M.; Falcke, H. D. E.; Garrington, S. T.; Garrett, M. A.; Gurvits, L.; Hoare, M.; Korpela, E.; Lazio, J.; Messerschmitt, D.; Morrison, I.; O'Brien, T.; Paragi, Z.; Penny, A.; Spitler, L.; Tarter, J.; Werthimer, D.

    2015-04-01

    The vast collecting area of the Square Kilometre Array (SKA), harnessed by sensitive receivers, flexible digital electronics and increased computational capacity, could permit the most sensitive and exhaustive search for technologically-produced radio emission from advanced extraterrestrial intelligence (SETI) ever performed. For example, SKA1-MID will be capable of detecting a source roughly analogous to terrestrial high-power radars (e.g. air route surveillance or ballistic missile warning radars, EIRP (EIRP = equivalent isotropic radiated power, ~10^17 erg sec^-1) at 10 pc in less than 15 minutes, and with a modest four beam SETI observing system could, in one minute, search every star in the primary beam out to ~100 pc for radio emission comparable to that emitted by the Arecibo Planetary Radar (EIRP ~2 x 10^20 erg sec^-1). The flexibility of the signal detection systems used for SETI searches with the SKA will allow new algorithms to be employed that will provide sensitivity to a much wider variety of signal types than previously searched for. Here we discuss the astrobiological and astrophysical motivations for radio SETI and describe how the technical capabilities of the SKA will explore the radio SETI parameter space. We detail several conceivable SETI experimental programs on all components of SKA1, including commensal, primary-user, targeted and survey programs and project the enhancements to them possible with SKA2. We also discuss target selection criteria for these programs, and in the case of commensal observing, how the varied use cases of other primary observers can be used to full advantage for SETI.

  19. Dynamics of neurons controlling movements of a locust hind leg. III. Extensor tibiae motor neurons.

    PubMed

    Newland, P L; Kondoh, Y

    1997-06-01

    Imposed movements of the apodeme of the femoral chordotonal organ (FeCO) of the locust hind leg elicit resistance reflexes in extensor and flexor tibiae motor neurons. The synaptic responses of the fast and slow extensor tibiae motor neurons (FETi and SETi, respectively) and the spike responses of SETi were analyzed with the use of the Wiener kernel white noise method to determine their response properties. The first-order Wiener kernels computed from soma recordings were essentially monophasic, or low passed, indicating that the motor neurons were primarily sensitive to the position of the tibia about the femorotibial joint. The responses of both extensor motor neurons had large nonlinear components. The second-order kernels of the synaptic responses of FETi and SETi had large on-diagonal peaks with two small off-diagonal valleys. That of SETi had an additional elongated valley on the diagonal, which was accompanied by two off-diagonal depolarizing peaks at a cutoff frequency of 58 Hz. These second-order components represent a half-wave rectification of the position-sensitive depolarizing response in FETi and SETi, and a delayed inhibitory input to SETi, indicating that both motor neurons were directionally sensitive. Model predictions of the responses of the motor neurons showed that the first-order (linear) characterization poorly predicted the actual responses of FETi and SETi to FeCO stimulation, whereas the addition of the second-order (nonlinear) term markedly improved the performance of the model. Simultaneous recordings from the soma and a neuropilar process of FETi showed that its synaptic responses to FeCO stimulation were phase delayed by about -30 degrees at 20 Hz, and reduced in amplitude by 30-40% when recorded in the soma. Similar configurations of the first and second-order kernels indicated that the primary process of FETi acted as a low-pass filter. Cross-correlation between a white noise stimulus and a unitized spike discharge of SETi again produced well-defined first- and second-order kernels that showed that the SETi spike response was also dependent on positional inputs. An elongated negative valley on the diagonal, characteristic of the second-order kernel of the synaptic response in SETi, was absent in the kernel from the spike component, suggesting that information is lost in the spike production process. The functional significance of these results is discussed in relation to the behavior of the locust.

  20. MindModeling@Home . . . and Anywhere Else You Have Idle Processors

    DTIC Science & Technology

    2009-12-01

    was SETI @Home. It was established in 1999 for the purpose of demonstrating the utility of “distributed grid computing” by providing a mechanism for...the public imagination, and SETI @Home remains the longest running and one of the most popular volunteer computing projects in the world. This...pursuits. Most of them, including SETI @Home, run on a software architecture called the Berkeley Open Infrastructure for Network Computing (BOINC). Some of

  1. Kurzweil's Singularity as a part of Evo-SETI Theory

    NASA Astrophysics Data System (ADS)

    Maccone, Claudio

    2017-03-01

    Ray Kurzweil's famous 2006 book "The Singularity Is Near" predicted that the Singularity (i.e. computers taking over humans) would occur around the year 2045. In this paper we prove that Kurzweil's prediction is in agreement with the "Evo-SETI" (Evolution and SETI)" mathematical model that this author has developed over the last five years in a series of mathematical papers published in both Acta Astronautica and the International Journal of Astrobiology.

  2. Searching for Good Science - The Cancellation of NASA's SETI Program

    NASA Astrophysics Data System (ADS)

    Garber, S. J.

    On Columbus Day, 1992, the National Aeronautics and Space Administration (NASA) formally initiated a radio astronomy program called SETI (Search for Extraterrestrial Intelligence). Less than a year later, Congress abruptly canceled the program. Why? While there was and still is a debate over the likelihood of finding intelligent extraterrestrial life, virtually all informed parties agreed that the SETI program constituted worthwhile, valid science. Yet, fervor over the federal budget deficit, lack of support from other scientists and aerospace contractors and a significant history of unfounded associations with nonscientific elements combined with bad timing in fall 1993 to make the program an easy target to eliminate. Thus SETI was a relative anomaly in terms of a small, scientifically valid program that was canceled for political expediency.

  3. The NASA SETI sky survey - Recent developments

    NASA Technical Reports Server (NTRS)

    Klein, Michael J.; Gulkis, Samuel; Olsen, Edward T.; Renzetti, Nicholas A.

    1988-01-01

    NASA's Search for Extraterrestrial Intelligence (SETI) project utilizes two complimentary search strategies: a sky survey and a targeted search. The SETI team at the Jet Propulsion Laboratory have primary responsibility to develop and carry out the sky survey part of the Microwave Observing Project. The paper describes progress that has been made to develop the major elements of the survey including a two-million channel wideband spectrum analyzer system that is being developed and constructed by JPL for the Deep Space Network. The new system will be a multiuser instrument that will serve as a prototype for the SETI Sky Survey processor. This system will be used to test the signal detection and observational strategies on deep-space network antennas in the near future.

  4. Undergraduate Research at SETI in Astrobiology

    NASA Astrophysics Data System (ADS)

    Kress, Monika; Phillips, C.; DeVore, E.; Hubickyj, O.

    2012-05-01

    The SETI Institute and San Jose State University (SJSU) have begun a partnership (URSA: Undergraduate Research at the SETI Institute in Astrobiology) in which undergraduate science and engineering majors from SJSU participate in research at the SETI Institute during the academic year. We are currently in our second year of the three-year NASA-funded grant. The goal of this program is to expose future scientists, engineers and educators to the science of astrobiology and to NASA in general, and by so doing, to prepare them for the transition to their future career in the Silicon Valley or beyond. The URSA students are mentored by a SETI Institute scientist who conducts research at the SETI Institute headquarters or nearby at NASA Ames Research Center. The SETI Institute is a private, nonprofit organization dedicated to scientific research, education and public outreach. Its mission is to explore, understand and explain the origin, nature and prevalence of life in the universe. SJSU is a large urban public university that serves the greater Silicon Valley area in California. Students at SJSU come from diverse ethnic, cultural and socioeconomic backgrounds. Many of them face financial pressures that force them to pursue part-time work. URSA students are paid to work for 10 hours/week during the academic year, and also participate in monthly group meetings where they practice their presentation skills and discuss future plans. We encourage underserved and underrepresented students, including women, minority, and those who are the first in their family to go to college, to apply to the URSA program and provide ongoing mentoring and support as needed. While preparing students for graduate school is not a primary goal, some of our students have gone on to MS or PhD programs or plan to do so. The URSA program is funded by NASA EPOESS.

  5. Distributions of nerve and muscle fibre types in locust jumping muscle.

    PubMed

    Hoyle, G

    1978-04-01

    Muscle fibres of the locust extensor tibiae (jumping muscle) were examined by interference microscopy and by electron microscopy. The electrical responses of single fibres and the mechanical responses of bundles or selected regions to the nerve fibres were examined. Four axons innervate the muscle: fast (FETi), slow (SETi), common inhibitor (CI) and dorsal unpaired median (DUMETi). Their distributions were examined by combined electrophysiological tracing and EM sectioning. The mean diameter of muscle fibres in different regions varies from 40 to 140 micrometer and is related to the local leg thickness rather than muscle fibre type. The fine structure of a fibre is related to its innervation. Fibres innervated by FETi but not SETi are of fast type ultrastructurally. Fibres innervated by SETi but not by FETi are of slow type ultrastructurally. Fibres innervated by both axons are generally intermediate between the extremes though more nearly of fast type than slow. Distal slow muscle fibres have much slower relaxation rates than do proximal ones. The most proximal bundles are of mixed muscle fibre type. There is an abrupt transition from a mixed population to homogeneous fast type, in the muscle units immediately distal to the most proximal bundles. This transition is associated with the presence of DUMETi terminals on some of the fibres distal to the transition point. There are no SETi endings on these same fibres. Fibres innervated by both SETi and FETi are scattered throughout the leg, but are commonest in the dorsal bundles. The percentage of these increases progressively passing distally. The most distal muscle fibres are innervated by SETi but not by FETi. It is concluded that different regions of the muscle will play different roles functionally since they are differentially sensitive to the pattern of SETi discharge.

  6. Selectivity of the uptake of glutamate and GABA in two morphologically distinct insect neuromuscular synapses.

    PubMed

    van Marle, J; Piek, T; Lammertse, T; Lind, A; Van Weeren-Kramer, J

    1985-11-25

    The common inhibitor (CI) and slow excitor tibiae (SETi) innervated slow muscles 135cd of the locust Schistocerca gregaria were incubated under high-affinity uptake conditions either in [3H]GABA or in [3H]glutamate. [3H]GABA is accumulated in the glia of the nerve endings of the CI as well as the SETi; however, it is accumulated only in the terminal axons of the CI, not in the terminal axons of the SETi. The grain densities above the glia and above the CI terminal axons are approximately 2 grains/micron2. After incubation in [3H]glutamate the grain densities above the CI terminal axons and the SETi terminal axons are approximately 4 grains/micron2; the grain densities above the glia of both types of nerve endings are approximately 17 grains/micron2. The relatively high labeling (3 grains/micron2) of the muscles after incubation in the presence of glutamate is ascribed to the high metabolic requirements of slow muscles. The conclusion is drawn that a high-affinity uptake system for GABA is present in the CI terminal axons and in the glia of both the CI and SETi nerve endings. However, while the glutamate uptake in the CI and SETi nerve endings of the slow 135cd is comparable to the high-affinity uptake of glutamate in the fast excitor tibiae (FETi) nerve endings of the fast retractor unguis muscle, a high-affinity uptake of glutamate was only demonstrated in the glia of both types of nerve endings. A high-affinity uptake in the terminal axons of the CI and SETi may be masked by an extensively low-affinity uptake of glutamate by the muscles.

  7. Search for Extraterrestrial Intelligence (SETI)

    NASA Technical Reports Server (NTRS)

    Billingham, John

    1993-01-01

    Various aspects of project SETI are discussed. Some of the topics discussed include spectrum analyzers, signal processing, sky surveys, radiotelescopes, high resolution microwave survey, Deep Space Network, and signal detection.

  8. Analysis of a crossed Bragg cell acousto-optical spectrometer for SETI

    NASA Technical Reports Server (NTRS)

    Gulkis, S.

    1989-01-01

    The search for radio signals from extraterrestrial intelligent beings (SETI) requires the use of large instantaneous bandwidth (500 MHz) and high resolution (20 Hz) spectrometers. Digital systems with a high degree of modularity can be used to provide this capability, and this method has been widely discussed. Another technique for meeting the SETI requirement is to use a crossed Bragg cell spectrometer as described by Psaltis and Casasent. This technique makes use of the Folded Spectrum concept, introduced by Thomas. The Folded Spectrum is a 2-D Fourier Transform of a raster scanned 1-D signal. It is directly related to the long 1-D spectrum of the original signal and is ideally suited for optical signal processing. The folded spectrum technique has received little attention to date, primarily because early systems made use of photographic film which are unsuitable for the real time data analysis and voluminous data requirements of SETI. An analysis of the crossed Bragg cell spectrometer is presented as a method to achieve the spectral processing requirements for SETI. Systematic noise contributions unique to the Bragg cell system will be discussed.

  9. Analysis of a crossed Bragg cell acousto-optical spectrometer for SETI.

    PubMed

    Gulkis, S

    1989-01-01

    The search for radio signals from extraterrestrial intelligent beings (SETI) requires the use of large instantaneous bandwidth (500 MHz) and high resolution (20 Hz) spectrometers. Digital systems with a high degree of modularity can be used to provide this capability, and this method has been widely discussed. Another technique for meeting the SETI requirement is to use a crossed Bragg cell spectrometer as described by Psaltis and Casasent. This technique makes use of the Folded Spectrum concept, introduced by Thomas. The Folded Spectrum is a 2-D Fourier Transform of a raster scanned 1-D signal. It is directly related to the long 1-D spectrum of the original signal and is ideally suited for optical signal processing. The folded spectrum technique has received little attention to date, primarily because early systems made use of photographic film which are unsuitable for the real time data analysis and voluminous data requirements of SETI. An analysis of the crossed Bragg cell spectrometer is presented as a method to achieve the spectral processing requirements for SETI. Systematic noise contributions unique to the Bragg cell system will be discussed.

  10. Analysis of a crossed Bragg cell acousto-optical spectrometer for SETI

    NASA Astrophysics Data System (ADS)

    Gulkis, Samuel

    The search for radio signals from extraterrestrial intelligent beings (SETI) requires the use of large instantaneous bandwidth (500 MHz) and high resolution (20 Hz) spectrometers. Digital systems with a high degree of modularity can be used to provide this capability, and this method has been widely discussed. Another technique for meeting the SETI requirement is to use a crossed Bragg cell spectrometer as described by Psaltis and Casasent. This technique makes use of the Folded Spectrum concept, introduced by Thomas. The Folded Spectrum is a 2-D Fourier Transform of a raster scanned 1-D signal. It is directly related to the long 1-D spectrum of the original signal and is ideally suited for optical signal processing. The folded spectrum technique has received little attention to date, primarily because early systems made use of photographic film which are unsuitable for the real time data analysis and voluminous data requirements of SETI. An analysis of the crossed Bragg cell spectrometer is presented as a method to achieve the spectral processing requirements for SETI. Systematic noise contributions unique to the Bragg cell system will be discussed.

  11. Reoptimization of the Ohio State University radio telescope for the NASA SETI program

    NASA Technical Reports Server (NTRS)

    Dixon, R. S.

    1991-01-01

    The Ohio State University radiotelescope is the second largest radio telescope in the United States, equivalent in collecting area (2200 sq m) to a 175-foot diameter dish. For the past 17 years it has been dedicated fulltime to SETI, and it is now being considered by NASA for selection as the NASA dedicated SETI observatory. The telescope was originally designed, optimized, and used as an all-sky survey instrument to create detailed maps and catalogs of the radio astronomical sky. For the SETI Program, some re-optimizations are required. Right ascension tracking for one to two hours (depending on the declination) was achieved by exploiting the exceptionally large f/d ratio of the telescope. The feed horns were mounted on a large moveable, rubber-tired cart which is capable of a total motion of 100 feet. The cart can carry many horns, making possible simultaneous observations at many sky directions and frequency ranges. Rapid declination movement and its automation will be accomplished through simplification of the existing braking system, and replacement of older mechanical sensors by modern electronic inclinometers and proximity detectors. Circular polarization capability will be achieved through an increase in the number of horizontal wires in the reflector mesh, or addition of a finer mesh on top of the existing one. The telescope has great inherent resistance to radio frequency interference, due to its ground-mounted feed horns and shielding by the large reflectors of half the horizon. The resistance was recently increased further by installation of rolled-edges and diffraction-trapping gratings on the feed horns. If further shielding should be required, inexpensive side shields could be added to the telescope, making it a totally closed structure on all four sides.

  12. A SETI experiment. [Search for Extra Terrestrial Intelligence

    NASA Technical Reports Server (NTRS)

    Mclaughlin, W. I.

    1986-01-01

    In order to increase the probability of contact in the search for extraterrestrial intelligence (SETI), it has been proposed to search more intensively in certain regions of the electromagnetic spectrum ('the water hole'). The present paper describes a similar narrowing of the search in the time domain. Application of this strategy results in the SETI experiments searching for signals from the Tau Ceti system late in 1986 and early in 1987, and from the Epsilon Eridani system in mid 1988.

  13. The Scientific Search for Extraterrestrial Intelligence: a Sociological Analysis.

    NASA Astrophysics Data System (ADS)

    Romesberg, Daniel Ray

    1992-01-01

    This study examines the search for extraterrestrial intelligence, as it has been conducted by scientists over the past century. The following questions are explored: (1) What are the historical patterns of American scientific interest in extraterrestrial intelligence? From a sociology of science perspective, how can these patterns of interest be explained? (2) Who are the most prominent scientists involved in SETI? What are their academic backgrounds? (3) How has the rather exotic idea of extraterrestrial intelligence managed to penetrate the realm of respectable science?. In order to measure the historical fluctuations of scientific interest in extraterrestrial intelligence, a frequency distribution of relevant articles published in American scientific journals over the past century has been constructed. The core scholars of the "extraterrestrial" field have been determined via citation analysis, in a selected portion of the scientific literature. An analysis of recent scientific literature on the Search for Extraterrestrial Intelligence (SETI) has revealed a number of tactics of legitimation and de-legitimation used by SETI proponents, as well as opponents. This study has generated the following findings: (1) Historically, there are three factors which tend to stimulate general scientific interest in extraterrestrial intelligence: First, the strong demonstration of the plausibility of extraterrestrial intelligence, or life, especially in a tangible, and therefore studiable location. Scientific laboratories are primary agents of plausibility here. Second, the organized political activity of SETI scientists. Third, the availability of government funding for searches for extraterrestrial intelligence, or life. (2) Statistically, the leading scholars of modern SETI are Sagan, Drake and Morrison. The field itself tends to be dominated by astronomers and physicists. (3) Because SETI has no concrete data, and is easily stigmatized as an illegitimate scientific activity, it must engage in an intense campaign of scientific legitimation. Most importantly, SETI scientists must try to resemble scientists who are engaged in "normal," respectable scientific activities. (4) The sociological study of SETI's history demonstrates the strengths and limits of the constructivist and realist approaches to the sociology of science. It suggests that sociological analyses of science should attempt to incorporate both analytical perspectives.

  14. NASA SETI microwave observing project: Sky Survey element

    NASA Technical Reports Server (NTRS)

    Klein, M. J.

    1991-01-01

    The SETI Sky Survey Observing Program is one of two complimentary strategies that NASA plans to use in its microwave Search for Extraterrestrial Intelligence (SETI). The primary objective of the sky survey is to search the entire sky over the frequency range of 1.0 to 10.0 GHz for evidence of narrow band signals of extraterrestrial intelligent origin. Frequency resolutions of 30 Hz or narrower will be used across the entire band. Spectrum analyzers with upwards of ten million channels are required to keep the survey time approximately 6 years. Data rates in excess of 10 megabits per second will be generated in the data taking process. Sophisticated data processing techniques will be required to determine the ever changing receiver baselines, and to detect and archive potential SETI signals. Existing radio telescopes, including several of NASA's Deep Space Network (DSN) 34 meter antennas located at Goldstone, CA and Tidbinbilla, Australia will be used for the observations. The JPL has the primary responsibility to develop and carry out the sky survey. In order to lay the foundation for the full scale SETI Sky Survey, a prototype system is being developed at the JPL. The system will be installed at the new 34-m high efficiency antenna at the Deep Space Station (DSS) 13 research and development station, Goldstone, CA, where it will be used to initiate the observational phase of the NASA SETI Sky Survey. It is anticipated that the early observations will be useful to test signal detection algorithms, scan strategies, and radio frequency interference rejection schemes. The SETI specific elements of the prototype system are: (1) the Wide Band Spectrum Analyzer (WBSA); a 2-million channel fast Fourier transformation (FFT) spectrum analyzer which covers an instantaneous bandpass of 40 MHz; (2) the signal detection processor; and (3) the SETI Sky Survey Manager, a network-based C-language environment that provides observatory control, performs data acquisition and analysis algorithms. A high level description of the prototype hardware and software systems will be given and the current status of the system development will be reported.

  15. ARC-2007-ACD07-0152-030

    NASA Image and Video Library

    2007-08-12

    Perseid Meteor flight on Google's Gulfstream Aircraft. P.I. Peter Jenniskens, SETI Group Peter Jenniskens, SETI - briefing w/L-R; J Nott, P Jenniskens, M Koop, D Holman and two Apex Aviation Corp reps.

  16. The 1993 Finnish Interdisciplinary Seminar on SETI - A review of aims, approaches and conclusions

    NASA Astrophysics Data System (ADS)

    Seppanen, Jouko

    1993-10-01

    The communications of the International Interdisciplinary Seminar on SETI, held on March 6-7, 1993 in Vantaa, Finland, are reviewed and the contents and conclusions of papers summarized. The seminar was organized jointly by the Finnish Artificial Intelligence Society (FAIS), Finnish Astronomical Society, Ursa Astronomical Association and Heureka - The Finnish Science Centre. As the ninth in a series of intelligence-related seminars of FAIS, SETI was chosen as the topic for spring 1993, noting the new ten year NASA SETI program HRMS (High Resolution Micro-wave Survey), commenced on Columbus Day, October 12, 1992. The aims and the interdisciplinary format of the seminar are described, the main results and conclusions of papers are restated, and the seminar publications introduced. The summaries of papers are based on their abstracts and contain excerpts from texts.

  17. THE FIRST VERY LONG BASELINE INTERFEROMETRIC SETI EXPERIMENT

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Rampadarath, H.; Morgan, J. S.; Tingay, S. J.

    2012-08-15

    The first Search for Extra-Terrestrial Intelligence (SETI) conducted with very long baseline interferometry (VLBI) is presented. By consideration of the basic principles of interferometry, we show that VLBI is efficient at discriminating between SETI signals and human generated radio frequency interference (RFI). The target for this study was the star Gliese 581, thought to have two planets within its habitable zone. On 2007 June 19, Gliese 581 was observed for 8 hr at 1230-1544 MHz with the Australian Long Baseline Array. The data set was searched for signals appearing on all interferometer baselines above five times the noise limit. Amore » total of 222 potential SETI signals were detected and by using automated data analysis techniques were ruled out as originating from the Gliese 581 system. From our results we place an upper limit of 7 MW Hz{sup -1} on the power output of any isotropic emitter located in the Gliese 581 system within this frequency range. This study shows that VLBI is ideal for targeted SETI including follow-up observations. The techniques presented are equally applicable to next-generation interferometers, such as the long baselines of the Square Kilometre Array.« less

  18. Wideband waveguide polarizer development for SETI

    NASA Technical Reports Server (NTRS)

    Lee, P.; Stanton, P.

    1991-01-01

    A wideband polarizer for the Deep Space Network (DSN) 34 meter beam waveguide antenna is needed for the Search for Extraterrestrial Intelligence (SETI) project. The results of a computer analysis of a wideband polarizer are presented.

  19. What is SETI?

    PubMed

    Tarter, J

    2001-12-01

    This paper describes the efforts of SETI that are going on around the world. It presents a brief rationale for the choice of methodology and the limits that can be set on the basis of such results to date.

  20. Educating the next generation of SETI scientists: Voyages through time

    NASA Astrophysics Data System (ADS)

    DeVore, Edna; Tarter, Jill; Fisher, Jane; O'Sullivan, Kathleen; Pendleton, Yvonne; Taylor, Sam; Burke, Margaret

    2003-08-01

    The search for extraterrestrial intelligence (SETI) could succeed tomorrow, or not for many generations, or never. SETI scientists are very cognizant of the need to train the next generation of researchers who can carry on this vast scientific exploration. Previously, the SETI Institute has met this challenge by developing supplementary teacher's guides for elementary and middle schools called "Life In the Universe" and published by Teacher Ideas Press. Currently, we are engaged in a far more challenging project that is funded primarily by the National Science Foundation (NSF). The SETI Institute is creating a year long, interdisciplinary, high school science curriculum called "Voyages Through Time: Everything Evolves". We are using the theme of evolution to weave a panoramic vista for students that begins with the origin of the universe, encompasses our own origin and evolution, and looks at the evolution of technology and our possible future. By integrating different scientific and technical disciplines to explore how we answer fundamentally important questions, we hope to excite and motivate high school students with the opportunities offered by the way science is practiced today. We invite them to plan a future in which they help to enrich the answers to the big questions: Where did I come from? Where am I going? is anybody else out there? Voyages Through Time consists of six modules on CD-ROMs for teachers and students that have been extensively tested both regionally and nationally. Publication is expected in 2003. The partners in the development of this curriculum are the SETI Institute, NASA Ames Research Center, California Academy of Sciences, and San Francisco State University. Voyages Through Time is funded by the NSF (IMD # 9730693) with additional support from NASA, Hewlett Packard Company, The Foundation for Microbiology, and the Federated Charitable Campaign. For further information, visit: http://www.seti.org/education/Welcome.html.

  1. Manifestation of intelligence implications for SETI

    NASA Technical Reports Server (NTRS)

    Kuiper, T. B. H.

    1986-01-01

    The objectives of the SETI projects are discussed. Life, intelligence, and sapience are defined in order to characterize the phenomena. Dissipation and coherence are useful characteristics for detection. Consideration is given to electromagnetically observable phenomena, in particular spatial coherence.

  2. SETI - The search for extraterrestrial intelligence - Plans and rationale

    NASA Technical Reports Server (NTRS)

    Wolfe, J. H.; Billingham, J.; Edelson, R. E.; Crow, R. B.; Gulkis, S.; Olsen, E. T.; Oliver, B. M.; Peterson, A. M.

    1981-01-01

    The methodology and instrumentation of a 10 yr search for extraterrestrial intelligence (SETI) program by NASA, comprising 5 yr for instrumentation development and 5 yr for observations, is described. A full sky survey in two polarizations between 1.2 and 10 GHz with resolution binwidths down to 32 Hz, and a two polarization can between 1.2-3 GHz with resolution binwidths down to 1 Hz of 700 nearby solar type stars within 20 light years of earth will extend the sensitivity of previous surveys by 300 times and cover 20,000 times more frequency space. EM signals are perceived as the only means for detecting life outside the solar system, and the SETI effort is driven by the empirical experience that once a physical process has been observed to occur, its occurrence elsewhere is assured. Further discussion is given of the history of searches for life in the Universe, the SETI search strategy, instrumentation, and signal identification.

  3. Summary of interference measurements at selected radio observatories

    NASA Technical Reports Server (NTRS)

    Tarter, Jill C.

    1990-01-01

    Results are presented from a series of RF interference (RFI) observations conducted during 1989 and 1990 at selected radio astronomy observatories in order to choose a site for the SETI, where the local and orbital RFI would be as benign as possible for observations of weak electromagnetic signals. These observatories included the DSS13 at Goldstone (California), the Arecibo Observatory (Puerto Rico), the Algonquin Radio Observatory in Ottawa (Canada), the Ohio State University Radio Observatory in Columbus (Ohio), and the NRAO in Green Bank (West Virginia). The observations characterize the RFI environment at these sites from 1 to 10 GHz, using radio astronomy antennas, feeds, and receivers; SETI signal processors; and stand-alone equipment built specifically for this purpose. The results served as part of the basis for the selection (by the NASA SETI Microwave Observing Project) of NRAO as the site of choice for SETI observations.

  4. Efficiency in SETI

    NASA Astrophysics Data System (ADS)

    Shostak, Seth

    2011-02-01

    While modern SETI experiments are often highly sensitive, reaching detection limits of 10 -25 W/m 2 Hz in the radio, interstellar distances imply that if extraterrestrial societies are using isotropic or broad-beamed transmitters, the power requirements for their emissions are enormous. Indeed, isotropic transmissions to the entire Galaxy, sufficiently intense to be detectable by our current searches, would consume power comparable to the stellar insolation of an Earth-size planet. In this paper we consider how knowledge can be traded for power, and how, and to what degree, astronomical accuracy can reduce the energy costs of a comprehensive transmission program by putative extraterrestrials. Indeed, an exploration of how far this trade-off might be taken suggests that extraterrestrial transmitting strategies of civilizations only modestly more advanced than our own would be, as are our SETI receiving experiments, inexpensive enough to allow multiple efforts. We explore the consequences this supposition has for our SETI listening experiments.

  5. Evo-SETI Theory and Information Gap among Civilizations

    NASA Astrophysics Data System (ADS)

    Maccone, Claudio

    2016-05-01

    In a series of recent papers (Refs. [1] through [9]) this author gave the equations of his mathematical model of Evolution and SETI, simply called "Evo-SETI". Key features of Evo-SETI are: 1) The Statistical Drake Equation is the extension of the classical Drake equation into Statistics. Probability distributions of the number of ET civilizations in the Galaxy (lognormals) were given, and so is the probable distribution of the distance of ETs from us. 2) Darwinian Evolution is re-defined as a Geometric Brownian Motion (GBM) in the number of living species on Earth over the last 3.5 billion years. Its mean value grew exponentially in time and Mass Extinctions of the past are accounted for as unpredictable low GBM values. 3) The exponential growth of the number of species during Evolution is the geometric locus of the peaks of a one-parameter family of lognormal distributions (b-lognormals, starting each at a different time b=birth) constrained between the time axis and the exponential mean value. This accounts for cladistics (i.e. Evolution Lineages). The above key features of Evo-SETI Theory were already discussed by this author in Refs. [1] through [9]. Now about this paper's "novelties". 4) The lifespan of a living being, let it be a cell, an animal, a human, a historic human society, or even an ET society, is mathematically described as a finite b-lognormal. This author then described mathematically the historical development of eight human historic civilizations, from Ancient Greece to the USA, by virtue of b-lognormals. 5) Finally, the b-lognormal's entropy is the measure of a civilization's advancement level. By measuring the entropy difference between Aztecs and Spaniards in 1519, this author was able to account mathematically for the 20-million-Aztecs defeat by a few thousand Spaniards, due to the latter's technological (i.e. entropic) superiority. The same might unfortunately happen to Humans when they will face an ET superior civilization for the first time. Now the question is: whenever a new exoplanet is discovered, where does that exoplanet stand in its evolution towards life as we have it on Earth nowadays, or beyond? This is the central question of SETI. This author hopes that his Evo-SETI Theory will help addressing this question when SETI astronomers will succeed in finding the first "life signatures" or even ET Civilizations.

  6. A reply from earth? - A proposed approach to developing a message from humankind to extraterrestrial intelligence after we detect them

    NASA Technical Reports Server (NTRS)

    Michaud, Michael; Billingham, John; Tarter, Jill

    1990-01-01

    The question of the formulation of a proper response to the detection of an extraterrestrial civilization is considered. It is proposed that an international agreement or declaration of principles establishing procedures enabling international participation in the making of such decisions be developed and that the SETI Committee of the International Academy of Aeronautics, in cooperation with other interested bodies, draft an agreement or declaration of principles that would set up these procedures; and that the draft be presented to the United Nations for consideration through the Committee on Peaceful Uses of Outer Space. A suggested outline of the agreement or declaration is presented and proposes that a response to the detection of extraterrestrial intelligence should be on behalf of all humankind; that this decision should be made by an appropriately representative international body; and that the content of the reply should reflect an international consensus.

  7. A Search for Brief Optical Flashes Associated with the SETI Target KIC 8462852

    NASA Technical Reports Server (NTRS)

    Abeysekara, A. U.; Archambault, S.; Archer, A.; Benbow, W.; Bird, R.; Buchovecky, M.; Buckley, J. H.; Byrum, K.; Cardenzana, J. V.; Cerruti, M.; hide

    2016-01-01

    The F-type star KIC8462852 has recently been identified as an exceptional target for search for extraterrestrial intelligence (SETI) observations. We describe an analysis methodology for optical SETI, which we have used to analyze nine hours of serendipitous archival observations of KIC8462852 made with the VERITAS gamma-ray observatory between 2009 and 2015. No evidence of pulsed optical beacons, above a pulse intensity at the Earth of approximately 1 photon/sq m, is found. We also discuss the potential use of imaging atmospheric Cherenkov telescope arrays in searching for extremely short duration optical transients in general.

  8. Fermi paradox and alternative strategies for SETI programs - The anthropic principle and the search for close solar analogs

    NASA Astrophysics Data System (ADS)

    Fracassini, Massimo; Pasinetti Fracassini, Laura E.; Pasinetti, Antonio L.

    1988-07-01

    The Anthropic Principle, a new trend of modern cosmology, claims that the origin of life and the development of intelligent beings on the Earth is the result of highly selective biological processes, strictly tuned in the fundamental physical characteristics of the Universe. This principle could account for the failure of some programs of search for extraterrestrial intelligences (SETI) and suggests the search for strict solar analogs as a primary target for SETI strategies. In this connection, the authors have selected 22 solar analogs and discussed their choice.

  9. A Search for Brief Optical Flashes Associated with the SETI Target KIC 8462852

    NASA Astrophysics Data System (ADS)

    Abeysekara, A. U.; Archambault, S.; Archer, A.; Benbow, W.; Bird, R.; Buchovecky, M.; Buckley, J. H.; Byrum, K.; Cardenzana, J. V.; Cerruti, M.; Chen, X.; Christiansen, J. L.; Ciupik, L.; Cui, W.; Dickinson, H. J.; Eisch, J. D.; Errando, M.; Falcone, A.; Fegan, D. J.; Feng, Q.; Finley, J. P.; Fleischhack, H.; Fortin, P.; Fortson, L.; Furniss, A.; Gillanders, G. H.; Griffin, S.; Grube, J.; Gyuk, G.; Hütten, M.; Håkansson, N.; Hanna, D.; Holder, J.; Humensky, T. B.; Johnson, C. A.; Kaaret, P.; Kar, P.; Kelley-Hoskins, N.; Kertzman, M.; Kieda, D.; Krause, M.; Krennrich, F.; Kumar, S.; Lang, M. J.; Lin, T. T. Y.; Maier, G.; McArthur, S.; McCann, A.; Meagher, K.; Moriarty, P.; Mukherjee, R.; Nieto, D.; O'Brien, S.; O'Faoláin de Bhróithe, A.; Ong, R. A.; Otte, A. N.; Park, N.; Perkins, J. S.; Petrashyk, A.; Pohl, M.; Popkow, A.; Pueschel, E.; Quinn, J.; Ragan, K.; Ratliff, G.; Reynolds, P. T.; Richards, G. T.; Roache, E.; Santander, M.; Sembroski, G. H.; Shahinyan, K.; Staszak, D.; Telezhinsky, I.; Tucci, J. V.; Tyler, J.; Vincent, S.; Wakely, S. P.; Weiner, O. M.; Weinstein, A.; Williams, D. A.; Zitzer, B.

    2016-02-01

    The F-type star KIC 8462852 has recently been identified as an exceptional target for search for extraterrestrial intelligence (SETI) observations. We describe an analysis methodology for optical SETI, which we have used to analyze nine hours of serendipitous archival observations of KIC 8462852 made with the VERITAS gamma-ray observatory between 2009 and 2015. No evidence of pulsed optical beacons, above a pulse intensity at the Earth of approximately 1 {photon} {{{m}}}-2, is found. We also discuss the potential use of imaging atmospheric Cherenkov telescope arrays in searching for extremely short duration optical transients in general.

  10. A strategic 'viewfinder' for SETI research

    NASA Astrophysics Data System (ADS)

    Teodorani, Massimo

    2014-12-01

    One of the most important reasons why unsuccessful results have been obtained so far by the SETI Project is due to the fact that no sure targets to aim at have been available up-to the present state of research. All-sky surveys, even if very accurate and complete, might result to be time-consuming. SETI needs at least one effective 'viewfinder' in order that a true targeted research is carried out with a possible success. The best foundation to get this can be identified with the search for the evidence of extraterrestrial astro-engineering activity in form of the Dyson spheres predicted by theory. The existence of such stellar objects can be ascertained by finding the evidence of two main signatures in stars of solar spectral type: infrared excess and anomalous light curves due to transiting artificial objects. These are probably the most powerful viewfinders in order to allow SETI techniques for intelligent signal search to be aimed at more appropriate targets. This paper is not intended to be a research paper but rather a review paper whose goal is not to present calculations and/or operational research but rather to be a research proposal for a more focused research in SETI just using Dyson Spheres as crucial markers.

  11. Life: Here? There? Elsewhere? The Search for Life on Venus and Mars. Life in the Universe Series.

    ERIC Educational Resources Information Center

    1996

    This classroom kit, designed by curriculum developers working with teachers and scientists from the SETI (Search for Extraterrestrial Intelligence) Institute, helps teachers guide students in the exploration of life through the multidisciplinary sciences of paleontology and exobiology. It reflects the real-life methods of science: making…

  12. DSS 13 microprocessor antenna controller

    NASA Technical Reports Server (NTRS)

    Gosline, R. M.

    1988-01-01

    A microprocessor-based antenna monitor and control system with multiple CPUs are described. The system was developed as part of the unattended station project for DSS 13 and was enhanced for use by the SETI project. The operational features, hardware, and software designs are described, and a discussion is provided of the major problems encountered.

  13. Multiple-Feed Design For DSN/SETI Antenna

    NASA Technical Reports Server (NTRS)

    Slobin, S. D.; Bathker, D. A.

    1988-01-01

    Frequency bands changed with little interruption of operation. Modification of feedhorn mounting on existing 34-m-diameter antenna in Deep Space Network (DSN) enables antenna to be shared by Search for Extra-Terrestrial Intelligence (SET) program with minimal interruption of DSN spacecraft tracking. Modified antenna useful in terrestrial communication systems requiring frequent changes of operating frequencies.

  14. ARC-2009-ACD09-0108-048

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Photo Credit: NASA/SETI/P. Jenniskens

  15. ARC-2009-ACD09-0108-046

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Photo Credit: NASA/SETI/P. Jenniskens

  16. ARC-2009-ACD09-0108-049

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Photo Credit: NASA/SETI/P. Jenniskens

  17. ARC-2009-ACD09-0108-047

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Photo Credit: NASA/SETI/P. Jenniskens

  18. The recognition of extraterrestrial artificial signals

    NASA Technical Reports Server (NTRS)

    Seeger, C. L.

    1980-01-01

    Considerations in the design of receivers for the detection and recognition of artificial microwave signals of extraterrestrial origin are discussed. Following a review of the objectives of SETI and the probable reception and detection characteristics of extraterrestrial signals, means for the improvement of the sensitivity, signal-to-noise ratios and on-line data processing capabilities of SETI receivers are indicated. The characteristics of the signals likely to be present at the output of an ultra-low-noise microwave receiver are then examined, including the system background noise, terrestrial radiations, astrophysical radiations, accidental artificial radiations of terrestrial origin, and intentional radiations produced by humans and by extraterrestrial intelligence. The classes of extraterrestrial signals likely to be detected, beacons and leakage signals, are considered, and options in the specification of gating and thresholding for a high-spectral resolution, high-time-resolution signal discriminator are indicated. Possible tests for the nonhuman origin of a received signal are also pointed out.

  19. ARC-2009-ACD09-0108-043

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Pyramids Photo Credit: NASA/SETI/P. Jenniskens

  20. ARC-2009-ACD09-0108-005

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (find) Photo Credit: NASA/SETI/P. Jenniskens

  1. ARC-2009-ACD09-0108-002

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (search team) Photo Credit: NASA/SETI/P. Jenniskens

  2. ARC-2009-ACD09-0108-037

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Peter Jenniskens Photo Credit: NASA/SETI/P. Jenniskens

  3. ARC-2009-ACD09-0108-012

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (group photo) Photo Credit: NASA/SETI/P. Jenniskens

  4. ARC-2009-ACD09-0108-033

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Nubian House) Photo Credit: NASA/SETI/P. Jenniskens

  5. ARC-2009-ACD09-0108-019

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite #4) Photo Credit: NASA/SETI/P. Jenniskens

  6. ARC-2009-ACD09-0108-018

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite) Photo Credit: NASA/SETI/P. Jenniskens

  7. ARC-2009-ACD09-0108-008

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (first find) Photo Credit: NASA/SETI/P. Jenniskens

  8. ARC-2009-ACD09-0108-020

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Meteorite #14) Photo Credit: NASA/SETI/P. Jenniskens

  9. ARC-2009-ACD09-0108-015

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Marble Mountain) Photo Credit: NASA/SETI/P. Jenniskens

  10. SETI at the Nancay radiotelescope.

    PubMed

    Biraud, F

    1983-11-01

    The Nancay (France) radiotelescope has been used in June, 1981, to search for artificial monochromatic signals from 102 nearby stars, without success. A different approach to SETI is also considered based on the properties of wide band signals. A detection procedure, through Karhunen-Loeve analysis, is suggested.

  11. SETI in the future - Toward other possible searches

    NASA Technical Reports Server (NTRS)

    Rummel, John D.

    1992-01-01

    The future prospects of SETI as a scientific endeavor, both in its own right and with respect to the side benefits to science and society, are discussed. Specifically, the consequences of a successful detection and the prospects for follow-on studies in exobiology are addressed.

  12. ARC-2009-ACD09-0108-007

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (find # 1) Photo Credit: NASA/SETI/P. Jenniskens

  13. ARC-2009-ACD09-0108-034

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (perified wood) Photo Credit: NASA/SETI/P. Jenniskens

  14. Anthropological Contributions to the Search for Extraterrestrial Intelligence

    NASA Astrophysics Data System (ADS)

    Vakoch, D. A.

    2009-12-01

    Three recent annual conferences of the American Anthropological Association (AAA) have included symposia on the Search for Extraterrestrial Intelligence (SETI). This paper reviews these symposia, which dealt with themes associated with the overarching AAA conference themes for each year: in 2004, the SETI session addressed Anthropology, Archaeology, and Interstellar Communication: Science and the Knowledge of Distant Worlds; in 2005, it dealt with Historical Perspectives on Anthropology and SETI; and in 2006, the session examined Culture, Anthropology, and SETI. Among the topics considered in these symposia were analogues for contact with extraterrestrial intelligence (ETI), examining anthropologists’ experience in the field encountering other cultures-past and present. Similarly, the methodologies of archaeologists provide analogies for making contact with temporally distant civilizations, based on reconstructions from fragmentary information. Case studies helped make such analogies concrete in the symposia. The challenges of comprehending intelligences with different mental worlds was explored through a study of the meetings of Neanderthals and Homo sapiens, for example, while the decryption of Mayan hieroglyphics provided lessons on understanding others of own species.

  15. The Search for Extraterrestrial Intelligence in the 1960s: Science in Popular Culture

    NASA Astrophysics Data System (ADS)

    Smith, Sierra

    2012-01-01

    Building upon the advancement of technology during the Second World War and the important scientific discoveries which have been made about the structure and components of the universe, scientists, especially in radio astronomy and physics, began seriously addressing the possibility of extraterrestrial intelligence in the 1960s. The Search for Extraterrestrial Intelligence (SETI) quickly became one of the most controversial scientific issues in the post Second World War period. The controversy played out, not only in scientific and technical journals, but in newspapers and in popular literature. Proponents for SETI, including Frank Drake, Carl Sagan, and Philip Morrison, actively used a strategy of engagement with the public by using popular media to lobby for exposure and funding. This paper will examine the use of popular media by scientists interested in SETI to popularize and heighten public awareness and also to examine the effects of popularization on SETI's early development. My research has been generously supported by the National Radio Astronomy Observatory.

  16. Life in the Universe - Astronomy and Planetary Science Research Experience for Undergraduates at the SETI Institute

    NASA Astrophysics Data System (ADS)

    Chiar, J.; Phillips, C. B.; Rudolph, A.; Bonaccorsi, R.; Tarter, J.; Harp, G.; Caldwell, D. A.; DeVore, E. K.

    2016-12-01

    The SETI Institute hosts an Astrobiology Research Experience for Undergraduates (REU) program. Beginning in 2013, we partnered with the Physics and Astronomy Dept. at Cal Poly Pomona, a Hispanic-serving university, to recruit underserved students. Over 11 years, we have served 155 students. We focus on Astrobiology since the Institute's mission is to explore, understand and explain the origin, nature and prevalence of life in the universe. Our REU students work with mentors at the Institute - a non-profit organization located in California's Silicon Valley-and at the nearby NASA Ames Research Center. Projects span research on survival of microbes under extreme conditions, planetary geology, astronomy, the Search for Extraterrestrial Intelligence (SETI), extrasolar planets and more. The REU program begins with an introductory lectures by Institute scientists covering the diverse astrobiology subfields. A week-long field trip to the SETI Institute's Allen Telescope Array (Hat Creek Radio Astronomy Observatory in Northern California) and field experiences at hydrothermal systems at nearby Lassen Volcanic National Park immerses students in radio astronomy and SETI, and extremophile environments that are research sites for astrobiologists. Field trips expose students to diverse environments and allow them to investigate planetary analogs as our scientists do. Students also participate in local trips to the California Academy of Sciences and other nearby locations of scientific interest, and attend the weekly scientific colloquium hosted by the SETI Institute at Microsoft, other seminars and lectures at SETI Institute and NASA Ames. The students meet and present at a weekly journal club where they hone their presentation skills, as well as share their research progress. At the end of the summer, the REU interns present their research projects at a session of the Institute's colloquium. As a final project, students prepare a 2-page formal abstract and 15-minute presentation that mirrors the requirements for professional conference presentations. In collaboration with the mentors, successful projects are selected and funded for submission to national scientific conferences during the subsequent academic year. This program is funded by the NSF AST Grant # 1359346.

  17. A real-time KLT implementation for radio-SETI applications

    NASA Astrophysics Data System (ADS)

    Melis, Andrea; Concu, Raimondo; Pari, Pierpaolo; Maccone, Claudio; Montebugnoli, Stelio; Possenti, Andrea; Valente, Giuseppe; Antonietti, Nicoló; Perrodin, Delphine; Migoni, Carlo; Murgia, Matteo; Trois, Alessio; Barbaro, Massimo; Bocchinu, Alessandro; Casu, Silvia; Lunesu, Maria Ilaria; Monari, Jader; Navarrini, Alessandro; Pisanu, Tonino; Schilliró, Francesco; Vacca, Valentina

    2016-07-01

    SETI, the Search for ExtraTerrestrial Intelligence, is the search for radio signals emitted by alien civilizations living in the Galaxy. Narrow-band FFT-based approaches have been preferred in SETI, since their computation time only grows like N*lnN, where N is the number of time samples. On the contrary, a wide-band approach based on the Kahrunen-Lo`eve Transform (KLT) algorithm would be preferable, but it would scale like N*N. In this paper, we describe a hardware-software infrastructure based on FPGA boards and GPU-based PCs that circumvents this computation-time problem allowing for a real-time KLT.

  18. Field test results with the targeted search MCSA. [multi-channel spectrum analyzer for SETI

    NASA Technical Reports Server (NTRS)

    Tarter, J. C.

    1988-01-01

    In April 1985, a 74,000 channel prototype of the multichannel spectrum analyzer (MCSA) that NASA plans to use in a systematic search for extraterrestrial intelligence (SETI) was installed at DSS13, a 26 meter R&D antenna facility at the Goldstone Deep Space Network (DSN) site. Since that time the instrumentation has been used to validate the performance of signal detection algorithms using locally injected signals and the weak carriers from distant spacecraft. This paper describes results from the Goldstone Field Tests and plans to move the prototype equipment to other sites where SETI may be conducted in the future.

  19. ETI, SETI and today's public opinion

    NASA Astrophysics Data System (ADS)

    Pinotti, Roberto

    During the last three decades the general public's initial opinions about ETI and SETI changed, turning ignorance, fear and superficiality into a gradual understanding of the importance of these concepts. After a brief analysis of this changing psycho-sociological attitude, the paper provides an "estimate of the situation" about general interest for ETI and SETI, suggesting a growing awareness in today's public opinion. Science fiction movies like Close Encounters of the Third Kind and E.T. the Extra-Terrestrial and popular interest in UFOs as visitors from outer space played a major role in the average man's acceptance of the reality of extra-terrestrial life and its meaning for mankind.

  20. ARC-2009-ACD09-0108-017

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite-brick-reenactment) Photo Credit: NASA/SETI/P. Jenniskens

  1. ARC-2009-ACD09-0108-016

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Mauwia checks on find) Photo Credit: NASA/SETI/P. Jenniskens

  2. ARC-2009-ACD09-0108-023

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite 3rd-bigone) Photo Credit: NASA/SETI/P. Jenniskens

  3. ARC-2009-ACD09-0108-004

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (El-Mahata-Sitah 1) Photo Credit: NASA/SETI/P. Jenniskens

  4. ARC-2009-ACD09-0108-040

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Peter Jenniskens meteorite. Photo Credit: NASA/SETI/P. Jenniskens

  5. ARC-2009-ACD09-0108-006

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (find #11 & 12) Photo Credit: NASA/SETI/P. Jenniskens

  6. ARC-2009-ACD09-0108-010

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (first one recovered) Photo Credit: NASA/SETI/P. Jenniskens

  7. ARC-2009-ACD09-0108-045

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. searching in the desert Photo Credit: NASA/SETI/P. Jenniskens

  8. ARC-2009-ACD09-0108-013

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (line 3rd day) Photo Credit: NASA/SETI/P. Jenniskens

  9. ARC-2009-ACD09-0108-021

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite 3rd) Photo Credit: NASA/SETI/P. Jenniskens

  10. ARC-2009-ACD09-0108-014

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Lunch at Marble Mountain) Photo Credit: NASA/SETI/P. Jenniskens

  11. ARC-2009-ACD09-0108-003

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Dr Mauwia Shaddad) Photo Credit: NASA/SETI/P. Jenniskens

  12. ARC-2009-ACD09-0108-031

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Meteorite search 1) Photo Credit: NASA/SETI/P. Jenniskens

  13. ARC-2009-ACD09-0108-024

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite 3rd-geologist) Photo Credit: NASA/SETI/P. Jenniskens

  14. ARC-2009-ACD09-0108-022

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite 3rd-22) Photo Credit: NASA/SETI/P. Jenniskens

  15. ARC-2009-ACD09-0108-009

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (first one found) Photo Credit: NASA/SETI/P. Jenniskens

  16. ARC-2009-ACD09-0108-001

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (approch station 6) Photo Credit: NASA/SETI/P. Jenniskens

  17. Visions of human futures in space and SETI

    NASA Astrophysics Data System (ADS)

    Wright, Jason T.; Oman-Reagan, Michael P.

    2018-04-01

    We discuss how visions for the futures of humanity in space and SETI are intertwined, and are shaped by prior work in the fields and by science fiction. This appears in the language used in the fields, and in the sometimes implicit assumptions made in discussions of them. We give examples from articulations of the so-called Fermi Paradox, discussions of the settlement of the Solar System (in the near future) and the Galaxy (in the far future), and METI. We argue that science fiction, especially the campy variety, is a significant contributor to the `giggle factor' that hinders serious discussion and funding for SETI and Solar System settlement projects. We argue that humanity's long-term future in space will be shaped by our short-term visions for who goes there and how. Because of the way they entered the fields, we recommend avoiding the term `colony' and its cognates when discussing the settlement of space, as well as other terms with similar pedigrees. We offer examples of science fiction and other writing that broaden and challenge our visions of human futures in space and SETI. In an appendix, we use an analogy with the well-funded and relatively uncontroversial searches for the dark matter particle to argue that SETI's lack of funding in the national science portfolio is primarily a problem of perception, not inherent merit.

  18. ARC-2009-ACD09-0108-039

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Peter Jenniskens pointing - finds the brick) Photo Credit: NASA/SETI/P. Jenniskens

  19. ARC-2009-ACD09-0108-038

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Peter Jenniskens finds the brick. Photo Credit: NASA/SETI/P. Jenniskens

  20. ARC-2009-ACD09-0108-011

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Girls dormatory at station 6) Photo Credit: NASA/SETI/P. Jenniskens

  1. ARC-2009-ACD09-0108-028

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. 9meteorite 3rd trip-strange) Photo Credit: NASA/SETI/P. Jenniskens

  2. ARC-2009-ACD09-0108-025

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Meteorite 3rd-several at once) Photo Credit: NASA/SETI/P. Jenniskens

  3. ARC-2009-ACD09-0108-027

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite 3rd trip-Insitu.) Photo Credit: NASA/SETI/P. Jenniskens

  4. Efficient computational methods to study new and innovative signal detection techniques in SETI

    NASA Technical Reports Server (NTRS)

    Deans, Stanley R.

    1991-01-01

    The purpose of the research reported here is to provide a rapid computational method for computing various statistical parameters associated with overlapped Hann spectra. These results are important for the Targeted Search part of the Search for ExtraTerrestrial Intelligence (SETI) Microwave Observing Project.

  5. ARC-2009-ACD09-0108-036

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Peter Jenniskens finds meteorites 1) Photo Credit: NASA/SETI/P. Jenniskens

  6. ARC-2009-ACD09-0108-035

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Peter Jenniskens examines 2nd trip finds) Photo Credit: NASA/SETI/P. Jenniskens

  7. ARC-2009-ACD09-0108-026

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (emteorite 3rd-three found) Photo Credit: NASA/SETI/P. Jenniskens

  8. An assessment of the impact of radio frequency interference on microwave SETI searches

    NASA Technical Reports Server (NTRS)

    Klein, M. J.; Gulkis, S.; Olsen, E. T.; Armstrong, E. F.; Jackson, E. B.

    1987-01-01

    The problem posed for SETI by radio frequency interference (RFI) is briefly discussed. The degree to which various frequencies are subject to RFI is indicated, and predictions about the future of such interference are made. Suggestions for coping with the problem are given.

  9. Risk and value analysis of SETI

    NASA Technical Reports Server (NTRS)

    Billingham, J.

    1986-01-01

    The risks, values, and costs of the SETI project are evaluated and compared with those of the Viking project. Examination of the scientific values, side benefits, and costs of the two projects reveal that both projects provide equal benefits at equal costs. The probability of scientific and technical success is analyzed.

  10. ARC-2009-ACD09-0108-030

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite find 3rd trip 1) Photo Credit: NASA/SETI/P. Jenniskens

  11. ARC-2009-ACD09-0108-029

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite find - bus gets stuck) Photo Credit: NASA/SETI/P. Jenniskens

  12. A New Approach Towards Deployment of Far Side Lunar SETI Using a Tethered Link to a Near Side Antenna

    NASA Astrophysics Data System (ADS)

    Datta, L. V.; Guven, U.; Goel, E.

    2017-10-01

    Keeping in pace with the recent growth in interest in deployable space telescopes for detection of extra-solar objects, we suggest a feasible approach to make a lunar far side SETI mission a reality with the technology. available today.

  13. Searching for extraterrestrial intelligence - The ultimate exploration

    NASA Technical Reports Server (NTRS)

    Black, D.; Tarter, J.; Cuzzi, J. N.; Conners, M.; Clark, T. A.

    1977-01-01

    A survey highlighting the central issues of the SETI program (Search for Extraterrestrial Intelligence), including its rationale, scope, search problems, and goals is presented. Electromagnetic radiation is suggested as the most likely means via which knowledge of extraterrestrial intelligence will be obtained, and the variables governing these signals are discussed, including: signal frequency and polarization, state, possible coordinates, and signal duration. The modern history of SETI and NASA's involvement is briefly reviewed, and the search strategies used by the Jet Propulsion Laboratory and the Ames Research Center are discussed and compared. Some of the potential scientific and cultural impacts of the SETI program are mentioned, noting advancements in technological, biological, and chemical research.

  14. The search for extra-terrestrial intelligence.

    PubMed

    Drake, Frank

    2011-02-13

    Modern history of the search for extra-terrestrial intelligence is reviewed. The history of radio searches is discussed, as well as the major advances that have occurred in radio searches and prospects for new instruments and search strategies. Recent recognition that searches for optical and infrared signals make sense, and the reasons for this are described, as well as the equipment and special detection methods used in optical searches. The long-range future of the search for extra-terrestrial intelligence (SETI) is discussed in the context of the history of rapid change, on the cosmic and even the human time scale, of the paradigms guiding SETI searches. This suggests that SETI searches be conducted with a very open mind.

  15. The West Virginia Special Education Technology Integration Specialist (SETIS) Program: 2012-2014 Evaluation Report

    ERIC Educational Resources Information Center

    Stohr, Amber D.

    2015-01-01

    The Special Education Technology Integration Specialist (SETIS) program provides professional development for special education teachers to assist them in achieving proficiency with 21st Century Technology Tools. The program completed its eighth and ninth rounds during the 2012-2013 and 2013-2014 school years, training more than 30 special…

  16. On Predictability of System Anomalies in Real World

    DTIC Science & Technology

    2011-08-01

    distributed system SETI @home [44]. Different from the above work, this work focuses on quantifying the predictability of real-world system anomalies. V...J.-M. Vincent, and D. Anderson, “Mining for statistical models of availability in large-scale distributed systems: An empirical study of seti @home,” in Proc. of MASCOTS, sept. 2009.

  17. ARC-2009-ACD09-0108-032

    NASA Image and Video Library

    2009-02-08

    An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (image used as cover for March 26, 2009 journal Nature) Photo Credit: NASA/SETI/P. Jenniskens

  18. SETI Observations of Low Mass Stars at the SETI Institute

    NASA Astrophysics Data System (ADS)

    Harp, Gerald R.

    2017-05-01

    Are planets orbiting low-mass stars suitable for the development of life? Observations in the near future, including radio, will help to assess whether atmospheres do persist over long timescales for planets orbiting nearby M dwarfs, and clarify the nature of the radiation that penetrates to the surface of these planets. These are important ingredients for assessing planetary habitability, yet the question of habitability can be answered only with the positive measurement of an unambiguous biosignature. Radio and optical SETI observations capable of detecting technological activities of intelligent inhabitants could provide the most compelling evidence for the habitability of exoplanets orbiting M dwarfs. In this presentation we shall consider what information can be gleaned from our observations so far. The SETI Institute is currently undertaking a large survey of 20,000 low mass stars that is now about 30% complete. The frequency coverage on each star is about 450 MHz bandwidth (per star) over a range of selected frequencies from 1-10 GHz. From these observations we derive quantitative results relating to the probability that M dwarfs are actually inhabited.

  19. Octopamine mediated relaxation of maintained and catch tension in locust skeletal muscle.

    PubMed

    Evans, P D; Siegler, M V

    1982-03-01

    1. The modulatory actions of an identified octopaminergic neurone (DUMETi) that projects to the extensor-tibiae muscle of the locust hind leg depend upon the frequency of stimulation of the slow motoneurone (SETi) to this muscle. 2. At low frequencies of SETi stimulation (1Hz and below) the predominant modulatory effects are increases in the amplitude and relaxation rate of twitch tension. At higher frequencies, where twitches summate but tetanus is incomplete (up to 20 Hz), the reduction of maintained tension becomes considerably more important. 3. Both octopamine application and DUMETi stimulation reduce the amount of catch tension displayed by the extensor muscle when SETi is fired in a variety of different stimulus patterns. The extensor-tibiae muscle is itself 'pattern sensitive' since is shows a 'positive spacing effect' when SETi is stimulated at an average frequency of 1 Hz. 4. It is suggested that a primary function of DUMETi is to change the response of the muscle from one that favours maintenance of posture to one that favours rapid changes in joint position or force, such as might occur during locomotion.

  20. Octopamine mediated relaxation of maintained and catch tension in locust skeletal muscle.

    PubMed Central

    Evans, P D; Siegler, M V

    1982-01-01

    1. The modulatory actions of an identified octopaminergic neurone (DUMETi) that projects to the extensor-tibiae muscle of the locust hind leg depend upon the frequency of stimulation of the slow motoneurone (SETi) to this muscle. 2. At low frequencies of SETi stimulation (1Hz and below) the predominant modulatory effects are increases in the amplitude and relaxation rate of twitch tension. At higher frequencies, where twitches summate but tetanus is incomplete (up to 20 Hz), the reduction of maintained tension becomes considerably more important. 3. Both octopamine application and DUMETi stimulation reduce the amount of catch tension displayed by the extensor muscle when SETi is fired in a variety of different stimulus patterns. The extensor-tibiae muscle is itself 'pattern sensitive' since is shows a 'positive spacing effect' when SETi is stimulated at an average frequency of 1 Hz. 4. It is suggested that a primary function of DUMETi is to change the response of the muscle from one that favours maintenance of posture to one that favours rapid changes in joint position or force, such as might occur during locomotion. PMID:6808122

  1. The NASA SETI program

    NASA Technical Reports Server (NTRS)

    Billingham, J.; Brocker, D. H.

    1991-01-01

    In 1959, it was proposed that a sensible way to conduct interstellar communication would be to use radio at or near the frequency of hydrogen. In 1960, the first Search for Extraterrestrial Intelligence (SETI) was conducted using a radiotelescope at Green Bank in West Virginia. Since 1970, NASA has systematically developed a definitive program to conduct a sophisticated search for evidence of extraterrestrial intelligent life. The basic hypothesis is that life may be widespread in the univers, and that in many instances extraterrestrial life may have evolved into technological civilizations. The underlying scientific arguments are based on the continuously improving knowledge of astronomy and astrophysics, especially star system formation, and of planetary science, chemical evolution, and biological evolution. If only one in a million sun-like stars in our galaxy harbors species with cognitive intelligence, then there are 100,000 civilizations in the Milky Way alone. The fields of radioastronomy digital electronic engineering, spectrum analysis, and signal detection have advanced rapidly in the last twenty years and now allow for sophisticated systems to be built in order to attempt the detection of extraterrestrial intelligence signals. In concert with the scientific and engineering communities, NASA has developed, over the last several years, a Microwave Observing Project whose goal is to design, build, and operate SETI systems during the decade of the nineties in pursuit of the goal signal detection. The Microwave Observing Project is now approved and underway. There are two major components in the project: the Target Search Element and the Sky Survey Element.

  2. Radio frequency interference at Jodrell Bank Observatory within the protected 21 cm band

    NASA Technical Reports Server (NTRS)

    Tarter, J.

    1989-01-01

    Radio frequency interference (RFI) will provide one of the most difficult challenges to systematic Searches for Extraterrestrial Intelligence (SETI) at microwave frequencies. The SETI-specific equipment is being optimized for the detection of signals generated by a technology rather than those generated by natural processes in the universe. If this equipment performs as expected, then it will inevitably detect many signals originating from terrestrial technology. If these terrestrial signals are too numerous and/or strong, the equipment will effectively be blinded to the (presumably) weaker extraterrestrial signals being sought. It is very difficult to assess how much of a problem RFI will actually represent to future observations, without employing the equipment and beginning the search. In 1983 a very high resolution spectrometer was placed at the Nuffield Radio Astronomy Laboratories at Jodrell Bank, England. This equipment permitted an investigation of the interference environment at Jodrell Bank, at that epoch, and at frequencies within the 21 cm band. This band was chosen because it has long been "protected" by international agreement; no transmitters should have been operating at those frequencies. The data collected at Jodrell Bank were expected to serve as a "best case" interference scenario and provide the minimum design requirements for SETI equipment that must function in the real and noisy environment. This paper describes the data collection and analysis along with some preliminary conclusions concerning the nature of the interference environment at Jodrell Bank.

  3. Radio frequency interference at Jodrell Bank Observatory within the protected 21 cm band.

    PubMed

    Tarter, J

    1989-01-01

    Radio frequency interference (RFI) will provide one of the most difficult challenges to systematic Searches for Extraterrestrial Intelligence (SETI) at microwave frequencies. The SETI-specific equipment is being optimized for the detection of signals generated by a technology rather than those generated by natural processes in the universe. If this equipment performs as expected, then it will inevitably detect many signals originating from terrestrial technology. If these terrestrial signals are too numerous and/or strong, the equipment will effectively be blinded to the (presumably) weaker extraterrestrial signals being sought. It is very difficult to assess how much of a problem RFI will actually represent to future observations, without employing the equipment and beginning the search. In 1983 a very high resolution spectrometer was placed at the Nuffield Radio Astronomy Laboratories at Jodrell Bank, England. This equipment permitted an investigation of the interference environment at Jodrell Bank, at that epoch, and at frequencies within the 21 cm band. This band was chosen because it has long been "protected" by international agreement; no transmitters should have been operating at those frequencies. The data collected at Jodrell Bank were expected to serve as a "best case" interference scenario and provide the minimum design requirements for SETI equipment that must function in the real and noisy environment. This paper describes the data collection and analysis along with some preliminary conclusions concerning the nature of the interference environment at Jodrell Bank.

  4. High resolution SETI: Experiences and prospects

    NASA Astrophysics Data System (ADS)

    Horowitz, Paul; Clubok, Ken

    Megachannel spectroscopy with sub-Hertz resolution constitutes an attractive strategy for a microwave search for extraterrestrial intelligence (SETI), assuming the transmission of a narrowband radiofrequency beacon. Such resolution matches the properties of the interstellar medium, and the necessary Doppler corrections provide a high degree of interference rejection. We have constructed a frequency-agile receiver with an FFT-based 8 megachannel digital spectrum analyzer, on-line signal recognition, and multithreshold archiving. We are using it to conduct a meridian transit search of the northern sky at the Harvard-Smithsonian 26-m antenna, with a second identical system scheduled to begin observations in Argentina this month. Successive 400 kHz spectra, at 0.05 Hz resolution, are searched for features characteristic of an intentional narrowband beacon transmission. These spectra are centered on guessable frequencies (such as λ21 cm), referenced successively to the local standard of rest, the galactic barycenter, and the cosmic blackbody rest frame. This search has rejected interference admirably, but is greatly limited both in total frequency coverage and sensitivity to signals other than carriers. We summarize five years of high resolution SETI at Harvard, in the context of answering the questions "How useful is narrowband SETI, how serious are its limitations, what can be done to circumvent them, and in what direction should SETI evolve?" Increasingly powerful signal processing hardware, combined with ever-higher memory densities, are particularly relevant, permitting the construction of compact and affordable gigachannel spectrum analyzers covering hundreds of megahertz of instantaneous bandwidth.

  5. An Opportunistic Search for Extraterrestrial Intelligence (SETI) with the Murchison Widefield Array

    NASA Astrophysics Data System (ADS)

    Tingay, S. J.; Tremblay, C.; Walsh, A.; Urquhart, R.

    2016-08-01

    A spectral line image cube generated from 115 minutes of MWA data that covers a field of view of 400 sq, deg. around the Galactic Center is used to perform the first Search for ExtraTerrestrial Intelligence (SETI) with the Murchison Widefield Array (MWA). Our work constitutes the first modern SETI experiment at low radio frequencies, here between 103 and 133 MHz, paving the way for large-scale searches with the MWA and, in the future, the low-frequency Square Kilometre Array. Limits of a few hundred mJy beam-1 for narrowband emission (10 kHz) are derived from our data, across our 400 sq. deg. field of view. Within this field, 45 exoplanets in 38 planetary systems are known. We extract spectra at the locations of these systems from our image cube to place limits on the presence of narrow line emission from these systems. We then derive minimum isotropic transmitter powers for these exoplanets; a small handful of the closest objects (10 s of pc) yield our best limits of order 1014 W (Equivalent Isotropic Radiated Power). These limits lie above the highest power directional transmitters near these frequencies currently operational on Earth. A SETI experiment with the MWA covering the full accessible sky and its full frequency range would require approximately one month of observing time. The MWA frequency range, its southern hemisphere location on an extraordinarily radio quiet site, its very large field of view, and its high sensitivity make it a unique facility for SETI.

  6. Intrinsic rhythm and basic tonus in insect skeletal muscle.

    PubMed

    Hoyle, G

    1978-04-01

    The jumping muscle of orthopterous insects contains fibres that possess an intrinsic rhythm (IR) of slow contraction. The contributing fibres are generally synchronized, but as many as three or four pacemakers are present. The frequency, amplitude and duration of IR contractions fluctuate erratically over a 24 h period. Metathoracic DUM neurone bursts suppress IR for a few minutes. Other, unidentified dorsal neurones enhance its amplitude. In addition to IR, the extensor tibiae shows intrinsic basic tonus (BT). BT is relaxed for several s by low-frequency burst output from unidentified metathoracic dorsal neurones. DUM neurone bursts may enhance extensor BT, relax it, or leave it unaffected. The effects on IR of various regimes of activity in the slow extensor tibiae (SETi) and the common inhibitor (CI) axons were examined. CI affects IR when stimulated at frequencies above 2 Hz. It causes amplitude depression and reduced duration of individual IR contractions as well as increased frequency. At 30 Hz and above, CI completely suppresses IR. An enhanced IR contraction starts within a few milliseconds of the termination of a CI train. At low frequencies (below 10 Hz) SETi causes increased frequency and decreased amplitude of IR, with a depressed IR contraction following cessation of the SETi burst. At frequencies above 15 Hz the SETi-evoked contraction dominates tension development, though IR summates with it during the rising phase. In quiescent preparations not showing IR, SETi stimulation at 10 Hz often started up IR. Single SETi or FETi impulses can initiate an IR contraction, and cause altered phasing, with up to a quintupling of frequency. After a critical period has elapsed following the onset of an IR contraction, a single single impulse in any one of the three axons will terminate it abruptly. The early termination is followed by a reduced interval which is proportional to the reduced IR contraction time. The rhythm of accumulated readiness to go into an IR contraction is independent of the pacemaker rhythm that initiates the contraction.

  7. Some perspectives on research into the biological response to non-ionizing electromagnetic radiation. [relation to SETI, SPS, and other government projects

    NASA Technical Reports Server (NTRS)

    Sharp, J. C.

    1979-01-01

    Research on the biological effects of RF radiation in the United States has undergone a series of swings during the last three decades. The resurgence of research during the past decade is examined in the light of two projects: the proposed Space Power Station and SETI.

  8. SETI group let by Barney Oliver, John Wolfe and John Billingham (in middle standing) lead a 1976

    NASA Technical Reports Server (NTRS)

    1976-01-01

    SETI group let by Barney Oliver, John Wolfe and John Billingham (in middle standing) lead a 1976 discussion on the best strategies in the Search for Extraterrestrial Intelligence. Joining the discussion are L-R; Charles Seeger, Dario Black, Mary Connors, (Oliver, Wolfe, Billingham) and Larry Lesyna, (seated) Mark Stull.

  9. Millions and Billions of Channels

    NASA Astrophysics Data System (ADS)

    Leigh, Darren; Horowitz, Paul

    The history of the Harvard SETI group is inextricably linked with the history of Paul Horowitz. Horowitz became enamored with SETI as a student at Harvard, reading Ed Purcell's paper "Radio Astronomy and Communication Through Space" (Purcell, 1960), discussing with his roommates a class that Carl Sagan was teaching there using a draft of Shklovskii and Sagan's "Intelligent Life in the Universe" (Shklovskii and Sagan, 1966) as a text, and finally attending a Loeb Lecture series at Harvard by Frank Drake (Drake, 1969). The series was officially about pulsars but Drake did manage to slip in one inspiring talk about SETI. Horowitz says that "It was this lecture that launched me into this field; it was a revelation that you could go beyond idle speculation - you could actually calculate stuff."

  10. OAST Space Theme Workshop. Volume 2: Theme summary. 3: Search for extraterrestrial intelligence (no. 9). A: Theme statement. B. 26 April 1976 presentation. C. Summary. D. Newer initiatives (form 4). E. Initiative actions (form 5)

    NASA Technical Reports Server (NTRS)

    1976-01-01

    Preliminary (1977-1983), intermediate (1982-1988), and long term (1989+) phases of the search for extraterrestrial intelligence (SETI) program are examined as well as the benefits to be derived in radioastronomy and the problems to be surmounted in radio frequency interference. The priorities, intrinsic value, criteria, and strategy for the search are discussed for both terrestrial and lunar-based CYCLOPS and for a space SETI system located at lunar liberation point L4. New initiatives related to antenna independent technology, multichannel analyzers, and radio frequency interference shielding are listed. Projected SETI program costs are included.

  11. Analysis of a crossed Bragg-cell acousto optical spectrometer for SETI

    NASA Technical Reports Server (NTRS)

    Gulkis, S.

    1986-01-01

    The search for radio signals from extraterrestrial intelligent (SETI) beings requires the use of large instantaneous bandwidth (500 MHz) and high resolution (20 Hz) spectrometers. Digital systems with a high degree of modularity can be used to provide this capability, and this method has been widely discussed. Another technique for meeting the SETI requirement is to use a crossed Bragg-cell spectrometer as described by Psaltis and Casasent (1979). This technique makes use of the Folded Spectrum concept, introduced by Thomas (1966). The Folded Spectrum is a two-dimensional Fourier Transform of a raster scanned one-dimensional signal. It is directly related to the long one-dimensional spectrum of the original signal and is ideally suited for optical signal processing.

  12. Analysis of a crossed Bragg-cell acousto optical spectrometer for SETI

    NASA Astrophysics Data System (ADS)

    Gulkis, S.

    1986-10-01

    The search for radio signals from extraterrestrial intelligent (SETI) beings requires the use of large instantaneous bandwidth (500 MHz) and high resolution (20 Hz) spectrometers. Digital systems with a high degree of modularity can be used to provide this capability, and this method has been widely discussed. Another technique for meeting the SETI requirement is to use a crossed Bragg-cell spectrometer as described by Psaltis and Casasent (1979). This technique makes use of the Folded Spectrum concept, introduced by Thomas (1966). The Folded Spectrum is a two-dimensional Fourier Transform of a raster scanned one-dimensional signal. It is directly related to the long one-dimensional spectrum of the original signal and is ideally suited for optical signal processing.

  13. Overview of the NASA SETI Program

    NASA Technical Reports Server (NTRS)

    Oliver, B. M.

    1986-01-01

    The NASA Search of Extraterrestrial Intelligence (SETI) program plan is to scan the microwave window from 1 to 10 GHz with existing radio telescopes and sophisticated signal processing equipment looking for narrow band features that might represent artificial signals. A microwave spectrometer was built and is being field tested. A pattern recognition computer to search for drifting continuous wave signals and pulse trains in the output spectra is being designed. Equipment to characterize the radio frequency interference environment was also built. The plan is to complete the hardware and software by FY-88. Then, with increased funding, this equipment will be replicated in Very Large Scale Integration form. Observations, both a complete sky survey and a search fo nearby solar type stars, will begin in about 1990. The hypothesis that very powerful signals exist or that signals are being beamed at us will be tested. To detect the kinds of signals radiated at distances of 100 light years will require a collecting area kilometers in diameter.

  14. The Search for Life in the Universe: The Past Through the Future

    NASA Astrophysics Data System (ADS)

    Lebofsky, L. A.; Lebofsky, A.; Lebofsky, M.; Lebofsky, N. R.

    2003-05-01

    ``Are we alone?'' This is a question that has been asked by humans for thousands of years. More than any other topic in science, the search for life in the Universe has captured the imagination. Now, for the first time in history, we are on the verge of answering this question. The search for life beyond the Earth can be seen as far back as the 17th century writings of Bishops F. Godwin and J. Wilkins and S. Cyrano de Bergerac to the early 20th century's H. G. Wells. From a scientific perspective, this search led to the formulation of the Drake Equation which in turn has led to a number of projects that are searching for signs of intelligent life beyond the Earth, the Search for Extraterrestrial Intelligence. SETI@home reaches millions of users, including thousands of K-12 teachers across the nation. We are developing a project that will enhance the SETI@home web site located at UC Berkeley. The project unites the resources of the SETI@home distributed computing community web site, university settings, and informal science learning centers. It will reach approximately 100,000 learners. The goal is to increase public understanding of math and science and to create and strengthen the connections between informal and formal learning communities. We will present a variety of ways that the Drake Equation and SETI@home can enhance the public and student understanding of the search for life in the Universe, from its roots in literature, to the development (and evolution) of the Drake Equation, to the actual search for life with SETI.

  15. The Ĝ infrared search for extraterrestrial civilizations with large energy supplies. I. Background and justification

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Wright, J. T.; Mullan, B.; Sigurdsson, S.

    We motivate the Ĝ infrared search for extraterrestrial civilizations with large energy supplies. We discuss some philosophical difficulties of the search for extraterrestrial intelligence (SETI), and how communication SETI circumvents them. We review 'Dysonian SETI', the search for artifacts of alien civilizations, and find that it is highly complementary to traditional communication SETI; the two together might succeed where either one alone has not. We discuss the argument of Hart that spacefaring life in the Milky Way should be either galaxy-spanning or non-existent, and examine a portion of his argument that we call the 'monocultural fallacy'. We discuss some rebuttalsmore » to Hart that invoke sustainability and predict long Galaxy colonization timescales. We find that the maximum Galaxy colonization timescale is actually much shorter than previous work has found (<10{sup 9} yr), and that many 'sustainability' counter-arguments to Hart's thesis suffer from the monocultural fallacy. We extend Hart's argument to alien energy supplies and argue that detectably large energy supplies can plausibly be expected to exist because life has the potential for exponential growth until checked by resources or other limitations, and intelligence implies the ability to overcome such limitations. As such, if Hart's thesis is correct, then searches for large alien civilizations in other galaxies may be fruitful; if it is incorrect, then searches for civilizations within the Milky Way are more likely to succeed than Hart argued. We review some past Dysonian SETI efforts and discuss the promise of new mid-infrared surveys, such as that of WISE.« less

  16. AN OPPORTUNISTIC SEARCH FOR EXTRATERRESTRIAL INTELLIGENCE (SETI) WITH THE MURCHISON WIDEFIELD ARRAY

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Tingay, S. J.; Tremblay, C.; Walsh, A.

    A spectral line image cube generated from 115 minutes of MWA data that covers a field of view of 400 sq, deg. around the Galactic Center is used to perform the first Search for ExtraTerrestrial Intelligence (SETI) with the Murchison Widefield Array (MWA). Our work constitutes the first modern SETI experiment at low radio frequencies, here between 103 and 133 MHz, paving the way for large-scale searches with the MWA and, in the future, the low-frequency Square Kilometre Array. Limits of a few hundred mJy beam{sup −1} for narrowband emission (10 kHz) are derived from our data, across our 400more » sq. deg. field of view. Within this field, 45 exoplanets in 38 planetary systems are known. We extract spectra at the locations of these systems from our image cube to place limits on the presence of narrow line emission from these systems. We then derive minimum isotropic transmitter powers for these exoplanets; a small handful of the closest objects (10 s of pc) yield our best limits of order 10{sup 14} W (Equivalent Isotropic Radiated Power). These limits lie above the highest power directional transmitters near these frequencies currently operational on Earth. A SETI experiment with the MWA covering the full accessible sky and its full frequency range would require approximately one month of observing time. The MWA frequency range, its southern hemisphere location on an extraordinarily radio quiet site, its very large field of view, and its high sensitivity make it a unique facility for SETI.« less

  17. The Ĝ Infrared Search for Extraterrestrial Civilizations with Large Energy Supplies. I. Background and Justification

    NASA Astrophysics Data System (ADS)

    Wright, J. T.; Mullan, B.; Sigurdsson, S.; Povich, M. S.

    2014-09-01

    We motivate the Ĝ infrared search for extraterrestrial civilizations with large energy supplies. We discuss some philosophical difficulties of the search for extraterrestrial intelligence (SETI), and how communication SETI circumvents them. We review "Dysonian SETI," the search for artifacts of alien civilizations, and find that it is highly complementary to traditional communication SETI; the two together might succeed where either one alone has not. We discuss the argument of Hart that spacefaring life in the Milky Way should be either galaxy-spanning or non-existent, and examine a portion of his argument that we call the "monocultural fallacy." We discuss some rebuttals to Hart that invoke sustainability and predict long Galaxy colonization timescales. We find that the maximum Galaxy colonization timescale is actually much shorter than previous work has found (<109 yr), and that many "sustainability" counter-arguments to Hart's thesis suffer from the monocultural fallacy. We extend Hart's argument to alien energy supplies and argue that detectably large energy supplies can plausibly be expected to exist because life has the potential for exponential growth until checked by resources or other limitations, and intelligence implies the ability to overcome such limitations. As such, if Hart's thesis is correct, then searches for large alien civilizations in other galaxies may be fruitful; if it is incorrect, then searches for civilizations within the Milky Way are more likely to succeed than Hart argued. We review some past Dysonian SETI efforts and discuss the promise of new mid-infrared surveys, such as that of WISE.

  18. SETI reloaded: Next generation radio telescopes, transients and cognitive computing

    NASA Astrophysics Data System (ADS)

    Garrett, Michael A.

    2015-08-01

    The Search for Extra-terrestrial Intelligence (SETI) using radio telescopes is an area of research that is now more than 50 years old. Thus far, both targeted and wide-area surveys have yet to detect artificial signals from intelligent civilisations. In this paper, I argue that the incidence of co-existing intelligent and communicating civilisations is probably small in the Milky Way. While this makes successful SETI searches a very difficult pursuit indeed, the huge impact of even a single detection requires us to continue the search. A substantial increase in the overall performance of radio telescopes (and in particular future wide-field instruments such as the Square Kilometre Array - SKA), provide renewed optimism in the field. Evidence for this is already to be seen in the success of SETI researchers in acquiring observations on some of the world's most sensitive radio telescope facilities via open, peer-reviewed processes. The increasing interest in the dynamic radio sky, and our ability to detect new and rapid transient phenomena such as Fast Radio Bursts (FRB) is also greatly encouraging. While the nature of FRBs is not yet fully understood, I argue they are unlikely to be the signature of distant extra-terrestrial civilisations. As astronomers face a data avalanche on all sides, advances made in related areas such as advanced Big Data analytics, and cognitive computing are crucial to enable serendipitous discoveries to be made. In any case, as the era of the SKA fast approaches, the prospects of a SETI detection have never been better.

  19. Inspiring the next generation of scientists with their observations of quasars, black holes, Jupiter, and SETI with the Goldstone Apple Valley Radio Telescope, GAVRT

    NASA Astrophysics Data System (ADS)

    Jauncey, D. L.; Levin, S.; Teitelbaum, L.; Hofstadter, M.; Arballo, J.; McConnell, S.; Dorcey, R.; Cole, K.; Kreuser-Jenkins, N.; Leflang, J.; Kruzins, E.; Ricardo, L.; Horiuchi, S.; Nagle, G.; Miro, C. G.

    2017-04-01

    This paper describes a radio astronomy programfor schools, the Goldstone-AppleValley Radio Telescope,GAVRT. The GAVRT program is designed to bring the inspiration and enthusiasm to a younger generation of teachers and children who learn about science by doing real science, just as Iosif Shklovsky brought to an older generation.

  20. New CCIR report on SETI

    NASA Technical Reports Server (NTRS)

    Degroot, N. F.

    1988-01-01

    Since 1978, the reports and recommendations of the Comite Consultatif International des Radiocommunications (CCIR) have included a document describing SETI (the Search for Extraterrestrial Intelligence) in the context of radio frequency management. A new report to replace the old one was adopted by a CCIR study group; both reports were written at JPL. Following introductory and background material, the text of the new report is given.

  1. Kardashev's Classification at 50+: A Fine Vehicle With Room for Improvement

    NASA Astrophysics Data System (ADS)

    Ćirković, M. M.

    2015-12-01

    We review the history and status of the famous classification of extraterrestrial civilizations given by the great Russian astrophysicist Nikolai Semenovich Kardashev, roughly half a century after it has been proposed. While Kardashev's classification (or Kardashev's scale) has often been seen as oversimplified, and multiple improvements, refinements, and alternatives to it have been suggested, it is still one of the major tools for serious theoretical investigation of SETI issues. During these 50+ years, several attempts at modifying or reforming the classification have been made; we review some of them here, together with presenting some of the scenarios which present difficulties to the standard version. Recent results in both theoretical and observational SETI studies, especially the {Ĝ infrared survey (2014-2015), have persuasively shown that the emphasis on detectability inherent in Kardashev's classification obtains new significance and freshness. Several new movements and conceptual frameworks, such as the Dysonian SETI, tally extremely well with these developments. So, the apparent simplicity of the classification is highly deceptive: Kardashev's work offers a wealth of still insufficiently studied methodological and epistemological ramifications and it remains, in both letter and spirit, perhaps the worthiest legacy of the SETI "founding fathers".

  2. Neuromuscular transmission in a primitive insect: modulation by octopamine, and catch-like tension.

    PubMed

    Hoyle, G

    1984-01-01

    The third pair of legs of the primitive New Zealand orthopteran insect, the " weta ", has and innervation and muscle cell distribution exactly similar to that of locusts, but wetas do not jump. Neuromuscular transmission to the slow excitatory axon ( SETi ) is potentiated more than 10-fold by the natural modulator octopamine (OCT). A brief burst of SETi impulses following infusion of as little as 10(-8) M OCT is followed by a very long-lasting plateau of catch-like tension (CT). The plateau is abruptly relaxed by a single inhibitory impulse, or even by a single SETi impulse if this arrives no sooner than about 30 sec following excitation. CT is used by wetas in a defense posture. Locusts and grasshoppers have a different type of modulation by OCT.

  3. Elicitation and abrupt termination of behaviorally significant catchlike tension in a primitive insect.

    PubMed

    Hoyle, G; Field, L H

    1983-07-01

    Sustained steady contractural or catchlike tension (CT) occurs in the metathoracic extensor tibiae muscle of the primitive insect the weta (Orthoptera: Stenopelmatidae) during its characteristic leg-extension defense behavior or following leg-position conditioning. Similar action occurs occasionally in semi-intact preparations and is abruptly turned off by a single peripheral inhibitory impulse. These phenomena were reproduced routinely by first infusing saline containing 10(-8) M (or stronger) octopamine into the muscle for 12 min, and then stimulating the slow excitatory motor neuron SETi with a brief burst. Direct stimulation of the dorsal unpaired median neuron, innervating the extensor tibiae (DUMETi) prior to SETi stimulation, also led to CT. Both octopamine and DUMETi markedly enhanced the tension developed in response to a burst of impulses in SETi.

  4. Dynamic message sign message design and display manual training : participant notebook, two-day course.

    DOT National Transportation Integrated Search

    2009-03-01

    This Dynamic Message Sign Message Design and Display Manual was written for use by Texas Department of : Transportation (TxDOT) personnel who have responsibility for the operation of and/or message design for large : permanent dynamic message signs (...

  5. Dynamic message sign message design and display manual training : participant notebook, one-day "core" course.

    DOT National Transportation Integrated Search

    2009-03-01

    This Dynamic Message Sign Message Design and Display Manual was written for use by Texas Department of Transportation (TxDOT) personnel who have responsibility for the operation of and/or message design for large permanent dynamic message signs (DMSs...

  6. DMS message design workshops.

    DOT National Transportation Integrated Search

    2009-03-01

    This report summarizes the training conducted statewide regarding the design and display of messages on : dynamic message signs. The training is based on the Dynamic Message Sign Message Design and Display : Manual (0-4023-P3). Researchers developed ...

  7. The Serendip piggyback SETI project

    NASA Technical Reports Server (NTRS)

    Lampton, Michael; Bowyer, Stuart; Werthimer, Dan; Donnelly, Charles; Herrick, Walter

    1988-01-01

    The Serendip project, an ongoing SETI program of monitoring and processing broadband radio signals acquired by existing radio astronomy observatories, are summarized. Serendip operates in a piggyback mode, making use of whatever observing plan is under way at its host observatory. The Serendip system at NRAO and the signature detection and identification techniques used by the project are described. The method used to reject terrestrial interference is discussed.

  8. The Search for Life in the Universe: The Past Through the Future

    NASA Astrophysics Data System (ADS)

    Lebofsky, L. A.; Lebofsky, A.; Lebofsky, M.; Lebofsky, N. R.

    2003-05-01

    ``Are we alone?" This is a question that has been asked by humans for thousands of years. More than any other topic in science, the search for life in the Universe has captured everyone's imagination. Now, for the first time in history, we are on the verge of answering this question. The search for life beyond the Earth can be seen as far back as the 16th century writings of J. Kepler, Bishops F. Godwin and J. Wilkins, and S. Cyrano de Bergerac to the early 20th century's H. G. Wells. From a scientific perspective, this search led to the formulation of the Drake Equation which in turn has led to a number of projects that are searching for signs of intelligent life beyond the Earth, the Search for Extraterrestrial Intellegence. SETI@home reaches millions of users, including thousands of K-12 teachers across the nation. We are developing a project that will enhance the SETI@home web site located at UC Berkeley. The project unites the resources of the SETI@home distributed computing community web site , university settings, and informal science learning centers. It will reach approximately 100,000 learners. The goal is to increase public understanding of math and science and to create and strengthen the connections between informal and formal learning communities. We will present a variety of ways that the Drake Equation and SETI@home can enhance the public and student understanding of the search for life in the Universe, from its roots in literature, to the development (and evolution) of the Drake Equation, to the actual search for life with SETI.

  9. SETI from the moon: an invitation to COSPAR

    NASA Astrophysics Data System (ADS)

    Heidmann, J.

    After presenting arguments for SETI (Search for ExtraTerrestrial Intelligence) work to be done well into the 21st century, and in view of the dramatic increase of blinding human-made radiofrequency interference, this author proposed that a well defined locale on the farside of the Moon - crater Saha - be preserved for the next 20-30 years not only for SETI but also for future high-sensitivity radioastronomy. The long-term programmatic issues were presented at the Lunar Exploration Symposium of the Jerusalem 1994 International Astronautical Federation Congress. The legal questions raised were delineated at the International Institute of Space Law (IISL) Colloquium of the same Jerusalem Congress. Numerous suggestions were given for an action strategy, in particular to present a proposal at a COSPAR venue. In the words of IISL Director A.A. Cocca: ``This reservation of a lunar zone for scientific activities, and its further utilization aiming at the common good of humanity, must be recognized, and constitutes a precedent.'' At the Hamburg 1995 European Geophysical Society XXth GA, we pointed out that this Saha project could offer interesting possibilities for a symbiosis with the `Science on the Moon Exobiology' teams. We also presented it at the Berlin 1996 European Space Agency/Deutsche Forschungsanstalt für Luft und Raumfahrt `International Moon Workshop' to geologists and to bioastrononomers at the Capri 1996 Bioastronomy International Astronomical Union Colloquium #161. At the 1995 IAF Congress in Oslo, the SETI Committee of the International Academy of Astronautics took action for the future benefit of humankind by setting-up a Sub-committee for `A SETI Lunar Study', chaired by the author. We hope that, in view of these initial endeavors, COSPAR may become interested in this Saha proposal and supports it.

  10. Evolutionary contingency and SETI revisited

    NASA Astrophysics Data System (ADS)

    Cirkovic, Milan M.

    2014-07-01

    The well-known argument against the Search for ExtraTerrestrial Intelligence (SETI) due to George Gaylord Simpson is re-analyzed almost half a century later, in the light of our improved understanding of preconditions for the emergence of life and intelligence brought about by the ongoing "astrobiological revolution". Simpson's argument has been enormously influential, in particular in biological circles, and it arguably fueled the most serious opposition to SETI programmes and their funding. I argue that both proponents and opponents of Simpson's argument have occasionally mispresented its core content. Proponents often oversimplify it as just another consequence of biological contingency, thus leaving their position open to general arguments limiting the scope of contingency in evolution (such as the recent argument of Geerat Vermeij based on selection effects in the fossil record). They also tend to neglect that the argument has been presented as essentially atemporal, while referring to entities and processes that are likely to change over time; this has become even less justifiable as our astrobiological knowledge increased in recent years. Opponents have failed to see that the weaknesses in Simpson's position could be removed by restructuring of the argument; I suggest one way of such restructuring, envisioned long ago in the fictional context by Stanislaw Lem. While no firm consensus has emerged on the validity of Simpson's argument so far, I suggest that, contrary to the original motivation, today it is less an anti-SETI argument, and more an astrobiological research programme. In this research programme, SETI could be generalized into a platform for testing some of the deepest assumptions about evolutionary continuity and the relative role of contingency versus convergence on unprecedented spatial and temporal scales.

  11. Embryonic development of the innervation of the locust extensor tibiae muscle by identified neurons: formation and elimination of inappropriate axon branches.

    PubMed

    Myers, C M; Whitington, P M; Ball, E E

    1990-01-01

    Intracellular dye fills have been used to reveal the pattern of embryonic growth of each of the four neurons which innervate the extensor tibiae muscle (ETi) of the hind leg of the locust. The growth cone of the slow extensor tibiae motoneuron (SETi), the first of the four neurons to leave the central nervous system, pioneers nerve 3 (N3). The fast extensor motoneuron (FETi), the next neuron to grow out, follows earlier outgrowing motoneurons into the periphery in nerve 5 (N5) and then rejoins SETi in N3. As it transfers from N5 to N3, it is transiently dye-coupled to the Tr1 pioneer neuron which spans the gap between the two nerves. It then follows SETi onto the ETi muscle in the femur. The common inhibitory neuron and the dorsal unpaired median neuron (DUMETi) follow SETi and FETi in nerves 3B2 and 5B1, respectively. SETi's growth cone requires almost twice as long to reach ETi as those of the three later motoneurons, all of which follow preexisting neural pathways. At least three of the four developing motoneurons form one or more axon branches not found in the adult. These branches may occur (1) at segmental boundaries; (2) where the nerve, which the growth cone is following, itself branches or the growth cone encounters another nerve; or (3) when the axon continues to grow beyond its target muscle. These findings contrast with the apparent absence of inappropriate axon branches in another developing locust neuromuscular system and during the innervation of zebrafish myotomes, but resemble in some ways the transient production of inappropriate axonal branches reported for embryonic leech motoneurons.

  12. RFI in the 0.5 to 10.8 GHz Band at the Allen Telescope Array

    NASA Astrophysics Data System (ADS)

    Backus, Peter R.; Kilsdonk, T. N.; Allen Telescope Array Team

    2007-05-01

    Thanks to funding from the Paul G. Allen Foundation (and other philanthropic supporters) for the technology development and first phase of construction, the first 42 elements of the Allen Telescope Array (ATA-42) are being commissioned for rapid surveys of the astrophysical and technological sky. Because of the innovative design of this array that will eventually include 350 elements, traditional radio astronomy and SETI are enabled simultaneously 24x7. The array has been designed to provide an optimal snapshot image of a very large field of view and simultaneously, 16 (dual polarization) phased beams within the field of view to be analyzed by a suite of backend processors. Four independent 100 MHz bands may be tuned anywhere within the instantaneous receiver bandwidth from 0.5 to 11.2 GHz. One key to the success of rapid surveys for astrophysical or technological signals is a quiet background. This poster presents the results of initial surveys with 6.1 meter dishes at high-spectral-resolution of the background spectrum from 0.5 to 10.8 GHz at the Hat Creek Radio Observatory, where the ATA is being constructed, and compares it with the background spectrum from 1.2-3 GHz at other observatories where SETI observations have been conducted within the past 11 years.

  13. A Sentry on the Universe

    NASA Astrophysics Data System (ADS)

    Dixon, Robert

    This chapter introduces the Argus radio telescope concept, a radically new approach to radio telescope design (not to be confused with The SETI League's Project Argus, a linked global array of fairly conventional radio telescopes). It represents a complete departure from designs that have been used ever since the invention of the first telescope by Galileo in 1609. It starts over from the beginning, and in doing so overcomes the legacy of Galileo. Argus can do things that are amazing and even hard to believe, when viewed in the context of previous telescopes. Here are some examples.

  14. Enlivening Introductory Physics With SETI

    NASA Astrophysics Data System (ADS)

    Hobson, Art

    2001-04-01

    The search for extraterrestrial intelligence (SETI), popular for years in astronomy courses, is also an excellent topic in physics literacy courses. Space travel, relativity, scientific methodology, pseudoscience, and physics-related societal topics can all be taught within the SETI context. Fermi's question (see Kuiper and Brin, Extraterrestrial Civilization, AAPT 1989, p. 67) is especially appropriate. Enrico Fermi, speculating in 1950 on the number of technological civilizations in our galaxy, concluded that we should have been visited long ago and many times over. Thus one might ask, paraphrasing Fermi, "Where is everybody?" Fermi concluded that either interstellar travel is impossible, or is always judged not to be worth the effort, or technological civilization doesn't last long enough for it to happen. Whether one agrees with Fermi or not, the great physicist's third suggestion is a sobering perspective on the sustainability of Earth-based civilization.

  15. The outlook for cosmic company.

    PubMed

    Shostak, S

    2001-12-01

    The last 100 million years or so has seen a continued increase in encephalization for several terrestrial species. Intelligence has survival value. Developments in astrobiology suggest that what was once considered enormously improbable, namely life, is now suspected of being ubiquitous. It may be that the evolution of intelligence is unlikely, but in a finite, breathtakingly large universe (10(22) stars) small probability likely does not matter. Even if nature is indifferent to producing intelligence, SETI might still succeed. Biological intelligence may be rare, but it has the potential for creating engineered synthetic intelligence, capable of rapid and directed self-evolution. The galaxy could be rife with such long-lived, communicating devices, even if intelligent protoplasm is both rare and fleeting. SETI is looking for narrow-band, microwave signals that are not produced naturally. Ultimately, SETI is more exploration than experimentation.

  16. Back to the future: SETI before the space age

    NASA Astrophysics Data System (ADS)

    Dick, Steven J.

    1995-02-01

    In the late 1890s and early 1900s, before the advent of formalized search for extraterrestrial intelligence (SETI) programs, scientists such as Nikola Tesla and Gulielmo Marconi reported evidence of extraterrestrial radio signals. This paper reviews the history of 'interstellar/interplanetary radio communication'. The investigations of David P. Todd and Donald Menzel are discussed, and the fields of radio communication and radio astronomy are mentioned briefly.

  17. SETI at X-energies - parasitic searches from astrophysical observations.

    NASA Astrophysics Data System (ADS)

    Corbet, R. H. D.

    1997-01-01

    If a sufficiently advanced civilization can either modulate the emission from an X-ray binary, or make use of the natural high luminosity to power an artificial transmitter, these can serve as good beacons for interstellar communication without involving excessive energy costs to the broadcasting civilization. In addition, the small number of X-ray binaries in the Galaxy considerably reduces the number of targets that must be investigated compared to searches in other energy bands. Low mass X-ray binaries containing neutron stars in particular are considered as prime potential natural and artificial beacons and high time resolution (better than 1ms) observations are encouraged. All sky monitors provide the capability of detecting brief powerful artificial signals from isolated neutron stars. New capabilities of X-ray astronomy satellites developed for astrophysical purposes are enabling SETI in new parameter regimes. For example, the X-ray Timing Explorer satellite provides the capability of exploring the sub-millisecond region. Other planned X-ray astronomy satellites should provide significantly improved spectral resolution. While SETI at X-ray energies is highly speculative (and rather unfashionable) by using a parasitic approach little additional cost is involved. The inclusion of X-ray binaries in target lists for SETI at radio and other wavebands is also advocated.

  18. Motor neurone responses during a postural reflex in solitarious and gregarious desert locusts.

    PubMed

    Blackburn, Laura M; Ott, Swidbert R; Matheson, Tom; Burrows, Malcolm; Rogers, Stephen M

    2010-08-01

    Desert locusts show extreme phenotypic plasticity and can change reversibly between two phases that differ radically in morphology, physiology and behaviour. Solitarious locusts are cryptic in appearance and behaviour, walking slowly with the body held close to the ground. Gregarious locusts are conspicuous in appearance and much more active, walking rapidly with the body held well above the ground. During walking, the excursion of the femoro-tibial (F-T) joint of the hind leg is smaller in solitarious locusts, and the joint is kept more flexed throughout an entire step. Under open loop conditions, the slow extensor tibiae (SETi) motor neurone of solitarious locusts shows strong tonic activity that increases at more extended F-T angles. SETi of gregarious locusts by contrast showed little tonic activity. Simulated flexion of the F-T joint elicits resistance reflexes in SETi in both phases, but regardless of the initial and final position of the leg, the spiking rate of SETi during these reflexes was twice as great in solitarious compared to gregarious locusts. This increased sensory-motor gain in the neuronal networks controlling postural reflexes in solitarious locusts may be linked to the occurrence of pronounced behavioural catalepsy in this phase similar to other cryptic insects such as stick insects. Copyright (c) 2010 Elsevier Ltd. All rights reserved.

  19. Effects of Message Design Logic on the Communication of Intention.

    ERIC Educational Resources Information Center

    O'Keefe, Barbara J.; Lambert, Bruce L.

    In producing and comprehending messages, a communicator relies on a "message design logic" embodying an individual's knowledge about how to relate message forms and functions. According to this model, there are three different message design logics: (1) expressive, in which self-expression is the chief function, and affective and…

  20. Audience Design through Social Interaction during Group Discussion

    PubMed Central

    Rogers, Shane L.; Fay, Nicolas; Maybery, Murray

    2013-01-01

    This paper contrasts two accounts of audience design during multiparty communication: audience design as a strategic individual-level message adjustment or as a non-strategic interaction-level message adjustment. Using a non-interactive communication task, Experiment 1 showed that people distinguish between messages designed for oneself and messages designed for another person; consistent with strategic message design, messages designed for another person/s were longer (number of words) than those designed for oneself. However, audience size did not affect message length (messages designed for different sized audiences were similar in length). Using an interactive communication task Experiment 2 showed that as group size increased so too did communicative effort (number of words exchanged between interlocutors). Consistent with a non-strategic account, as group members were added more social interaction was necessary to coordinate the group's collective situation model. Experiment 3 validates and extends the production measures used in Experiment 1 and 2 using a comprehension task. Taken together, our results indicate that audience design arises as a non-strategic outcome of social interaction during group discussion. PMID:23437343

  1. Broadening and Simplifying the First SETI Protocol

    NASA Astrophysics Data System (ADS)

    Michaud, M. A. G.

    The Declaration of Principles Concerning Activities Following the Detection of Extraterrestrial Intelligence, known informally as the First SETI Protocol, is the primary existing international guidance on this subject. During the fifteen years since the document was issued, several people have suggested revisions or additional protocols. This article proposes a broadened and simplified text that would apply to the detection of alien technology in our solar system as well as to electromagnetic signals from more remote sources.

  2. Radio astronomy aspects of the NASA SETI Sky Survey

    NASA Technical Reports Server (NTRS)

    Klein, Michael J.

    1986-01-01

    The application of SETI data to radio astronomy is studied. The number of continuum radio sources in the 1-10 GHz region to be counted and cataloged is predicted. The radio luminosity functions for steep and flat spectrum sources at 2, 8, and 22 GHz are derived using the model of Peacock and Gull (1981). The relation between source number and flux density is analyzed and the sensitivity of the system is evaluated.

  3. Past and Future of Astronomy and SETI Cast in Maths

    NASA Astrophysics Data System (ADS)

    Maccone, C.

    Assume that the history of Astronomy and SETI is the leading proof of the evolution of human knowledge on Earth over the last 3000 years. Then, human knowledge has increased a lot, although not at a uniform pace. A mathematical description of how much human knowledge has increased, however, is difficult to achieve. In this paper, we cast a mathematical model of the evolution of human knowledge over the last three thousand years that seems to reflect reasonably well both what is known from the past and might be extrapolated into the future. Our model is based on two seminal books by Sagan and Finney and Jones. Our model is based on the use of two cubic curves, representing the evolution of Astronomy and of SETI, respectively. We conclude by extrapolating these curves into the future and reach the conclusion that the "Star Trek" age of humankind might possibly begin by the end of this century.

  4. Project Phoenix and beyond. Pesek Lecture.

    PubMed

    Tarter, J

    1997-01-01

    Although there are no federally funded projects at this time, SETI (the search for extraterrestrial intelligence) is a vigorous exploratory science. There are currently eight observational programs on telescopes around the world, of which the Phoenix Project is the most comprehensive. Most of these projects are rooted in the conclusions of the pioneering studies of the early 1970's that are summarized in the Cyclops Report. Technology has experienced an exponential growth over the past two and a half decades. It is reasonable to reassess the Cyclops conclusions as SETI enters the next century. Listening for radio signals is still the preferred method of searching, however new technologies are making searches at other wavelengths possible and are modifying the ways in which the radio searches can and should be conducted. It may be economically feasible to undertake the construction of very large telescopes that can simultaneously provide multiple beams on the sky for use by SETI and the radioastronomy community.

  5. What ET will look like and why should we care

    NASA Astrophysics Data System (ADS)

    Shostak, Seth

    2010-11-01

    Our experiments to find extraterrestrial life are predicated on the assumption that it is most likely to be found on so-called "habitable worlds." These are planets and moons where surface liquid water exists, and atmospheres of light gases are found. Our searches presume that life on other worlds has a biochemistry at least somewhat similar to our own. While these postulates might be our best guide for finding biology, they could be misleading us in the search for extraterrestrial intelligence (SETI). Timescale arguments suggest that shortly after a sentient species invents the technology for communication, it develops synthetic intelligence. Consequently, SETI's targeted searches of star systems that might have habitable planets in the conventional sense may be chasing a very short-lived prey. In this paper, we discuss what the implications of post-biological intelligence might have in directing our SETI experiments.

  6. A Scheme for Targeting Optical SETI Observations

    NASA Astrophysics Data System (ADS)

    Shostak, Seth

    2004-06-01

    In optical SETI (OSETI) experiments, it is generally assumed that signals will be deliberate, narrowly targeted beacons sent by extraterrestrial societies to large numbers of candidate star systems. If this is so, then it may be unrealistic to expect a high duty cycle for the received signal. Ergo, an advantage accrues to any OSETI scheme that realistically suggests where and when to search. In this paper, we elaborate a proposal (Castellano, Doyle, &McIntosh 2000) for selecting regions of sky for intensive optical SETI monitoring based on characteristics of our solar system that would be visible at great distance. This can enormously lessen the amount of sky that needs to be searched. In addition, this is an attractive approach for the transmitting society because it both increases the chances of reception and provides a large reduction in energy required. With good astrometric information, the transmitter need be no more powerful than an automobile tail light.

  7. Pesek lecture project Phoenix and beyond

    NASA Astrophysics Data System (ADS)

    Tarter, Jill

    Although there are no federally funded projects at this time, SETI (the search for extraterrestrial intelligence) is a vigorous exploratory science. There are currently eight observational programs on telescopes around the world, of which the Phoenix Project is the most comprehensive. Most of these projects are rooted in the conclusions of the pioneering studies of the early 1970's that are summarized in the Cyclops Report1. Technology has experienced an exponential growth over the past two and a half decades. It is reasonable to reassess the Cyclops conclusions as SETI enters the next century. Listening for radio signals is still the preferred method of searching, however new technologies are making searches at other wavelengths possible and are modifying the ways in which the radio searches can and should be conducted. It may be economically feasible to undertake the construction of very large telescopes that can simultaneously provide multiple beams on the sky for use by SETI and the radioastronomy community.

  8. Detection of the earth with the SETI microwave observing system assumed to be operating out in the Galaxy

    NASA Technical Reports Server (NTRS)

    Billingham, John; Tarter, Jill

    1989-01-01

    The maximum range is calculated at which radar signals from the earth could be detected by a search system similar to the NASA SETI Microwave Observing Project (SETI MOP) assumed to be operating out in the Galaxy. Figures are calculated for the Targeted Search and for the Sky Survey parts of the MOP, both planned to be operating in the 1990s. The probability of detection is calculated for the two most powerful transmitters, the planetary radar at Arecibo (Puerto Rico) and the ballistic missile early warning systems (BMEWSs), assuming that the terrestrial radars are only in the eavesdropping mode. It was found that, for the case of a single transmitter within the maximum range, the highest probability is for the sky survey detecting BMEWSs; this is directly proportional to BMEWS sky coverage and is therefore 0.25.

  9. SETI low-frequency feed design study for DSS 24

    NASA Technical Reports Server (NTRS)

    Stanton, P. H.; Lee, P. R.

    1992-01-01

    The Search for Extraterrestrial Intelligence Sky Survey project requires operation from 1 to 10 GHz on the beam waveguide (BWG) antenna DSS 24. The BWG reflectors are undersized in the 1- to 3.02-GHz range, resulting in poor performance. Horn designs and a method for implementing 1- to 3.02-GHz operation on DSS 24 are presented. A combination of a horn and a shaped feed reflector placed above the main reflector is suggested. The horn and feed reflector could be hidden in the RF shadow of the subreflector and struts. Results from computer analysis of this design indicate that adequate performance could be achieved.

  10. Twinkle, Twinkle, Little Laser by Ben Bova

    NASA Astrophysics Data System (ADS)

    Bova, Ben

    2000-03-01

    Radio astronomers have had no success in the search for extraterrestrial intelligence (SETI). Astronomers are now studying the heavens for signals that intelligent beings might send using lasers. Laser lights have the advantage of directionality, monochromaticity, and coherence. This research, called "optical SETI," looks for optical or infrared pulses with detectors that can pick up a broad spectrum of frequencies. By confining the search to stars similar to the Sun, scientists hope to find evidence of life other than ours.

  11. Cultural Evolution and SETI

    NASA Astrophysics Data System (ADS)

    Dick, S. J.

    2009-12-01

    The Drake Equation for the number of radio communicative technological civilizations in the Galaxy encompasses three components of cosmic evolution: astronomical, biological and cultural. Of these three, cultural evolution totally dominates in terms of the rapidity of its effects. Yet, SETI scientists do not take cultural evolution into account, perhaps for understandable reasons, since cultural evolution is not well-understood even on Earth and is unpredictable in its outcome. But the one certainty for technical civilizations billions, millions, or even thousands of years older than ours is that they will have undergone cultural evolution. Cultural evolution potentially takes place in many directions, but this paper argues that its central driving force is the maintenance, improvement and perpetuation of knowledge and intelligence, and that to the extent intelligence can be improved, it will be improved. Applying this principle to life in the universe, extraterrestrials will have sought the best way to improve their intelligence. One possibility is that they may have long ago advanced beyond flesh-and-blood to artificial intelligence, constituting a postbiological universe. Although this subject has been broached, it has not been given the attention it is due from its foundation in cultural evolution. Nor has the idea of a postbiological universe been carried to its logical conclusion, including a careful analysis of the implications for SETI. SETI scientists, social scientists, and experts in AI should consider the strengths and weaknesses of this new paradigm.

  12. SETI in vivo: testing the we-are-them hypothesis

    NASA Astrophysics Data System (ADS)

    Makukov, Maxim A.; Shcherbak, Vladimir I.

    2018-04-01

    After it was proposed that life on Earth might descend from seeding by an earlier extraterrestrial civilization motivated to secure and spread life, some authors noted that this alternative offers a testable implication: microbial seeds could be intentionally supplied with a durable signature that might be found in extant organisms. In particular, it was suggested that the optimal location for such an artefact is the genetic code, as the least evolving part of cells. However, as the mainstream view goes, this scenario is too speculative and cannot be meaningfully tested because encoding/decoding a signature within the genetic code is something ill-defined, so any retrieval attempt is doomed to guesswork. Here we refresh the seeded-Earth hypothesis in light of recent observations, and discuss the motivation for inserting a signature. We then show that `biological SETI' involves even weaker assumptions than traditional SETI and admits a well-defined methodological framework. After assessing the possibility in terms of molecular and evolutionary biology, we formalize the approach and, adopting the standard guideline of SETI that encoding/decoding should follow from first principles and be convention-free, develop a universal retrieval strategy. Applied to the canonical genetic code, it reveals a non-trivial precision structure of interlocked logical and numerical attributes of systematic character (previously we found these heuristically). To assess this result in view of the initial assumption, we perform statistical, comparison, interdependence and semiotic analyses. Statistical analysis reveals no causal connection of the result to evolutionary models of the genetic code, interdependence analysis precludes overinterpretation, and comparison analysis shows that known variations of the code lack any precision-logic structures, in agreement with these variations being post-LUCA (i.e. post-seeding) evolutionary deviations from the canonical code. Finally, semiotic analysis shows that not only the found attributes are consistent with the initial assumption, but that they make perfect sense from SETI perspective, as they ultimately maintain some of the most universal codes of culture.

  13. SETI in the light of cosmic convergent evolution

    NASA Astrophysics Data System (ADS)

    Flores Martinez, Claudio L.

    2014-11-01

    Theodosius Dobzhansky, one of the founding fathers of the modern evolutionary synthesis, once famously stated that ;nothing makes sense in biology except in the light of evolution;. Here it will be argued that nothing in astrobiology makes sense except in the light of ;Cosmic Convergent Evolution; (CCE). This view of life contends that natural selection is a universal force of nature that leads to the emergence of similarly adapted life forms in analogous planetary biospheres. Although SETI historically preceded the rise of astrobiology that we have witnessed in the recent decade, one of its main tenets from the beginning was the convergence of life on a cosmic scale toward intelligent behavior and subsequent communication via technological means. The question of cultural convergence in terms of symbolic exchange, language and scientific capabilities between advanced interstellar civilizations has been the subject of ongoing debate. However, at the core of the search for extraterrestrial intelligence lies in essence a biological problem since even post-biological extraterrestrial intelligences must have had an origin based on self-replicating biopolymers. Thus, SETI assumes a propensity of the Universe towards biogenesis in accordance with CCE, a new evolutionary concept which posits the multiple emergence of life across the Cosmos. Consequently, we have to wonder about the biophilic properties the Universe apparently exhibits, as well as to try to find an encompassing theory that is able to explain this ;fine-tuning; in naturalistic terms. The aims of this paper are as follows: 1) to emphasize the importance of convergent evolution in astrobiology and ongoing SETI research; 2) to introduce novel and biology-centered cosmological ideas such as the ;Selfish Biocosm Hypothesis; and the ;Evo Devo Universe; as valuable arguments in theorizing about the origin and nature of extraterrestrial intelligence and 3) to synthesize these findings within an emerging post-biological paradigm on which future SETI efforts may be founded.

  14. L factor: hope and fear in the search for extraterrestrial intelligence

    NASA Astrophysics Data System (ADS)

    Rubin, Charles T.

    2001-08-01

    The L factor in the Drake equation is widely understood to account for most of the variance in estimates of the number of extraterrestrial intelligences that might be contacted by the search for extraterrestrial intelligence (SETI). It is also among the hardest to quantify. An examination of discussions of the L factor in the popular and technical SETI literature suggests that attempts to estimate L involve a variety of potentially conflicting assumptions about civilizational lifespan that reflect hopes and fears about the human future.

  15. Fluorescence imaging technology (FI) for high-throughput screening of selenide-modified nano-TiO2 catalysts.

    PubMed

    Wang, Liping; Lee, Jianchao; Zhang, Meijuan; Duan, Qiannan; Zhang, Jiarui; Qi, Hailang

    2016-02-18

    A high-throughput screening (HTS) method based on fluorescence imaging (FI) was implemented to evaluate the catalytic performance of selenide-modified nano-TiO2. Chemical ink-jet printing (IJP) technology was reformed to fabricate a catalyst library comprising 1405 (Ni(a)Cu(b)Cd(c)Ce(d)In(e)Y(f))Se(x)/TiO2 (M6Se/Ti) composite photocatalysts. Nineteen M6Se/Tis were screened out from the 1405 candidates efficiently.

  16. Evolution of Life and SETI (Evo-SETI)

    NASA Astrophysics Data System (ADS)

    Maccone, Claudio

    When SETI scientists will be able to discover a signal or just some signs of an Extra-Terrestrial (ET) Civilization, those ETs should turn out to be technologically advanced at least as much as Humans, if not more, or much more so. Comparing the technological level of two different Civilizations is then a key issue in SETI. But at the moment we only know about the development of life on Earth over the last 3.5 billion years. We thus need to mathematically model the evolution of life on Earth (RNA to Humans) and then apply our results to other extra-solar planets to find out “where they stand” along their evolution of life. In a series of recent papers and in a book (refs. [1] through [4]) this author introduced a new statistical model embracing SETI, Darwinian Evolution and Human History into a unified statistical picture and concisely called Evo-SETI (Evolution & SETI). The relevant mathematical instruments are: 1) The statistical generalization of the Drake equation yielding the number N of communicating ET civilizations in the Galaxy. Assuming that each input variable in the Drake equation was a random variable, rather than just a pure number, N was shown to follow the lognormal probability distribution having as mean value the sum of the input mean values, and as variance the sum of the input variances (ref. [1]). 2) Geometric Brownian Motion (GBM), the stochastic process representing Evolution as the stochastic increase of the number of Species living on Earth over the last 3.5 billion years. This GBM is well-known in the mathematics of finances (Black-Sholes models). Its main features are that its probability density function (pdf) is a lognormal pdf, and its mean value is either an increasing, or, more rarely (as in the Mass Extinctions of the past) a decreasing exponential of the time. 3) The probability distributions known as b-lognormals, i.e. lognormals starting at a certain positive instant b>0 rather than at the origin. These b-lognormals were then forced by us to have their peak value located on the exponential mean-value curve of the GBM (this is the so-called “Peak-Locus Theorem”). In the framework of Darwinian Evolution, the resulting mathematical construction was shown to identify with Cladistics (refs. [2], [3], [4]). 4) The (Shannon) Entropy of such b-lognormals is then seen to represent the “degree of progress” reached by each living organism or by each big set of living organisms, like historic human civilizations. Having understood this fact, Human History may then be cast into the language of b-lognormals that are more and more organized in time (i.e. having smaller and smaller entropy, or smaller and smaller “chaos”), and have their peaks located on the increasing GBM exponential. This exponential is thus the “trend of progress” in Human History. 5) But our most striking new result is about the well-known “Molecular Clock of Evolution”, namely the “constant rate of Evolution at the molecular level” as shown by Kimura’s Neutral Theory of Molecular Evolution. We showed that that the Molecular Clock identifies with Entropy in our Evo-SETI model because they both grew linearly in time since the origin of life. 6) Furthermore, we applid our Evo-SETI model to lognormal stochastic processes other then the GBMs. For instance, we showed that the Markov-Korotayev (2007-2008, refs. [5], [6]) model for Darwinian Evolution identifies with an Evo-SETI model for which the mean value of the lognormal stochastic process is a cubic (third degree polynomial) function of the time. In conclusion: we have provided a vast mathematical model capable of embracing Molecular Evolution, SETI and Entropy into a simple set of statistical equations based upon b-lognormals pdfs and lognormal stochastic processes Keywords: Molecular Clock, Darwinian evolution, statistical Drake equation, lognormal probability densities, geometric Brownian motion, entropy. REFERENCES [1] Maccone, C. (2008), “The Statistical Drake Equation”, paper #IAC-08-A4.1.4 presented on October 1st, 2008, at the 59th International Astronautical Congress (IAC) held in Glasgow, Scotland, UK, September 29th thru October 3rd, 2008, later published in Acta Astronautica, Vol. 67 (2010), pages 1366-1383. [2] Maccone, C. (2011, b), “A Mathematical Model for Evolution and SETI”, Origins of Life and Evolutionary Biospheres (OLEB), Vol. 41, pages 609-619, available online December 3rd, 2011. [3] Maccone, C. (2012), “Mathematical SETI”, a 724-pages book published by Praxis-Springer in the fall of 2012. ISBN, ISBN-10: 3642274366 | ISBN-13: 978-3642274367 | Edition: 2012 [4] Maccone, C., (2013), “SETI, Evolution and Human History merged into a Mathematical Model”, International Journal of Astrobiology, Vol. 12, issue 3 (2013), pages 218-245. Available online since April 23, 2013. [5] Markov A., Korotayev A., “Phanerozoic marine biodiversity follows a hyperbolic trend”, Paleoworld, Volume 16, Issue 4, December 2007, Pages 311-318. [6] Markov A., Korotayev A., “Hyperbolic growth of marine and continental biodiversity through the Phanerozoic and community evolution”, Journal of General Biology. Volume 69, 2008, N. 3, pp. 175-194.

  17. Studies of radio frequency interference at Parkes Observatory

    NASA Astrophysics Data System (ADS)

    Backus, Peter R.; Laroque, Sam; Tarter, Jill C.; Dreher, John; Gullers, Kent; Patrick, Alan; Heiligman, Gary

    1997-01-01

    From February through early June 1995, Project Phoenix conducted SETI observations of 209 stars over the frequency range from 1195 to 3005 MHz. A byproduct of this search is a unique data set suitable for studying the Radio Frequency Interference (RFI) environment at the Parkes 64-m telescope in New South Wales, Australia. RFI is an increasing problem for SETI and other radio astronomy observations conducted outside of the 'protected' frequency bands. The data analyzed for this paper were 'mean baseline' spectra in Left and Right Circular Polarization (LCP, RCP), integrated for either 138 or 276 s, covering a 10-MHz bandwidth with 15,552 channels at a resolution of 643 Hz. Channels were identified as contaminated by RFI when the power in the channel exceeded the mean noise by 3 percent. The 'spectral occupancy', the fraction of time RFI was seen, was determined for each channel. The RFI occupancy for LCP and RCP are distinctly different. Approximately 100 MHz of the spectrum was too heavily contaminated for SETI observations.

  18. The lure of local SETI: Fifty years of field experiments

    NASA Astrophysics Data System (ADS)

    Ailleris, Philippe

    2011-01-01

    With the commemoration in October 2007 of the Sputnik launch, space exploration celebrated its 50th anniversary. Despite impressive technological and scientific achievements the fascination for space has weakened during the last decades. One contributing factor has been the gradual disappearance of mankind's hope of discovering extraterrestrial life within its close neighbourhood. In striking contrast and since the middle of the 20th century, a non-negligible proportion of the population have already concluded that intelligent beings from other worlds do exist and visit Earth through space vehicles popularly called Unidentified Flying Objects (UFOs). In light of the continuous public interest for the UFO enigma symbolized by the recent widely diffused media announcements on the release of French and English governmental files; and considering the approach of broadening the strategies of the "Active SETI" approach and the existence of a rich multi-disciplinary UFO documentation of potential interest for SETI; this paper describes some past scientific attempts to demonstrate the physical reality of the phenomena and potentially the presence on Earth of probes of extraterrestrial origin. Details of the different instrumented field studies deployed by scientists and organizations during the period 1950-1990 in the USA, Canada and Europe are provided. In conclusion it will be argued that while continuing the current radio/optical SETI searches, there is the necessity to maintain sustaining attention to the topic of anomalous aerospace phenomena and to develop new rigorous research approaches.

  19. Ultrastructure of identified fast excitatory, slow excitatory and inhibitory neuromuscular junctions in the locust.

    PubMed

    Titmus, M J

    1981-06-01

    The specialized jumping muscle of the locust, the metathoracic extensor tibiae (ETi), is innervated by four physiologically different motoneurons, including FETi, a phasic excitor, SETi, a tonic excitor, and CI, a tonic common inhibitor. FETi neuromuscular junctions were examined in three phasic ETi bundles innervated by FETi. FETi terminals were characterized by patchy contacts on to granular sarcoplasm. The ETi accessory extensor, innervated by both SETi and CI, contains two morphologically different types of axon ending. When this muscle was soaked in horseradish peroxidase, stimulation of SETi led to selective uptake in vesicles in terminals similar to those of FETi axons but containing smaller vesicles, while stimulation by CI caused increased uptake into terminals with more extensive contact directly on to fibrillar sarcoplasm. As has been observed in excitatory and inhibitory synapses in some crustacean and vertebrate nervous systems, the synaptic vesicles in the locust excitatory endings are round and electron-lucent while those in the inhibitory endings are more irregular in shape. The tonic neuromuscular junctions, SETi and CI, are more densely packed with vesicles, larger in cross-sectional area and appear to be of more complex shape than the smaller, vesicle-sparse, phasic FETi terminals. Following long duration stimulation at 10 Hz, the tonic neuromuscular junctions showed little morphological change. FETi endings, which fatigue within minutes at the same stimulation frequency, showed a 20% decrease in synaptic vesicle density and an increase in irregularly shaped membrane inclusions.

  20. Empowerment in the process of health messaging for rural low-income mothers: an exploratory message design project.

    PubMed

    Aldoory, Linda; Braun, Bonnie; Maring, Elisabeth Fost; Duggal, Mili; Briones, Rowena Lynn

    2015-01-01

    Rural, low-income mothers face challenges to their health equal to or greater than those of low-income mothers from urban areas. This study put health message design into the hands of low-income rural mothers. The current study filled a research gap by analyzing a participatory process used to design health messages tailored to the everyday lives of rural low-income mothers. A total of forty-three mothers participated in nine focus groups, which were held from 2012 to 2013, in eight states. The mothers were from different racial and ethnic backgrounds. Participants discussed food security, physical activity, and oral health information. They created messages by considering several elements: visuals, length of message, voice/perspective, self-efficacy and personal control, emotional appeals, positive and negative reinforcements, and steps to health behavior change. This study was innovative in its focus on empowerment as a key process to health message design.

  1. Guidelines On The Selection And Design Of Messages For Changeable Message Signs

    DOT National Transportation Integrated Search

    1992-06-01

    THIS REPORT PRESENTS GUIDELINES ON THE DESIGN OF CHANGEABLE MESSAGE SIGN (CMS) MESSAGES FOR USE IN FREEWAY CORRIDORS FOR INCIDENT MANAGEMENT AND ROUTE DIVERSION. IT IS A COMPANION TO REPORT NO. FHWA/TX-92/1232-9, WHICH IS A PRIMER ON THE CHARACTERIST...

  2. #FoundThem-21st Century pre-search and post-detection seti protocols for social and digital media

    NASA Astrophysics Data System (ADS)

    Forgan, Duncan; Scholz, Alexander

    2016-09-01

    The transmission of news stories in global culture has changed fundamentally in the last three decades. The general public are alerted to breaking stories on increasingly rapid timescales, and the discussion/distortion of facts by writers, bloggers, commenters and Internet users can also be extremely fast. The narrative of a news item no longer belongs to a small cadre of conventional media outlets, but is instead synthesised to some level by the public as they select where and how they consume news. The IAA Search for Extraterrestrial Intelligence (SETI) post-detection protocols, initially drafted in 1989 and updated in 2010, were written to guide SETI scientists in the event of detecting evidence of extraterrestrial intelligence, but do not give guidance as to how scientists should prepare to navigate this media maelstrom. The protocols assume communication channels between scientists and the public still resemble those of 1989, which were specifically one-way with a narrative controlled by a select few media outlets. Modern SETI researchers must consider this modern paradigm for consumption of news by the public, using social media and other non-traditional outlets, when planning and executing searches for extraterrestrial intelligence. We propose additions to the post detection protocols as they pertain to the use of the Internet and social media, as well as pre-search protocols. It is our belief that such protocols are necessary if there is to be a well-informed, sane global conversation amongst the world's citizens following the discovery of intelligent life beyond the Earth.

  3. Searching for Cost-Optimized Interstellar Beacons

    NASA Astrophysics Data System (ADS)

    Benford, Gregory; Benford, James; Benford, Dominic

    2010-06-01

    What would SETI beacon transmitters be like if built by civilizations that had a variety of motives but cared about cost? In a companion paper, we presented how, for fixed power density in the far field, a cost-optimum interstellar beacon system could be built. Here, we consider how we should search for a beacon if it were produced by a civilization similar to ours. High-power transmitters could be built for a wide variety of motives other than the need for two-way communication; this would include beacons built to be seen over thousands of light-years. Extraterrestrial beacon builders would likely have to contend with economic pressures just as their terrestrial counterparts do. Cost, spectral lines near 1 GHz, and interstellar scintillation favor radiating frequencies substantially above the classic "water hole." Therefore, the transmission strategy for a distant, cost-conscious beacon would be a rapid scan of the galactic plane with the intent to cover the angular space. Such pulses would be infrequent events for the receiver. Such beacons built by distant, advanced, wealthy societies would have very different characteristics from what SETI researchers seek. Future searches should pay special attention to areas along the galactic disk where SETI searches have seen coherent signals that have not recurred on the limited listening time intervals we have used. We will need to wait for recurring events that may arriarrive in intermittent bursts. Several new SETI search strategies have emerged from these ideas. We propose a new test for beacons that is based on the Life Plane hypotheses.

  4. Searching for Cost-Optimized Interstellar Beacons

    NASA Technical Reports Server (NTRS)

    Benford, Gregory; Benford, James; Benford, Dominic

    2010-01-01

    What would SETI beacon transmitters be like if built by civilizations that had a variety of motives but cared about cost? In a companion paper, we presented how, for fixed power density in the far field, a cost-optimum interstellar beacon system could be built. Here, we consider how we should search for a beacon if it were produced by a civilization similar to ours. High-power transmitters could be built for a wide variety of motives other than the need for two-way communication, this would include beacons built to be seen over thousands of light-years. Extraterrestrial beacon builders would likely have to contend with economic pressures just as their terrestrial counterparts do. Cost, spectral lines near 1GHz, and interstellar scintillation favor radiating frequencies substantially above the classic "water hole." Therefore, the transmission strategy for a distant, cost-conscious beacon would be a rapid scan of the galactic plane with the intent to cover the angular space. Such pulses would be infrequent events for the receiver. Such beacons built by distant, advanced, wealthy societies would have very different characteristics from what SETI researchers seek. Future searches should pay special attention to areas along the galactic disk where SETI searches have seen coherent signals that have not recurred on the limited listening time intervals we have used. We will need to wait for recurring events that may arrive in intermittent bursts. Several new SETI search strategies have emerged from these ideas. We propose a new test for beacons that is based on the Life Plane hypotheses.

  5. Searching for cost-optimized interstellar beacons.

    PubMed

    Benford, Gregory; Benford, James; Benford, Dominic

    2010-06-01

    What would SETI beacon transmitters be like if built by civilizations that had a variety of motives but cared about cost? In a companion paper, we presented how, for fixed power density in the far field, a cost-optimum interstellar beacon system could be built. Here, we consider how we should search for a beacon if it were produced by a civilization similar to ours. High-power transmitters could be built for a wide variety of motives other than the need for two-way communication; this would include beacons built to be seen over thousands of light-years. Extraterrestrial beacon builders would likely have to contend with economic pressures just as their terrestrial counterparts do. Cost, spectral lines near 1 GHz, and interstellar scintillation favor radiating frequencies substantially above the classic "water hole." Therefore, the transmission strategy for a distant, cost-conscious beacon would be a rapid scan of the galactic plane with the intent to cover the angular space. Such pulses would be infrequent events for the receiver. Such beacons built by distant, advanced, wealthy societies would have very different characteristics from what SETI researchers seek. Future searches should pay special attention to areas along the galactic disk where SETI searches have seen coherent signals that have not recurred on the limited listening time intervals we have used. We will need to wait for recurring events that may arrive in intermittent bursts. Several new SETI search strategies have emerged from these ideas. We propose a new test for beacons that is based on the Life Plane hypotheses.

  6. Introduction to the special issue: message design in health communication research.

    PubMed

    Harrington, Nancy Grant

    2015-01-01

    Message design is one of the most complex and vibrant research areas in the communication discipline. Based on the preconference of the 2014 Kentucky Conference on Health Communication, this special issue of Health Communication is focused on a broad range of message design concerns. It features 10 original articles addressing topics ranging from fundamental questions related to theory and method to questions of message adaptation for translation and dissemination. Together, these articles reflect the rich variety of health behaviors addressed by health communication researchers and the breadth and depth of theoretical, methodological, and practical approaches to be considered in message design research.

  7. Search for extraterrestrial intelligence/High Resolution Microwave Survey team member

    NASA Technical Reports Server (NTRS)

    Steffes, Paul G.

    1994-01-01

    This final report summarizes activities conducted during the three years of the NASA High Resolution Microwave Survey (HRMS). With primary interest in the Sky Survey activity, the principal investigator attended nine Working Group meetings and traveled independently to conduct experiments or present results at other meetings. The major activity involved evaluating the effects of spaceborne radio frequency interference (RFI) on both the SETI sky survey and targeted search. The development of a database of all unclassified earth or biting and deep space transmitters, along with accompanying search software, was a key accomplishment. The software provides information about potential sources of interference and gives complete information regarding the frequencies, positions and levels of interference generated by the spacecraft. A complete description of this search system (called HRS, or HRMS RFI Search) is provided. Other accomplishments include development of a 32,000 channel Fast-Fourier-Transform Spectrum analyzer for use in studies of interference from satellites and in a 1.4 mm SETI observational study. The latest revision of HRS has now been distributed to the extended radio astronomy and SETI community.

  8. The Scientific Search for Extraterrestrials

    NASA Astrophysics Data System (ADS)

    Shostack, S.

    2001-05-01

    The premise of intelligent life elsewhere in the cosmos is an old one, but has recently gained new impetus from discoveries that suggest that planets are common and biologically friendly habitats could be plentiful. Since there is some chance that a large number of sentient societies could inhabit the galaxy, a small group of scientists have undertaken the research activity known as SETI, the Search for Extraterrestrial Intelligence. SETI's methods are well founded in both astronomy and engineering: it is an attempt to find technically sophisticated civilizations in situ by looking for narrow-band radio signals or short pulses of laser light from other star systems. The rapid increase in SETI capability gives some reason to expect that a signal detection might occur early in the 21st century. If so, it would demonstrate that the natural processes that have produced intelligence on this planet have spawned functionally similar intelligence elsewhere. This would be further evidence that not only physics and chemistry are universal, but biology and the evolution of intelligence are also cosmic, rather than merely earthly phenomena.

  9. New SETI prospects opened up by current information networking

    NASA Astrophysics Data System (ADS)

    Piotelat, Elisabeth; Cerceau, Florence Raulin

    2013-07-01

    This paper discusses ideas that impact the f c factor as defined by Frank Drake in 1961, i.e. the fraction of planets with intelligent creatures capable of interstellar communication. This factor remains one of the most speculative terms of the equation. We suggest that the ability of sharing information is an important parameter to take into account in evaluating the tendency of a civilization to make contact (or share data) with other civilizations. Thus, we give special consideration to the fraction of planets with intelligent creatures capable of producing and sharing large amount of data. First, we determine the level of our own civilization in the framework of Sagan's energy- and information-based classification, by taking into account the recent improvements in computing and networking technologies. Second, we distinguish two types of organization, hierarchical and heterarchical, with respect to information sharing. We illustrate this distinction in the case of SETI and we show that the probability to detect a civilization would be greater if it is heterarchical than if it is hierarchical and if we utilize heterarchical principles for SETI.

  10. New Assumptions to Guide SETI Research

    NASA Technical Reports Server (NTRS)

    Colombano, S. P.

    2018-01-01

    The recent Kepler discoveries of Earth-like planets offer the opportunity to focus our attention on detecting signs of life and technology in specific planetary systems, but I feel we need to become more flexible in our assumptions. The reason is that, while it is still reasonable and conservative to assume that life is most likely to have originated in conditions similar to ours, the vast time differences in potential evolutions render the likelihood of "matching" technologies very slim. In light of these challenges I propose a more "aggressive"� approach to future SETI exploration in directions that until now have received little consideration.

  11. Goldstone field test activities: Target search

    NASA Technical Reports Server (NTRS)

    Tarter, J.

    1986-01-01

    In March of this year prototype SETI equipment was installed at DSS13, the 26 meter research and development antenna at NASA's Goldstone complex of satellite tracking dishes. The SETI equipment will remain at this site at least through the end of the summer so that the hardware and software developed for signal detection and recognition can be fully tested in a dynamic observatory environment. The field tests are expected to help understand which strategies for observing and which signal recognition algorithms perform best in the presence of strong man-made interfering signals (RFI) and natural astronomical sources.

  12. Designing Anti-Binge Drinking Prevention Messages: Message Framing vs. Evidence Type.

    PubMed

    Kang, Hannah; Lee, Moon J

    2017-09-27

    We investigated whether presenting anti-binge drinking health campaign messages in different message framing and evidence types influences college students' intention to avoid binge drinking, based on prospect theory (PT) and exemplification theory. A 2 (message framing: loss-framed message/gain-framed message) X 2 (evidence type: statistical/narrative) between-subjects factorial design with a control group was conducted with 156 college students. College students who were exposed to the loss-framed message condition exhibited a higher level of intention to avoid binge drinking in the near future than those who did not see any messages (the control group). This finding was mainly among non-binge drinkers. Regardless of evidence type, those who were exposed to the messages exhibited a higher level of intention to avoid binge drinking than those in the control group. This is also mainly among non-binge drinkers. We also found the main effects of message framing and evidence type on attitude toward the message and the main effect of message framing on attitude toward drinking.

  13. Texting for Health: The Use of Participatory Methods to Develop Healthy Lifestyle Messages for Teens

    ERIC Educational Resources Information Center

    Hingle, Melanie; Nichter, Mimi; Medeiros, Melanie; Grace, Samantha

    2013-01-01

    Objective: To develop and test messages and a mobile phone delivery protocol designed to influence the nutrition and physical activity knowledge, attitudes, and behavior of adolescents. Design: Nine focus groups, 4 classroom discussions, and an 8-week pilot study exploring message content, format, origin, and message delivery were conducted over…

  14. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Benford, James N.; Benford, Dominic J., E-mail: jimbenford@gmail.com

    The most observable leakage radiation from an advanced civilization may well be from the use of power beaming to transfer energy and accelerate spacecraft. Applications suggested for power beaming involve launching spacecraft to orbit, raising satellites to a higher orbit, and interplanetary concepts involving space-to-space transfers of cargo or passengers. We also quantify beam-driven launch to the outer solar system, interstellar precursors, and ultimately starships. We estimate the principal observable parameters of power beaming leakage. Extraterrestrial civilizations would know their power beams could be observed, and so could put a message on the power beam and broadcast it for ourmore » receipt at little additional energy or cost. By observing leakage from power beams we may find a message embedded on the beam. Recent observations of the anomalous star KIC 8462852 by the Allen Telescope Array (ATA) set some limits on extraterrestrial power beaming in that system. We show that most power beaming applications commensurate with those suggested for our solar system would be detectable if using the frequency range monitored by the ATA, and so the lack of detection is a meaningful, if modest, constraint on extraterrestrial power beaming in that system. Until more extensive observations are made, the limited observation time and frequency coverage are not sufficiently broad in frequency and duration to produce firm conclusions. Such beams would be visible over large interstellar distances. This implies a new approach to the SETI search: instead of focusing on narrowband beacon transmissions generated by another civilization, look for more powerful beams with much wider bandwidth. This requires a new approach for their discovery by telescopes on Earth. Further studies of power beaming applications should be performed, potentially broadening the parameter space of the observable features that we have discussed here.« less

  15. The pioneers of interplanetary communication: From Gauss to Tesla

    NASA Astrophysics Data System (ADS)

    Raulin-Cerceau, Florence

    2010-12-01

    The present overview covers the period from 1820 to the beginning of the 20th century. Emphasis is laid on the latter half of the 19th century because many efforts have been done at that time to elaborate schemes for contacting our neighboring planets by interplanetary telegraphy. This period knew many advances not only in planetary studies but also in the nascent field of telecommunications. Such a context led astronomers who were also interested in the problem of planetary habitability, to envisage that other planets could be contacted, especially the planet Mars. Interplanetary communication using a celestial telegraphy was planned during this period of great speculations about life on Mars. This paper focuses on four authors: the Frenchmen C. Flammarion, Ch. Cros, A. Mercier and the Serbian N. Tesla, who formulated early proposals to communicate with Mars or Venus. The first proposals (which remained only theoretical) showed that an initial reflection had started as early as the second part of the 19th century on the type of language that could be both universal and distinguishable from a natural signal. Literary history of interplanetary communication preceded by far the scientific one. Authors of the 1900s were very prolific on this topic. French fictions are mentioned in this paper as examples of such a literature. This incursion into selected texts stresses the fact that the problem of techniques and messages employed to communicate with other planets goes beyond the strict scientific framework. Finally, this paper aims to highlight the similarities as well as the differences between the different proposals and to underline what that could possibly help present SETI research to define messages supposed to be sent to other planetary systems.

  16. Evolution and mass extinctions as lognormal stochastic processes

    NASA Astrophysics Data System (ADS)

    Maccone, Claudio

    2014-10-01

    In a series of recent papers and in a book, this author put forward a mathematical model capable of embracing the search for extra-terrestrial intelligence (SETI), Darwinian Evolution and Human History into a single, unified statistical picture, concisely called Evo-SETI. The relevant mathematical tools are: (1) Geometric Brownian motion (GBM), the stochastic process representing evolution as the stochastic increase of the number of species living on Earth over the last 3.5 billion years. This GBM is well known in the mathematics of finances (Black-Sholes models). Its main features are that its probability density function (pdf) is a lognormal pdf, and its mean value is either an increasing or, more rarely, decreasing exponential function of the time. (2) The probability distributions known as b-lognormals, i.e. lognormals starting at a certain positive instant b>0 rather than at the origin. These b-lognormals were then forced by us to have their peak value located on the exponential mean-value curve of the GBM (Peak-Locus theorem). In the framework of Darwinian Evolution, the resulting mathematical construction was shown to be what evolutionary biologists call Cladistics. (3) The (Shannon) entropy of such b-lognormals is then seen to represent the `degree of progress' reached by each living organism or by each big set of living organisms, like historic human civilizations. Having understood this fact, human history may then be cast into the language of b-lognormals that are more and more organized in time (i.e. having smaller and smaller entropy, or smaller and smaller `chaos'), and have their peaks on the increasing GBM exponential. This exponential is thus the `trend of progress' in human history. (4) All these results also match with SETI in that the statistical Drake equation (generalization of the ordinary Drake equation to encompass statistics) leads just to the lognormal distribution as the probability distribution for the number of extra-terrestrial civilizations existing in the Galaxy (as a consequence of the central limit theorem of statistics). (5) But the most striking new result is that the well-known `Molecular Clock of Evolution', namely the `constant rate of Evolution at the molecular level' as shown by Kimura's Neutral Theory of Molecular Evolution, identifies with growth rate of the entropy of our Evo-SETI model, because they both grew linearly in time since the origin of life. (6) Furthermore, we apply our Evo-SETI model to lognormal stochastic processes other than GBMs. For instance, we provide two models for the mass extinctions that occurred in the past: (a) one based on GBMs and (b) the other based on a parabolic mean value capable of covering both the extinction and the subsequent recovery of life forms. (7) Finally, we show that the Markov & Korotayev (2007, 2008) model for Darwinian Evolution identifies with an Evo-SETI model for which the mean value of the underlying lognormal stochastic process is a cubic function of the time. In conclusion: we have provided a new mathematical model capable of embracing molecular evolution, SETI and entropy into a simple set of statistical equations based upon b-lognormals and lognormal stochastic processes with arbitrary mean, of which the GBMs are the particular case of exponential growth.

  17. CDC MessageWorks: Designing and Validating a Social Marketing Tool to Craft and Defend Effective Messages.

    PubMed

    Cole, Galen E; Keller, Punam A; Reynolds, Jennifer; Schaur, Michelle; Krause, Diane

    2016-03-01

    The Centers for Disease Control and Prevention's Division of Cancer Prevention and Control, in partnership with Oak Ridge Associated Universities, designed an online social marketing strategy tool, MessageWorks, to help health communicators effectively formulate messages aimed at changing health behaviors and evaluate message tactics and audience characteristics. MessageWorks is based on the advisor for risk communication model that identifies 10 variables that can be used to predict target audience intentions to comply with health recommendations. This article discusses the value of the MessageWorks tool to health communicators and to the field of social marketing by (1) describing the scientific evidence supporting use of MessageWorks to improve health communication practice and (2) summarizing how to use MessageWorks and interpret the results it produces.

  18. Wide-bandwidth high-resolution search for extraterrestrial intelligence

    NASA Technical Reports Server (NTRS)

    Horowitz, Paul

    1995-01-01

    Research was accomplished during the third year of the grant on: BETA architecture, an FFT array, a feature extractor, the Pentium array and workstation, and a radio astronomy spectrometer. The BETA (this SETI project) system architecture has been evolving generally in the direction of greater robustness against terrestrial interference. The new design adds a powerful state-memory feature, multiple simultaneous thresholds, and the ability to integrate multiple spectra in a flexible state-machine architecture. The FFT array is reported with regards to its hardware verification, array production, and control. The feature extractor is responsible for maintaining a moving baseline, recognizing large spectral peaks, following the progress of previously identified interesting spectral regions, and blocking signals from regions previously identified as containing interference. The Pentium array consists of 21 Pentium-based PC motherboards, each with 16 MByte of RAM and an Ethernet interface. Each motherboard receives and processes the data from a feature extractor/correlator board set, passing on the results of a first analysis to the central Unix workstation (through which each is also booted). The radio astronomy spectrometer is a technological spinoff from SETI work. It is proposed to be a combined spectrometer and power-accumulator, for use at Arecibo Observatory to search for neutral hydrogen emission from condensations of neutral hydrogen at high redshift (z = 5).

  19. The Breakthrough Listen Initiative and the Future of the Search for Intelligent Life

    NASA Astrophysics Data System (ADS)

    Enriquez, J. Emilio; Siemion, Andrew; Falcke, Heino; Croft, Steve; DeBoer, David R.; Gajjar, Vishal; Hickish, Jack; Isaacson, Howard T.; Lebofsky, Matt; MacMahon, David; Price, Danny C.; Tellis, Nate; Werthimer, Dan; ter Veen, Sander; Garrett, Michael A.; Hellbourg, Greg

    2017-01-01

    Unprecedented recent results in the fields of exoplanets and astrobiology have dramatically increased the interest in the potential existence of intelligent life elsewhere in the galaxy. Additionally, the capabilities of modern Searches for Extraterrestrial Intelligence (SETI) have increased tremendously. Much of this improvement is due to the ongoing development of wide bandwidth radio instruments and the Moore’s Law increase in computational power over the previous decades. Together, these instrumentation improvements allow for narrow band signal searches of billions of frequency channels at once.The Breakthrough Listen Initiative (BL) was launched on July 20, 2015 at the Royal Society in London, UK with a charge to conduct the most comprehensive and sensitive search for advanced life in humanity’s history. Here we detail important milestones achieved during the first year of the program, describe the key BL SETI surveys and briefly describe current facilities, including the Green Bank Telescope, the Automated Planet Finder and the Parkes Observatory.Complementary to the BL initiative (at a smaller scale), pioneering SETI work at low radio frequencies (20-250 MHz) is being undertaken with the LOw Frequency ARray (LOFAR). This program uses simple fixed-stationary antennas and multiple phased-array beams formed in a supercomputer to search many targets at once and will lay the groundwork for future searches with SKA1-low and mid frequency aperture array pathfinders. We will present the results of a volume complete sample of nearby stars (< 5pc) observed with LOFAR, searching for drifting narrow band signals with expected Doppler drifts covering a wide range of potential transmitter host planets.We conclude with a brief view towards future SETI searches with upcoming next-generation radio facilities such as SKA and ngVLA.

  20. Designing Tailored Messages about Smoking and Breast Cancer: A Focus Group Study with Youth.

    PubMed

    Bottorff, Joan L; Haines-Saah, Rebecca; Oliffe, John L; Struik, Laura L; Bissell, Laura J L; Richardson, Chris P; Gotay, Carolyn; Johnson, Kenneth C; Hutchinson, Peter

    2014-03-01

    The purpose of this study was to design an approach to supporting the development of gender- and Aboriginal-specific messages regarding the link between tobacco exposure and breast cancer, drawing on youth perspectives. Focus groups were held with 18 girls (8 First Nations and Métis) and 25 boys (12 First Nations and Métis) to solicit advice in the design of messages. Transcribed data were analyzed for themes. Girls preferred messages that included the use of novel images, a personal story of breast cancer, and ways to avoid secondhand smoke. Boys endorsed messages that were "catchy" but not "cheesy" and had masculine themes. First Nations and Métis participants confirmed the use of Aboriginal symbols in messages as signalling their relevance to youth in their communities. The results can be used as a guide in developing tailored health promotion messages. Challenges in developing gender-appropriate messages for youth are described. Copyright© by Ingram School of Nursing, McGill University.

  1. Assessing college students' attitudes toward responsible drinking messages to identify promising binge drinking intervention strategies.

    PubMed

    Pilling, Valerie K; Brannon, Laura A

    2007-01-01

    Health communication appeals were utilized through a Web site simulation to evaluate the potential effectiveness of 3 intervention approaches to promote responsible drinking among college students. Within the Web site simulation, participants were exposed to a persuasive message designed to represent either the generalized social norms advertising approach (based on others' behavior), the personalized behavioral feedback approach (tailored to the individual's behavior), or the schema-based approach (tailored to the individual's self-schema, or personality). A control group was exposed to a message that was designed to be neutral (it was designed to discourage heavy drinking, but it did not represent any of the previously mentioned approaches). It was hypothesized that the more personalized the message was to the individual, the more favorable college students' attitudes would be toward the responsible drinking message. Participants receiving the more personalized messages did report more favorable attitudes toward the responsible drinking message.

  2. CDC MessageWorks: Designing and Validating a Social Marketing Tool to Craft and Defend Effective Messages

    PubMed Central

    Cole, Galen E.; Keller, Punam A.; Reynolds, Jennifer; Schaur, Michelle; Krause, Diane

    2016-01-01

    The Centers for Disease Control and Prevention’s Division of Cancer Prevention and Control, in partnership with Oak Ridge Associated Universities, designed an online social marketing strategy tool, MessageWorks, to help health communicators effectively formulate messages aimed at changing health behaviors and evaluate message tactics and audience characteristics. MessageWorks is based on the advisor for risk communication model that identifies 10 variables that can be used to predict target audience intentions to comply with health recommendations. This article discusses the value of the MessageWorks tool to health communicators and to the field of social marketing by (1) describing the scientific evidence supporting use of MessageWorks to improve health communication practice and (2) summarizing how to use MessageWorks and interpret the results it produces. PMID:26877714

  3. The windows of SETI - Frequency and time in the search for extraterrestrial intelligence

    NASA Technical Reports Server (NTRS)

    Oliver, Bernard M.

    1987-01-01

    Since interstellar travel is not economically possible on the time scale of a human lifetime, communication with extraterrestrials can be achieved only by sending some form of energy or matter across space; photons (electromagnetic waves) are best. Of particular interest to SETI is the region from about 1,000-60,000 MHz known as the free-space microwave window. During the course of NASA's Cyclops program, it was pointed out that the hydrogen and hydroxyl lines bounded a band in which there were no other known lines. The threatened loss of the microwave window to earth-based services is discussed.

  4. Exoplanets and SETI

    NASA Astrophysics Data System (ADS)

    Wright, Jason T.

    The discovery of exoplanets has both focused and expanded the search for extraterrestrial intelligence. The consideration of Earth as an exoplanet, the knowledge of the orbital parameters of individual exoplanets, and our new understanding of the prevalence of exoplanets throughout the galaxy have all altered the search strategies of communication SETI efforts, by inspiring new "Schelling points" (i.e. optimal search strategies for beacons). Future efforts to characterize individual planets photometrically and spectroscopically, with imaging and via transit, will also allow for searches for a variety of technosignatures on their surfaces, in their atmospheres, and in orbit around them. In the near-term, searches for new planetary systems might even turn up free-floating megastructures.

  5. Lick Observatory Optical SETI: targeted search and new directions.

    PubMed

    Stone, R P S; Wright, S A; Drake, F; Muñoz, M; Treffers, R; Werthimer, D

    2005-10-01

    Lick Observatory's Optical SETI (search for extraterrestrial intelligence) program has been in regular operation for 4.5 years. We have observed 4,605 stars of spectral types F-M within 200 light-years of Earth. Occasionally, we have appended objects of special interest, such as stars with known planetary systems. We have observed 14 candidate signals ("triple coincidences"), all but one of which are explained by transient local difficulties. Additional observations of the remaining candidate have failed to confirm arriving pulse events. We now plan to proceed in a more economical manner by operating in an unattended drift scan mode. Between operational and equipment modifications, efficiency will more than double.

  6. Astrobiology in culture: the search for extraterrestrial life as "science".

    PubMed

    Billings, Linda

    2012-10-01

    This analysis examines the social construction of authority, credibility, and legitimacy for exobiology/astrobiology and, in comparison, the search for extraterrestrial intelligence (SETI), considering English-language conceptions of these endeavors in scientific culture and popular culture primarily in the United States. The questions that define astrobiology as a scientific endeavor are multidisciplinary in nature, and this endeavor is broadly appealing to public audiences as well as to the scientific community. Thus, it is useful to examine astrobiology in culture-in scientific culture, official culture, and popular culture. A researcher may explore science in culture, science as culture, by analyzing its rhetoric, the primary means that people use to construct their social realities-their cultural environment, as it were. This analysis follows this path, considering scientific and public interest in astrobiology and SETI and focusing on scientific and official constructions of the two endeavors. This analysis will also consider whether and how scientific and public conceptions of astrobiology and SETI, which are related but at the same time separate endeavors, converge or diverge and whether and how these convergences or divergences affect the scientific authority, credibility, and legitimacy of these endeavors.

  7. Broad horizons SETI, SF and education

    NASA Astrophysics Data System (ADS)

    Griffiths, Martin

    2004-04-01

    Science fiction (SF) is often perceived as a ‘fringe’ form of entertainment that excites the socially challenged. This misperception detracts from the critical, scientific and interpretive nature of the genre which can be directed into science teaching at school and university levels as an innovative way of exploring the cultural background, politics, leitmotif and themes of society, science and their operation. One example is the ‘alien’ theme in SF; it is perceptually one of the driving factors in the search for extraterrestrial intelligence (SETI). Such a topic can become an introduction to current technology, the motives and politics of science and the sociological implications inherent in a confrontation with the ideal of man's uniqueness in the cosmos. When applied to the SETI, SF engenders a constructive convergence in studies such as biological determinism, the evolution of life, communication, interstellar travel and methods of contact, thus enriching the consideration of possible life in the cosmos. Adopting elements of SF in lifelong learning therefore enables informed, imaginative reflection and debate that educates, trains and instructs, broadening the potential of students and their future roles by invoking an analysis of vital public, scientific and humanistic fields.

  8. The SERENDIP 2 SETI project: Current status

    NASA Technical Reports Server (NTRS)

    Bowyer, C. S.; Werthimer, D.; Donnelly, C.; Herrick, W.; Lampton, M.

    1991-01-01

    Over the past 30 years, interest in extraterrestrial intelligence has progressed from philosophical discussion to rigorous scientific endeavors attempting to make contact. Since it is impossible to assess the probability of success and the amount of telescope time needed for detection, Search for Extraterrestrial Intelligence (SETI) Projects are plagued with the problem of attaining the large amounts of time needed on the world's precious few large radio telescopes. To circumvent this problem, the Search for Extraterrestrial Radio Emissions from Nearby Developed Intelligent Populations (SERENDIP) instrument operates autonomously in a piggyback mode utilizing whatever observing plan is chosen by the primary observer. In this way, large quantities of high-quality data can be collected in a cost-effective and unobtrusive manner. During normal operations, SERENDIP logs statistically significant events for further offline analysis. Due to the large number of terrestrial and near-space transmitters on earth, a major element of the SERENDIP project involves identifying and rejecting spurious signals from these sources. Another major element of the SERENDIP Project (as well as most other SETI efforts) is detecting extraterrestrial intelligence (ETI) signals. Events selected as candidate ETI signals are studied further in a targeted search program which utilizes between 24 to 48 hours of dedicated telescope time each year.

  9. Exobiology and SETI from the lunar farside

    NASA Technical Reports Server (NTRS)

    Tarter, Jill C.; Rummel, John

    1990-01-01

    Within the Life Sciences Division of NASA, the Exobiology Program seeks to understand the origin, evolution and distribution of life in the universe. There are two feasible methods of searching for life beyond the earth. The first is to return to Mars and systematically explore its surface and subsurface with instrumentation capable of identifying extinct as well as extant life. The second is to search for advanced forms of life in other planetary systems that have developed a technology capable of modifying their environment in ways that make it detectable across the vast interstellar distances. The Exobiology Program is currently pursuing both of these options. If NASA's SETI (search for extraterrestrial intelligence) Microwave Observing Project of the 1990s fails to detect evidence of radio signals generated by an extraterrestrial technology, what might be the next step? The establishment of a permanent lunar base early in the next century may enable the construction of large aperture radio telescopes that can extend both the sensitivity and the frequency range of SETI observations. A lunar base may also provide the opportunity for construction of optical and IR telescopes intended for the direct detection of extrasolar planetary systems.

  10. A near-infrared SETI experiment: A multi-time resolution data analysis

    NASA Astrophysics Data System (ADS)

    Tallis, Melisa; Maire, Jerome; Wright, Shelley; Drake, Frank D.; Duenas, Andres; Marcy, Geoffrey W.; Stone, Remington P. S.; Treffers, Richard R.; Werthimer, Dan; NIROSETI

    2016-06-01

    We present new post-processing routines which are used to detect very fast optical and near-infrared pulsed signals using the latest NIROSETI (Near-Infrared Optical Search for Extraterrestrial Intelligence) instrument. NIROSETI was commissioned in 2015 at Lick Observatory and searches for near-infrared (0.95 to 1.65μ) nanosecond pulsed laser signals transmitted by distant civilizations. Traditional optical SETI searches rely on analysis of coincidences that occur between multiple detectors at a fixed time resolution. We present a multi-time resolution data analysis that extends our search from the 1ns to 1ms range. This new feature greatly improves the versatility of the instrument and its search parameters for near-infrared SETI. We aim to use these algorithms to assist us in our search for signals that have varying duty cycles and pulse widths. We tested the fidelity and robustness of our algorithms using both synthetic embedded pulsed signals, as well as data from a near-infrared pulsed laser installed on the instrument. Applications of NIROSETI are widespread in time domain astrophysics, especially for high time resolution transients, and astronomical objects that emit short-duration high-energy pulses such as pulsars.

  11. The Tomb of SETI i (KV17) in the Florence Egyptian Museum. Integrated Non-Invasive Methods for Documentation, Material History and Diagnostics

    NASA Astrophysics Data System (ADS)

    Coppola, M.; Bracci, S.; Cantisani, E.; Magrini, D.

    2017-05-01

    The tomb of Seti I (KV17) is a magnificent example of New Kingdom funerary architecture, among the longest tombs in the Valley of the Kings. As part of a collaboration between the Egyptian Museum in Florence, the University of Florence and CNR, a survey project was launched, with non-invasive methods, on the fragments from the Seti I tomb, in Florence, coming from a gate jamb connecting the chamber F to the corridor G, taken by the franco-tuscan expedition in 1829. The primary goal is to achieve the best level of documentation, knowledge of the material history and conservation assessment. Preliminary results allowed to focus some steps of the history of this fragment, from its realization to the present. The digital documentation created an excellent support for the mapping and management of the collected information. Even if still on a preliminary phase, this study shows how the combination of imaging and spectroscopic techniques allowed the characterization of many materials and the mapping of their distribution on the surface. Several original pigments have been identified as well as many anomalies due to subsequent interventions.

  12. Kepler Mission IYA Teacher Professional Development Workshops

    NASA Astrophysics Data System (ADS)

    Devore, E. K.; Harman, P.; Gould, A. D.; Koch, D.

    2009-12-01

    NASA's Kepler Mission conducted six teacher professional development workshops on the search for Earth-size in the habitable zone of Sun-like stars. The Kepler Mission launched in March, 2009. As a part of International Year of Astronomy 2009, this series of one-day workshops were designed and presented for middle and high school teachers, and science center and planetarium educators prior to and after the launch. The professional development workshops were designed using the best practices and principals from the National Science Education Standards and similar documents. Sharing the outcome of our plans, strategies and formative evaluation results can be of use to other Education and Public Outreach practitioners who plan similar trainings. Each event was supported by a Kepler team scientist, two Education & Public Outreach staff and local hosts. The workshops combined a science content lecture and discussion, making models, kinesthetic activities, and interpretation of transit data. The emphasis was on inquiry-based instruction and supported science education standards in grades 7-12. Participants’ kit included an orrery, optical sensor and software to demonstrate transit detection. The workshop plan, teaching strategies, and lessons learned from evaluation will be discussed. Future events are planned. Kepler's Education and Public Outreach program is jointly conducted by the SETI Institute and Lawrence Hall of Science at UC Berkeley in close coordination with the Kepler Mission at NASA Ames Research Center. The IYA Kepler Teacher Professional Development workshops were supported by NASA Grants to the E. DeVore, SETI Institute NAG2-6066 Kepler Education and Public Outreach and NNX08BA74G, IYA Kepler Mission Pre-launch Workshops. Teachers participate in human orrery.

  13. Developing and Pretesting a Text Messaging Program for Health Behavior Change: Recommended Steps.

    PubMed

    Abroms, Lorien C; Whittaker, Robyn; Free, Caroline; Mendel Van Alstyne, Judith; Schindler-Ruwisch, Jennifer M

    2015-12-21

    A growing body of evidence demonstrates that text messaging-based programs (short message service [SMS]) on mobile phones can help people modify health behaviors. Most of these programs have consisted of automated and sometimes interactive text messages that guide a person through the process of behavior change. This paper provides guidance on how to develop text messaging programs aimed at changing health behaviors. Based on their collective experience in designing, developing, and evaluating text messaging programs and a review of the literature, the authors drafted the guide. One author initially drafted the guide and the others provided input and review. Steps for developing a text messaging program include conducting formative research for insights into the target audience and health behavior, designing the text messaging program, pretesting the text messaging program concept and messages, and revising the text messaging program. The steps outlined in this guide may help in the development of SMS-based behavior change programs.

  14. User evaluations of design complexity: the impact of visual perceptions for effective online health communication.

    PubMed

    Lazard, Allison; Mackert, Michael

    2014-10-01

    This paper highlights the influential role of design complexity for users' first impressions of health websites. An experimental design was utilized to investigate whether a website's level of design complexity impacts user evaluations. An online questionnaire measured the hypothesized impact of design complexity on predictors of message effectiveness. Findings reveal that increased design complexity was positively associated with higher levels of perceived design esthetics, attitude toward the website, perceived message comprehensibility, perceived ease of use, perceived usefulness, perceived message quality, perceived informativeness, and perceived visual informativeness. This research gives further evidence that design complexity should be considered an influential variable for health communicators to effectively reach their audiences, as it embodies the critical first step for message evaluation via electronic platforms. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  15. Astrobiology Research Experience for Undergraduates: An Interdisciplinary REU Program at the SETI Institute

    NASA Astrophysics Data System (ADS)

    Phillips, C. B.; Devore, E. K.

    2009-12-01

    The SETI Institute hosts a summer Astrobiology Research Experience for Undergraduates program for highly motivated students interested in astrobiology research. Students work with scientists at the SETI Institute and at the nearby NASA Ames Research Center on projects spanning the field of astrobiology from microbiology to planetary geology to astronomy and astrophysics. Each student is mentored by a scientist for his/her summer research project. As astrobiology is interdisciplinary, the first week includes a seminar series to provide a broad foundation in the field as the students begin their research projects. The 10-week program includes a week-long field trip to the SETI Institute’s Allen Telescope Array, located at the Hat Creek Radio Astronomy Observatory in Northern California, as well as a field experience at hydrothermal systems at nearby Lassen Volcanic National Park. Students also participate in local field trips to places like the California Academy of Sciences and other nearby locations of scientific interest, and attend seminars, lectures, and discussions on astrobiology. Students are also invited to attend events at nearby NASA Ames Research Center, which offers the opportunity to interact with other undergraduate and graduate students participating in NASA summer programs. At the end of the program, students write up and present their research projects, and mentors recommend some projects for submission to a national scientific conference, which the selected students will be funded to attend. The Astrobiology REU program emphasizes three main areas, which are listed in the table along with typical project themes. Each year, specific student research projects are described on the website, and students are asked to select the three that most interest them as a part of their applications. Applications are due in early February. Typically, 10 students apply for each available position. Students have been selected from colleges and universities national-wide, including community colleges. The Astrobiology REU program has served 4 classes of students, and is funded through summer of 2011. A total of 61 students have participated (12 in 2006, 17 in 2007, 17 in 2008, and 15 in 2009); all have successfully completed their internships. Of these students, 59% were women, and 21% were minorities. To date 18 students have gone on to graduate studies, in Master’s or PhD programs at schools including Harvard, UC Berkeley, UC Santa Cruz, Stanford, Univ. of Nebraska, and many others, in fields including astronomy, optical science, space life sciences, geology, physics, mechanical engineering, and molecular and cellular biology. The SETI Institute is a non-profit private scientific research institution located in California’s Silicon Valley. The Astrobiology REU program is supported by National Science Foundation Grant AST-0852095 with additional funding from NASA’s Astrobiology Institute, the SETI Institute and private donors.Main research areas and typical project themes

  16. Using Visual Metaphors in Health Messages: A Strategy to Increase Effectiveness for Mental Illness Communication.

    PubMed

    Lazard, Allison J; Bamgbade, Benita A; Sontag, Jennah M; Brown, Carolyn

    2016-12-01

    Depression is highly prevalent among college students. Although treatment is often available on university campuses, many stigma-based barriers prevent students from seeking help. Communication strategies, such as the use of metaphors, are needed to reduce barriers. Specially, the use of visual metaphors, as a strategic message design tactic, may be an effective communication strategy to increase message appeal and engagement. Using a 2-phase approach, this study first identified common metaphors students use to conceptualize mental illness. Messages incorporating conceptual and visual metaphors were then designed and tested to determine their potential in reducing stigma. Participants (n = 256) were randomly assigned to 1 of 4 conditions in a between-subjects experiment: messages with visual and textual metaphors, messages with straightforward visuals and textual metaphors, text-based metaphor messages, or a control group. Overall, metaphorical messages are appealing, the use of visual metaphors leads to greater message engagement, and messages based on conceptual metaphors have the potential to reduce stigma. The use of conceptual and visual metaphors in campaign design is an effective strategy to communicate about a complex health topic, such as mental illness, and should be considered for use in campaigns to reduce barriers for help-seeking behavior.

  17. Matching Message Design and Depressed Cognition: An Exploration of Attention Patterns for Gain- and Loss-Framed Depression Help-Seeking Messages.

    PubMed

    Lueck, Jennifer A

    2017-07-01

    Although disproportionally affected by depression, most depressed college students do not seek the help they need. Research has recently uncovered the potential negative effects of depression help-seeking messages if depressed cognition is not considered in the health message design process. It is unclear if depression determines whether and how individuals pay attention to gain- and loss-framed depression help-seeking messages-a mechanism that has significant implications for the strategic planning of health communication interventions. In order to enable the effective matching of message design and audience features, this study investigated attention patterns for gain (n = 75)- and loss (n = 78)-framed depression help-seeking messages using eye-tracking technology and self-report measures. The results confirmed that depression is a characteristic of risk avoidance and negative cognition. Depressed participants tended to pay more attention to disease information that was placed in a loss-framed rather than a gain-framed depression help-seeking message. Using negative message framing strategies for health messages seeking to educate about depression symptoms might therefore be a useful persuasive strategy-particularly when disseminated to vulnerable populations affected by depression. Furthermore, the present study emphasizes the effective use of eye-tracking technology in communication research.

  18. A contest to create media messages aimed at recruiting adolescents for stop smoking programs.

    PubMed

    Croghan, Ivana T; Campbell, Heather M; Patten, Christi A; Croghan, Gary A; Schroeder, Darrell R; Novotny, Paul J

    2004-10-01

    This project engaged adolescents in a contest to create advertising messages aimed at recruiting teens for stop smoking programs. Middle school students were invited to design a media message for television, radio, Web, or print (newspaper or billboard). Of 4,289 students in eight middle schools of Rochester, Minn., 265 (6.2%) developed 172 stop smoking messages. The quality of their work confirmed that teens can design media messages to encourage their smoking adolescent peers to enroll in a program to stop smoking.

  19. New Evo-SETI results about civilizations and molecular clock

    NASA Astrophysics Data System (ADS)

    Maccone, Claudio

    2017-01-01

    In two recent papers (Maccone 2013, 2014) as well as in the book (Maccone 2012), this author described the Evolution of life on Earth over the last 3.5 billion years as a lognormal stochastic process in the increasing number of living Species. In (Maccone 2012, 2013), the process used was `Geometric Brownian Motion' (GBM), largely used in Financial Mathematics (Black-Sholes models). The GBM mean value, also called `the trend', always is an exponential in time and this fact corresponds to the so-called `Malthusian growth' typical of population genetics. In (Maccone 2014), the author made an important generalization of his theory by extending it to lognormal stochastic processes having an arbitrary trend m L (t), rather than just a simple exponential trend as the GBM have. The author named `Evo-SETI' (Evolution and SETI) his theory inasmuch as it may be used not only to describe the full evolution of life on Earth from RNA to modern human societies, but also the possible evolution of life on exoplanets, thus leading to SETI, the current Search for ExtraTerrestrial Intelligence. In the Evo-SETI Theory, the life of a living being (let it be a cell or an animal or a human or a Civilization of humans or even an ET Civilization) is represented by a b-lognormal, i.e. a lognormal probability density function starting at a precise instant b (`birth') then increasing up to a peak-time p, then decreasing to a senility-time s (the descending inflexion point) and then continuing as a straight line down to the death-time d (`finite b-lognormal'). (1) Having so said, the present paper describes the further mathematical advances made by this author in 2014-2015, and is divided in two halves: Part One, devoted to new mathematical results about the History of Civilizations as b-lognormals, and (2) Part Two, about the applications of the Evo-SETI Theory to the Molecular Clock, well known to evolutionary geneticists since 50 years: the idea is that our EvoEntropy grows linearly in time just as the molecular clock. (a) Summarizing the new results contained in this paper: In Part One, we start from the History Formulae already given in (Maccone 2012, 2013) and improve them by showing that it is possible to determine the b-lognormal not only by assigning its birth, senility and death, but rather by assigning birth, peak and death (BPD Theorem: no assigned senility). This is precisely what usually happens in History, when the life of a VIP is summarized by giving birth time, death time, and the date of the peak of activity in between them, from which the senility may then be calculated (approximately only, not exactly). One might even conceive a b-scalene (triangle) probability density just centred on these three points (b, p, d) and we derive the relevant equations. As for the uniform distribution between birth and death only, that is clearly the minimal description of someone's life, we compare it with both the b-lognormal and the b-scalene by comparing the Shannon Entropy of each, which is the measure of how much information each of them conveys. Finally we prove that the Central Limit Theorem (CLT) of Statistics becomes a new `E-Pluribus-Unum' Theorem of the Evo-SETI Theory, giving formulae by which it is possible to find the b-lognormal of the History of a Civilization C if the lives of its Citizens C i are known, even if only in the form of birth and death for the vast majority of the Citizens. (b) In Part Two, we firstly prove the crucial Peak-Locus Theorem for any given trend m L (t) and not just for the GBM exponential. Then we show that the resulting Evo-Entropy grows exactly linearly in time if the trend is the exponential GMB trend. (c) In addition, three Appendixes (online) with all the relevant mathematical proofs are attached to this paper. They are written in the Maxima language, and Maxima is a symbolic manipulator that may be downloaded for free from the web. In conclusion, this paper further increases the huge mathematical spectrum of applications of the Evo-SETI Theory to prepare Humans for the first Contact with an Extra-Terrestrial Civilization.

  20. An audience-channel-message-evaluation (ACME) framework for health communication campaigns.

    PubMed

    Noar, Seth M

    2012-07-01

    Recent reviews of the literature have indicated that a number of health communication campaigns continue to fail to adhere to principles of effective campaign design. The lack of an integrated, organizing framework for the design, implementation, and evaluation of health communication campaigns may contribute to this state of affairs. The current article introduces an audience-channel-message-evaluation (ACME) framework that organizes the major principles of health campaign design, implementation, and evaluation. ACME also explicates the relationships and linkages between the varying principles. Insights from ACME include the following: The choice of audience segment(s) to focus on in a campaign affects all other campaign design choices, including message strategy and channel/component options. Although channel selection influences options for message design, choice of message design also influences channel options. Evaluation should not be thought of as a separate activity, but rather should be infused and integrated throughout the campaign design and implementation process, including formative, process, and outcome evaluation activities. Overall, health communication campaigns that adhere to this integrated set of principles of effective campaign design will have a greater chance of success than those using principles idiosyncratically. These design, implementation, and evaluation principles are embodied in the ACME framework.

  1. The NASA HRMS educational outreach program - Searching for extraterrestrial intelligence while developing extraintelligent terrestrials

    NASA Technical Reports Server (NTRS)

    Coulter, Gary R.; O'Sullivan, Kathleen; Milne, David; Stoneburner, Cara

    1993-01-01

    Students, young and old, find extraterrestrial life one of the most intriguing of all science topics. A curriculum development project co-funded by the National Science Foundation and NASA, and administered by the SETI Institute, is underway to develop and test third through ninth grade science lessons that draw upon this fascination to focus student interest on science and mathematics. Individual lessons are designed by teachers and curriculum developers, tested in classrooms, revised and re-tested prior to distribution. A series of guides, each containing 10 to 15 lessons, will be finished by late summer 1994.

  2. Hand hygiene posters: motivators or mixed messages?

    PubMed

    Jenner, E A; Jones, F; Fletcher, B C; Miller, L; Scott, G M

    2005-07-01

    Poster campaigns regarding hand hygiene are commonly used by infection control teams to improve practice, yet little is known of the extent to which they are based on established theory or research. This study reports on the content analysis of hand hygiene posters (N=69) and their messages (N=75) using message-framing theory. The results showed that posters seldom drew on knowledge about effective ways to frame messages. Frequently, they simply conveyed information 'telling' rather than 'selling' and some of this was confusing. Most posters were not designed to motivate, and some conveyed mixed messages. Few used fear appeals. Hand hygiene posters could have a greater impact if principles of message framing were utilized in their design. Suggestions for gain-framed messages are offered, but these need to be tested empirically.

  3. 2014 Summer Series - Jill Tarter - Searching for ET: An Investment In Our Long Future

    NASA Image and Video Library

    2014-07-31

    SETI marked it's semi-centennial as a scientific exploration in 2010. Now that exoplanets have been discovered in such abundance and diversity, and Earth 2.0 is a reasonable expectation, it seems more relevant than ever to ask the 'Are we alone?' question. What should we be doing to improve our capability to detect intelligent life beyond Earth? There are lots of technical questions about how to move forward, but the most difficult question of all may be how do we integrate and support this vast, and potentially long-term endeavor into a world of short-term thinking? How do we justify continued investment in SETI?

  4. Subjective knowledge and fear appeal effectiveness: implications for message design.

    PubMed

    Nabi, Robin L; Roskos-Ewoldsen, David; Carpentier, Francesca Dillman

    2008-01-01

    This research investigates the role of perceived health knowledge on the effectiveness of fear-based persuasive appeals. Undergraduates (N = 263) read a strong fear, weak fear, or efficacy-only message encouraging breast or testicular self-examination. As expected, results indicated that men high in subjective knowledge were less reactant and more persuaded by the efficacy-only message whereas those low in subjective knowledge did not evidence this pattern. Contrary to expectation, women high in subjective knowledge had comparable reactions to each of the 3 messages. Implications for fear appeal theory and message design are discussed.

  5. Are We Alone? GAVRT Search for Extra Terrestrial Intelligence (SETI) Project

    NASA Astrophysics Data System (ADS)

    Bensel, Holly; Cool, Ian; St. Mary's High School Astronomy Club; St. Mary's Middle School Astronomy Club

    2017-01-01

    The Goldstone Apple Valley Radio Telescope Program (GAVRT) is a partnership between NASA’s Jet Propulsion Laboratory and the Lewis Center for Educational Research. The program is an authentic science investigation program for students in grades K through 12 and offers them the ability to learn how to be a part of a science team while they are making a real contribution to scientific knowledge.Using the internet from their classroom, students take control of a 34-meter decommissioned NASA radio telescope located at the Goldstone Deep Space Network complex in California. Students collect data on strong radio sources and work in collaboration with professional radio astronomers to analyze the data.Throughout history man has wondered if we were alone in the Universe. SETI - or the Search for Extra Terrestrial Intelligence - is one of the programs offered through GAVRT that is designed to help answer that question. By participating in SETI, students learn about science by doing real science and maybe, if they get very lucky, they might make the most important discovery of our lifetime: Intelligent life beyond Earth!At St. Mary’s School, students in grades 6-12 have participated in the project since its inception. The St. Mary’s Middle School Astronomy Club is leading the way in their relentless search for ET and radio telescope studies. Students use the radio telescope to select a very small portion of the Milky Way Galaxy - or galactic plane - and scan across it over and over in the hopes of finding a signal that is not coming from humans or radio interference. The possibility of being the first to discover an alien signal has kept some students searching for the past three years. For them to discover something of this magnitude is like winning the lottery: small chance of winning - big payoff. To that end, the club is focusing on several portions of the Milky Way where they have detected a strong candidate in the past. The hope is to pick it up a second and third time. If that happens, the club will be one step closer to proving intelligent life does exist.

  6. Energy of Extra-Terrestrial Civilizations according to Evo-SETI Theory

    NASA Astrophysics Data System (ADS)

    Maccone, Claudio

    2018-03-01

    Consider two great scientists of the past: Kepler (1571-1630) and Newton (1642-1727). Kepler discovered his three laws of planetary motion by observing Mars: he knew experimentally that his three laws were correct, but he didn't even suspect that all three mathematical laws could be derived as purely mathematical consequences by a "superior" mathematical law. The latter was the Law of Gravitation that Newton gave the world together with his supreme mathematical discovery of the Calculus, necessary for that mathematical derivation. We think we did the same for the "molecular clock", the experimental law of genetics discovered in 1962 by Émile Zuckerkandl (1922-2013) and Linus Pauling (1901-1994) and derived by us as a purely mathematical consequence of our mathematical Evo-SETI Theory. Let us now summarize how this mathematical derivation was achieved. Darwinian evolution over the last 3.5 billion years was an increase in the number of living species from one (RNA ?) to the current (say) 50 million. This increasing trend in time looks like being exponential, but one may not assume an exact exponential curve since many species went extinct in the past, especially in the five, big mass extinctions. Thus, the simple exponential curve must be replaced by a stochastic process having an exponential mean value. Borrowing from financial mathematics (the "Black-Sholes models"), this "exponential" stochastic process is called Geometric Brownian Motion (GBM). Its probability density function (pdf) is a lognormal (and not a Gaussian) (Proof: see Ref. [3], Chapter 30, and Ref. [4], and, more in general, refs. [2] and [5]). Lognormal also is the pdf of the statistical number of communicating ExtraTerrestrial (ET) civilizations in the Galaxy at a certain fixed time, like a snapshot: this result was obtained in 2008 by this author as his solution to the Statistical Drake Equation of SETI (Proof: see Ref. [1]). Thus, the GBM of Darwinian evolution may also be regarded as the extension in time of the Statistical Drake equation (Proof: see ref. [4]). But the key step ahead made by this author in his Evo-SETI (Evolution and SETI) mathematical theory was to realize that life also is just a b-lognormal in time: every living organism (a cell, a human, a civilization, even an ET civilization) is born at a certain time b ("birth"), grows up to a peak p (with an ascending inflexion point in between, a for adolescence), then declines from p to s (senility, i.e. descending inflexion point) and finally declines linearly and dies at a final instant d (death). In other words, the infinite tail of the b-lognormal was cut away and replaced by just a straight line between s and d, leading to simple mathematical formulae ("History Formulae") allowing one to find this "finite b-lognormal" when the three instants b, s, and d are assigned. Next our crucial Peak-Locus Theorem comes. It means that the GBM exponential may be regarded as the geometric locus of all the peaks of a one-parameter (i.e. the peak time p) family of b-lognormals. Since b-lognormals are pdf-s, the area under each of them always equals 1 (normalization condition) and so, going from left to right on the time axis, the b-lognormals become more and more "peaky", and so they last less and less in time. This is precisely what happened in Human History: civilizations that lasted a millennium each (like Ancient Greece and Rome) lasted just a few centuries in later times (like the Italian Renaissance and Portuguese, Spanish, French, British and USA Empires) but they were more and more advanced in the "level of civilization". This "level of civilization" is what physicists call entropy. Also, in refs. [3,4], this author proved that, for all GBMs, the (Shannon) Entropy of the b-lognormals in his Peak-Locus Theorem grows linearly in time. The Molecular Clock (refs. [6] through [11]), well known to geneticists since 1962, shows that the DNA base-substitutions occur linearly in time since they are neutral with respect to Darwinian selection. This is Kimura's neutral theory of molecular evolution. The conclusion is that the Molecular Clock and the linear increase of EvoEntropy in time are just the same thing! In other words, we derived the Molecular Clock mathematically as a part of our Evo-SETI Theory. In addition, our EvoEntropy, i.e. the Shannon Entropy of the b-lognormal (with the minus sign reversed and starting at zero at the time of the origin of Life on Earth) is just the new Evo-SETI Scale to measure the evolution of life on Exoplanets (measured in bits). That was the situation prior to the present paper, firstly presented at the SETI II Session of the Adelaide IAC in October 2017. In fact, just as classical thermodynamics entails both energy and entropy, so our Evo-SETI Theory needs entailing the energy used by a living Species or Civilization along its whole lifetime in addition to its entropy (i.e. Molecular Clock). In other words still, while the Molecular Clock is a measure of the advancement in evolution, the energy required to get that advancement is another topic not faced by this author prior to 2017. However, in the present paper we were able to add the consideration of energy in addition to entropy by replacing the b-lognormal probability densities previously used by a new curve, finite in the time, that we call "logpar". This logpar is made up by an ascending b-lognormal in the time between the birth and the peak of the living organism, followed by a descending parabola in the time between its peak and death. The logpar curve is not normalized to one: the area under the logpar curve may be any positive number since it represents the energy requested by the organism to live over its entire lifetime "birth-to-death". In other words still, we mathematically demonstrate in this paper that just three instants (birth b, peak p and death d) must be assigned in order to make the mathematical logpar curve perfectly described. The history of the Roman Civilization fits to this description in that we not only know when Rome was funded (753 B.C.) and reached its peak (117 A.D.) but also when it collapsed (in the West), i.e. 476 A.D. Its energy is then estimated in terms of money (Sestertii) and so we dare to say that our Evo-SETI Theory so extended adequately describes not only the Entropy but also the Energy of Rome. In conclusion, we think that our invention of the logpar power curve provides a new, formidable mathematical tool for our Evo-SETI mathematical description of Life, History and SETI.

  7. Using the Theory of Planned Behavior to Guide Focus Group Development of Messages Aimed at Increasing Compliance With a Tobacco-Free Policy.

    PubMed

    Record, Rachael A; Harrington, Nancy G; Helme, Donald W; Savage, Matthew W

    2018-01-01

    This study details the persuasive message development for a theory-based campaign designed to increase compliance with a university's tobacco-free policy. The theory of planned behavior (TPB) guided message design and evaluation for focus group-tested messages that were adapted to the context of complying with a tobacco-free policy. The study was conducted at a university located in the tobacco belt. Undergraduate focus group participants (n = 65) were mostly male (69%), white (82%), and freshman (62%) who smoked at least 1 cigarette in the last 30 days; on-campus smoking percentages were never/rare (60%), occasionally (23%), and often/frequently (16%). Data analysis used a theoretical thematic approach to identify how the TPB constructs related to perceptions of message effectiveness. Participants responded favorably to attitudinal strategies about health, respect, and university figures; they rejected approaches they considered juvenile and offensive. They also discussed the impact of noncompliance and avoiding overgeneralized statements for addressing subjective norms, suggesting shortening text, adjusting picture location, and emphasizing the importance of compliance to increase perceptions of behavioral control. Applying theory to preexisting messages is challenging. The design approach in this study is an evidence-based strategy that can be used as a universal process for message adaptation. Results offer health promotion suggestions for designing messages aimed at improving undergraduate smokers' willingness to comply with tobacco-free campus policies.

  8. SETI meets a social intelligence: Dolphins as a model for real-time interaction and communication with a sentient species

    NASA Astrophysics Data System (ADS)

    Herzing, Denise L.

    2010-12-01

    In the past SETI has focused on the reception and deciphering of radio signals from potential remote civilizations. It is conceivable that real-time contact and interaction with a social intelligence may occur in the future. A serious look at the development of relationship, and deciphering of communication signals within and between a non-terrestrial, non-primate sentient species is relevant. Since 1985 a resident community of free-ranging Atlantic spotted dolphins has been observed regularly in the Bahamas. Life history, relationships, regular interspecific interactions with bottlenose dolphins, and multi-modal underwater communication signals have been documented. Dolphins display social communication signals modified for water, their body types, and sensory systems. Like anthropologists, human researchers engage in benign observation in the water and interact with these dolphins to develop rapport and trust. Many individual dolphins have been known for over 20 years. Learning the culturally appropriate etiquette has been important in the relationship with this alien society. To engage humans in interaction the dolphins often initiate spontaneous displays, mimicry, imitation, and synchrony. These elements may be emergent/universal features of one intelligent species contacting another for the intention of initiating interaction. This should be a consideration for real-time contact and interaction for future SETI work.

  9. Observational Research on Star and Planetary System Formation

    NASA Technical Reports Server (NTRS)

    Simpson, Janet P.

    1998-01-01

    Institute scientists collaborate with a number of NASA Ames scientists on observational studies of star and planetary system formation to their mutual benefit. As part of this collaboration, SETI scientists have, from 1988 to the present: (1) contributed to the technical studies at NASA Ames of the Stratospheric Observatory for Infrared Astronomy (SOFIA), an infrared 2.5 meter telescope in a Boeing 747, which will replace the Kuiper Airborne Observatory (KAO), a 0.9 meter telescope in a Lockheed C-141. SOFIA will be an important facility for the future exploration of the formation of stars and planetary systems, and the origins of life, and as such will be an important future facility to SETI scientists; (2) worked with the Laboratory Astrophysics Group at Ames, carrying out laboratory studies of the spectroscopic properties of ices and pre-biotic organics, which could be formed in the interstellar or interplanetary media; (3) helped develop a photometric approach for determining the Frequency of Earth-Sized Inner Planets (FRESIP) around solar-like stars, a project (now called Kepler) which complements the current efforts of the SETI Institute to find evidence for extraterrestrial intelligence; and (4) carried out independent observational research, in particular research on the formation of stars and planetary systems using both ground-based telescopes as well as the KAO.

  10. Observational Research on Star and Planetary System Formation

    NASA Astrophysics Data System (ADS)

    Simpson, Janet P.

    1998-07-01

    Institute scientists collaborate with a number of NASA Ames scientists on observational studies of star and planetary system formation to their mutual benefit. As part of this collaboration, SETI scientists have, from 1988 to the present: (1) contributed to the technical studies at NASA Ames of the Stratospheric Observatory for Infrared Astronomy (SOFIA), an infrared 2.5 meter telescope in a Boeing 747, which will replace the Kuiper Airborne Observatory (KAO), a 0.9 meter telescope in a Lockheed C-141. SOFIA will be an important facility for the future exploration of the formation of stars and planetary systems, and the origins of life, and as such will be an important future facility to SETI scientists; (2) worked with the Laboratory Astrophysics Group at Ames, carrying out laboratory studies of the spectroscopic properties of ices and pre-biotic organics, which could be formed in the interstellar or interplanetary media; (3) helped develop a photometric approach for determining the Frequency of Earth-Sized Inner Planets (FRESIP) around solar-like stars, a project (now called Kepler) which complements the current efforts of the SETI Institute to find evidence for extraterrestrial intelligence; and (4) carried out independent observational research, in particular research on the formation of stars and planetary systems using both ground-based telescopes as well as the KAO.

  11. Leg kinematics and muscle activity during treadmill running in the cockroach, Blaberus discoidalis: I. Slow running.

    PubMed

    Watson, J T; Ritzmann, R E

    1998-01-01

    We have combined high-speed video motion analysis of leg movements with electromyogram (EMG) recordings from leg muscles in cockroaches running on a treadmill. The mesothoracic (T2) and metathoracic (T3) legs have different kinematics. While in each leg the coxa-femur (CF) joint moves in unison with the femurtibia (FT) joint, the relative joint excursions differ between T2 and T3 legs. In T3 legs, the two joints move through approximately the same excursion. In T2 legs, the FT joint moves through a narrower range of angles than the CF joint. In spite of these differences in motion, no differences between the T2 and T3 legs were seen in timing or qualitative patterns of depressor coxa and extensor tibia activity. The average firing frequencies of slow depressor coxa (Ds) and slow extensor tibia (SETi) motor neurons are directly proportional to the average angular velocity of their joints during stance. The average Ds and SETi firing frequency appears to be modulated on a cycle-by-cycle basis to control running speed and orientation. In contrast, while the frequency variations within Ds and SETi bursts were consistent across cycles, the variations within each burst did not parallel variations in the velocity of the relevant joints.

  12. Neuromuscular plasticity in the locust after permanent removal of an excitatory motoneuron of the extensor tibiae muscle.

    PubMed

    Büschges, A; Djokaj, S; Bässler, D; Bässler, U; Rathmayer, W

    2000-01-01

    The capacity of the larval insect nervous system to compensate for the permanent loss of one of the two excitatory motoneurons innervating a leg muscle was investigated in the locust (Locusta migratoria). In the fourth instar, the fast extensor tibiae (FETi) motoneuron in the mesothoracic ganglion was permanently removed by photoinactivation with a helium-cadmium laser. Subsequently, the animals were allowed to develop into adulthood. When experimental animals were tested as adults after final ecdysis, fast-contracting fibers in the most proximal region of the corresponding extensor muscle, which are normally predominantly innervated by FETi only, uniformly responded to activity of the slow extensor tibiae (SETi) neuron. In adult operated animals, single pulses to SETi elicited large junctional responses in the fibers which resulted in twitch contractions of these fibers similar to the responses to FETi activity in control animals. The total number of muscle fibers, their properties as histochemically determined contractional types (fast and slow), and their distribution were not affected by photoinactivation of FETi. Possible mechanisms enabling the larval neuromuscular system to compensate for the loss of FETi through functionally similar innervation by a different motoneuron, i.e. SETi, are discussed. Copyright 2000 John Wiley & Sons, Inc.

  13. The Breakthrough Listen Initiative and the Future of the Search for Intelligent Life

    NASA Astrophysics Data System (ADS)

    Enriquez, J. Emilio; Siemion, Andrew; Croft, Steve; Hellbourg, Greg; Lebofsky, Matt; MacMahon, David; Price, Danny; DeBoer, David; Werthimer, Dan

    2017-05-01

    Unprecedented recent results in the fields of exoplanets and astrobiology have dramatically increased the interest in the potential existence of intelligent life elsewhere in the galaxy. Additionally, the capabilities of modern Searches for Extraterrestrial Intelligence (SETI) have increased tremendously. Much of this improvement is due to the ongoing development of wide bandwidth radio instruments and the Moore's Law increase in computing power over the previous decades. Together, these instrumentation improvements allow for narrow band signal searches of billions of frequency channels at once.The Breakthrough Listen Initiative (BL) was launched on July 20, 2015 at the Royal Society in London, UK with the goal to conduct the most comprehensive and sensitive search for advanced life in humanity's history. Here we detail important milestones achieved during the first year and a half of the program. We describe the key BL SETI surveys and briefly describe current facilities, including the Green Bank Telescope, the Automated Planet Finder and the Parkes Observatory. We also mention the ongoing and potential collaborations focused on complementary sciences, these include pulse searches of pulsars and FRBs, as well as astrophysically powered radio emission from stars targeted by our program.We conclude with a brief view towards future SETI searches with upcoming next-generation radio facilities such as SKA and ngVLA.

  14. Photo-sharing social media for eHealth: analysing perceived message effectiveness of sexual health information on Instagram.

    PubMed

    O'Donnell, Nicole Hummel; Willoughby, Jessica Fitts

    2017-10-01

    Health professionals increasingly use social media to communicate health information, but it is unknown how visual message presentation on these platforms affects message reception. This study used an experiment to analyse how young adults (n = 839) perceive sexual health messages on Instagram. Participants were exposed to one of four conditions based on visual message presentation. Messages with embedded health content had the highest perceived message effectiveness ratings. Additionally, message sensation value, attitudes and systematic information processing were significant predictors of perceived message effectiveness. Implications for visual message design for electronic health are discussed.

  15. Scientific Message Translation and the Heuristic Systematic Model: Insights for Designing Educational Messages About Progesterone and Breast Cancer Risks

    PubMed Central

    Perrault, Evan; Smith, Sandi; Keating, David M.; Nazione, Samantha; Silk, Kami; Russell, Jessica

    2017-01-01

    Results of ongoing scientific research on environmental determinants of breast cancer are not typically presented to the public in ways they can easily understand and use to take preventive actions. In this study, results of scientific studies on progesterone exposure as a risk factor for breast cancer were translated into high and low literacy level messages. Using the heuristic systematic model, this study examined how ability, motivation, and message processing (heuristic and systematic) influenced perceptions of risk beliefs and negative attitudes about progesterone exposure among women who read the translated scientific messages. Among the 1254 participants, those given the higher literacy level message had greater perceptions of risk about progesterone. Heuristic message cues of source credibility and perceived message quality, as well as motivation, also predicted risk beliefs. Finally, risk beliefs were a strong predictor of negative attitudes about exposure to progesterone. The results can help improve health education message design in terms of practitioners having better knowledge of message features that are the most persuasive to the target audiences on this topic. PMID:25903053

  16. SMSaúde: Design, Development, and Implementation of a Remote/Mobile Patient Management System to Improve Retention in Care for HIV/AIDS and Tuberculosis Patients.

    PubMed

    Nhavoto, José António; Grönlund, Åke; Chaquilla, Walter Ponce

    2015-03-09

    The widespread and low cost of mobile phones and the convenience of short message service (SMS) text messaging suggest potential suitability for use with alternative strategies for supporting retention in care and adherence to the treatment of various chronic diseases, such as HIV and tuberculosis (TB). Despite the growing body of literature reporting positive outcomes of SMS text message-based communication with patients, there is yet very little research about the integration of communication technologies and electronic medical records or electronic patient tracking systems. To design, develop, and implement an integrated mobile phone text messaging system used to follow up with patients with HIV and TB in treatment in Mozambique. Following the design science research methodology, we developed a Web-based system that provides support to patients. A case study involving three health care sites in Mozambique was a basis for discussing design issues for this kind of system. We used brainstorming techniques to solicit usability requirements, focus group meetings to discuss and define system architecture, and prototyping to test in real environments and to improve the system. We found six sets of system requirements that need to be addressed for success: data collection, telecommunication costs, privacy and data security, text message content, connectivity, and system scalability. A text messaging system was designed and implemented in three health facilities. These sites feed data into a central data repository, which can be used for analysis of operations and decision support. Based on the treatment schedule, the system automatically sent SMS text message appointment reminders, medication reminders, as well as motivational and educational messages to patients enrolled in antiretroviral therapy and TB treatment programs. We successfully defined the requirements for, designed, and implemented a mobile phone text messaging system to support HIV and TB treatments. Implementation of this system could improve patients' self-management skills and strengthen communication between patients and health care providers.

  17. Area Coverage of Expanding E.T. Signals in the Galaxy: SETI and Drake’s N

    NASA Astrophysics Data System (ADS)

    Grimaldi, Claudio; Marcy, Geoffrey W.; Tellis, Nathaniel K.; Drake, Frank

    2018-05-01

    The Milky Way Galaxy contains an unknown number, N, of civilizations that emit electromagnetic radiation (of unknown wavelengths) over a finite lifetime, L. Here we are assuming that the radiation is not produced indefinitely, but within L as a result of some unknown limiting event. When a civilization stops emitting, the radiation continues traveling outward at the speed of light, c, but is confined within a shell wall having constant thickness, cL. We develop a simple model of the Galaxy that includes both the birthrate and detectable lifetime of civilizations to compute the possibility of a SETI detection at the Earth. Two cases emerge for radiation shells that are (1) thinner than or (2) thicker than the size of the Galaxy, corresponding to detectable lifetimes, L, less than or greater than the light-travel time, ∼100,000 years, across the Milky Way, respectively. For case (1), each shell wall has a thickness smaller than the size of the Galaxy and intersects the Galactic plane in a donut shape (annulus) that fills only a fraction of the Galaxy’s volume, inhibiting SETI detection. But the ensemble of such shell walls may still fill our Galaxy, and indeed may overlap locally, given a sufficiently high birthrate of detectable civilizations. In the second case, each radiation shell is thicker than the size of our Galaxy. Yet, the ensemble of walls may or may not yield a SETI detection depending on the civilization birthrate. We compare the number of different electromagnetic transmissions arriving at Earth to Drake’s N, the number of currently emitting civilizations, showing that they are equal to each other for both cases (1) and (2). However, for L < 100,000 years, the transmissions arriving at Earth may come from distant civilizations long extinct, while civilizations still alive are sending signals yet to arrive.

  18. Human factors research problems in electronic voice warning system design

    NASA Technical Reports Server (NTRS)

    Simpson, C. A.; Williams, D. H.

    1975-01-01

    The speech messages issued by voice warning systems must be carefully designed in accordance with general principles of human decision making processes, human speech comprehension, and the conditions in which the warnings can occur. The operator's effectiveness must not be degraded by messages that are either inappropriate or difficult to comprehend. Important experimental variables include message content, linguistic redundancy, signal/noise ratio, interference with concurrent tasks, and listener expectations generated by the pragmatic or real world context in which the messages are presented.

  19. Validation of mobile phone text messages for nicotine and tobacco risk communication among college students: A content analysis.

    PubMed

    Khalil, Georges E; Calabro, Karen S; Crook, Brittani; Machado, Tamara C; Perry, Cheryl L; Prokhorov, Alexander V

    2018-02-01

    In the United States, young adults have the highest prevalence of tobacco use. The dissemination of mobile phone text messages is a growing strategy for tobacco risk communication among young adults. However, little has been done concerning the design and validation of such text messages. The Texas Tobacco Center of Regulatory Science (Texas-TCORS) has developed a library of messages based on framing (gain- or loss-framed), depth (simple or complex) and appeal (emotional or rational). This study validated the library based on depth and appeal, identified text messages that may need improvement, and explored new themes. The library formed the study sample (N=976 messages). The Linguistic Inquiry and Word Count (LIWC) software of 2015 was used to code for word count, word length and frequency of emotional and cognitive words. Analyses of variance, logistic regression and scatter plots were conducted for validation. In all, 874 messages agreed with LIWC-coding. Several messages did not agree with LIWC. Ten messages designed to be complex indicated simplicity, while 51 messages designed to be rational exhibited no cognitive words. New relevant themes were identified, such as health (e.g. 'diagnosis', 'cancer'), death (e.g. 'dead', 'lethal') and social connotations (e.g. 'parents', 'friends'). Nicotine and tobacco researchers can safely use, for young adults, messages from the Texas-TCORS library to convey information in the intended style. Future work may expand upon the new themes. Findings will be utilized to develop new campaigns, so that risks of nicotine and tobacco products can be widely disseminated.

  20. Evaluation of emotion-based messages designed to motivate Hispanic and Asian parents of early adolescents to engage in calcium-rich food and beverage parenting practices.

    PubMed

    Banna, Jinan Corinne; Reicks, Marla; Gunther, Carolyn; Richards, Rickelle; Bruhn, Christine; Cluskey, Mary; Wong, Siew Sun; Misner, Scottie; Hongu, Nobuko; Johnston, N Paul

    2016-08-01

    Setting healthful beverage expectations, making calcium-rich foods and beverages (CRF/B) available, and role modeling are parenting practices promoting calcium intake among early adolescents. This study aimed to evaluate emotion-based messages designed to motivate parents of early adolescents to perform these practices. Emotion-based messages were developed for each parenting practice and tested in 35 parents from 5 states. Findings were used to modify messages and develop a survey administered via Amazon MechanicalTurk to a convenience sample of Asian (n = 166) and Hispanic (n = 184) parents of children 10-13 years. Main outcome measures were message comprehension, motivation, relevance, acceptability, and novelty. Engagement in the parenting practices was also assessed. Message comprehension was acceptable for the majority of parents. Most also agreed that messages were motivational (setting healthful beverage expectations (69.0%), making CRF/B available (67.4%), and role modeling (80.0%)), relevant and acceptable. About 30-50% indicated they had not seen the information before. Many parents indicated they were already engaging in the practices (> 70%). No racial/ethnic differences were observed for responses to messages or engaging in parenting practices. Results indicate that emotion-based messages designed to motivate parents to engage in parenting practices that promote calcium intake among early adolescents were motivating, relevant, and acceptable.

  1. GMSEC Interface Specification Document 2016 March

    NASA Technical Reports Server (NTRS)

    Handy, Matthew

    2016-01-01

    The GMSEC Interface Specification Document contains the standard set of defined messages. Each GMSEC standard message contains a GMSEC Information Bus Header section and a Message Contents section. Each message section identifies required fields, optional fields, data type and recommended use of the fields. Additionally, this document includes the message subjects associated with the standard messages. The system design of the operations center should ensure the components that are selected use both the API and the defined standard messages in order to achieve full interoperability from component to component.

  2. The Search for Extra-Terrestrial Intelligence

    NASA Astrophysics Data System (ADS)

    Tarter, J.

    1998-12-01

    Aliens abound on the movie screens, but in reality we are still trying to find out if we share our universe with other sentient creatures. Intelligence is very difficult to define, and impossible to directly detect over interstellar distances. Therefore, SETI, the search for extraterrestrial intelligence, is actually an attempt to detect evidence of another distant technology. If we find such evidence, we will infer the existence of intelligent technologists. For the past 36 years, the SETI community has had a very pragmatic definition of intelligence - the ability to build radio telescopes! Radio signals are not the only possible way to detect a technology across the vast distances that separate the stars, but given our own current technological state, it remains the best way.

  3. Are transmissions to space dangerous?

    NASA Astrophysics Data System (ADS)

    Shostak, Seth

    2013-01-01

    We consider the suggestion that, as a matter of caution, the deliberate broadcast of signals to the cosmos should be proscribed. We explore the likely capabilities of extraterrestrial societies that might conceivably pose a threat to our species and show that this suggestion is without merit because even if followed, it would fail to keep our existence secret. In addition, trying to limit signalling activities would be a burden on our descendants, crippling their own activities for the indefinite future. A corollary to these considerations affects the search for extraterrestrial intelligence (SETI): namely, it seems inarguable that technologically advanced beings will assume that other societies are capable of detecting their leakage. Consequently, the premise that SETI should expect to find deliberate beacons from other worlds may be mistaken.

  4. SETI-ITALIA 2008: On-going searches and future prospects

    NASA Astrophysics Data System (ADS)

    Montebugnoli, S.; Bartolini, M.; Bianchi, G.; Cosmovici, C.; Monari, J.; Orlati, A.; Perini, F.; Pluchino, S.; Pupillo, G.; Salerno, E.; Schillirò, F.; Zoni, L.

    2010-12-01

    The Medicina Radioastronomical Station is located nearby Bologna, in Italy. It consists of two receiving antennas currently dedicated to the astronomical research at radio frequencies. The 32 m diameter parabolic dish performs observations from 1.4 to 22 GHz whereas the Northern Cross (a 30.000 m 2 wide T-shaped array transit antenna) works at 408 MHz. So far SETI observations have been performed using a SERENDIP IV high resolution spectrometer connected to the parabolic antenna. Data acquisition were performed meanwhile the antenna was employed in ordinary astronomical observations (piggy-back mode). An innovative method to search for possible extraterrestrial signals could be provided by using the UHF Northern Cross transit telescope. In this paper observational modalities and the required technological set-up are investigated.

  5. Extraterrestrial Life

    NASA Technical Reports Server (NTRS)

    Klein, M. J.

    1993-01-01

    Extraterrestrial Intelligence is intelligent life that developed somewhere other than the earth. Such life has not yet been discovered. However, scientific research, including astronomy, biology, planetary science and studies of fossils here on earth have led many scientists to conclude that such life may exist on planets orbiting at least some of the hundreds of billions of stars in our Milky Way Galaxy. Today, some researchers are trying to find evidence for extraterrestrial intelligence. This effort is often called SETI, which stands for Search for Extraterrestrial Intelligence. SETI researchers decided that looking for evidence of their technology might be the best way to discover other intelligent life in the Galaxy. They decided to use large radio telescopes to search the sky over a wide range of radio frequencies...

  6. A new collage steganographic algorithm using cartoon design

    NASA Astrophysics Data System (ADS)

    Yi, Shuang; Zhou, Yicong; Pun, Chi-Man; Chen, C. L. Philip

    2014-02-01

    Existing collage steganographic methods suffer from low payload of embedding messages. To improve the payload while providing a high level of security protection to messages, this paper introduces a new collage steganographic algorithm using cartoon design. It embeds messages into the least significant bits (LSBs) of color cartoon objects, applies different permutations to each object, and adds objects to a cartoon cover image to obtain the stego image. Computer simulations and comparisons demonstrate that the proposed algorithm shows significantly higher capacity of embedding messages compared with existing collage steganographic methods.

  7. Managing fear in public health campaigns: a theory-based formative evaluation process.

    PubMed

    Cho, Hyunyi; Witte, Kim

    2005-10-01

    The HIV/AIDS infection rate of Ethiopia is one of the world's highest. Prevention campaigns should systematically incorporate and respond to at-risk population's existing beliefs, emotions, and perceived barriers in the message design process to effectively promote behavior change. However, guidelines for conducting formative evaluation that are grounded in proven risk communication theory and empirical data analysis techniques are hard to find. This article provides a five-step formative evaluation process that translates theory and research for developing effective messages for behavior change. Guided by the extended parallel process model, the five-step process helps message designers manage public's fear surrounding issues such as HIV/AIDS. An entertainment education project that used the process to design HIV/AIDS prevention messages for Ethiopian urban youth is reported. Data were collected in five urban regions of Ethiopia and analyzed according to the process to develop key messages for a 26-week radio soap opera.

  8. Searching for `ET': Some Open Questions

    NASA Astrophysics Data System (ADS)

    Kracher, A.

    2013-09-01

    The assumptions underlying the “search for extraterrestrial intelligence” are examined, including the role of meteoritics, planetology and exoplanetology. Interdisciplinary strategies for SETI and their problems are evaluated.

  9. Validation of mobile phone text messages for nicotine and tobacco risk communication among college students: A content analysis

    PubMed Central

    Khalil, Georges E.; Calabro, Karen S.; Crook, Brittani; Machado, Tamara C.; Perry, Cheryl L.; Prokhorov, Alexander V.

    2018-01-01

    INTRODUCTION In the United States, young adults have the highest prevalence of tobacco use. The dissemination of mobile phone text messages is a growing strategy for tobacco risk communication among young adults. However, little has been done concerning the design and validation of such text messages. The Texas Tobacco Center of Regulatory Science (Texas-TCORS) has developed a library of messages based on framing (gain- or loss-framed), depth (simple or complex) and appeal (emotional or rational). This study validated the library based on depth and appeal, identified text messages that may need improvement, and explored new themes. METHODS The library formed the study sample (N=976 messages). The Linguistic Inquiry and Word Count (LIWC) software of 2015 was used to code for word count, word length and frequency of emotional and cognitive words. Analyses of variance, logistic regression and scatter plots were conducted for validation. RESULTS In all, 874 messages agreed with LIWC-coding. Several messages did not agree with LIWC. Ten messages designed to be complex indicated simplicity, while 51 messages designed to be rational exhibited no cognitive words. New relevant themes were identified, such as health (e.g. ‘diagnosis’, ‘cancer’), death (e.g. ‘dead’, ‘lethal’) and social connotations (e.g. ‘parents’, ‘friends’). CONCLUSIONS Nicotine and tobacco researchers can safely use, for young adults, messages from the Texas-TCORS library to convey information in the intended style. Future work may expand upon the new themes. Findings will be utilized to develop new campaigns, so that risks of nicotine and tobacco products can be widely disseminated. PMID:29888338

  10. Message Variability and Heterogeneity: A Core Challenge for Communication Research

    PubMed Central

    Slater, Michael D.; Peter, Jochen; Valkenberg, Patti

    2015-01-01

    Messages are central to human social experience, and pose key conceptual and methodological challenges in the study of communication. In response to these challenges, we outline a systematic approach to conceptualizing, operationalizing, and analyzing messages. At the conceptual level, we distinguish between two core aspects of messages: message variability (the defined and operationalized features of messages) and message heterogeneity (the undefined and unmeasured features of messages), and suggest preferred approaches to defining message variables. At the operational level, we identify message sampling, selection, and research design strategies responsive to issues of message variability and heterogeneity in experimental and survey research. At the analytical level, we highlight effective techniques to deal with message variability and heterogeneity. We conclude with seven recommendations to increase rigor in the study of communication through appropriately addressing the challenges presented by messages. PMID:26681816

  11. Detection of the Earth with the SETI microwave observing system assumed to be operating out in the galaxy

    NASA Technical Reports Server (NTRS)

    Billingham, J.; Tarter, J.

    1992-01-01

    This paper estimates the maximum range at which radar signals from the Earth could be detected by a search system similar to the NASA Search for Extraterrestrial Intelligence Microwave Observing Project (SETI MOP) assumed to be operating out in the galaxy. Figures are calculated for the Targeted Search, and for the Sky Survey parts of the MOP, both operating, as currently planned, in the second half of the decade of the 1990s. Only the most powerful terrestrial transmitters are considered, namely, the planetary radar at Arecibo in Puerto Rico, and the ballistic missile early warning systems (BMEWS). In each case the probabilities of detection over the life of the MOP are also calculated. The calculation assumes that we are only in the eavesdropping mode. Transmissions intended to be detected by SETI systems are likely to be much stronger and would of course be found with higher probability to a greater range. Also, it is assumed that the transmitting civilization is at the same level of technological evolution as ours on Earth. This is very improbable. If we were to detect another technological civilization, it would, on statistical grounds, be much older than we are and might well have much more powerful transmitters. Both factors would make detection by the NASA MOP a much more likely outcome.

  12. Evo-SETI: A Mathematical Tool for Cladistics, Evolution, and SETI.

    PubMed

    Maccone, Claudio

    2017-04-06

    The discovery of new exoplanets makes us wonder where each new exoplanet stands along its way to develop life as we know it on Earth. Our Evo-SETI Theory is a mathematical way to face this problem. We describe cladistics and evolution by virtue of a few statistical equations based on lognormal probability density functions (pdf) in the time . We call b -lognormal a lognormal pdf starting at instant b (birth). Then, the lifetime of any living being becomes a suitable b -lognormal in the time . Next, our "Peak-Locus Theorem" translates cladistics : each species created by evolution is a b -lognormal whose peak lies on the exponentially growing number of living species. This exponential is the mean value of a stochastic process called "Geometric Brownian Motion" (GBM). Past mass extinctions were all-lows of this GBM. In addition, the Shannon Entropy (with a reversed sign) of each b -lognormal is the measure of how evolved that species is, and we call it EvoEntropy. The "molecular clock" is re-interpreted as the EvoEntropy straight line in the time whenever the mean value is exactly the GBM exponential. We were also able to extend the Peak-Locus Theorem to any mean value other than the exponential. For example, we derive in this paper for the first time the EvoEntropy corresponding to the Markov-Korotayev (2007) "cubic" evolution: a curve of logarithmic increase.

  13. Detection of the Earth with the SETI microwave observing system assumed to be operating out in the galaxy.

    PubMed

    Billingham, J; Tarter, J

    1992-01-01

    This paper estimates the maximum range at which radar signals from the Earth could be detected by a search system similar to the NASA Search for Extraterrestrial Intelligence Microwave Observing Project (SETI MOP) assumed to be operating out in the galaxy. Figures are calculated for the Targeted Search, and for the Sky Survey parts of the MOP, both operating, as currently planned, in the second half of the decade of the 1990s. Only the most powerful terrestrial transmitters are considered, namely, the planetary radar at Arecibo in Puerto Rico, and the ballistic missile early warning systems (BMEWS). In each case the probabilities of detection over the life of the MOP are also calculated. The calculation assumes that we are only in the eavesdropping mode. Transmissions intended to be detected by SETI systems are likely to be much stronger and would of course be found with higher probability to a greater range. Also, it is assumed that the transmitting civilization is at the same level of technological evolution as ours on Earth. This is very improbable. If we were to detect another technological civilization, it would, on statistical grounds, be much older than we are and might well have much more powerful transmitters. Both factors would make detection by the NASA MOP a much more likely outcome.

  14. Use of Qualitative Research to Inform Development of Nutrition Messages for Low-Income Mothers of Preschool Children

    ERIC Educational Resources Information Center

    White, Alicie H.; Wilson, Judy F.; Burns, Adam; Blum-Kemelor, Donna; Singh, Anita; Race, Patricia O.; Soto, Valery; Lockett, Alice F.

    2011-01-01

    Objective: To develop and test nutrition messages and supporting content with low-income mothers for use with theory-based interventions addressing fruit and vegetable consumption and child-feeding practices. Design: Six formative and 6 evaluative focus groups explored message concepts and tested messages, respectively. Setting: Research…

  15. Terse messaging and public health in the midst of natural disasters: the case of the Boulder floods.

    PubMed

    Sutton, Jeannette; League, Cedar; Sellnow, Timothy L; Sellnow, Deanna D

    2015-01-01

    Social media are quickly becoming the channel of choice for disseminating emergency warning messages. However, relatively little data-driven research exists to inform effective message design when using these media. The present study addresses that void by examining terse health-related warning messages sent by public safety agencies over Twitter during the 2013 Boulder, CO, floods. An examination of 5,100 tweets from 52 Twitter accounts over the course of the 5-day flood period yielded several key conclusions and implications. First, public health messages posted by local emergency management leaders are most frequently retweeted by organizations in our study. Second, emergency public health messages focus primarily on drinking water in this event. Third, terse messages can be designed in ways that include imperative/instructional and declarative/explanatory styles of content, both of which are essential for promoting public health during crises. These findings demonstrate that even terse messages delivered via Twitter ought to provide information about the hazard event, its impact, and actionable instructions for self-protection.

  16. Understanding the effectiveness of the entertainment-education strategy: an investigation of how audience involvement, message processing, and message design influence health information recall.

    PubMed

    Quintero Johnson, Jessie M; Harrison, Kristen; Quick, Brian L

    2013-01-01

    A growing body of evidence suggests that entertainment-education (EE) is a promising health communication strategy. The purpose of this study was to identify some of the factors that facilitate and hinder audience involvement with EE messages. Using confirmatory factor analysis, the authors introduce a construct they call experiential involvement, which describes the experience of being cognitively and emotionally involved with EE messages and is a product of transportation into an EE text and identification with EE characters. Using an experimental design, the authors also investigated how reports of experiential involvement and health information recall varied depending on the degree to which the educational content was well integrated with the narrative content in EE messages. Findings indicated that integration significantly influenced health information recall. Results indicated that experiential involvement and the perception that the health topic in EE messages was personally relevant predicted participants' systematic processing of the information in EE messages. Contrary to expectation, personal relevance did not predict experiential involvement, and systematic message processing was negatively related to health information recall. Implications for the construction of EE messages and the study of the EE strategy are discussed.

  17. Message Design Guidelines For Screen-Based Programs.

    ERIC Educational Resources Information Center

    Rimar, G. I.

    1996-01-01

    Effective message design for screen-based computer or video instructional programs requires knowledge from many disciplines. Evaluates current conventions and suggests a new set of guidelines for screen-based designers. Discusses screen layout, highlighting and cueing, text font and style, text positioning, color, and graphical user interfaces for…

  18. We are alone in our Galaxy

    NASA Astrophysics Data System (ADS)

    Tipler, F. J.

    1982-10-01

    An assessment is presented of the probability of the existence of intelligent extraterrestrial life in view of biological evolutionary constraints, in order to furnish some perspective for the hopes and claims of search of extraterrestrial intelligence (SETI) enthusiasts. Attention is given to a hypothetical extraterrestrial civilization's exploration/colonization of interstellar space by means of von Neumann machine-like, endlessly self-replicating space probes which would eventually reach the planetary systems of all stars in the Galaxy. These probes would be able to replicate the biology of their creator species, upon reaching a hospitable planet. It is suggested that the fundamental technological feasibility of such schemes, and their geometrically progressive comprehension of the Galaxy, would make actual colonization of the earth by extraterrestrials so probable as to destroy the hopes of SETI backers for occasional contact.

  19. Time and space integrating acousto-optic folded spectrum processing for SETI

    NASA Technical Reports Server (NTRS)

    Wagner, K.; Psaltis, D.

    1986-01-01

    Time and space integrating folded spectrum techniques utilizing acousto-optic devices (AOD) as 1-D input transducers are investigated for a potential application as wideband, high resolution, large processing gain spectrum analyzers in the search for extra-terrestrial intelligence (SETI) program. The space integrating Fourier transform performed by a lens channels the coarse spectral components diffracted from an AOD onto an array of time integrating narrowband fine resolution spectrum analyzers. The pulsing action of a laser diode samples the interferometrically detected output, aliasing the fine resolution components to baseband, as required for the subsequent charge coupled devices (CCD) processing. The raster scan mechanism incorporated into the readout of the CCD detector array is used to unfold the 2-D transform, reproducing the desired high resolution Fourier transform of the input signal.

  20. Media reaction to a SETI success.

    PubMed

    Shostak, G S

    1997-01-01

    Consideration of the reaction to a SETI detection by the media, and the effect this will have on the public, is more than mere sociological speculation. An accurate forecast of the media's interest can lead to actions that will help ensure that correct and comprehensible information reaches the public. This is most critical in the first few weeks following a discovery. While a widely accepted protocol for dealing with a detection exists in the "Declaration of Principles Following the Detection of Extraterrestrial Intelligence," it gives scant consideration to the fact that the actual situation will be chaotic and not subject to easy control. The 1996 story about the possible discovery of martian microfossils has provided a useful precedent for what will happen if astronomers uncover the existence of alien intelligence.

  1. Alerting prefixes for speech warning messages. [in helicopters

    NASA Technical Reports Server (NTRS)

    Bucher, N. M.; Voorhees, J. W.; Karl, R. L.; Werner, E.

    1984-01-01

    A major question posed by the design of an integrated voice information display/warning system for next-generation helicopter cockpits is whether an alerting prefix should precede voice warning messages; if so, the characteristics desirable in such a cue must also be addressed. Attention is presently given to the results of a study which ascertained pilot response time and response accuracy to messages preceded by either neutral cues or the cognitively appropriate semantic cues. Both verbal cues and messages were spoken in direct, phoneme-synthesized speech, and a training manipulation was included to determine the extent to which previous exposure to speech thus produced facilitates these messages' comprehension. Results are discussed in terms of the importance of human factors research in cockpit display design.

  2. Interface Message Processors for the ARPA Computer Network

    DTIC Science & Technology

    1975-04-01

    Pluribus IMP construction and checkout; sizeable changes to the i*4P message-processing algorithms: and Satellite IMP issues. The IMP message...extremely low cost modification design. We have begun to consider changes to the MLC design which would enable the MLC to suppress continuous breaks...existing authentication mechanisms need not make these changes . 2.7 Other Topics During the first quarter BBN constructed an environmental test chamber

  3. Tailored message interventions versus typical messages for increasing participation in colorectal cancer screening among a non-adherent population: A randomized controlled trial.

    PubMed

    Hirai, Kei; Ishikawa, Yoshiki; Fukuyoshi, Jun; Yonekura, Akio; Harada, Kazuhiro; Shibuya, Daisuke; Yamamoto, Seiichiro; Mizota, Yuri; Hamashima, Chisato; Saito, Hiroshi

    2016-05-24

    The purpose of this study was to examine the effectiveness and cost-efficiency of a tailored message intervention compared with a non-tailored message intervention for increasing colorectal cancer (CRC) screening rates among a non-adherent population, in a community-based client reminder program. After a baseline survey for psychological segmentation, 2140 eligible individuals were randomly assigned either to a group with a tailored matched-message condition (N = 356), a group with a non-tailored unmatched-message condition (N = 355), or to two control groups, one using a typical message with a professional design (N = 717) and one without a professional design (N = 712). The main outcome measure was attendance rates in a community-organized CRC screening program within five months of receiving a print reminder. There was a significant difference in fecal occult blood test (FOBT) attendance rates at follow-up assessments between the tailored matched-message condition (14.0 %) and the control (9.9 %; OR = 1.48, p = 0.026), while there was no significant difference between the unmatched-message condition (11.0 %) and the control (OR = 1.12, p = 0.558), and between the matched-message condition and the unmatched-message condition (OR = 1.32, p = 0.219). The cost of a one-person increase in FOBT screening was 3,740 JPY for the tailored matched-message condition, while it was 2,747 JPY for the control. A tailored-message intervention for segmented individuals designed to increase CRC screening rates in a community-based client reminder program was significantly effective compared to a usual reminder, but not more effective than an unmatched message in a randomized controlled trial, and was not sufficiently effective to highlight its value from a cost perspective. Therefore, the tailored intervention including target segmentation needs to be improved for future implementation in a CRC screening program for a non-adherent population. UMIN Clinical Trials Registry UMIN000004384 . Date of Registration: March 2011.

  4. Partnering with middle school students to design text messages about HPV vaccination.

    PubMed

    Cates, Joan R; Ortiz, Rebecca R; North, Steve; Martin, Amanda; Smith, Richalle; Coyne-Beasley, Tamera

    2015-03-01

    Human papillomavirus (HPV) vaccination is routinely recommended for U.S. adolescents ages 11 to 12 years, yet vaccine coverage remains low. Text message HPV immunization reminders to parents have been effective with increasing uptake, but text messages directly to adolescents in order to increase HPV vaccination uptake are unknown. The purpose of this study was to examine the acceptability of text messages about HPV vaccination and message preferences among adolescents. Middle school students (n = 43) assisted in designing text messages to promote HPV vaccine among their peers. Through seven focus groups and two in-class surveys, we assessed students' knowledge of HPV vaccine, use of texting, and preferences for text messages and sources. The average age of participants was 13 years, and all were White (17 males, 26 females) in this rural setting. More than 70% used text messaging with a cell phone. The text message with the best composite score (M = 2.33, SD = 0.72) for likeability, trustworthiness, and motivation to seek more information was a gain frame emphasizing reduction in HPV infection if vaccinated against HPV. Text messages with lower scores emphasized threats of disease if not vaccinated. Participants (68%) preferred doctors as their information source. Text messaging to adolescents may be a strategy to improve HPV knowledge and vaccination. © 2014 Society for Public Health Education.

  5. Methods to assess youth engagement in a text messaging supplement to an effective teen pregnancy program.

    PubMed

    Devine, Sharon; Leeds, Caroline; Shlay, Judith C; Leytem, Amber; Beum, Robert; Bull, Sheana

    2015-08-01

    Youth are prolific users of cell phone minutes and text messaging. Numerous programs using short message service text messaging (SMS) have been employed to help improve health behaviors and health outcomes. However, we lack information on whether and what type of interaction or engagement with SMS program content is required to realize any benefit. We explored youth engagement with an automated SMS program designed to supplement a 25-session youth development program with demonstrated efficacy for reductions in teen pregnancy. Using two years of program data, we report on youth participation in design of message content and response frequency to messages among youth enrolled in the intervention arm of a randomized controlled trial (RCT) as one indicator of engagement. There were 221 youth between the ages of 14-18 enrolled over two years in the intervention arm of the RCT. Just over half (51%) were female; 56% were Hispanic; and 27% African American. Youth were sent 40,006 messages of which 16,501 were considered bi-directional where youth were asked to text a response. Four-fifths (82%) responded at least once to a text. We found variations in response frequency by gender, age, and ethnicity. The most popular types of messages youth responded to include questions and quizzes. The first two months of the program in each year had the highest response frequency. An important next step is to assess whether higher response to SMS results in greater efficacy. This future work can facilitate greater attention to message design and content to ensure messages are engaging for the intended audience. Copyright © 2015 Elsevier Inc. All rights reserved.

  6. Design and Feasibility of a Text Messaging Intervention to Prevent Indoor Tanning Among Young Adult Women: A Pilot Study

    PubMed Central

    Mays, Darren

    2016-01-01

    Background Although skin cancer is largely preventable, it affects nearly 1 of 5 US adults. There is a need for research on how to optimally design persuasive public health indoor tanning prevention messages. Objective The objective of our study was to examine whether framed messages on indoor tanning behavioral intentions delivered through short message service (SMS) text messaging would produce (1) positive responses to the messages, including message receptivity and emotional response; (2) indoor tanning efficacy beliefs, including response efficacy and self-efficacy; and (3) indoor tanning risk beliefs. Methods We conducted a pilot study of indoor tanning prevention messages delivered via mobile phone text messaging in a sample of 21 young adult women who indoor tan. Participants completed baseline measures, were randomly assigned to receive gain-, loss-, or balanced-framed text messages, and completed postexposure outcome measures on indoor tanning cognitions and behaviors. Participants received daily mobile phone indoor tanning prevention text messages for 1 week and completed the same postexposure measures as at baseline. Results Over the 1-week period there were trends or significant changes after receipt of the text messages, including increased perceived susceptibility (P<.001), response efficacy beliefs (P<.001), and message receptivity (P=.03). Ordinary least squares stepwise linear regression models showed an effect of text message exposure on self-efficacy to quit indoor tanning (t6=–2.475, P<.02). Ordinary least squares linear regression including all measured scales showed a marginal effect of SMS texts on self-efficacy (t20=1.905, P=.08). Participants endorsed highly favorable views toward the text messaging protocol. Conclusions This study supports this use of mobile text messaging as an indoor tanning prevention strategy. Given the nature of skin cancer risk perceptions, the addition of multimedia messaging service is another area of potential innovation for disseminating indoor tanning prevention messages. PMID:28007691

  7. Design and Feasibility of a Text Messaging Intervention to Prevent Indoor Tanning Among Young Adult Women: A Pilot Study.

    PubMed

    Evans, William D; Mays, Darren

    2016-12-22

    Although skin cancer is largely preventable, it affects nearly 1 of 5 US adults. There is a need for research on how to optimally design persuasive public health indoor tanning prevention messages. The objective of our study was to examine whether framed messages on indoor tanning behavioral intentions delivered through short message service (SMS) text messaging would produce (1) positive responses to the messages, including message receptivity and emotional response; (2) indoor tanning efficacy beliefs, including response efficacy and self-efficacy; and (3) indoor tanning risk beliefs. We conducted a pilot study of indoor tanning prevention messages delivered via mobile phone text messaging in a sample of 21 young adult women who indoor tan. Participants completed baseline measures, were randomly assigned to receive gain-, loss-, or balanced-framed text messages, and completed postexposure outcome measures on indoor tanning cognitions and behaviors. Participants received daily mobile phone indoor tanning prevention text messages for 1 week and completed the same postexposure measures as at baseline. Over the 1-week period there were trends or significant changes after receipt of the text messages, including increased perceived susceptibility (P<.001), response efficacy beliefs (P<.001), and message receptivity (P=.03). Ordinary least squares stepwise linear regression models showed an effect of text message exposure on self-efficacy to quit indoor tanning (t 6 =-2.475, P<.02). Ordinary least squares linear regression including all measured scales showed a marginal effect of SMS texts on self-efficacy (t 20 =1.905, P=.08). Participants endorsed highly favorable views toward the text messaging protocol. This study supports this use of mobile text messaging as an indoor tanning prevention strategy. Given the nature of skin cancer risk perceptions, the addition of multimedia messaging service is another area of potential innovation for disseminating indoor tanning prevention messages. ©William Evans, Darren Mays. Originally published in JMIR Mhealth and Uhealth (http://mhealth.jmir.org), 22.12.2016.

  8. Engaging Novice Teachers in Semiotic Inquiry: Considering the Environmental Messages of School Learning Settings

    ERIC Educational Resources Information Center

    Shapiro, Bonnie

    2014-01-01

    Katherine Fogelberg's insightful study of the messages of zoo signs describes the complex, sometimes contradictory nature of the messages they communicate. The construction and content of signs are influenced by institutional power. Fogelberg argues that the creation of zoo signage designed to inform the public can, through its messages,…

  9. The Impact on Quality of Service When Using Security-Enabling Filters to Provide for the Security of Run-Time Virtual Environments

    DTIC Science & Technology

    2002-09-01

    Secure Multicast......................................................................24 i. Message Digests and Message Authentication Codes ( MACs ...that is, the needs of the VE will determine what the design will look like (e.g., reliable vs . unreliable data communications). In general, there...Molva00] and [Abdalla00]. i. Message Digests and Message Authentication Codes ( MACs ) Message digests and MACs are used for data integrity verification

  10. Legibility of Text and Pictograms in Variable Message Signs: Can Single-Word Messages Outperform Pictograms?

    PubMed

    Roca, Javier; Insa, Beatriz; Tejero, Pilar

    2018-05-01

    The current research shows the advantage of single-word messages in the particular case of variable message signs (VMSs) with a high aspect ratio. Early studies on traffic sign design proposed that pictorial information would advantage equivalent text messages in static signs. We used a driving simulator to present individually 36 VMSs, showing six words (e.g., "congestion") and six danger signs (e.g., congestion traffic sign). In Experiment 1, 18 drivers read aloud the text or orally identified the pictograms as soon as they could correctly do it. In Experiment 2, a different sample of 18 drivers gave a motor response, according to the meaning of the message. We analyzed the legibility distance and accuracy, driving performance (speed variability), and glance behavior. Our results show that single-word messages were associated with better performance (farther reading distances) and required less visual demands (fewer glances and less glancing times) than pictograms. As typical configurations of VMSs usually have a high aspect ratio, and thus allow large character heights, single-word messages can outperform the legibility of pictograms. However, the final advantage of text or pictorial messages would depend on several factors, such as the driver's knowledge of the language and the pictogram set, the use of single or multiple words, the particular design and size of critical details in letters and pictograms, environmental factors, and driver age. Potential applications include the design of VMSs and other devices aimed at displaying text and/or pictograms with a high aspect ratio.

  11. The Breakthrough Listen Search for Intelligent Life: the first SETI results and other future science.

    NASA Astrophysics Data System (ADS)

    Enriquez, J. Emilio; Breakthrough Listen Team

    2018-01-01

    The Breakthrough Listen (BL) Initiative is the largest campaign in human history on the search for extraterrestrial intelligence. The work presented here is the first BL search for engineered signals. This comprises a sample of 692 nearby stars within 50 pc. We used the Green Bank Telescope (GBT) to conduct observations over 1.1-1.9 GHz (L-band). Our observing strategy allows us to reject most of the detected signals as terrestrial interference. During the analysis, eleven stars show events that passed our thresholding algorithm, but detailed analysis of their properties indicates they are consistent with known examples of anthropogenic radio frequency interference. This small number of false positives and their understood properties give confidence on the techniques used for this search. We conclude that, at the time of our observations none of the observed systems host high-duty-cycle radio transmitters emitting at the observed frequencies with an EIRP of 10^13 W, readily achievable by our own civilization.We can place limits on the presence of engineered signals from putative extraterrestrial civilizations inhabiting the environs of the target stars. Our results suggest that fewer than ~0.1% of the stellar systems within 50 pc possess the type of transmitters searched in this survey. This work provides the most stringent limit on the number of low power radio transmitters around nearby stars to date. We explored several metics to compare our results to previous SETI efforts. We developed a new figure-of-merit that can encompass a wider set of parameters and can be used on future SETI experiments for a meaningful comparison.We note that the current BL state-of-the-art digital backend installed at the Green Bank Observatory is the fastest ever used for a SETI experiment by a factor of a few. Here we will describe the potential use of the BL backend by other groups on complementary science, as well as a mention the ongoing and potential collaborations focused in particular in the study of astrophysically powered radio emission from stars targeted by our program.

  12. The Step approach to Message Design and Testing (SatMDT): A conceptual framework to guide the development and evaluation of persuasive health messages.

    PubMed

    Lewis, Ioni; Watson, Barry; White, Katherine M

    2016-12-01

    This paper provides an important and timely overview of a conceptual framework designed to assist with the development of message content, as well as the evaluation, of persuasive health messages. While an earlier version of this framework was presented in a prior publication by the authors in 2009, important refinements to the framework have seen it evolve in recent years, warranting the need for an updated review. This paper outlines the Step approach to Message Design and Testing (or SatMDT) in accordance with the theoretical evidence which underpins, as well as empirical evidence which demonstrates the relevance and feasibility of, each of the framework's steps. The development and testing of the framework have thus far been based exclusively within the road safety advertising context; however, the view expressed herein is that the framework may have broader appeal and application to the health persuasion context. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. Development of patient-centric linguistically tailored psychoeducational messages to support nutrition and medication self-management in type 2 diabetes: a feasibility study

    PubMed Central

    Ellis, Rebecca J Bartlett; Connor, Ulla; Marshall, James

    2014-01-01

    Purpose This study evaluated the feasibility of developing linguistically tailored educational messages designed to match the linguistic styles of patients segmented into types with the Descriptor™, and to determine patient preferences for tailored or standard messages based on their segments. Patients and methods Twenty patients with type 2 diabetes (T2DM) were recruited from a diabetes health clinic. Participants were segmented using the Descriptor™, a language-based questionnaire, to identify patient types based on their control orientation (internal/external), agency (high/low), and affect (positive/negative), which are well studied constructs related to T2DM self-management. Two of the seven self-care behaviors described by the American Association of Diabetes Educators (healthy eating and taking medication) were used to develop standard messages and then linguistically tailored using features of the six different construct segment types of the Descriptor™. A subset of seven participants each provided feedback on their preference for standard or linguistically tailored messages; 12 comparisons between standard and tailored messages were made. Results Overall, the tailored messages were preferred to the standard messages. When the messages were matched to specific construct segment types, the tailored messages were preferred over the standard messages, although this was not statistically significant. Conclusion Linguistically tailoring messages based on construct segments is feasible. Furthermore, tailored messages were more often preferred over standard messages. This study provides some preliminary evidence for tailoring messages based on the linguistic features of control orientation, agency, and affect. The messages developed in this study should be tested in a larger more representative sample. The present study did not explore whether tailored messages were better understood. This research will serve as preliminary evidence to develop future studies with the ultimate goal to design intervention studies to investigate if linguistically tailoring communication within the context of patient education influences patient knowledge, motivation, and activation toward making healthy behavior changes in T2DM self-management. PMID:25336928

  14. Google glass: a driver distraction cause or cure?

    PubMed

    Sawyer, Ben D; Finomore, Victor S; Calvo, Andres A; Hancock, P A

    2014-11-01

    We assess the driving distraction potential of texting with Google Glass (Glass), a mobile wearable platform capable of receiving and sending short-message-service and other messaging formats. A known roadway danger, texting while driving has been targeted by legislation and widely banned. Supporters of Glass claim the head-mounted wearable computer is designed to deliver information without concurrent distraction. Existing literature supports the supposition that design decisions incorporated in Glass might facilitate messaging for drivers. We asked drivers in a simulator to drive and use either Glass or a smartphone-based messaging interface, then interrupted them with an emergency brake event. Both the response event and subsequent recovery were analyzed. Glass-delivered messages served to moderate but did not eliminate distracting cognitive demands. A potential passive cost to drivers merely wearing Glass was also observed. Messaging using either device impaired driving as compared to driving without multitasking. Glass in not a panacea as some supporters claim, but it does point the way to design interventions that effect reduced load in multitasking. Discussions of these identified benefits are framed within the potential of new in-vehicle systems that bring both novel forms of distraction and tools for mitigation into the driver's seat.

  15. Theory-Based Formative Research on an Anti-Cyberbullying Victimization Intervention Message.

    PubMed

    Savage, Matthew W; Deiss, Douglas M; Roberto, Anthony J; Aboujaoude, Elias

    2017-02-01

    Cyberbullying is a common byproduct of the digital revolution with serious consequences to victims. Unfortunately, there is a dearth of empirically based methods to confront it. This study used social cognitive theory to design and test an intervention message aimed at persuading college students to abstain from retaliation, seek social support, save evidence, and notify authorities-important victim responses identified and recommended in previous research. Using a posttest-only control group design, this study tested the effectiveness of an intervention message in changing college students' perceived susceptibility to and perceived severity of cyberbullying as well as their self-efficacy, response efficacy, attitudes, and behavioral intentions toward each recommended response in future episodes of cyberbullying. Results indicated that the intervention message caused participants in the experimental condition to report significantly higher susceptibility, but not perceived severity, to cyberbullying than those in the control condition. The intervention message also caused expected changes in all outcomes except self-efficacy for not retaliating and in all outcomes for seeking social support, saving evidence, and notifying an authority. Implications for message design and future research supporting evidence-based anti-cyberbullying health communication campaigns are discussed.

  16. Instant messaging at the hospital: supporting articulation work?

    PubMed

    Iversen, Tobias Buschmann; Melby, Line; Toussaint, Pieter

    2013-09-01

    Clinical work is increasingly fragmented and requires extensive articulation and coordination. Computer systems may support such work. In this study, we investigate how instant messaging functions as a tool for supporting articulation work at the hospital. This paper aims to describe the characteristics of instant messaging communication in terms of number and length of messages, distribution over time, and the number of participants included in conversations. We also aim to determine what kind of articulation work is supported by analysing message content. Analysis of one month's worth of instant messages sent through the perioperative coordination and communication system at a Danish hospital. Instant messaging was found to be used extensively for articulation work, mostly through short, simple conversational exchanges. It is used particularly often for communication concerning the patient, specifically, the coordination and logistics of patient care. Instant messaging is used by all actors involved in the perioperative domain. Articulation work and clinical work are hard to separate in a real clinical setting. Predefined messages and strict workflow design do not suffice when supporting communication in the context of collaborative clinical work. Flexibility is of vital importance, and this needs to be reflected in the design of supportive communication systems. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  17. Patients’ Engagement With “Sweet Talk” – A Text Messaging Support System for Young People With Diabetes

    PubMed Central

    Franklin, Victoria Louise; Greene, Alexandra; Waller, Annalu; Greene, Stephen Alan

    2008-01-01

    Background Guidelines for optimizing type 1 diabetes in young people advocate intensive insulin therapy coupled with personal support from the health care team. “Sweet Talk” is a novel intervention designed to support patients between clinic visits using text messages sent to a mobile phone. Scheduled messages are tailored to patient profiles and diabetes self-management goals, and generic messages include topical “newsletters” and anonymized tips from other participants. The system also allows patients to submit data and questions to the diabetes care team. Objectives The aim was to explore how patients with type 1 diabetes interact with the Sweet Talk system in order to understand its utility to this user group. Methods Subjects were 64 young people with diabetes who were participating in the intervention arms of a randomized controlled trial. All text messages submitted to Sweet Talk during a 12-month period were recorded. Messaging patterns and content were analyzed using mixed quantitative and qualitative methods. Results Patients submitted 1180 messages during the observation period (mean 18.4, median 6). Messaging frequency ranged widely between participants (0-240) with a subset of 5 high users contributing 52% of the total. Patients’ clinical and sociodemographic characteristics were not associated with total messaging frequency, although girls sent significantly more messages unrelated to diabetes than did boys (P = .002). The content of patients’ messages fell into 8 main categories: blood glucose readings, diabetes questions, diabetes information, personal health administration, social messages, technical messages, message errors, and message responses. Unprompted submission of blood glucose values was the most frequent incoming message type (35% of total). Responses to requests for personal experiences and tips generated 40% of all the incoming messages, while topical news items also generated good responses. Patients also used the service to ask questions, submit information about their self-management, and order supplies. No patients nominated supporters to receive text messages about their self-management goals. Another option that was not used was the birthday reminder service. Conclusions Automated, scheduled text messaging successfully engaged young people with diabetes. While the system was primarily designed to provide “push” support to patients, submission of clinical data and queries illustrates that it was seen as a trusted medium for communicating with care providers. Responses to the newsletters and submission of personal experiences and tips for circulation to other participants also illustrate the potential value of such interventions for establishing a sense of community. Although participants submitted relatively few messages, positive responses to the system suggest that most derived passive support from reading the messages. The Sweet Talk system could be readily adapted to suit other chronic disease models and age groups, and the results of this study may help to inform the design of future text message support interventions. PMID:18653444

  18. Mobile Phones in the Classroom: Examining the Effects of Texting, Twitter, and Message Content on Student Learning

    ERIC Educational Resources Information Center

    Kuznekoff, Jeffrey H.; Munz, Stevie; Titsworth, Scott

    2015-01-01

    This study examined mobile phone use in the classroom by using an experimental design to study how message content (related or unrelated to class lecture) and message creation (responding to or creating a message) impact student learning. Participants in eight experimental groups and a control group watched a video lecture, took notes, and…

  19. DICE: An Object Oriented Programming Environment for Cooperative Engineering Design

    DTIC Science & Technology

    1989-03-20

    environment called PARMENIDES /FRULEKIT; PARMENIDES /FRULEKIT supports programming in frames and rules and was developed in LISP at Carnegie-Mellon...the domain of building design and construction. The Blackboard in DICEY-BUILDER is represented as frames in PARMENIDES , while the KMs are implemented... PARMENIDES fo rart omat format d a b C /envelope BLACKBOAR D machine to machine (’BLACKBOARD l m message f il transfer message p read •d message format J

  20. Text Messages Promoting Mental Imagery Increase Self-Reported Physical Activity in Older Adults: A Randomized Controlled Study.

    PubMed

    Robin, Nicolas; Toussaint, Lucette; Coudevylle, Guillaume R; Ruart, Shelly; Hue, Olivier; Sinnapah, Stephane

    2018-06-22

    This study tested whether text messages prompting adults 50 years of age and older to perform mental imagery would increase aerobic physical activity (APA) duration using a randomized parallel trial design. Participants were assigned to an Imagery 1, Imagery 2, or placebo group. For 4 weeks, each group was exposed to two conditions (morning text message vs. no morning text message). In the morning message condition, the imagery groups received a text message with the instruction to mentally imagine performing an APA, and the placebo group received a placebo message. All participants received an evening text message of "Did you do your cardio today? If yes, what did you do?" for 3 days per week. Participants of the imagery groups reported significantly more weekly minutes of APA in the morning text message condition compared with the no morning message condition. Electronic messages were effective at increasing minutes of APA.

  1. SETI The Search for Extraterrestrial Intelligence.

    ERIC Educational Resources Information Center

    Jones, Barrie W.

    1991-01-01

    Discussed is the search for life on other planets similar to Earth based on the Drake equation. Described are search strategies and microwave searches. The reasons why people are searching are also discussed. (KR)

  2. A SETI Course at University of Western Sydney Macarthur.

    ERIC Educational Resources Information Center

    Bhathal, Ragbir

    1999-01-01

    Describes a course based on the scientific approach to the search for extraterrestrial intelligence. Explores the biological and technological aspects of the search and the social implications of possible contact. (Author/CCM)

  3. Is interstellar archeology possible?

    NASA Astrophysics Data System (ADS)

    Carrigan, Richard A.

    2012-09-01

    Searching for signatures of cosmic-scale archeological artifacts such as Dyson spheres is an interesting alternative to conventional radio SETI. Uncovering such an artifact does not require the intentional transmission of a signal on the part of the original civilization. This type of search is called interstellar archeology or sometimes cosmic archeology. A variety of interstellar archeology signatures is discussed including non-natural planetary atmospheric constituents, stellar doping, Dyson spheres, as well as signatures of stellar, and galactic-scale engineering. The concept of a Fermi bubble due to interstellar migration is reviewed in the discussion of galactic signatures. These potential interstellar archeological signatures are classified using the Kardashev scale. A modified Drake equation is introduced. With few exceptions interstellar archeological signatures are clouded and beyond current technological capabilities. However SETI for so-called cultural transmissions and planetary atmosphere signatures are within reach.

  4. A symbiotic approach to SETI observations: use of maps from the Westerbork Synthesis Radio Telescope

    NASA Technical Reports Server (NTRS)

    Tarter, J. C.; Israel, F. P.

    1982-01-01

    High spatial resolution continuum radio maps produced by the Westerbork Synthesis Radio Telescope (WSRT) of The Netherlands at frequencies near the 21 cm HI line have been examined for anomalous sources of emmission coincident with the locations of nearby bright stars. From a total of 542 stellar positions investigated, no candidates for radio stars or ETI signals were discovered to formal limits on the minimum detectable signal ranging from 7.7 x 10(-22) W/m2 to 6.4 x 10(-24) W/m2. This preliminary study has verified that data collected by radio astronomers at large synthesis arrays can profitably be analysed for SETI signals (in a non-interfering manner) provided only that the data are available in the form of a more or less standard two dimensional map format.

  5. A symbiotic approach to SETI observations: use of maps from the Westerbork Synthesis Radio Telescope.

    PubMed

    Tarter, J C; Israel, F P

    1982-01-01

    High spatial resolution continuum radio maps produced by the Westerbork Synthesis Radio Telescope (WSRT) of The Netherlands at frequencies near the 21 cm HI line have been examined for anomalous sources of emmission coincident with the locations of nearby bright stars. From a total of 542 stellar positions investigated, no candidates for radio stars or ETI signals were discovered to formal limits on the minimum detectable signal ranging from 7.7 x 10(-22) W/m2 to 6.4 x 10(-24) W/m2. This preliminary study has verified that data collected by radio astronomers at large synthesis arrays can profitably be analysed for SETI signals (in a non-interfering manner) provided only that the data are available in the form of a more or less standard two dimensional map format.

  6. A Serendipitous MWA Search for Narrowband Signals from ‘Oumuamua

    NASA Astrophysics Data System (ADS)

    Tingay, S. J.; Kaplan, D. L.; Lenc, E.; Croft, S.; McKinley, B.; Beardsley, A.; Crosse, B.; Emrich, D.; Franzen, T. M. O.; Gaensler, B. M.; Horsley, L.; Johnston-Hollitt, M.; Kenney, D.; Morales, M. F.; Pallot, D.; Steele, K.; Trott, C. M.; Walker, M.; Wayth, R. B.; Williams, A.; Wu, C.

    2018-04-01

    We examine data from the Murchison Widefield Array (MWA) in the frequency range 72–102 MHz for a field of view that serendipitously contained the interstellar object ‘Oumuamua on 2017 November 28. Observations took place with a time resolution of 0.5 s and a frequency resolution of 10 kHz. Based on the interesting but highly unlikely suggestion that ‘Oumuamua is an interstellar spacecraft, due to some unusual orbital and morphological characteristics, we examine our data for signals that might indicate the presence of intelligent life associated with ‘Oumuamua. We searched our radio data for (1) impulsive narrowband signals, (2) persistent narrowband signals, and (3) impulsive broadband signals. We found no such signals with nonterrestrial origins and make estimates of the upper limits on equivalent isotropic radiated power (EIRP) for these three cases of approximately 7 kW, 840 W, and 100 kW, respectively. These transmitter powers are well within the capabilities of human technologies, and are therefore plausible for alien civilizations. While the chances of positive detection in any given search for extraterrestrial intelligence (SETI) experiment are vanishingly small, the characteristics of new generation telescopes such as the MWA (and, in the future, the Square Kilometre Array) make certain classes of SETI experiments easy, or even a trivial by-product of astrophysical observations. This means that the future costs of SETI experiments are very low, allowing large target lists to partially balance the low probability of a positive detection.

  7. Evo-SETI: A Mathematical Tool for Cladistics, Evolution, and SETI

    PubMed Central

    Maccone, Claudio

    2017-01-01

    The discovery of new exoplanets makes us wonder where each new exoplanet stands along its way to develop life as we know it on Earth. Our Evo-SETI Theory is a mathematical way to face this problem. We describe cladistics and evolution by virtue of a few statistical equations based on lognormal probability density functions (pdf) in the time. We call b-lognormal a lognormal pdf starting at instant b (birth). Then, the lifetime of any living being becomes a suitable b-lognormal in the time. Next, our “Peak-Locus Theorem” translates cladistics: each species created by evolution is a b-lognormal whose peak lies on the exponentially growing number of living species. This exponential is the mean value of a stochastic process called “Geometric Brownian Motion” (GBM). Past mass extinctions were all-lows of this GBM. In addition, the Shannon Entropy (with a reversed sign) of each b-lognormal is the measure of how evolved that species is, and we call it EvoEntropy. The “molecular clock” is re-interpreted as the EvoEntropy straight line in the time whenever the mean value is exactly the GBM exponential. We were also able to extend the Peak-Locus Theorem to any mean value other than the exponential. For example, we derive in this paper for the first time the EvoEntropy corresponding to the Markov-Korotayev (2007) “cubic” evolution: a curve of logarithmic increase. PMID:28383497

  8. The effects of iPod and text-messaging use on driver distraction: a bio-behavioral analysis.

    PubMed

    Mouloua, M; Ahern, A; Quevedo, A; Jaramillo, D; Rinalducci, E; Smither, J; Alberti, P; Brill, C

    2012-01-01

    This study was designed to empirically examine the effects of iPod device and text-messaging activities on driver distraction. Sixty participants were asked to perform a driving simulation task while searching for songs using an iPod device or text messaging. Driving errors as measured by lane deviations were recorded and analyzed as a function of the distracters. Physiological measures (EEG) were also recorded during the driving phases in order to measure participant levels of cortical arousal. It was hypothesized that iPod use and text messaging would result in a profound effect on driving ability. The results showed a significant effect of iPod use and text-messaging on driving performance. Increased numbers of driving errors were recorded during the iPod and text-messaging phases than the pre- and post-allocation phases. Higher levels of Theta activity were also observed during the iPod and Text-messaging phase than the pre- and post-allocation phases. Implications for in-vehicle systems design, training, and safety are also discussed.

  9. Designing Skin Cancer Prevention Messages: Should We Emphasize Gains or Losses? Message Framing, Risk Type, and Prior Experience.

    PubMed

    Lee, Moon J; Kang, Hannah

    2018-05-01

    To test whether message framing (ie, gain vs. loss) and risk type (ie, health vs appearance risk) in skin cancer prevention messages interact with one's prior experience. Two experiments with a 2 (message framing: gain vs loss) × 2 (risk type: health vs appearance risk) factorial design were conducted. The participants were given a URL to the experiment website via e-mail. On the first page of the website, the participants were told that they would be asked to evaluate a skin cancer print public service announcement (PSA): Online experiments. A total of 397 individuals participated (236 for experiment 1 and 161 for experiment 2). Apparatus: Four versions of the skin cancer print PSAs were developed. Four PSAs were identical except for the 2 manipulated components: message framing and risk type. Measures were adopted from Cho and Boster (message framing), Jones and Leary and Kiene et al. (risk type), De Vries, Mesters, van't Riet, Willems, and Reubsaet and Knight, Kirincich, Farmer, and Hood (prior experience), and Hammond, Fong, Zanna, Thrasher, and Borland and Hoffner and Ye (behavioral intent). General linear models were used to test hypotheses. Three-way interactions among message framing, risk type, and prior experience were found: When the intent of the message was to encourage sunscreen use, the effects of message framing and risk type were shown to be the exact opposite directions from when the intent was to discourage indoor/outdoor tanning. To discourage tanning among those with prior experience, messages emphasizing losses in terms of one's health will work better. For those with no prior experience, messages emphasizing potential appearance losses will work better for discouraging tanning while messages emphasizing gains like improving appearance will do a better job in encouraging sunscreen use.

  10. Persuasive messages. Development of persuasive messages may help increase mothers' compliance of their children's immunization schedule.

    PubMed

    Gore, P; Madhavan, S; Curry, D; McClurg, G; Castiglia, M; Rosenbluth, S A; Smego, R A

    1998-01-01

    Effective immunization campaigns can be designed by determining which persuasion strategy is most effective in attracting the attention of mothers of preschoolers. The authors assess the impact of three persuasional strategies: fear-arousal, motherhood-arousal, and rational messages, on mothers of preschoolers who are late for their immunizations. The fear-arousal message was found to be most effective, followed by the motherhood-arousal, and then the rational message, in attracting mothers' attention to their child's immunization status.

  11. Effects of subliminal backward-recorded messages on attitudes.

    PubMed

    Swart, L C; Morgan, C L

    1992-12-01

    This study was designed to measure the effects of subliminal backward messages on attitudes. It was hypothesized that subliminal backward-recorded messages would influence the attitudes of listeners. Three subliminal backward-recorded messages from a popular song were used. 82 undergraduates were randomly assigned to one of four conditions: a three-message group heard a tape containing the backward messages recorded three times in succession, a six-message group heard a tape with the same backward messages recorded six times in succession, two control groups heard nonbackward recorded music. No statistically significant differences were found between the groups on a posttape attitude questionnaire. The results are discussed in terms of unconscious processing and the tricomponent theory of attitudes and attitude change.

  12. Visual Dialect: Ethnovisual and Sociovisual Elements of Design in Public Service Communication.

    ERIC Educational Resources Information Center

    Schiffman, Carole B.

    Graphic design is a form of communication by which visual messages are conveyed to a viewer. Audience needs and views must steer the design process when constructing public service visual messages. Well-educated people may be better able to comprehend visuals which require some level of interpretation or extend beyond their world view. Public…

  13. Navigating Cross-Cultures, Curriculum and Confrontation: Addressing Ethics and Stereotypes in Design Education

    ERIC Educational Resources Information Center

    Buck-Coleman, Audra

    2010-01-01

    Graphic design's messages can reach across streets and across the globe; they can bring together countries, communities and strangers for a common cause; they can also serve to divide otherwise amenable neighbors. Design students must fully understand this potential reach and thus the responsibility they have to create tolerant, informed messages.…

  14. MessageSpace: a messaging system for health research

    NASA Astrophysics Data System (ADS)

    Escobar, Rodrigo D.; Akopian, David; Parra-Medina, Deborah; Esparza, Laura

    2013-03-01

    Mobile Health (mHealth) has emerged as a promising direction for delivery of healthcare services via mobile communication devices such as cell phones. Examples include texting-based interventions for chronic disease monitoring, diabetes management, control of hypertension, smoking cessation, monitoring medication adherence, appointment keeping and medical test result delivery; as well as improving patient-provider communication, health information communication, data collection and access to health records. While existing messaging systems very well support bulk messaging and some polling applications, they are not designed for data collection and processing of health research oriented studies. For that reason known studies based on text-messaging campaigns have been constrained in participant numbers. In order to empower healthcare promotion and education research, this paper presents a system dedicated for healthcare research. It is designed for convenient communication with various study groups, feedback collection and automated processing.

  15. Design Report for the Synchronized Position, Velocity, and Time Code Generator

    DTIC Science & Technology

    2015-08-01

    Stream Specification 4 2.3 Data Packet Format Specification 4 2.3.1 Individual Message Definition 5 3. MATLAB Parsing Software 6 4. Conclusions and...packet format structure ..................................................................4 Table 2 PPS time message definition ...5 Table 3 Position message definition ...................................................................5

  16. Design and Multi-Country Validation of Text Messages for an mHealth Intervention for Primary Prevention of Progression to Hypertension in Latin America.

    PubMed

    Diez-Canseco, Francisco; Zavala-Loayza, J Alfredo; Beratarrechea, Andrea; Kanter, Rebecca; Ramirez-Zea, Manuel; Rubinstein, Adolfo; Martinez, Homero; Miranda, J Jaime

    2015-02-18

    Mobile health (mHealth) has been posited to contribute to the reduction in health gaps and has shown fast and widespread growth in developing countries. This growth demands understanding of, and preparedness for, local cultural contexts. To describe the design and validation of text messages (short message service, SMS) that will be used for an mHealth behavioral change intervention to prevent hypertension in three Latin American countries: Argentina, Guatemala, and Peru. An initial set of 64 SMS text messages were designed to promote healthy lifestyles among individuals in different stages of behavior change, addressing four key domains: salt and sodium intake, fruit and vegetable intake, consumption of high fat and sugar foods, and physical activity. The 64 SMS text messages were organized into nine subsets for field validation. In each country 36 people were recruited, half of them being male. Of the participants, 4 per country evaluated each subset of SMS text messages, which contained between 6 and 8 SMS text messages regarding different key domains and stages of change. The understanding and appeal of each SMS text message was assessed using a 7-item questionnaire. The understanding and appeal ratings were used to reach a final set of 56 SMS text messages. Overall, each of the 64 SMS text messages received a total of 12 evaluations (4 per country). The majority of evaluations-742 out of a total of 767 (96.7%) valid responses-revealed an adequate understanding of the key idea contained in the SMS text message. On a scale from 1 to 10, the average appeal score was 8.7 points, with a range of 4 to 10 points. Based on their low scores, 8 SMS text messages per country were discarded. Once the final set of 56 SMS text messages was established, and based on feedback obtained in the field, wording and content of some SMS text messages were improved. Of the final set, 9, 8, and 16 of the SMS text messages were improved based on participant evaluations from Argentina, Guatemala, and Peru, respectively. Most SMS text messages selected for the final set (49/56, 88%) were the same in all countries, except for small wording differences. The final set of SMS text messages produced had very high rates of understanding and appeal in three different Latin American countries. This study highlights the importance of developing and validating a package of simple, preventative SMS text messages, grounded in evidence and theory, across three different Latin American countries with active engagement of end users.

  17. Design and Multi-Country Validation of Text Messages for an mHealth Intervention for Primary Prevention of Progression to Hypertension in Latin America

    PubMed Central

    Diez-Canseco, Francisco; Zavala-Loayza, J Alfredo; Beratarrechea, Andrea; Kanter, Rebecca; Ramirez-Zea, Manuel; Rubinstein, Adolfo; Martinez, Homero

    2015-01-01

    Background Mobile health (mHealth) has been posited to contribute to the reduction in health gaps and has shown fast and widespread growth in developing countries. This growth demands understanding of, and preparedness for, local cultural contexts. Objective To describe the design and validation of text messages (short message service, SMS) that will be used for an mHealth behavioral change intervention to prevent hypertension in three Latin American countries: Argentina, Guatemala, and Peru. Methods An initial set of 64 SMS text messages were designed to promote healthy lifestyles among individuals in different stages of behavior change, addressing four key domains: salt and sodium intake, fruit and vegetable intake, consumption of high fat and sugar foods, and physical activity. The 64 SMS text messages were organized into nine subsets for field validation. In each country 36 people were recruited, half of them being male. Of the participants, 4 per country evaluated each subset of SMS text messages, which contained between 6 and 8 SMS text messages regarding different key domains and stages of change. The understanding and appeal of each SMS text message was assessed using a 7-item questionnaire. The understanding and appeal ratings were used to reach a final set of 56 SMS text messages. Results Overall, each of the 64 SMS text messages received a total of 12 evaluations (4 per country). The majority of evaluations—742 out of a total of 767 (96.7%) valid responses—revealed an adequate understanding of the key idea contained in the SMS text message. On a scale from 1 to 10, the average appeal score was 8.7 points, with a range of 4 to 10 points. Based on their low scores, 8 SMS text messages per country were discarded. Once the final set of 56 SMS text messages was established, and based on feedback obtained in the field, wording and content of some SMS text messages were improved. Of the final set, 9, 8, and 16 of the SMS text messages were improved based on participant evaluations from Argentina, Guatemala, and Peru, respectively. Most SMS text messages selected for the final set (49/56, 88%) were the same in all countries, except for small wording differences. Conclusions The final set of SMS text messages produced had very high rates of understanding and appeal in three different Latin American countries. This study highlights the importance of developing and validating a package of simple, preventative SMS text messages, grounded in evidence and theory, across three different Latin American countries with active engagement of end users. PMID:25693595

  18. Design of Instant Messaging System of Multi-language E-commerce Platform

    NASA Astrophysics Data System (ADS)

    Yang, Heng; Chen, Xinyi; Li, Jiajia; Cao, Yaru

    2017-09-01

    This paper aims at researching the message system in the instant messaging system based on the multi-language e-commerce platform in order to design the instant messaging system in multi-language environment and exhibit the national characteristics based information as well as applying national languages to e-commerce. In order to develop beautiful and friendly system interface for the front end of the message system and reduce the development cost, the mature jQuery framework is adopted in this paper. The high-performance server Tomcat is adopted at the back end to process user requests, and MySQL database is adopted for data storage to persistently store user data, and meanwhile Oracle database is adopted as the message buffer for system optimization. Moreover, AJAX technology is adopted for the client to actively pull the newest data from the server at the specified time. In practical application, the system has strong reliability, good expansibility, short response time, high system throughput capacity and high user concurrency.

  19. Audience reactions and receptivity to HIV prevention message concepts for people living with HIV.

    PubMed

    Uhrig, Jennifer D; Bann, Carla M; Wasserman, Jill; Guenther-Grey, Carolyn; Eroğlu, Doğan

    2010-04-01

    This study measured audience reactions and receptivity to five draft HIV prevention messages developed for people living with HIV (PLWH) to inform future HIV message choice and audience targeting decisions. Our premise was that message concepts that receive wide audience appeal constitute a strong starting point for designing future HIV prevention messages, program activities, and health communication and marketing campaigns for PLWH. The majority of participants indicated agreement with evaluative statements that expressed favorable attitudes toward all five of the message concepts we evaluated. Participants gave the lowest approval to the message promoting sero-sorting. Sociodemographic characteristics played less of a role in predicting differences in message perceptions than attitudes, beliefs and sexual behavior. The general appeal for these messages is encouraging given that messages were expressed in plain text without the support of other creative elements that are commonly used in message execution. These results confirm the utility of systematic efforts to generate and screen message concepts prior to large-scale testing.

  20. SETI@home

    Science.gov Websites

    experiment, based at UC Berkeley, that uses Internet-connected computers in the Search for Extraterrestrial several hours to be sure. If that didn't solve the problem, it probably means the index the server uses to

  1. Monitoring Receptivity to Online Health Messages by Tracking Daily Web Traffic Engagement Patterns: A Review of More than 13 Million US Web Exposures over 1,235 Days.

    PubMed

    Seeman, Neil; Seeman, Bob

    2017-01-01

    Reaching the recipient of online health messages is necessary to Web-based health promotion applications. To measure willingness to adhere to a health-related Web message, we explored the frequency with which more than 13 million Web users ignored or opted to receive a random inbound message. The findings suggest declining curiosity among Web users about online messages, and that certain days may be more propitious than others for communicating with users. This approach can be modified to gather more granular insights into how messages, including timing and design features, can be tailored to promote improved public health messaging.

  2. Message Testing to Create Effective Health Communication Campaigns

    ERIC Educational Resources Information Center

    Domigan, Juliane; Glassman, Tavis J.; Miller, Jeff; Hug, Heather; Diehr, Aaron J.

    2015-01-01

    Purpose: The purpose of this paper was to assess a health communication campaign designed to reduce distracted driving among college students within the USA. Design/methodology/approach: Utilizing central interviewing techniques, participants were asked qualitative and quantitative items soliciting feedback concerning the efficacy of the messages.…

  3. Software Design Document MCC CSCI (1). Volume 1 Sections 1.0-2.18

    DTIC Science & Technology

    1991-06-01

    AssociationUserProtocol /simnet/common!include/prot ____________________ ____________________ ocol/p assoc.h Primitive long Standard C type...Information. 2.2.1.4.2 ProcessMessage ProcessMessage processes a message from another process. type describes the message as either one-way, a synchronous or...Macintosh Consoles. This is sometimes necessary due to normal clock skew so that operations among the MCC components will remain synchronized . This

  4. Effects of color scheme and message lines of variable message signs on driver performance.

    PubMed

    Lai, Chien-Jung

    2010-07-01

    The advancement in variable message signs (VMS) technology has made it possible to display message with various formats. This study presented an ergonomic study on the message design of Chinese variable message signs on urban roads in Taiwan. Effects of color scheme (one, two and three) and number of message lines (single, double and triple) of VMS on participants' response performance were investigated through a laboratory experiment. Results of analysis showed that color scheme and number of message lines are significant factors for participants' response time to VMS. Participants responded faster for two-color than for one- and three-color scheme. Participants also took less response time for double line message than for single and triple line message. Both color scheme and number of message lines had no significant effect on participants' response accuracy. The preference survey after the experiment showed that most participants preferred two-color scheme and double line message to the other combinations. The results can assist in adopting appropriate color scheme and number of message lines of Chinese VMS. Copyright 2009 Elsevier Ltd. All rights reserved.

  5. Sensation Seeking as a Moderator of Gain- and Loss-Framed HIV-Test Promotion Message Effects.

    PubMed

    Hull, Shawnika J; Hong, Yangsun

    2016-01-01

    This study used an experiment (N = 504) to test whether the fit between sensation-seeking disposition and frame enhances the persuasiveness of gain- and loss-framed HIV test promotion messages. Gain- and loss-framed messages may be consistent with low and high sensation seekers' disposition with respect to risk behavior. We hypothesized that a loss-framed message would be more persuasive for high sensation seekers and that a gain-framed message should be more effective for low sensation seekers. We also expected elaboration to mediate the interaction. Results demonstrated the hypothesized interaction. When the message frame fit with the viewer's way of thinking, the persuasive power of the message was enhanced. The mediation hypothesis was not supported. Practical implications for targeting and message design are discussed.

  6. Two systems analyses of SETI. [microwave Search for Extra-Terrestrial Intelligence

    NASA Technical Reports Server (NTRS)

    Machol, R. E.

    1976-01-01

    The problem of receiving and identifying a single microwave signal transmitted by extraterrestrial intelligent beings is analyzed in the cases where the signal is designed to catch our attention and the signal is designed for internal purposes of another civilization. Six variables which yield uncertainty as to the exact signal which should be searched for are described: polarization, modulation, flux level, direction, frequency (including bandwidth and drift rate), and time. It is shown that if all reasonable variations of these parameters are to be examined sequentially for 1000 seconds, the search would take over a million times longer than the age of the Universe. Ways to simplify the search are considered, including widening the frequency bin, selecting specific targets, cutting the observation time, using a Fourier transform device for data processing, and building larger antennas as well as better low-noise receivers.

  7. The Telecommunications and Data Acquisition Report

    NASA Technical Reports Server (NTRS)

    Posner, E. C. (Editor)

    1988-01-01

    The Office of Space Operation (OSO) tasks addressed include: Deep Space Network (DSN) advanced systems and systems implementation. The Office of Space Science and Applications (OSSA) tasks discussed include SETI data controllers and simulated performance for narrowband signal detection.

  8. Making the message meaningful: a qualitative assessment of media promoting all-terrain vehicle safety.

    PubMed

    Brann, Maria; Mullins, Samantha Hope; Miller, Beverly K; Eoff, Shane; Graham, James; Aitken, Mary E

    2012-08-01

    Millions of all-terrain vehicles (ATV) are used around the world for recreation by both adults and youth. This increase in use has led to a substantial increase in the number of injuries and fatalities each year. Effective strategies for reducing this incidence are clearly needed; however, minimal research exists regarding effective educational interventions. This study was designed to assess rural ATV riders' preferences for and assessment of safety messages. 13 focus group discussions with youth and adult ATV riders were conducted. 88 formative research participants provided feedback on existing ATV safety materials, which was used to develop more useful ATV safety messages. 60 evaluative focus group participants critiqued the materials developed for this project. Existing ATV safety materials have limited effectiveness, in part because they may not address the content or design needs of the target population. ATV riders want educational and action-oriented safety messages that inform youth and adult riders about their responsibilities to learn, educate and implement safety behaviours (eg, appropriate-sized ATV, safety gear, solo riding, speed limits, riding locations). In addition, messages should be clear, realistic, visually appealing and easily accessible. Newly designed ATV safety materials using the acronym TRIPSS (training, ride off-road, impairment, plan ahead, safety gear, single rider) meet ATV riders' safety messaging needs. To reach a target population, it is crucial to include them in the development and assessment of safety messages. Germane to this particular study, ATV riders provided essential information for creating useful ATV safety materials.

  9. Unpacking the great transmission debate

    NASA Astrophysics Data System (ADS)

    Denning, Kathryn

    2010-12-01

    The debate about the wisdom of sending interstellar transmissions is well-known to those involved in SETI, and frustrating for many. Its tendency towards intractability is a result of multiple factors, including: different models of the scientist's role as citizen and/or leader; disparate ideas about society's readiness to cope with frontier science; variable political substrates, particularly ideas concerning individual freedom and state control; competing ideologies of globalization; and the perceived relative risks and benefits of contact. (Variations in the latter, i.e. assessments of the risks and benefits of contact, derive partly from different thinking styles, including tolerance for risk, and partly from inferences based upon episodes of biological and cultural contact on Earth.) Unpacking the debate into its components may be of use to those debating policy about SETI transmissions, or at the very least, help keep in focus what, precisely, the perennial arguments are really about.

  10. Space biology research development

    NASA Technical Reports Server (NTRS)

    Bonting, Sjoerd L.

    1993-01-01

    The purpose of the Search for Extraterrestrial Intelligence (SETI) Institute is to conduct and promote research related activities regarding the search for extraterrestrial life, particularly intelligent life. Such research encompasses the broad discipline of 'Life in the Universe', including all scientific and technological aspects of astronomy and the planetary sciences, chemical evolution, the origin of life, biological evolution, and cultural evolution. The primary purpose was to provide funding for the Principal Investigator to collaborate with the personnel of the SETI Institute and the NASA-Ames Research center in order to plan and develop space biology research on and in connection with Space Station Freedom; to promote cooperation with the international partners in the space station; to conduct a study on the use of biosensors in space biology research and life support system operation; and to promote space biology research through the initiation of an annual publication 'Advances in Space Biology and Medicine'.

  11. SETI: A good introductory physics topic

    NASA Astrophysics Data System (ADS)

    Hobson, Art

    1997-04-01

    If America is to achieve the science literacy that is essential to industrialized democracy, all students must study such topics as scientific methodology, pseudoscience, ozone depletion, and global warming. My large-enrollment liberal-arts physics course covers the great principles of physics along with several such philosophical and societal topics. It is easy to include the interdisciplinary context of physics in courses for non-scientists, because these courses are flexible, conceptual, and taught to students whose interests span a broad range. Students find these topics relevant and fascinating, leading to large enrollments by non-scientists even in courses labeled ''physics.'' I will discuss my approach to teaching the search for extra-terrestrial intelligence (SETI), a topic with lots of good physics and with connections to scientific methodology and pseudoscience. A textbook for this kind of course has been published, Physics: Concepts and Connections (Prentice-Hall, 1995).

  12. The SETI episode in the 1967 discovery of pulsars

    NASA Astrophysics Data System (ADS)

    Penny, Alan John

    2013-09-01

    In the winter of 1967 Cambridge radio astronomers discovered a new type of radio source of such an artificial seeming nature that for a few weeks some members of the group had to seriously consider whether they had discovered an extraterrestrial intelligence. Although their investigations lead them to a natural explanation (they had discovered pulsars), they had discussed the implications if it was indeed an artificial source: how to verify such a conclusion and how to announce it, and whether such a discovery might be dangerous. In this they presaged many of the components of the SETI Detection Protocols and the proposed Reply Protocols which have been used to guide the responses of groups dealing with the detection of an extraterrestrial intelligence. These Protocols were only established some twenty five years later in the 1990s and 2000s. Using contemporary and near-contemporary documentation and later recollections, this paper discusses in detail what happened that winter.

  13. SETI: another way to find habitable worlds

    NASA Astrophysics Data System (ADS)

    Tarter, Jill

    2003-10-01

    There are currently eleven active SETI (search for extraterrestrial intelligence) programs on telescopes around the world. They operate at microwave and optical frequencies, as either sky surveys or targeted searches in the direction of (primarily) solar-type stars. Each is attempting to detect an electromagnetic biosignature of a technological civilization. Although detectable technologies will be far older than our own, these searches are constrained by our current understanding of physics and the terrestrial technologies available in the 21st century. Moore's Law suggests that most of these detection technologies will improve their capacity exponentially. Thus if any of the current strategies is valid, a thorough exploration of the Milky Way Galaxy should be possible within decades (not centuries), and success, or a significant null-result is predictable. Giving up, incorporating new search strategies based on emergent technologies, or adding beacon transmission to the listening strategies are all future possibilities.

  14. The Impact of the Temporal Distribution of Communicating Civilizations on Their Detectability.

    PubMed

    Balbi, Amedeo

    2018-01-01

    We used a statistical model to investigate the detectability (defined by the requirement that causal contact has been initiated with us) of communicating civilizations within a volume of the Universe surrounding our location. If the civilizations are located in our galaxy, the detectability requirement imposes a strict constraint on their epoch of appearance and their communicating life span. This, in turn, implies that our ability to gather empirical evidence of the fraction of civilizations within range of detection strongly depends on the specific features of their temporal distribution. Our approach illuminates aspects of the problem that can escape the standard treatment based on the Drake equation. Therefore, it might provide the appropriate framework for future studies dealing with the evolutionary aspects of the search for extraterrestrial intelligence (SETI). Key Words: Astrobiology-Extraterrestrial life-SETI-Complex life-Life detection-Intelligence. Astrobiology 18, 54-58.

  15. A numerical testbed for hypotheses of extraterrestrial life and intelligence

    NASA Astrophysics Data System (ADS)

    Forgan, D. H.

    2009-04-01

    The search for extraterrestrial intelligence (SETI) has been heavily influenced by solutions to the Drake Equation, which returns an integer value for the number of communicating civilizations resident in the Milky Way, and by the Fermi Paradox, glibly stated as: ‘If they are there, where are they?’. Both rely on using average values of key parameters, such as the mean signal lifetime of a communicating civilization. A more accurate answer must take into account the distribution of stellar, planetary and biological attributes in the galaxy, as well as the stochastic nature of evolution itself. This paper outlines a method of Monte Carlo realization that does this, and hence allows an estimation of the distribution of key parameters in SETI, as well as allowing a quantification of their errors (and the level of ignorance therein). Furthermore, it provides a means for competing theories of life and intelligence to be compared quantitatively.

  16. A bimodal search strategy for SETI

    NASA Technical Reports Server (NTRS)

    Gulkis, S.; Olsen, E. T.; Tarter, J.

    1980-01-01

    The search strategy and resultant observational plan which was developed to carry out a comprehensive Search for Extraterrestrial Intelligence (SETI) over that portion of the electromagnetic spectrum known as the terrestrial microwave window is described. The limiting sensitivity achieved was parameterized and calculated for Deep Space Network antennas as well as several radio astronomy observatories. A brief description of the instrumentation to be employed in the search and the classes of signals to be looked for is given. One observational goal is to survey the entire sky over a wide range of frequency to a relatively constant flux level. This survey ensures that all potential life sites are observed to some limiting equivalent isotropic radiated power depending upon their distance. A second goal is to survey a set of potential transmission sites selected a priori to be especially promising, achieving very high sensitivity over a smaller range of frequency.

  17. Five Years of SETI with the Allen Telescope Array: Lessons Learned

    NASA Astrophysics Data System (ADS)

    Harp, Gerald

    2016-01-01

    We discuss recent observations at the Allen Telescope Array (ATA) supporting a wide ranging Search for Extraterrestrial Intelligence (SETI). The ATA supports observations over the frequency range 1-10 GHz with three simultaneous phased array beams used in an anticoincidence detector for false positive rejection. Here we summarize observational results over the years 2011-2015 covering multiple campaigns of exoplanet stars, the galactic plane, infrared excess targets, etc. Approximately 2 x 108 signals were identified and classified over more than 5000 hours of observation. From these results we consider various approaches to the rapid identification of human generated interference in the process of the search for a signal with origins outside the radius of the Moon's orbit. We conclude that the multi-beam technique is superb tool for answering the very difficult question of the direction of origin of signals. Data-based simulations of future instruments with more than 3 beams are compared.

  18. Ten years of the international review meetings on Communication with Extraterrestrial Intelligence /CETI/

    NASA Technical Reports Server (NTRS)

    Pesek, R.; Billingham, J.

    1981-01-01

    The development of ideas on CETI within the international community over the past five years is reviewed, and the outlook for future CETI activities is discussed. The growth of review sessions on CETI held annually by the International Academy of Astronautics (IAA) is considered, with particular attention given to the issue of radio frequency allocation for the search for extraterrestrial intelligence. CETI activities outside the IAA are then examined, including the Viking search for life on Mars, Project Orion for the detection of extrasolar planetary systems, SETI programs undertaken in the U.S. and Soviet Union, and the development of multispectral spectrum analyzers and signal processors. The expected future development of CETI strategies, techniques and instrumentation as well as popular and scientific interest in SETI are discussed, and it is noted that the IAA sessions remain the only regular international forum for the exchange of data on all aspects of CETI.

  19. Relevance and speed of message delivery trade-offs in augmentative and alternative communication.

    PubMed

    Bedrosian, Jan L; Hoag, Linda A; McCoy, Kathleen F

    2003-08-01

    This report is the first in a series of investigations designed to test a theory identifying the effects of conversational trade-offs between selected maxims on public attitudes toward augmentative and alternative communication (AAC) system users and their communication. In the current study, the trade-offs between the relevance of a prestored message and its speed of delivery were examined. Participating were 96 sales clerks. Twelve scripted videotaped conversational conditions, involving an AAC customer and a clerk at a checkout counter, were used to manipulate message relevance, speed of message delivery, and participant/AAC user gender. Following each assigned viewing, participants completed a questionnaire designed to assess their attitudes toward the AAC user and his or her communication. Significantly higher mean ratings were found for the conditions involving the slowly delivered relevant messages (both preceded by a conversational floorholder and without a floorholder) when compared to the quickly delivered partly relevant message condition. In addition, the condition involving the slowly delivered relevant message with a floorholder yielded significantly higher mean ratings than that without the floorholder. There was no effect for participant/user gender. Modifications of the theory and technological implications are discussed.

  20. Effects of message framing in anti-binge drinking PSAs: the moderating role of counterfactual thinking.

    PubMed

    Baek, Tae Hyun; Shen, Lijiang; Reid, Leonard N

    2013-01-01

    This experiment examined the interaction effects of message framing and counterfactual thinking on attitudes toward binge drinking and behavioral intentions. Data from a 2 (message framing: gain vs. loss) × 2 (counterfactual thinking priming: additive vs. subtractive) between-subjects factorial design showed that a gain-framed message resulted in lower binge drinking intentions than did a loss-framed message after subjects engaged in additive counterfactual thinking. The effects of a loss-framed message on binge drinking intentions occurred when subtractive counterfactual thinking was induced. Theoretical and practical implications for anti-binge drinking public service announcements are discussed.

  1. Recipient Design in Tacit Communication

    ERIC Educational Resources Information Center

    Newman-Norlund, Sarah E.; Noordzij, Matthijs L.; Newman-Norlund, Roger D.; Volman, Inge A. C.; de Ruiter, Jan Peter; Hagoort, Peter; Toni, Ivan

    2009-01-01

    The ability to design tailored messages for specific listeners is an important aspect of human communication. The present study investigates whether a mere belief about an addressee's identity influences the generation and production of a communicative message in a novel, non-verbal communication task. Participants were made to believe they were…

  2. Design of a network for concurrent message passing systems

    NASA Astrophysics Data System (ADS)

    Song, Paul Y.

    1988-08-01

    We describe the design of the network design frame (NDF), a self-timed routing chip for a message-passing concurrent computer. The NDF uses a partitioned data path, low-voltage output drivers, and a distributed token-passing arbiter to provide a bandwidth of 450 Mbits/sec into the network. Wormhole routing and bidirectional virtual channels are used to provide low latency communications, less than 2us latency to deliver a 216 bit message across the diameter of a 1K node mess-connected machine. To support concurrent software systems, the NDF provides two logical networks, one for user messages and one for system messages. The two networks share the same set of physical wires. To facilitate the development of network nodes, the NDF is a design frame. The NDF circuitry is integrated into the pad frame of a chip leaving the center of the chip uncommitted. We define an analytic framework in which to study the effects of network size, network buffering capacity, bidirectional channels, and traffic on this class of networks. The response of the network to various combinations of these parameters are obtained through extensive simulation of the network model. Through simulation, we are able to observe the macro behavior of the network as opposed to the micro behavior of the NDF routing controller.

  3. C2 Core and UCore Message Design Capstone: Interoperable Message Structure

    DTIC Science & Technology

    2009-09-01

    there are sufficient resources to carry out a mission. The Team used the Theatre Battle Management Command System ( TBMCS ) to generate sample CMD...System ( TBMCS ) was used to generate CMD messages as inputs for both use cases. These were programmatically transformed into the three-layer message...used for the experiment was generated from the TBMCS in the form of a CMD XML document. The Capstone experiment included transforming that document to

  4. Guidelines and Recommendations for Developing Interactive eHealth Apps for Complex Messaging in Health Promotion.

    PubMed

    Heffernan, Kayla Joanne; Chang, Shanton; Maclean, Skye Tamara; Callegari, Emma Teresa; Garland, Suzanne Marie; Reavley, Nicola Jane; Varigos, George Andrew; Wark, John Dennis

    2016-02-09

    The now ubiquitous catchphrase, "There's an app for that," rings true owing to the growing number of mobile phone apps. In excess of 97,000 eHealth apps are available in major app stores. Yet the effectiveness of these apps varies greatly. While a minority of apps are developed grounded in theory and in conjunction with health care experts, the vast majority are not. This is concerning given the Hippocratic notion of "do no harm." There is currently no unified formal theory for developing interactive eHealth apps, and development is especially difficult when complex messaging is required, such as in health promotion and prevention. This paper aims to provide insight into the creation of interactive eHealth apps for complex messaging, by leveraging the Safe-D case study, which involved complex messaging required to guide safe but sufficient UV exposure for vitamin D synthesis in users. We aim to create recommendations for developing interactive eHealth apps for complex messages based on the lessons learned during Safe-D app development. For this case study we developed an Apple and Android app, both named Safe-D, to safely improve vitamin D status in young women through encouraging safe ultraviolet radiation exposure. The app was developed through participatory action research involving medical and human computer interaction researchers, subject matter expert clinicians, external developers, and target users. The recommendations for development were created from analysis of the development process. By working with clinicians and implementing disparate design examples from the literature, we developed the Safe-D app. From this development process, recommendations for developing interactive eHealth apps for complex messaging were created: (1) involve a multidisciplinary team in the development process, (2) manage complex messages to engage users, and (3) design for interactivity (tailor recommendations, remove barriers to use, design for simplicity). This research has provided principles for developing interactive eHealth apps for complex messaging as guidelines by aggregating existing design concepts and expanding these concepts and new learnings from our development process. A set of guidelines to develop interactive eHealth apps generally, and specifically those for complex messaging, was previously missing from the literature; this research has contributed these principles. Safe-D delivers complex messaging simply, to aid education, and explicitly, considering user safety.

  5. Guidelines and Recommendations for Developing Interactive eHealth Apps for Complex Messaging in Health Promotion

    PubMed Central

    Heffernan, Kayla Joanne; Maclean, Skye Tamara; Callegari, Emma Teresa; Garland, Suzanne Marie; Reavley, Nicola Jane; Varigos, George Andrew; Wark, John Dennis

    2016-01-01

    Background The now ubiquitous catchphrase, “There’s an app for that,” rings true owing to the growing number of mobile phone apps. In excess of 97,000 eHealth apps are available in major app stores. Yet the effectiveness of these apps varies greatly. While a minority of apps are developed grounded in theory and in conjunction with health care experts, the vast majority are not. This is concerning given the Hippocratic notion of “do no harm.” There is currently no unified formal theory for developing interactive eHealth apps, and development is especially difficult when complex messaging is required, such as in health promotion and prevention. Objective This paper aims to provide insight into the creation of interactive eHealth apps for complex messaging, by leveraging the Safe-D case study, which involved complex messaging required to guide safe but sufficient UV exposure for vitamin D synthesis in users. We aim to create recommendations for developing interactive eHealth apps for complex messages based on the lessons learned during Safe-D app development. Methods For this case study we developed an Apple and Android app, both named Safe-D, to safely improve vitamin D status in young women through encouraging safe ultraviolet radiation exposure. The app was developed through participatory action research involving medical and human computer interaction researchers, subject matter expert clinicians, external developers, and target users. The recommendations for development were created from analysis of the development process. Results By working with clinicians and implementing disparate design examples from the literature, we developed the Safe-D app. From this development process, recommendations for developing interactive eHealth apps for complex messaging were created: (1) involve a multidisciplinary team in the development process, (2) manage complex messages to engage users, and (3) design for interactivity (tailor recommendations, remove barriers to use, design for simplicity). Conclusions This research has provided principles for developing interactive eHealth apps for complex messaging as guidelines by aggregating existing design concepts and expanding these concepts and new learnings from our development process. A set of guidelines to develop interactive eHealth apps generally, and specifically those for complex messaging, was previously missing from the literature; this research has contributed these principles. Safe-D delivers complex messaging simply, to aid education, and explicitly, considering user safety. PMID:26860623

  6. Action languages: Dimensions, effects

    NASA Technical Reports Server (NTRS)

    Hayes, Daniel G.; Streeter, Gordon

    1989-01-01

    Dimensions of action languages are discussed for communication between humans and machines, and the message handling capabilities of object oriented programming systems are examined. Design of action languages is seen to be very contextual. Economical and effective design will depend on features of situations, the tasks intended to be accomplished, and the nature of the devices themselves. Current object oriented systems turn out to have fairly simple and straightforward message handling facilities, which in themselves do little to buffer action or even in some cases to handle competing messages. Even so, it is possible to program a certain amount of discretion about how they react to messages. Such thoughtfulness and perhaps relative autonomy of program modules seems prerequisite to future systems to handle complex interactions in changing situations.

  7. NASA-SETI microwave observing project: Targeted Search Element (TSE)

    NASA Technical Reports Server (NTRS)

    Webster, L. D.

    1991-01-01

    The Targeted Search Element (TSE) performs one of two complimentary search strategies of the NASA-SETI Microwave Observing Project (MOP): the targeted search. The principle objective of the targeted search strategy is to scan the microwave window between the frequencies of one and three gigahertz for narrowband microwave emissions eminating from the direction of 773 specifically targeted stars. The scanning process is accomplished at a minimum resolution of one or two Hertz at very high sensitivity. Detectable signals will be of a continuous wave or pulsed form and may also drift in frequency. The TSE will possess extensive radio frequency interference (RFI) mitigation and verification capability as the majority of signals detected by the TSE will be of local origin. Any signal passing through RFI classification and classifiable as an extraterrestrial intelligence (ETI) candidate will be further validated at non-MOP observatories using established protocol. The targeted search will be conducted using the capability provided by the TSE. The TSE provides six Targeted Search Systems (TSS) which independently or cooperatively perform automated collection, analysis, storage, and archive of signal data. Data is collected in 10 megahertz chunks and signal processing is performed at a rate of 160 megabits per second. Signal data is obtained utilizing the largest radio telescopes available for the Targeted Search such as those at Arecibo and Nancay or at the dedicated NASA-SETI facility. This latter facility will allow continuous collection of data. The TSE also provides for TSS utilization planning, logistics, remote operation, and for off-line data analysis and permanent archive of both the Targeted Search and Sky Survey data.

  8. A cloaking device for transiting planets

    NASA Astrophysics Data System (ADS)

    Kipping, David M.; Teachey, Alex

    2016-06-01

    The transit method is presently the most successful planet discovery and characterization tool at our disposal. Other advanced civilizations would surely be aware of this technique and appreciate that their home planet's existence and habitability is essentially broadcast to all stars lying along their ecliptic plane. We suggest that advanced civilizations could cloak their presence, or deliberately broadcast it, through controlled laser emission. Such emission could distort the apparent shape of their transit light curves with relatively little energy, due to the collimated beam and relatively infrequent nature of transits. We estimate that humanity could cloak the Earth from Kepler-like broad-band surveys using an optical monochromatic laser array emitting a peak power of ˜30 MW for ˜10 hours per year. A chromatic cloak, effective at all wavelengths, is more challenging requiring a large array of tunable lasers with a total power of ˜250 MW. Alternatively, a civilization could cloak only the atmospheric signatures associated with biological activity on their world, such as oxygen, which is achievable with a peak laser power of just ˜160 kW per transit. Finally, we suggest that the time of transit for optical Search for Extraterrestrial Intelligence (SETI) is analogous to the water-hole in radio SETI, providing a clear window in which observers may expect to communicate. Accordingly, we propose that a civilization may deliberately broadcast their technological capabilities by distorting their transit to an artificial shape, which serves as both a SETI beacon and a medium for data transmission. Such signatures could be readily searched in the archival data of transit surveys.

  9. Reducing high calorie snack food in young adults: a role for social norms and health based messages

    PubMed Central

    2013-01-01

    Background Consumption of high calorie junk foods has increased recently, especially among young adults and higher intake may cause weight gain. There is a need to develop public health approaches to motivate people to reduce their intake of junk food. Objective To assess the effect of health and social norm messages on high calorie snack food intake (a type of junk food) as a function of usual intake of junk food. Design In a between-subjects design, 129 young adults (45 men and 84 women, mean age = 22.4 years, SD = 4.5) were assigned to one of three conditions: 1) a social norm condition, in which participants saw a message about the junk food eating habits of others; 2) a health condition, in which participants saw a message outlining the health benefits of reducing junk food consumption and; 3) a control condition, in which participants saw a non-food related message. After exposure to the poster messages, participants consumed a snack and the choice and amount of snack food consumed was examined covertly. We also examined whether usual intake of junk food moderated the effect of message type on high calorie snack food intake. Results The amount of high calorie snack food consumed was significantly lower in both the health and the social norm message condition compared with the control message condition (36% and 28%, both p < 0.05). There was no significant difference in snack food or energy intake between the health and social norm message conditions. There was no evidence that the effect of the messages depended upon usual consumption of junk food. Conclusions Messages about the health effects of junk food and social normative messages about intake of junk food can motivate people to reduce their consumption of high calorie snack food. PMID:23738741

  10. An Invitation to Physical Education. Fastback 452.

    ERIC Educational Resources Information Center

    Chandler, Gary L.

    This booklet, which is based on the philosophy of invitational education, focuses on physical education. It is designed to encourage educators to become aware of the messages they send to students; messages that are general and subtle as well as messages that are direct, specific, and personal. This awareness leads to becoming consistently,…

  11. Persuasiveness of Anti-Smoking Messages: Self-Construal and Message Focus

    ERIC Educational Resources Information Center

    Yang, Bo; Nan, Xiaoli; Zhao, Xinyan

    2017-01-01

    Purpose: The purpose of this paper is to examine the role of independent vs interdependent self-construal in non-smokers' responses to an anti-smoking message that focuses on either personal or relational consequences of smoking. Design/methodology/approach: Two web-based experimental studies were conducted among US college non-smokers. In the…

  12. Refusals and Rejections: Designing Messages to Serve Multiple Goals.

    ERIC Educational Resources Information Center

    Saeki, Mimako; O'Keefe, Barbara J.

    1994-01-01

    Tests a rational model of the elaboration of themes found in rejection messages, using Japanese and American participants. Finds partial support for the initial rational model but notes two key revisions: identifies two new themes in rejection messages and suggests substantial differences in the way Americans and Japanese elaborate themes to serve…

  13. Associations Between Message Features and Subjective Evaluations of the Sensation Value of Antidrug Public Service Announcements.

    ERIC Educational Resources Information Center

    Morgan, Susan E.; Palmgreen, Philip; Stephenson, Michael T.; Hoyle, Rick H.; Lorch, Elizabeth P.

    2003-01-01

    Identifies message design features that show the greatest promise for developing message high in sensation value for anti-drug campaigns and other interventions aimed at sensation-seeking risky behaviors. Investigates certain features of drug prevention Public Service Announcements (PSAs) associated with viewers' subjective responses to them.…

  14. Tailoring Messages to Individual Differences in Monitoring-Blunting Styles to Increase Fruit and Vegetable Intake

    ERIC Educational Resources Information Center

    Williams-Piehota, Pamela; Latimer, Amy E.; Katulak, Nicole A.; Cox, Ashley; Silvera, Stephanie A. N.; Mowad, Linda; Salovey, Peter

    2009-01-01

    Objective: To examine whether messages matched to individuals' monitoring-blunting coping styles (MBCS) are more effective in increasing fruit and vegetable intake than mismatched messages. MBCS refers to the tendency to either attend to and amplify, or distract oneself from and minimize threatening information. Design/Setting: Randomly assigned…

  15. Engaging novice teachers in semiotic inquiry: considering the environmental messages of school learning settings

    NASA Astrophysics Data System (ADS)

    Shapiro, Bonnie

    2014-12-01

    Katherine Fogelberg's insightful study of the messages of zoo signs describes the complex, sometimes contradictory nature of the messages they communicate. The construction and content of signs are influenced by institutional power. Fogelberg argues that the creation of zoo signage designed to inform the public can, through its messages, silence a perspective of care and compassion for animals. The research presented in the following article extends discussion about the value of critical considerations of cultural and institutional messages created and read in another type of setting designed to educate and inform, the school learning setting. The article reports on a project that engaged novice teachers in explorations of the nature and types of environmental messages found in learning settings. During our inquiry work together, novice teachers suggested areas of particular concern to them, and began to construct ideas about aspects of their work in which they plan to take action or engage in future inquiry. The research also reveals some of the challenges involved when novice educators first begin the process of engaging in semiotic interpretive readings of learning settings.

  16. Improving Health Worker Adherence to Malaria Treatment Guidelines in Papua New Guinea: Feasibility and Acceptability of a Text Message Reminder Service

    PubMed Central

    Kurumop, Serah F.; Bullen, Chris; Whittaker, Robyn; Betuela, Inoni; Hetzel, Manuel W.; Pulford, Justin

    2013-01-01

    The aim of this study is to assess whether a text message reminder service designed to support health worker adherence to a revised malaria treatment protocol is feasible and acceptable in Papua New Guinea (PNG). The study took place in six purposively selected health facilities located in the Eastern Highlands Province (EHP) of PNG. Ten text messages designed to remind participants of key elements of the new NMTP were transmitted to 42 health workers twice over a two week period (two text messages per day, Monday to Friday) via the country’s largest mobile network provider. The feasibility and acceptability of the text message reminder service was assessed by transmission reports, participant diaries and group discussions. Findings indicate that the vast majority of text messages were successfully transmitted, participants’ had regular mobile phone access and that most text messages were read most of the time and were considered both acceptable and clinically useful. Nevertheless, the study found that PNG health workers may tire of the service if the same messages are repeated too many times and that health workers may be reluctant to utilize more comprehensive, yet complementary, resources. In conclusion, a text message reminder service to support health worker adherence to the new malaria treatment protocol is feasible and acceptable in PNG. A rigorous pragmatic, effectiveness trial would be justified on the basis of these findings. PMID:24116122

  17. A 640-MHz 32-megachannel real-time polyphase-FFT spectrum analyzer

    NASA Technical Reports Server (NTRS)

    Zimmerman, G. A.; Garyantes, M. F.; Grimm, M. J.; Charny, B.

    1991-01-01

    A polyphase fast Fourier transform (FFT) spectrum analyzer being designed for NASA's Search for Extraterrestrial Intelligence (SETI) Sky Survey at the Jet Propulsion Laboratory is described. By replacing the time domain multiplicative window preprocessing with polyphase filter processing, much of the processing loss of windowed FFTs can be eliminated. Polyphase coefficient memory costs are minimized by effective use of run length compression. Finite word length effects are analyzed, producing a balanced system with 8 bit inputs, 16 bit fixed point polyphase arithmetic, and 24 bit fixed point FFT arithmetic. Fixed point renormalization midway through the computation is seen to be naturally accommodated by the matrix FFT algorithm proposed. Simulation results validate the finite word length arithmetic analysis and the renormalization technique.

  18. Design Considerations in Developing a Text Messaging Program Aimed at Smoking Cessation

    PubMed Central

    Holtrop, Jodi Summers; Bağci Bosi, A Tülay; Emri, Salih

    2012-01-01

    Background Cell phone text messaging is gaining increasing recognition as an important tool that can be harnessed for prevention and intervention programs across a wide variety of health research applications. Despite the growing body of literature reporting positive outcomes, very little is available about the design decisions that scaffold the development of text messaging-based health interventions. What seems to be missing is documentation of the thought process of investigators in the initial stages of protocol and content development. This omission is of particular concern because many researchers seem to view text messaging as the intervention itself instead of simply a delivery mechanism. Certainly, aspects of this technology may increase participant engagement. Like other interventions, however, the content is a central driver of the behavior change. Objective To address this noted gap in the literature, we discuss the protocol decisions and content development for SMS Turkey (or Cebiniz birakin diyor in Turkish), a smoking cessation text messaging program for adult smokers in Turkey. Methods Content was developed in English and translated into Turkish. Efforts were made to ensure that the protocol and content were grounded in evidence-based smoking cessation theory, while also reflective of the cultural aspects of smoking and quitting in Turkey. Results Methodological considerations included whether to provide cell phones and whether to reimburse participants for texting costs; whether to include supplementary intervention resources (eg, personal contact); and whether to utilize unidirectional versus bidirectional messaging. Program design considerations included how messages were tailored to the quitting curve and one’s smoking status after one’s quit date, the number of messages participants received per day, and over what period of time the intervention lasted. Conclusion The content and methods of effective smoking cessation quitline programs were a useful guide in developing SMS Turkey. Proposed guidelines in developing text messaging-based behavior change programs are offered. PMID:22832182

  19. Beyond Basic Feedback in Mobile Brief Interventions: Designing SMS Message Content for Delivery to Young Adults During Risky Drinking Events

    PubMed Central

    Dietze, Paul M; Lim, Megan S C

    2017-01-01

    Background Brief interventions can reduce alcohol consumption in young people through screening and delivery of personally relevant feedback. Recently, Web and mobile platforms have been harnessed to increase the reach of brief interventions. Existing literature on mobile-based alcohol brief interventions indicates mixed use of theory in developing interventions. There is no research available to guide the development of SMS text messaging (short message service, SMS) interventions delivered during risky drinking events. Objective The aim of this study was to develop and pilot an alcohol-related risk-reduction brief intervention delivered by SMS to Australian young adults during drinking events. This paper describes the development of intervention message content, with specific focus on the context of delivery during drinking events. Methods A sample of 42 young adults attended 4 workshops; these comprised focus-group style discussion on drinking habits and motivations, discussion of intervention design, analysis of existing alcohol media campaigns, and participant development of message content. Data were analyzed thematically. Results Participants described a focus on having fun and blocking out any incongruent negative influences during drinking episodes. For content to be acceptable, nonjudgmental and non-authoritative language was deemed essential. A preference for short, actionable messages was observed, including suggestions for reminders around drinking water, organizing transport home, checking on friends, and plans the next day. Participants were excited about the potential for messages to be tailored to individuals, as previous alcohol-related campaigns were deemed too generic and often irrelevant. Normative-based messages were also perceived as largely irrelevant as participants felt that they understood the drinking-related norms of their immediate peers already. Conclusions Findings from this study offer insights into young adults’ drinking events and practical advice for designing alcohol-related brief interventions. During our formative development process, we demonstrated a neat correspondence between young people’s preferences for alcohol harm reduction interventions and the theoretical principles of brief interventions, including acceptable topics and message style. PMID:28634153

  20. Optimising text messaging to improve adherence to web-based smoking cessation treatment: a randomised control trial protocol

    PubMed Central

    Graham, Amanda L; Jacobs, Megan A; Cohn, Amy M; Cha, Sarah; Abroms, Lorien C; Papandonatos, George D; Whittaker, Robyn

    2016-01-01

    Introduction Millions of smokers use the Internet for smoking cessation assistance each year; however, most smokers engage minimally with even the best designed websites. The ubiquity of mobile devices and their effectiveness in promoting adherence in other areas of health behaviour change make them a promising tool to address adherence in Internet smoking cessation interventions. Text messaging is used by most adults, and messages can proactively encourage use of a web-based intervention. Text messaging can also be integrated with an Internet intervention to facilitate the use of core Internet intervention components. Methods and analysis We identified four aspects of a text message intervention that may enhance its effectiveness in promoting adherence to a web-based smoking cessation programme: personalisation, integration, dynamic tailoring and message intensity. Phase I will use a two-level full factorial design to test the impact of these four experimental features on adherence to a web-based intervention. The primary outcome is a composite metric of adherence that incorporates general utilisation metrics (eg, logins, page views) and specific feature utilisation shown to predict abstinence. Participants will be N=860 adult smokers who register on an established Internet cessation programme and enrol in its text message programme. Phase II will be a two-arm randomised trial to compare the efficacy of the web-based cessation programme alone and in conjunction with the optimised text messaging intervention on 30-day point prevalence abstinence at 9 months. Phase II participants will be N=600 adult smokers who register to use an established Internet cessation programme and enrol in text messaging. Secondary analyses will explore whether adherence mediates the effect of treatment condition on outcome. Ethics and dissemination This protocol was approved by Chesapeake IRB. We will disseminate study results through peer-reviewed manuscripts and conference presentations related to the methods and design, outcomes and exploratory analyses. Trial registration number NCT02585206. PMID:27029775

  1. 75 FR 63838 - Agency Information Collection Activities; Submission for Office of Management and Budget Review...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-10-18

    ... to design effective communication strategies, messages, and labels. These communications will aim to..., as evaluative research, it will allow FDA to ascertain the effectiveness of the messages and the... from 0.08- 1.5 hours). The operating and maintenance costs include contractor expenses for designing...

  2. 77 FR 49819 - Agency Information Collection Activities; Proposed Collection; Comment Request; Pretesting of...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-08-17

    .... Knowledge of these decisionmaking processes will be applied by FDA to help design effective communication... effectively design messages and select formats that have the greatest potential to influence the target... each new pretest will vary, depending on the nature of the material or message being tested and the...

  3. Developing and Testing Rational Models of Message Design.

    ERIC Educational Resources Information Center

    O'Keefe, Barbara J.

    1992-01-01

    Responds to an article in the same issue regarding research methods for conversational cognition. Argues for a noncognitive view of rational models in communication research. Sets out an analysis of the kinds of claims made by rational models of message design. Discusses the implications of this analysis for studies of the cognitive processes…

  4. Re: Design Changing the Message

    ERIC Educational Resources Information Center

    Wall, Miranda Wakeman

    2008-01-01

    The advertisements that flood everyone's visual culture are designed to create desire. From the author's experience, most high school students are not aware of the messages that they are bombarded with every day, and if they are, few care or think about them critically. The author's goals for this lesson were to increase students' awareness of the…

  5. 47 CFR 11.18 - EAS Designations.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... Designations. (a) National Primary (NP) is a source of EAS Presidential messages. (b) Local Primary (LP) is a... as specified in its EAS Local Area Plan. If it is unable to carry out this function, other LP sources... broadcast stations in the Local Area. (c) State Primary (SP) is a source of EAS State messages. These...

  6. 47 CFR 11.18 - EAS Designations.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... Designations. (a) National Primary (NP) is a source of EAS Presidential messages. (b) Local Primary (LP) is a... as specified in its EAS Local Area Plan. If it is unable to carry out this function, other LP sources... broadcast stations in the Local Area. (c) State Primary (SP) is a source of EAS State messages. These...

  7. Development of a replicable process for translating science into practical health education messages.

    PubMed

    Tyus, Nadra C; Freeman, Randall J; Gibbons, M Christopher

    2006-09-01

    There has been considerable discussion about translating science into practical messages, especially among urban minority and "hard-to-reach" populations. Unfortunately, many research findings rarely make it back in useful format to the general public. Few innovative techniques have been established that provide researchers with a systematic process for developing health awareness and prevention messages for priority populations. The purpose of this paper is to describe the early development and experience of a unique community-based participatory process used to develop health promotion messages for a predominantly low-income, black and African-American community in Baltimore, MD. Scientific research findings from peer-reviewed literature were identified by academic researchers. Researchers then taught the science to graphic design students and faculty. The graphic design students and faculty then worked with both community residents and researchers to transform this information into evidence-based public health education messages. The final products were culturally and educationally appropriate, health promotion messages reflecting urban imagery that were eagerly desired by the community. This early outcome is in contrast to many previously developed messages and materials created through processes with limited community involvement and by individuals with limited practical knowledge of local community culture or expertise in marketing or mass communication. This process may potentially be utilized as a community-based participatory approach to enhance the translation of scientific research into desirable and appropriate health education messages.

  8. Approach/avoidance motivation, message framing and skin cancer prevention: a test of the congruency hypothesis.

    PubMed

    Hevey, David; Dolan, Michelle

    2014-08-01

    The congruency hypothesis posits that approach-orientated individuals are persuaded to engage in prevention behaviours by positively framed messages; conversely, negatively framed messages are more persuasive in encouraging those who are avoidance-orientated. A 2 (frame: loss vs gain) × 2 (motivation: avoidance vs approach) design examined the effects of skin cancer information on sun-protective intentions and free sunscreen sample requests among 533 young adults. Gain-framed messages had the strongest effect on sun-protective intentions for approach-oriented individuals, whereas loss-framed messages had the strongest effect on avoidance-oriented individuals. Message framing effects on precautionary sun behaviour intentions were moderated by motivational differences. © The Author(s) 2013.

  9. Designing prenatal care messages for low-income Mexican women.

    PubMed Central

    Alcalay, R; Ghee, A; Scrimshaw, S

    1993-01-01

    Communication theories and research data were used to design cross-cultural health education messages. A University of California Los Angeles-Universidad Autonoma in Tijuana, Mexico, research team used the methods of ethnographic and survey research to study behaviors, attitudes, and knowledge concerning prenatal care of a sample of pregnant low-income women living in Tijuana. This audience provided information that served as a framework for a series of messages to increase awareness and change prenatal care behaviors. The message design process was guided by persuasion theories that included Petty and Caccioppo's elaboration likelihood model, McGuire's persuasion matrix, and Bandura's social learning theory. The results from the research showed that poor women in Tijuana tend to delay or not seek prenatal care. They were not aware of symptoms that could warn of pregnancy complications. Their responses also revealed pregnant women's culturally specific beliefs and behaviors regarding pregnancy. After examination of these and other results from the study, prenatal care messages about four topics were identified as the most relevant to communicate to this audience: health services use, the mother's weight gain, nutrition and anemia, and symptoms of high-risk complications during pregnancy. A poster, a calendar, a brochure, and two radio songs were produced and pretested in focus groups with low-income women in Tijuana. Each medium included one or more messages addressing informational, attitudinal, or behavioral needs, or all three, of the target population. PMID:8497574

  10. Fear, threat, and perceptions of efficacy from frightening skin cancer messages.

    PubMed

    Stephenson, M T; Witte, K

    1998-01-01

    Fear appeal messages were designed and tested to ascertain their effectiveness in promoting skin protective behaviors. Theoretically guided by the Extended Parallel Process Model, the fear appeal messages in this study conveyed the seriousness of exposed and unprotected skin for college students in the Southwestern United States, and recommended a series of behaviors that would protect individuals from serious sunburns. The results demonstrated that fear appeals are effective in promoting skin protective behaviors. Specifically, highly threatening fear appeal messages were most effective when combined with a strong efficacy message emphasizing the effectiveness of the recommended behaviors.

  11. Why are you bringing up condoms now? The effect of message content on framing effects of condom use messages.

    PubMed

    Kiene, Susan M; Barta, William D; Zelenski, John M; Cothran, Dee Lisa

    2005-05-01

    According to prospect theory (A. Tversky & D. Kahneman, 1981), messages advocating a low-risk (i.e., easy, low-cost) behavior are most effective if they stress the benefits of adherence (gain framed), whereas messages advocating a risky behavior are most effective if they stress the costs of nonadherence (loss framed). Although condom use is viewed as a low-risk behavior, it may entail risky interpersonal negotiations. Study 1 (N = 167) compared ratings of condom use messages advocating relational behaviors (e.g., discussing condoms) or health behaviors (e.g., carrying condoms). As predicted, loss-framed relational messages and gain-framed health messages received higher evaluations. Study 2 (N = 225) offers a replication and evidence of issue involvement and gender as moderators. Results are discussed with reference to the design of condom use messages. ((c) 2005 APA, all rights reserved).

  12. Efficient Data Generation and Publication as a Test Tool

    NASA Technical Reports Server (NTRS)

    Einstein, Craig Jakob

    2017-01-01

    A tool to facilitate the generation and publication of test data was created to test the individual components of a command and control system designed to launch spacecraft. Specifically, this tool was built to ensure messages are properly passed between system components. The tool can also be used to test whether the appropriate groups have access (read/write privileges) to the correct messages. The messages passed between system components take the form of unique identifiers with associated values. These identifiers are alphanumeric strings that identify the type of message and the additional parameters that are contained within the message. The values that are passed with the message depend on the identifier. The data generation tool allows for the efficient creation and publication of these messages. A configuration file can be used to set the parameters of the tool and also specify which messages to pass.

  13. An assessment of the impact of radiofrequency interference on microwave SETI searches

    NASA Technical Reports Server (NTRS)

    Klein, M. J.; Gulkis, S.; Olsen, E. T.; Armstrong, E. F.; Jackson, E. B.

    1992-01-01

    Investigations are carried out at JPL on radiofrequency interferences at very low levels (-130 to -180 dBm) in various bands, especially the 1-2 GHz band. Extrapolation of interferences in the years to come is attempted.

  14. An assessment of the impact of radiofrequency interference on microwave SETI searches.

    PubMed

    Klein, M J; Gulkis, S; Olsen, E T; Armstrong, E F; Jackson, E B

    1992-01-01

    Investigations are carried out at JPL on radiofrequency interferences at very low levels (-130 to -180 dBm) in various bands, especially the 1-2 GHz band. Extrapolation of interferences in the years to come is attempted.

  15. Inventing Life-Forms: The Creation of an Extraterrestrial Species.

    ERIC Educational Resources Information Center

    Science Activities, 1996

    1996-01-01

    Presents activities in which students play the role of cadets performing missions for the fictitious SETI (Search for Extraterrestrial Intelligence) Academy. Guides students toward an understanding of evolutionary forces and how they are affected by the physical environment. (JRH)

  16. Spelling for Writing: Student Activity Book. Level 5.

    ERIC Educational Resources Information Center

    Peet, Howard

    The Level 5 activity book is designed to help children learn that writing messages and stories will help them see the value of learning to spell. The workbook's program is based on the ideas that accurate spelling contributes to the clarity of written messages; spelling accuracy shows attention to detail, sending a positive message to teachers and…

  17. Use of Text Messaging for Monitoring Sugar-Sweetened Beverages, Physical Activity, and Screen Time in Children: A Pilot Study

    ERIC Educational Resources Information Center

    Shapiro, Jennifer R.; Bauer, Stephanie; Hamer, Robert M.; Kordy, Hans; Ward, Dianne; Bulik, Cynthia M.

    2008-01-01

    Objective: To examine acceptability, attrition, adherence, and preliminary efficacy of mobile phone short message service (SMS; text messaging) for monitoring healthful behaviors in children. Design: All randomized children received a brief psychoeducational intervention. They then either monitored target behaviors via SMS with feedback or via…

  18. The Stages of Change Model: An Effective Audience Analysis Tool Used To Design and Implement Health Promoting Messages.

    ERIC Educational Resources Information Center

    Smith, Ronda L.

    Researchers have been slow to acknowledge the salient role communication can play in motivating people to adopt more healthy lifestyles. Because persuasive messages increase awareness and can increase health promoting behaviors, it is important to determine the most effective health promoting messages in various health contexts. Thus, the primary…

  19. Improving Refill Adherence in Medicare Patients With Tailored and Interactive Mobile Text Messaging: Pilot Study

    PubMed Central

    Jeong, Erwin W; Feger, Erin; Noble, Harmony K; Kmiec, Magdalen; Prayaga, Ram S

    2018-01-01

    Background Nonadherence is a major concern in the management of chronic conditions such as hypertension, cardiovascular disease, and diabetes where patients may discontinue or interrupt their medication for a variety of reasons. Text message reminders have been used to improve adherence. However, few programs or studies have explored the benefits of text messaging with older populations and at scale. In this paper, we present a program design using tailored and interactive text messaging to improve refill rates of partially adherent or nonadherent Medicare members of a large integrated health plan. Objective The aim of this 3-month program was to gain an understanding of whether tailored interactive text message dialogues could be used to improve medication refills in Medicare patients with one or more chronic diseases. Methods We used the mPulse Mobile interactive text messaging solution with partially adherent and nonadherent Medicare patients (ie, over age 65 years or younger with disabilities) of Kaiser Permanente Southern California (KP), a large integrated health plan, and compared refill rates of the text messaging group (n=12,272) to a group of partially adherent or nonadherent Medicare patients at KP who did not receive text messages (nontext messaging group, n=76,068). Both groups were exposed to other forms of refill and adherence outreach including phone calls, secure emails, and robo-calls from December 2016 to February 2017. Results The text messaging group and nontext messaging group were compared using an independent samples t test to test difference in group average of refill rates. There was a significant difference in medication refill rates between the 2 groups, with a 14.07 percentage points higher refill rate in the text messaging group (P<.001). Conclusions The results showed a strong benefit of using this text messaging solution to improve medication refill rates among Medicare patients. These findings also support using interactive text messaging as a cost-effective, convenient, and user-friendly solution for patient engagement. Program outcomes and insights can be used to enhance the design of future text-based solutions to improve health outcomes and promote adherence and long-term behavior change. PMID:29382623

  20. Design and Implementation of a C++ Software Package to scan for and parse Tsunami Messages issued by the Tsunami Warning Centers for Operational use at the Pacific Tsunami Warning Center

    NASA Astrophysics Data System (ADS)

    Sardina, V.

    2012-12-01

    The US Tsunami Warning Centers (TWCs) have traditionally generated their tsunami message products primarily as blocks of text then tagged with headers that identify them on each particular communications' (comms) circuit. Each warning center has a primary area of responsibility (AOR) within which it has an authoritative role regarding parameters such as earthquake location and magnitude. This means that when a major tsunamigenic event occurs the other warning centers need to quickly access the earthquake parameters issued by the authoritative warning center before issuing their message products intended for customers in their own AOR. Thus, within the operational context of the TWCs the scientists on duty have an operational need to access the information contained in the message products issued by other warning centers as quickly as possible. As a solution to this operational problem we designed and implemented a C++ software package that allows scanning for and parsing the entire suite of tsunami message products issued by the Pacific Tsunami Warning Center (PTWC), the West Coast and Alaska Tsunami Warning Center (WCATWC), and the Japan Meteorological Agency (JMA). The scanning and parsing classes composing the resulting C++ software package allow parsing both non-official message products(observatory messages) routinely issued by the TWCs, and all official tsunami message products such as tsunami advisories, watches, and warnings. This software package currently allows scientists on duty at the PTWC to automatically retrieve the parameters contained in tsunami messages issued by WCATWC, JMA, or PTWC itself. Extension of the capabilities of the classes composing the software package would make it possible to generate XML and CAP compliant versions of the TWCs' message products until new messaging software natively adds this capabilities. Customers who receive the TWCs' tsunami message products could also use the package to automatically retrieve information from messages sent via any text-based communications' circuit currently used by the TWCs to disseminate their tsunami message products.

  1. Motivational Text Message Intervention for Eating Disorders: A Single-Case Alternating Treatment Design Using Ecological Momentary Assessment.

    PubMed

    Shingleton, Rebecca M; Pratt, Elizabeth M; Gorman, Bernard; Barlow, David H; Palfai, Tibor P; Thompson-Brenner, Heather

    2016-05-01

    This study tested a motivational text message treatment adjunct for individuals with eating disorders (EDs) who exhibited high dietary restraint/restriction. A replicated single-case alternating treatment design was used to examine (a) the feasibility of combining a brief motivational interview with subsequent text messages and (b) the influence of the text messages on eating behaviors and motivation to change in individuals with EDs (N=12). The protocol was 8weeks and the text messages were adjunctive to cognitive-behavioral therapy. The intervention was well accepted (mean rating=7/10) and feasible within the context of monetary compensation (mean daily monitoring compliance =91%). Text messages did not impact behavioral outcomes: dietary restraint and kilocalorie intake. They had mixed effects on motivation to change dietary restraint, measured by the Readiness and Motivation Questionnaire (RMQ). When receiving text messages, RMQ precontemplation scores (desire to restrict) significantly increased, indicating decreased motivation; however, action scores (effort toward reducing dietary restraint) significantly increased, indicating increased motivation. These effects were moderated by weight status. Underweight individuals (n=4; body mass index [BMI]<19.0) reported increased ambivalence-that is, an increased desire to restrict and increased action toward reducing restriction-in response to the text messages. Normal weight participants (n=8; BMI>19.0) reported only increased action toward reducing restriction in response to the text messages. These data demonstrate text messages are a potentially feasible and acceptable treatment adjunct and may be effective at increasing motivation to change for normal weight individuals, while their influence on underweight patients is more complex. These findings provide a foundation for future research in technology-based motivational interventions for EDs and offer preliminary evidence for using these methods among normal weight individuals. Copyright © 2016. Published by Elsevier Ltd.

  2. Can persuasive messages encourage individuals to create action plans for physical activity?

    PubMed

    Sweet, Shane N; Brawley, Lawrence R; Hatchell, Alexandra; Gainforth, Heather L; Latimer-Cheung, Amy E

    2014-08-01

    Given the positive influence of action planning on physical activity, persuasive messages could be designed to promote action planning. The purpose of this paper was to test action planning messages in two studies. Participants were allocated to one of two message groups, reading either a physical activity only or physical activity plus action planning message (Study 1) and either a gain-framed or loss-framed action planning message (Study 2). The percent of individuals who created an action plan and the quality of the plans were evaluated. In Study 1, individuals in the physical activity plus action planning group created as many action plans as the physical activity only group, but their plans were higher quality. In Study 2, Week 2 differences between the gain- and loss-framed message groups were found for action planning. To our knowledge, these studies were the first to investigate message-induced action planning as a behavior. More research is needed to optimize these messages.

  3. Exploring the interaction of patient activation and message design variables: message frame and presentation mode influence on the walking behavior of patients with type 2 diabetes.

    PubMed

    Ledford, Christy J W

    2012-10-01

    Examining interpersonal (physician-patient) communication strategies for promoting walking exercise to patients with type 2 diabetes assigned to primary care clinics, the study evaluated two message design variables--frame and presentation mode--as influencers of communication and adoption success. The single-site, four-week, prospective intervention study followed a 2×3 factorial, non-equivalent comparison group quasi-experimental design. Results showed frame was significantly related to steps walked; however, when including patient activation as an interaction, frame was non-significant. The model including patient activation interactions, however, detected significant mode effects on behavior. Results provide evidence that statistics are most effectively used with activated patients.

  4. A qualitative study to explore Prospect theory and message framing and diet and cancer prevention-related issues among African American adolescents

    PubMed Central

    Satia, Jessie A.; Barlow, Jameta; Armstrong-Brown, Janelle; Watters, Joanne L.

    2010-01-01

    Aims To develop and test cancer prevention messages based on Prospect theory on motivation to improve dietary intake in African American adolescents, and to explore other salient factors that may inform dietary intervention design and implementation in this population. Methods Semi-structured in-person qualitative interviews were conducted with 13 African-American male and female adolescents, 12-16 years, in North Carolina. Prospect theory and message framing were used to guide the design of the four sets of diet-related messages related to cancer prevention: short-term gain-, long-term gain-, short-term loss-, and long-term loss-framed messages. Data were also collected on demographic, behavioral, and psychological factors; usual health behaviors; and preferences for intervention delivery. Results The majority of respondents found the gain-framed, short-term messages most salient for both fruits/vegetables (8 (61.5%)), and fat consumption (7 (53.8%)). For fat consumption only, 2 (15.4%) found the loss-framed, short-term messages pertinent; none found the loss-framed, long-term messages relevant for either dietary variable. All indicated interest in participating in a dietary intervention/education program; most preferred the Internet as a channel for intervention delivery. Participants expressed diverse views regarding knowledge, attitudes, and beliefs regarding healthy eating. Conclusions Researchers conducting dietary interventions and education initiatives and medical professionals who counsel African American adolescents should consider using Prospect Theory as a theoretical framework, should focus on gain-framed short-term messages regarding cancer prevention, and should employ the Internet for data collection and intervention and information delivery. PMID:20142738

  5. Receptivity of African American Adolescents to an HIV-Prevention Curriculum Enhanced by Text Messaging

    PubMed Central

    Cornelius, Judith B.; St Lawrence, Janet S.

    2013-01-01

    PURPOSE This study assessed African American adolescents’ receptivity to an HIV-prevention curriculum enhanced by text messaging. DESIGN AND METHODS Two focus groups were conducted with 14 African American adolescents regarding how an HIV-prevention curriculum could be enhanced for text messaging delivery. RESULTS The adolescents were receptive to the idea of text messaging HIV-prevention information but wanted to receive a maximum of three messages per day during the hours of 4:00–6:00 p.m. PRACTICE IMPLICATIONS By taking the findings of this study, nurses, other healthcare providers, and community-based organizations can adapt evidence-based interventions for text messaging delivery to individuals at high risk for HIV infection. PMID:19356206

  6. The 2012 Seti River flood disaster and alpine cryospheric hazards facing Pokhara, Nepal

    NASA Astrophysics Data System (ADS)

    Kargel, Jeffrey; Leonard, Gregory; Paudel, Lalu; Regmi, Dhananjay; Bajracharya, Samjwal; Fort, Monique; Joshi, Sharad; Poudel, Khagendra; Thapa, Bhabana; Watanabe, Teiji

    2014-05-01

    We have identified the likeliest cause of the Seti River disaster of May 5, 2012, in which a flash flood killed or left missing 72 people. A cascade of deadly physical Earth processes combined with imprudent habitation on the lowest flood terraces and floodplain. The process cascade started with rockfalls into the Seti River gorge (observed via repeat ASTER imaging). The last rockfall-one to several weeks prior to the disaster-affected a knickpoint in the Seti River gorge and impounded glacial meltwater and spring snowmelt. The trigger was a large rock/ice avalanche originating from cornice ice on Annapurna IV, where part of the mass was channeled into the impoundment reservoir. That violent ground-surge event, plus possibly an air blast caused by a violent gravity flow of airborne debris-then burst the rockfall dam. This was not a glacier lake outburst flood. Glaciers were involved in the disaster by supplying meltwater, which was impounded by the rockfall dam, by triggering the disaster with collapse of cornice ice, and by contributing ice to the landslide and outburst flood. Debuttressing of moraine debris and ancient glacial lake sediment by retreat and thinning of glaciers also may have played a role-this is the only possible indirect link of the disaster to climate change. The rockfall and avalanche mass movements occurred independently of climate change. The narrow and easily blocked Seti River gorge was a key factor in the 2012 disaster, and it remains a unique component of this physiographic setting. A similar flood in this area may happen by a different cascade of Earth surface processes. An enormous mass of ancient unconsolidated glaciolacustrine and moraine sediment-many cubic kilometers-was discovered and is vulnerable to production of debris flows and hyperconcentrated slurry flows. Some aggravating processes occurring in the Sabche Cirque are related to climate change. Glaciers in that area are melting, and small lakes are forming. Although the lakes were not implicated in the 2012 disaster, the possibility exists for a small glacial lake outburst flood to trigger a larger mass movement. Such a debris flow could reach Pokhara directly. More likely, a debris flow in the Sabche Cirque could form another temporary and potentially dangerous impoundment dam in the gorge. Furthermore, the type of rockfall blockage that produced 2012's natural impoundment reservoir is likely to happen repeatedly. Hence, there is a high capacity of the Earth system in this area to produce comparable or even bigger flash floods or mass flows. The likelihood of a further disaster is magnified by imprudent habitation of the river channel and lower floodplain. Of all the changes to the Pokhara Valley, human encroachment on the flood plain is the factor most related to increasing vulnerability, but it is also the one factor that could be remedied by a complete ban on construction on lower terraces, if that is politically feasible. Warning systems could help, but fairly relocating people in jeopardy would be more effective. Supported by NASA/USAID SERVIR Applied Sciences and USAID Climbers' Science.

  7. Insights into targeting young male drivers with anti-speeding advertising: An application of the Step approach to Message Design and Testing (SatMDT).

    PubMed

    Lewis, I; White, K M; Ho, B; Elliott, B; Watson, B

    2017-06-01

    In Australia, young drivers aged 17-25 years comprise 13% of the population yet account for 22% of all road deaths with young males over-represented in such trauma. Speeding represents a major contributing factor and advertising campaigns have long focused on promoting anti-speeding messages in the effort to reduce drivers' speeds. Positioned within a larger program of research aimed at developing, piloting, and evaluating a range of theoretically-informed anti-speeding messages, the current study reports results relating to the final phase of the research, the evaluation. Six messages were devised in accordance with the guiding framework, the Step approach to Message Design and Testing ([SatMDT]; Lewis et al., 2016) and based on the findings emerging from earlier qualitative and quantitative studies within the program of research. N=938 licensed drivers (n=455 males, 48%) aged 17-62 years completed an online survey. To ensure a controlled test of the persuasiveness of the message content, the messages were presented in an audio-based format and thus were devoid of potential confounds, such as images. The messages sought to address a particular belief (i.e., behavioural, normative, control) and to focus either on emphasising the positive aspects which make speeding less likely or challenging the negative aspects which make speeding more likely. Thus, key to this evaluation was to test the persuasiveness of the message content in terms of the particular belief and focus it was addressing. Participants were randomly assigned to either the Control condition (i.e., no exposure to a message) or the Intervention condition (i.e., exposed to one of the six messages presented as an audio-recorded message within the survey). Persuasiveness was assessed via a range of outcome measures including both direct (i.e., third-person perceptions, message rejection) as well as indirect measures (i.e., intentions, willingness to speed). Age, gender, and message type were independent variables (IVs), together with issue involvement as a covariate (or IV) in the study's analyses. Overall, positive persuasive effects, and a relative absence of any negative, dissuasive effects, were found for two messages, Glass Cars and The Lift. These messages addressed the same salient belief, control beliefs, with the former emphasising the factors which discourage speeding and the latter message challenging those factors which encourage speeding. The implications of the findings are discussed in terms of the insights they offer for the key content of future anti-speeding messages. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. The Use of Message Framing to Promote Sexual Risk Reduction in Young Adolescents: A Pilot Exploratory Study

    ERIC Educational Resources Information Center

    Camenga, Deepa R.; Hieftje, Kimberly D.; Fiellin, Lynn E.; Edelman, E. Jennifer; Rosenthal, Marjorie S.; Duncan, Lindsay R.

    2014-01-01

    Few studies have explored the application of message framing to promote health behaviors in adolescents. In this exploratory study, we examined young adolescents' selection of gain- versus loss-framed images and messages when designing an HIV-prevention intervention to promote delayed sexual initiation. Twenty-six adolescents (aged 10-14 years)…

  9. The Effects of Online Discussion Forum Aggressive Messages and Cognitive Distortion on Users' Negative Affect and Aggression

    ERIC Educational Resources Information Center

    Chiang, Yu-Tzu; Lin, Sunny S. J.; Liu, Eric Zhi-Feng

    2012-01-01

    This research is comprised of two studies designed to explore the effects of online discussion forum aggressive messages and Internet cognitive distortion on users' negative affect and aggression. The results of study 1 revealed 69 users could perceive both disgust and hostility feelings toward aggressive messages conducted by the authors, and…

  10. The Effects of Message Summaries on the Immediate Free Recall of Main Points.

    ERIC Educational Resources Information Center

    Shellen, Wesley N.

    This study was designed to test the effects of message summaries on the recall of main points of an informative message. Two different types of summary techniques, a mnemonic and a traditional type, were identified and compared with each other and with a third treatment involving no summaries. One hundred and eleven volunteer subjects were…

  11. A Contest to Create Media Messages Aimed at Recruiting Adolescents for Stop Smoking Programs.

    ERIC Educational Resources Information Center

    Croghan, Ivana T.; Campbell, Heather M.; Patten, Christi A.; Croghan, Gary A.; Schroeder, Darrell R.; Novotny, Paul J.

    2004-01-01

    This project engaged adolescents in a contest to create advertising messages aimed at recruiting teens for stop smoking programs. Middle school students were invited to design a media message for television, radio, Web, or print (newspaper or billboard). 0f 4,289 students in eight middle schools of Rochester, Minn., 265 (6.2%) developed 172 stop…

  12. Sampling the Radio Transient Universe: Studies of Pulsars and the Search for Extraterrestrial Intelligence

    NASA Astrophysics Data System (ADS)

    Chennamangalam, Jayanth

    The transient radio universe is a relatively unexplored area of astronomy, offering a variety of phenomena, from solar and Jovian bursts, to flare stars, pulsars, and bursts of Galactic and potentially even cosmological origin. Among these, perhaps the most widely studied radio transients, pulsars are fast-spinning neutron stars that emit radio beams from their magnetic poles. In spite of over 40 years of research on pulsars, we have more questions than answers on these exotic compact objects, chief among them the nature of their emission mechanism. Nevertheless, the wealth of phenomena exhibited by pulsars make them one of the most useful astrophysical tools. With their high densities, pulsars are probes of the nature of ultra-dense matter. Characterized by their high timing stability, pulsars can be used to verify the predictions of general relativity, discover planets around them, study bodies in the solar system, and even serve as an interplanetary (and possibly some day, interstellar) navigation aid. Pulsars are also used to study the nature of the interstellar medium, much like a flashlight illuminating airborne dust in a dark room. Studies of pulsars in the Galactic center can help answer questions about the massive black hole in the region and the star formation history in its vicinity. Millisecond pulsars in globular clusters are long-lived tracers of their progenitors, low-mass X-ray binaries, and can be used to study the dynamical history of those clusters. Another source of interest in radio transient astronomy is the hitherto undetected engineered signal from extraterrestrial intelligence. The Search for Extraterrestrial Intelligence (SETI) is an ongoing attempt at discovering the presence of technological life elsewhere in the Galaxy. In this work, I present my forays into two aspects of the study of the radio transient universe---pulsars and SETI. Firstly, I describe my work on the luminosity function and population size of pulsars in the globular clusters Terzan 5, 47 Tucanae, and M 28. Applying Bayesian statistics to our data set consisting of the number of detected pulsars, their flux densities, and the amount of diffuse radio emission from the direction of these clusters, we show that the number of potentially observable pulsars in Terzan 5 should be within a 95 per cent credible interval of 147+112-65 For 47 Tucanae and M 28, our results are 83+54-35 and 100+91-52 , spectively. We also constrain the luminosity function parameters for the pulsars in these clusters. The Galactic center pulsar population has been an interesting target for various studies, especially given that only one pulsar has been detected in the region, when we expect hundreds of pulsars to be present. In this work, we use the scattering measurements from recent observations of PSR J1745--2900, the Galactic center pulsar, and show that the size of the potentially observable pulsar population has a conservative upper limit of ~200. We show that the observational results so far are consistent with this number and make predictions for future radio pulsar surveys of the region. The Versatile GBT Astronomical Spectrometer (VEGAS) is a heterogeneous instrument used mainly for pulsar studies with the Green Bank Telescope. I describe our work on the GPU spectrometer that we developed as part of VEGAS. The GPU code supports a dual-polarization bandwidth of up to 600 MHz. In the field of SETI, I discuss two works. SERENDIP VI is a heterogeneous SETI spectrometer to be installed both at the Green Bank Telescope and at the Arecibo Observatory. In this work, we describe the design of the GPU spectrometer that forms part of SERENDIP VI. In the second work, we speculate on a novel search strategy for SETI, based on the idea that technological civilizations lacking the advancement required to build high-powered beacons may choose to build a modulator situated around a nearby pulsar, depending on whether it is energetically favorable. We discuss observational signatures to search for, using a model of artificially-nulled pulsars.

  13. A validity problem in measuring exposure to mass media campaigns.

    PubMed

    Brown, J D; Bauman, K E; Padgett, C A

    1990-01-01

    Recognition of radio and television messages included in three mass media campaigns designed to keep adolescents from starting to smoke cigarettes was measured in six treatment and four control cities (Standard Metropolitan Statistical Areas) in the southeastern United States. The telephone survey of 574 randomly selected adolescents found high recognition of campaign messages even in the areas where the campaigns had not been broadcast. Campaign messages that differed significantly from other anti-smoking messages were less likely to be falsely recognized. These results reinforce the need to include true control groups in mass media evaluations and to construct distinctive messages if exposure is an important aspect of campaign evaluation.

  14. Intel NX to PVM 3.2 message passing conversion library

    NASA Technical Reports Server (NTRS)

    Arthur, Trey; Nelson, Michael L.

    1993-01-01

    NASA Langley Research Center has developed a library that allows Intel NX message passing codes to be executed under the more popular and widely supported Parallel Virtual Machine (PVM) message passing library. PVM was developed at Oak Ridge National Labs and has become the defacto standard for message passing. This library will allow the many programs that were developed on the Intel iPSC/860 or Intel Paragon in a Single Program Multiple Data (SPMD) design to be ported to the numerous architectures that PVM (version 3.2) supports. Also, the library adds global operations capability to PVM. A familiarity with Intel NX and PVM message passing is assumed.

  15. Art messaging to engage homeless young adults.

    PubMed

    Nyamathi, Adeline; Slagle, Alexandra; Thomas, Alexandra; Hudson, Angela; Kahilifard, Farinaz; Avila, Glenna; Orser, Julie; Cuchilla, Manuel

    2011-01-01

    Art has been shown to be an empowering and engaging entity with numerous benefits to vulnerable populations, including the homeless persons and young adults. However, little is known how homeless young adults perceive the use of art as messages that can communicate the danger of initiating or continuing drug and alcohol use. The purpose of this study was to solicit perspectives of homeless, drug-using young adults as to how art can be used to design messages for their peers about the danger of initiating or continuing drug and alcohol use. Qualitative methodology via focus group discussions was utilized to engage 24 homeless young adults enrolled from a drop-in site in Santa Monica, California. The findings revealed support for a myriad of delivery styles, including in-person communication, flyers, music, documentary film, and creative writing. The young adults also provided insight into the importance of the thematic framework of messages. Such themes ranged from empowering and hopeful messages to those designed to scare young homeless adults into not experimenting with drugs. The findings indicate that in addition to messages communicating the need to prevent or reduce drug and alcohol use, homeless young adults respond to messages that remind them of goals and dreams they once had for their future, and to content that is personal, real, and truthful. Our research indicates that messages that reinforce protective factors such as hope for the future and self-esteem may be as important to homeless young adults as information about the risks and consequences of drug use.

  16. How do people feel about contact with ETIs?

    NASA Astrophysics Data System (ADS)

    Sabadell, Miguel A.; Salamero, Fernando J.

    1996-06-01

    'Astronomers find ET civilization.' In the opinion of many, this newspaper headline could reflect what would be the most exciting, challenging and profound discovery not only of the century but of human history. The idea of a plurality of inhabited worlds in the universe is as old as our civilization. It was a religious heresy in pre-Renaissance times; Giordano Bruno was burned at the stake in 1600 because of this belief. A slow but steady increase in the number of papers on the possible existence of other beings distinct from us has been appearing since then. The rapid progress in science and technology, our although poor understanding of the mechanisms of the cosmic evolution, the consolidation of the Darwinian hypothesis and, most importantly, the tenacious work of SETI pioneers have made possibly that the scientific community took seriously the possibility of life in other places of the universe and to search for it. There are different SETI projects running in the world. The unequivocal detection of an ETI signal is the goal. This could take many forms, all of them unpredictable. Some authors notice that the unambiguous confirmation that the signal is of extraterrestrial intelligence origin would be a hard work (Boyce 1990, Tarter 1991). But of most significance is the impact on our society of such a contact. How should we react? With fear and panic because advanced ETIs would quickly destroy the human spirit? Waiting a golden age? Imagine an extraterrestrial spaceship landing somewhere in our planet. What should we do? In both cases, will human behavior be influenced by the incontestable knowledge of the existence of ETIs? As John Billingham point out 'there has been little activity on those cultural aspects of SETI other than science and engineering.'

  17. PiHi Observations at the ATA, Conventional and Unconventional SETI

    NASA Astrophysics Data System (ADS)

    Harp, Gerald; Wilcox, B.; Arbunich, J.; Blair, S.; Backus, P. R.; Tarter, J. C.; Shostak, S.; Jordan, J.; Kilsdonk, T.; Ackermann, R. F.; Ross, J.; ATA Team

    2010-01-01

    Many radio SETI searches focus on the frequency range where the HI (1.42 GHz) and OH lines (1.6-1.7 GHz) lines are landmarks delineating the water hole This is only a small fraction of the terrestrial microwave window (TMW) from 1-10 GHz. This survey occurs near the center of the TMW at 4.462336275 GHz or π times the HI frequency. We call this the PiHI ("pie high") survey. The inspiration for PiHI observations comes from Carl Sagan in his book, Contact. This survey builds upon and extends a previous survey at PiHI (Blair, D. G. et al. (1992), MNRAS, 257, 105) with greater sensitivity, resolution, and coverage. We survey the nearest 94 main sequence stars in the HabCat catalog (Turnbull, M. C. and Tarter, J. C. (2003), ApJS, 145, 181) with spectral classes between F9 and G7 (max. radius 62 pc). The ATA's flexibility allows simultaneous measurements of targeted observations on stars (with beamformers) and 1° FOV "blind” observations of the areas around target stars (with imaging correlator). The targeted observations are carried out with a high resolution (0.7 Hz) spectrometer and integration times on the order of 200 s. The spectral imaging correlator measures a 50 x 50 grid of points with 3 kHz spectral resolution. This survey shows several signals of minor interest were discovered, though none of the signals reported are continuously "on,” which is an important characteristic for the positive identification of an ETI signal. The ATA has been funded through generous grants from the Paul G. Allen Family Foundation, the SETI Institute, UC Berkeley, the National Science Foundation (Grant No. 0540599), Sun Microsystems, Xilinx, Nathan Myhrvold, Greg Papadopoulos, and other corporations and individual donors.

  18. Searching for extraterrestrial civilizations.

    PubMed

    Kuiper, T B; Morris, M

    1977-05-06

    We have argued that planning for a search for extraterrestrial intelligence should involve a minimum number of assumptions. In view of the feasibility (at our present level of understanding) of using nuclear fusion to effect interstellar travel at a speed of 0.1c, it appears unwarranted (at this time) to assume that it would not occur for at least some technologically advanced civilizations. One cannot even conclude that humans would not attempt this within the next few centuries. On the contrary, the most likely future situation, given the maintenance of technological growth and the absence of extraterrestrial interference, is that our civilization will explore and colonize our galactic neighborhood. A comparison of the time scales of galactic evolution and interstellar travel leads to the conclusion that the galaxy is either essentially empty with respect to technological civilizations or extensively colonized. In the former instance, a SETI would be unproductive. In the latter, a SETI could be fruitful if a signal has been deliberately directed at the earth or at an alien outpost, probe, or communication relay station in our solar system. In the former case, an existing antenna would probably be sufficient to detect the signal. In the latter case, success would depend on the way in which the communications were coded. Failure to detect a signal could permit any of the following conclusions: (i) the galaxy is devoid of technological civilizations, advanced beyond our own, (ii) such civilizations exist, but cannot (for some reason which is presently beyond our ken) engage in interstellar colonization, or (iii) such civilizations are not attempting overt contact with terrestrial civilizations and their intercommunications, if present, are not coded in a simple way. To plan at this time for a high-cost, large-array SETI based on the last two possibilities appears to be rather premature.

  19. Promoting participation in physical activity using framed messages: an application of prospect theory.

    PubMed

    Latimer, Amy E; Rench, Tara A; Rivers, Susan E; Katulak, Nicole A; Materese, Stephanie A; Cadmus, Lisa; Hicks, Althea; Keany Hodorowski, Julie; Salovey, Peter

    2008-11-01

    Messages designed to motivate participation in physical activity usually emphasize the benefits of physical activity (gain-framed) as well as the costs of inactivity (loss-framed). The framing implications of prospect theory suggest that the effectiveness of these messages could be enhanced by providing gain-framed information only. We compared the effectiveness of gain-, loss-, and mixed-framed messages for promoting moderate to vigorous physical activity. Randomized trial. Sedentary, healthy callers to the US National Cancer Institute's Cancer Information Service (N=322) received gain-, loss-, or mixed-framed messages on three occasions (baseline, Week 1, and Week 5). Social cognitive variables and self-reported physical activity were assessed at baseline, Week 2, and Week 9. Separate regression analyses were conducted to examine message effects at each assessment point. At Week 2, gain- and mixed-framed messages resulted in stronger intentions and greater self-efficacy than loss-framed messages. At Week 9, gain-framed messages resulted in greater physical activity participation than loss- or mixed-framed messages. Social cognitive variables at Week 2 did not mediate the Week 9 framing effects on physical activity participation. Using gain-framed messages exclusively may be a means of increasing the efficacy of physical activity materials.

  20. Involving service users in intervention design: a participatory approach to developing a text-messaging intervention to reduce repetition of self-harm.

    PubMed

    Owens, Christabel; Farrand, Paul; Darvill, Ruth; Emmens, Tobit; Hewis, Elaine; Aitken, Peter

    2011-09-01

    OBJECTIVE To engage a group of people with relevant lived experience in the development of a text-messaging intervention to reduce repetition of self-harm. BACKGROUND Contact-based interventions, such as follow-up letters, postcards and telephone calls, have shown potential to reduce repetition of self-harm in those who present at Accident and Emergency departments. Text messaging offers a low-cost alternative that has not been tested. We set out to develop a text-based intervention. The process of intervention development is rarely reported and little is known about the impact of service user involvement on intervention design. METHOD We held a series of six participatory workshops and invited service users and clinicians to help us work out how to get the right message to the right person at the right time, and to simulate and test prototypes of an intervention. RESULTS Service users rejected both the idea of a generic, 'one size fits all' approach and that of 'audience segmentation', maintaining that text messages could be safe and effective only if individualized. This led us to abandon our original thinking and develop a way of supporting individuals to author their own self-efficacy messages and store them in a personal message bank for withdrawal at times of crisis. CONCLUSIONS This paper highlights both the challenge and the impact of involving consumers at the development stage. Working with those with lived experience requires openness, flexibility and a readiness to abandon or radically revise initial plans, and may have unexpected consequences for intervention design. © 2010 Blackwell Publishing Ltd.

  1. Involving service users in intervention design: a participatory approach to developing a text‐messaging intervention to reduce repetition of self‐harm

    PubMed Central

    Owens, Christabel; Farrand, Paul; Darvill, Ruth; Emmens, Tobit; Hewis, Elaine; Aitken, Peter

    2010-01-01

    Abstract Objective  To engage a group of people with relevant lived experience in the development of a text‐messaging intervention to reduce repetition of self‐harm. Background  Contact‐based interventions, such as follow‐up letters, postcards and telephone calls, have shown potential to reduce repetition of self‐harm in those who present at Accident and Emergency departments. Text messaging offers a low‐cost alternative that has not been tested. We set out to develop a text‐based intervention. The process of intervention development is rarely reported and little is known about the impact of service user involvement on intervention design. Method  We held a series of six participatory workshops and invited service users and clinicians to help us work out how to get the right message to the right person at the right time, and to simulate and test prototypes of an intervention. Results  Service users rejected both the idea of a generic, ‘one size fits all’ approach and that of ‘audience segmentation’, maintaining that text messages could be safe and effective only if individualized. This led us to abandon our original thinking and develop a way of supporting individuals to author their own self‐efficacy messages and store them in a personal message bank for withdrawal at times of crisis. Conclusions  This paper highlights both the challenge and the impact of involving consumers at the development stage. Working with those with lived experience requires openness, flexibility and a readiness to abandon or radically revise initial plans, and may have unexpected consequences for intervention design. PMID:20860777

  2. Graphic Communications Systems. Grade 11-12. Course #8135 (Semester). Technology Education Course Guide. Industrial Arts/Technology Education.

    ERIC Educational Resources Information Center

    North Carolina State Dept. of Public Instruction, Raleigh. Div. of Vocational Education.

    This guide is intended for use in teaching a graphic communications systems. The course has been designed to provide students with an opportunity to assess audiences; design, produce, and deliver printed and photographic messages; and analyze the impacts of these messages. The first two sections discuss the guide's development within the framework…

  3. Impact of Norm Perceptions and Guilt on Audience Response to Anti-Smoking Norm PSAs: The Case of Korean Male Smokers

    ERIC Educational Resources Information Center

    Lee, Hyegyu; Paek, Hye-Jin

    2013-01-01

    Objective: To examine how norm appeals and guilt influence smokers' behavioural intention. Design: Quasi-experimental design. Setting: South Korea. Method: Two hundred and fifty-five male smokers were randomly assigned to descriptive, injunctive, or subjective anti-smoking norm messages. After they viewed the norm messages, their norm perceptions,…

  4. SETV: an Extension of SETI?

    NASA Astrophysics Data System (ADS)

    Teodorani, M.

    2003-02-01

    In the ambit of the SETI Project, a new branch named SETV (Search for Extraterrestrial Visitation) was born very recently due to the international effort of some engineers, astronomers and other researchers, and it is now in a development phase with several monitoring projects. SETV is aimed at investigating, by using well-tested means of physical and technological sciences, the possible evidence of extraterrestrial visitations inside our solar system. On the basis of statistical calculations of galactic migration, and of models coming from standard stellar evolution, Dyson theory and advanced possibilities invoked by theoretical physics, the historical excursus which turned the SETA hypothesis (Search for Extraterrestrial Artifacts), developed in the 80', into the present SETV definition, is presented in detail. The possibility that extraterrestrial intelligences are present inside our solar system with inhabited and/or robotic probes is discussed, including the possibility that our planet is one of their targets. A proposal concerning instrumented multi-wavelength surveys and identification of such exogenous probes is presented.

  5. OAST Space Theme Workshop. Volume 3: Working group summary. 3: Sensors (E-3). A. Statement. B. Technology needs (form 1). C. Priority assessment (form 2). D. Additional assessment

    NASA Technical Reports Server (NTRS)

    1976-01-01

    Developments required to support the space power, SETI, solar system exploration and global services programs are identified. Instrumentation and calibration sensors (rather than scientific) are needed for the space power system. Highly sophisticated receivers for narrowband detection of microwave sensors and sensors for automated stellar cataloging to provide a mapping data base for SETI are needed. Various phases of solar system exploration require large area solid state imaging arrays from UV to IR; a long focal plane telescope; high energy particle detectors; advanced spectrometers; a gravitometer; and atmospheric distanalyzer; sensors for penetrometers; in-situ sensors for surface chemical analysis, life detection, spectroscopic and microscopic analyses of surface soils, and for meteorological measurements. Active and passive multiapplication sensors, advanced multispectral scanners with improved resolution in the UV and IR ranges, and laser techniques for advanced probing and oceanographic characterization will enhance for global services.

  6. A critical examination of factors that might encourage secrecy

    NASA Astrophysics Data System (ADS)

    Tough, Allen

    If a signal is detected someday from extraterrestrial intelligence, several factors might encourage complete and immediate secrecy. As a result, all data might be restricted to the receiving facility or nation instead of being shared promptly with SETI scientists around the world. Seven factors seem particularly like to encourage secrecy: (1) the belief that people may panic; (2) the fear of a negative impact on religion, science, and culture; (3) embarrassment; (4) the individual and national competitive urge; (5) avoiding a harmful premature reply; (6) a national trade or military advantage; and (7) the fear of a Trojan Horse. Three steps might alleviate the particularly difficult factors (numbers 4, 5, 6): an international treaty for immediate sharing of possible signals with SETI scientists in several other countries; implementation and frequent use of an actual network of scientists for such sharing; and further study of the possible need for partial restriction of data about the location and channel of a suspected signal.

  7. A SETI Search of Nearby Solar-Type Stars at the 203-GHz Positronium Hyperfine Resonance

    NASA Technical Reports Server (NTRS)

    Steffes, Paul G.; DeBoer, David R.

    1994-01-01

    The development of advanced millimeter-wave technology has made it possible to construct low-noise receivers and high-power transmitters comparable to those available at much lower frequencies. This technology, plus certain physical characteristics of the millimeter-wave spectrum, suggests possible advantages for use of this wavelength range for interstellar communications. As a result, a Search for ExtraTerrestrial Intelligence(SETI) type search has been conducted for narrow-bandwidth signals at frequencies near the positronium hyperfine spectral line (203.385 GHz), a potential natural reference frequency. A total of 40 solar-type stars within 23 parsecs were observed, in addition to three locations near the galactic center. No detections were made at the detection threshold of 2.3 x 10(exp -19) W/sq m in each of two orthogonal linear polarizations Future observations will be made with a higher resolution Fast Fourier Transform Spectrum Analyzer (FFTSA), which should improve sensitivity by an order of magnitude and reduce required observing time.

  8. An infrared search for extraterrestrial laser signals

    NASA Technical Reports Server (NTRS)

    Betz, A.

    1986-01-01

    The focus of project SETI is on microwave frequencies, where receivers fundamentally have the best sensitivity for the detection of narrow band signals. Such receivers, when coupled to existing radio telescopes, form an optimum system for broad area searches over the sky. Detection of narrow band infrared signals is best done with a laser heterodyne reciever similar in function to a microwave spectral line receiver. A receiver was built for astrophysical observations at 30 THz (10 microns) and the spectrometer is being adapted for SETI work. The receiver uses a small CO2 laser as the local oscillator, a HgCdTe diode as the photomixer, and a multichannel intermediate frequency (IF) filterbank. An advanced multichannel IF processor is now being built to detect infrared line radiation in 1000 spectral channels each 1 MHz wide. When completed this processor will be used with a ground based telescope next year for a survey of several hundred selected stars for narrow band CO2 laser signals at 30 THz.

  9. Astrobiological complexity with probabilistic cellular automata.

    PubMed

    Vukotić, Branislav; Ćirković, Milan M

    2012-08-01

    The search for extraterrestrial life and intelligence constitutes one of the major endeavors in science, but has yet been quantitatively modeled only rarely and in a cursory and superficial fashion. We argue that probabilistic cellular automata (PCA) represent the best quantitative framework for modeling the astrobiological history of the Milky Way and its Galactic Habitable Zone. The relevant astrobiological parameters are to be modeled as the elements of the input probability matrix for the PCA kernel. With the underlying simplicity of the cellular automata constructs, this approach enables a quick analysis of large and ambiguous space of the input parameters. We perform a simple clustering analysis of typical astrobiological histories with "Copernican" choice of input parameters and discuss the relevant boundary conditions of practical importance for planning and guiding empirical astrobiological and SETI projects. In addition to showing how the present framework is adaptable to more complex situations and updated observational databases from current and near-future space missions, we demonstrate how numerical results could offer a cautious rationale for continuation of practical SETI searches.

  10. Scope and effectiveness of mobile phone messaging for HIV/AIDS care: a systematic review.

    PubMed

    van Velthoven, M H M M T; Brusamento, S; Majeed, A; Car, J

    2013-01-01

    The objective of this mixed method systematic review was to assess the scope, effectiveness, acceptability and feasibility of the use of mobile phone messaging for HIV infection prevention, treatment and care. We comprehensively searched the peer-reviewed and grey literature. Two authors independently screened citations, extracted data and assessed study quality of included studies (any research design) focusing on mobile phone messaging interventions for HIV care. We present a narrative overview of the results. Twenty-one studies met the inclusion criteria: three randomized controlled trials, 11 interventional studies using other study designs and seven qualitative or cross-sectional studies. We also found six on-going trials and 21 projects. Five of the on-going trials and all the above mentioned projects took place in low or middle-income countries. Mobile phone messaging was researched for HIV prevention, appointment reminders, HIV testing reminders, medication adherence and for communication between health workers. Of the three randomized controlled trials assessing the use of short message service (SMS) to improve medication adherence, two showed positive results. Other interventional studies did not provide significant results. In conclusion, despite an extensive search we found limited evidence on the effectiveness of mobile phone messaging for HIV care. There is a need to adequately document outcomes and constraints of programs using mobile phone messaging to support HIV care to assess the impact and to focus on best practice.

  11. The impact of secure messaging on workflow in primary care: Results of a multiple-case, multiple-method study.

    PubMed

    Hoonakker, Peter L T; Carayon, Pascale; Cartmill, Randi S

    2017-04-01

    Secure messaging is a relatively new addition to health information technology (IT). Several studies have examined the impact of secure messaging on (clinical) outcomes but very few studies have examined the impact on workflow in primary care clinics. In this study we examined the impact of secure messaging on workflow of clinicians, staff and patients. We used a multiple case study design with multiple data collections methods (observation, interviews and survey). Results show that secure messaging has the potential to improve communication and information flow and the organization of work in primary care clinics, partly due to the possibility of asynchronous communication. However, secure messaging can also have a negative effect on communication and increase workload, especially if patients send messages that are not appropriate for the secure messaging medium (for example, messages that are too long, complex, ambiguous, or inappropriate). Results show that clinicians are ambivalent about secure messaging. Secure messaging can add to their workload, especially if there is high message volume, and currently they are not compensated for these activities. Staff is -especially compared to clinicians- relatively positive about secure messaging and patients are overall very satisfied with secure messaging. Finally, clinicians, staff and patients think that secure messaging can have a positive effect on quality of care and patient safety. Secure messaging is a tool that has the potential to improve communication and information flow. However, the potential of secure messaging to improve workflow is dependent on the way it is implemented and used. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. On the Conceptual Ambiguity Surrounding Perceived Message Effectiveness

    PubMed Central

    Yzer, Marco; LoRusso, Susan; Nagler, Rebekah H.

    2015-01-01

    Health message quality is best understood in terms of a message’s ability to effectively produce change in the variables that it was designed to change. The importance of determining a message’s effectiveness in producing change prior to implementation is clear: The better a message’s potential effectiveness is understood, the better able interventionists are to distinguish effective from ineffective messages before allocating scarce resources to message implementation. For this purpose, research has relied on perceived message effectiveness measures as a proxy of a message’s potential effectiveness. Remarkably, however, very little conceptual work has been done on perceived message effectiveness, which renders its measures under-informed and inconsistent across studies. To encourage greater conceptual work on this important construct, we review several threats to the validity of existing measures and consider strategies for improving our understanding of perceived message effectiveness. PMID:25470437

  13. The WLCG Messaging Service and its Future

    NASA Astrophysics Data System (ADS)

    Cons, Lionel; Paladin, Massimo

    2012-12-01

    Enterprise messaging is seen as an attractive mechanism to simplify and extend several portions of the Grid middleware, from low level monitoring to experiments dashboards. The production messaging service currently used by WLCG includes four tightly coupled brokers operated by EGI (running Apache ActiveMQ and designed to host the Grid operational tools such as SAM) as well as two dedicated services for ATLAS-DDM and experiments dashboards (currently also running Apache ActiveMQ). In the future, this service is expected to grow in numbers of applications supported, brokers and technologies. The WLCG Messaging Roadmap identified three areas with room for improvement (security, scalability and availability/reliability) as well as ten practical recommendations to address them. This paper describes a messaging service architecture that is in line with these recommendations as well as a software architecture based on reusable components that ease interactions with the messaging service. These two architectures will support the growth of the WLCG messaging service.

  14. A systematic review of three approaches for constructing physical activity messages: What messages work and what improvements are needed?

    PubMed Central

    2010-01-01

    Background To motivate individuals to adhere to a regular physical activity regime, guidelines must be supplemented with persuasive messages that are disseminated widely. While substantial research has examined effective strategies for disseminating physical activity messages, there has been no systematic effort to examine optimal message content. This paper reviews studies that evaluate the effectiveness of three approaches for constructing physical activity messages including tailoring messages to suit individual characteristics of message recipients (message tailoring), framing messages in terms of gains versus losses (message framing), and targeting messages to affect change in self-efficacy (i.e., a theoretical determinant of behavior change). Methods We searched the MEDLINE, PsycINFO, EMBASE and CINAHL databases up to July 2008. Relevant reference lists also were searched. We included intervention trials, field experiments, and laboratory-based studies that aimed to test the efficacy or effectiveness of tailored messages, framed messages and self-efficacy change messages among healthy adults. We used a descriptive approach to analyze emerging patterns in research findings. Based on this evidence we made recommendations for practice and future research. Results Twenty-two studies were identified. Twelve studies evaluated message tailoring. In 10 of these studies, tailored messages resulted in greater physical activity than a control message. Six studies evaluated framed messages. Five of these studies demonstrated that gain-framed messages lead to stronger intentions to be active compared to a control message. Moreover, a gain-frame advantage was evident in three of the four studies that assessed physical activity. Four studies evaluated self-efficacy change messages. The two studies that used an experimental design provide a clear indication that individuals' beliefs can be affected by messages that incorporate types of information known to be determinants of self-efficacy. Overall, strong evidence to support definitive recommendations for optimal message content and structure was lacking. Conclusions Additional research testing the optimal content of messages used to supplement physical activity guidelines is needed. Tailored messages, gain-framed messages, and self-efficacy change messages hold promise as strategies for constructing physical activity messages and should be a focus of future research. PMID:20459779

  15. 75 FR 61492 - Agency Information Collection Activities; Proposed Collection; Comment Request; Testing...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-10-05

    ... understanding of target audiences that FDA needs to design effective communication strategies, messages, and... reaction to the messages in either individual or group settings. Third, as evaluative research, it will...

  16. High occupancy vehicle (HOV) lane management system : amendment A.

    DOT National Transportation Integrated Search

    2011-12-01

    This report describes a system designed to provide Single Occupancy Hybrid Vehicles (SOHVs) restriction : messages dynamically to drivers through variable message signs. This system will allow California to : comply with federal requirements (that Si...

  17. Effect of Message Format and Content on Attitude Accessibility Regarding Sexually Transmitted Infections.

    PubMed

    Jain, Parul; Hoffman, Eric; Beam, Michael; Xu, Shan Susan

    2017-11-01

    Sexually transmitted infections (STIs) are widespread in the United States among people ages 15-24 years and cost almost $16 billion yearly. It is therefore important to understand message design strategies that could help reduce these numbers. Guided by exemplification theory and the extended parallel process model (EPPM), this study examines the influence of message format and the presence versus absence of a graphic image on recipients' accessibility of STI attitudes regarding safe sex. Results of the experiment indicate a significant effect from testimonial messages on increased attitude accessibility regarding STIs compared to statistical messages. Results also indicate a conditional indirect effect of testimonial messages on STI attitude accessibility, though threat is greater when a graphic image is included. Implications and directions for future research are discussed.

  18. Design of a clinical notification system.

    PubMed

    Wagner, M M; Tsui, F C; Pike, J; Pike, L

    1999-01-01

    We describe the requirements and design of an enterprise-wide notification system. From published descriptions of notification schemes, our own experience, and use cases provided by diverse users in our institution, we developed a set of functional requirements. The resulting design supports multiple communication channels, third party mappings (algorithms) from message to recipient and/or channel of delivery, and escalation algorithms. A requirement for multiple message formats is addressed by a document specification. We implemented this system in Java as a CORBA object. This paper describes the design and current implementation of our notification system.

  19. Depictions of substance use in reality television: a content analysis of The Osbournes

    PubMed Central

    Blair, Nicole A; Yue, So Kuen; Singh, Ranbir; Bernhardt, Jay M

    2005-01-01

    Objective To determine the source and slant of messages in a reality television programme that may promote or inhibit health related or risky behaviours. Design Coding visual and verbal references to alcohol, tobacco, and other drug (ATOD) use in The Osbournes. Review methods Three reviewers watched all 10 episodes of the first season and coded incidents of substance use according to the substance used (alcohol, tobacco, or drugs), the way use was portrayed (visually or verbally), the source of the message (the character in the show involved in the incident), and the slant of the incident (endorsement or rejection). Main outcome measures The variation in number of messages in an average episode, the slant of messages, and message source. Results The average number of messages per episode was 9.1 (range 2-17). Most drug use messages (15, 54%) implied rejection of drugs, but most alcohol messages (30, 64%) and tobacco messages (12, 75%) implied endorsements for using these substances. Most rejections (34, 94%) were conveyed verbally, but most endorsements (36, 65%) were conveyed visually. Messages varied in frequency and slant by source. Conclusions The reality television show analysed in this study contains numerous messages on substance use that imply both rejection and endorsement of use. The juxtaposition of verbal rejection messages and visual endorsement messages, and the depiction of contradictory messages about substance use from show characters, may send mixed messages to viewers about substance use. PMID:16373737

  20. BrdsNBz: A Mixed Methods Study Exploring Adolescents' Use of a Sexual Health Text Message Service

    ERIC Educational Resources Information Center

    Willoughby, Jessica Fitts

    2013-01-01

    Sexual health text message services are becoming increasingly popular, but little is known about who uses such services and why. This project details the implementation of a campaign promoting a state-wide sexual health text message service that allows teens to text directly with a health educator and uses a mixed method design to assess who uses…

  1. Audio Steganography with Embedded Text

    NASA Astrophysics Data System (ADS)

    Teck Jian, Chua; Chai Wen, Chuah; Rahman, Nurul Hidayah Binti Ab.; Hamid, Isredza Rahmi Binti A.

    2017-08-01

    Audio steganography is about hiding the secret message into the audio. It is a technique uses to secure the transmission of secret information or hide their existence. It also may provide confidentiality to secret message if the message is encrypted. To date most of the steganography software such as Mp3Stego and DeepSound use block cipher such as Advanced Encryption Standard or Data Encryption Standard to encrypt the secret message. It is a good practice for security. However, the encrypted message may become too long to embed in audio and cause distortion of cover audio if the secret message is too long. Hence, there is a need to encrypt the message with stream cipher before embedding the message into the audio. This is because stream cipher provides bit by bit encryption meanwhile block cipher provide a fixed length of bits encryption which result a longer output compare to stream cipher. Hence, an audio steganography with embedding text with Rivest Cipher 4 encryption cipher is design, develop and test in this project.

  2. Optimising text messaging to improve adherence to web-based smoking cessation treatment: a randomised control trial protocol.

    PubMed

    Graham, Amanda L; Jacobs, Megan A; Cohn, Amy M; Cha, Sarah; Abroms, Lorien C; Papandonatos, George D; Whittaker, Robyn

    2016-03-30

    Millions of smokers use the Internet for smoking cessation assistance each year; however, most smokers engage minimally with even the best designed websites. The ubiquity of mobile devices and their effectiveness in promoting adherence in other areas of health behaviour change make them a promising tool to address adherence in Internet smoking cessation interventions. Text messaging is used by most adults, and messages can proactively encourage use of a web-based intervention. Text messaging can also be integrated with an Internet intervention to facilitate the use of core Internet intervention components. We identified four aspects of a text message intervention that may enhance its effectiveness in promoting adherence to a web-based smoking cessation programme: personalisation, integration, dynamic tailoring and message intensity. Phase I will use a two-level full factorial design to test the impact of these four experimental features on adherence to a web-based intervention. The primary outcome is a composite metric of adherence that incorporates general utilisation metrics (eg, logins, page views) and specific feature utilisation shown to predict abstinence. Participants will be N=860 adult smokers who register on an established Internet cessation programme and enrol in its text message programme. Phase II will be a two-arm randomised trial to compare the efficacy of the web-based cessation programme alone and in conjunction with the optimised text messaging intervention on 30-day point prevalence abstinence at 9 months. Phase II participants will be N=600 adult smokers who register to use an established Internet cessation programme and enrol in text messaging. Secondary analyses will explore whether adherence mediates the effect of treatment condition on outcome. This protocol was approved by Chesapeake IRB. We will disseminate study results through peer-reviewed manuscripts and conference presentations related to the methods and design, outcomes and exploratory analyses. NCT02585206. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  3. Increasing Sun Protection in Winter Outdoor Recreation

    PubMed Central

    Walkosz, Barbara J.; Buller, David B.; Andersen, Peter A.; Scott, Michael D.; Dignan, Mark B.; Cutter, Gary R.; Maloy, Julie A.

    2009-01-01

    Background Unprotected and excessive exposure to ultraviolet radiation (UVR) is the primary risk factor for skin cancer. Design A pair-matched, group-randomized, pre-test/post-test, quasi-experimental design, with ski resorts as the unit of randomization, tested the effectiveness of Go Sun Smart, a multi-channel skin cancer prevention program. Independent samples of guests were taken at baseline (2001) and follow-up (2002); data were analyzed in 2006. Setting and Participants A total of 6516 adult guests at 26 ski resorts in the western U.S. and Canada were recruited, consented, and interviewed on chairlifts. This study was nested within an occupational intervention for ski resort workers. Intervention Ski resorts were pair-matched and randomized to receive Go Sun Smart, which consisted of print, electronic, visual, and interpersonal skin cancer prevention messages. Main Outcome Measures Sun-protection behaviors, sunburning, recall of sun-protection messages, and the association of message exposure to sun protection. Results The difference in recall of all sun-protection messages, messages on signs and posters, and the Go Sun Smart logo was significant between the intervention and control resorts. Reported use of sun-protection practices was higher by guests at intervention ski areas using more (a higher dose of) Go Sun Smart materials. Intervention-group guests who recalled a sun-safety message were more likely to practice sun safety than intervention-group guests who did not recall a message and control-group guests. Conclusions While the mere implementation of Go Sun Smart did not produce sun-safety improvements, Go Sun Smart appeared to be effective for guests who encountered and remembered it. Many factors can work against message exposure. Signage seemed to produce the greatest increase in exposure to sun-safety messages. PMID:18471586

  4. {open_quotes}Media-On-Demand{close_quotes} multimedia electronic mail: A tool for collaboration on the web

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Tsoi, Kei Nam; Rahman, S.M.

    1996-12-31

    Undoubtedly, multimedia electronic mail has many advantages in exchanging information electronically in a collaborative work. The existing design of e-mail systems architecture is inefficient in exchanging multimedia message which has much larger volume, and requires more bandwidth and storage space than the text-only messages. This paper presents an innovative method for exchanging multimedia mail messages in a heterogeneous environment to support collaborative work over YAW on the Internet. We propose a {open_quotes}Parcel Collection{close_quotes} approach for exchanging multimedia electronic mail messages. This approach for exchanging multimedia electronic mail messages integrates the current WWW technologies with the existing electronic mail systems.

  5. Improving Refill Adherence in Medicare Patients With Tailored and Interactive Mobile Text Messaging: Pilot Study.

    PubMed

    Brar Prayaga, Rena; Jeong, Erwin W; Feger, Erin; Noble, Harmony K; Kmiec, Magdalen; Prayaga, Ram S

    2018-01-30

    Nonadherence is a major concern in the management of chronic conditions such as hypertension, cardiovascular disease, and diabetes where patients may discontinue or interrupt their medication for a variety of reasons. Text message reminders have been used to improve adherence. However, few programs or studies have explored the benefits of text messaging with older populations and at scale. In this paper, we present a program design using tailored and interactive text messaging to improve refill rates of partially adherent or nonadherent Medicare members of a large integrated health plan. The aim of this 3-month program was to gain an understanding of whether tailored interactive text message dialogues could be used to improve medication refills in Medicare patients with one or more chronic diseases. We used the mPulse Mobile interactive text messaging solution with partially adherent and nonadherent Medicare patients (ie, over age 65 years or younger with disabilities) of Kaiser Permanente Southern California (KP), a large integrated health plan, and compared refill rates of the text messaging group (n=12,272) to a group of partially adherent or nonadherent Medicare patients at KP who did not receive text messages (nontext messaging group, n=76,068). Both groups were exposed to other forms of refill and adherence outreach including phone calls, secure emails, and robo-calls from December 2016 to February 2017. The text messaging group and nontext messaging group were compared using an independent samples t test to test difference in group average of refill rates. There was a significant difference in medication refill rates between the 2 groups, with a 14.07 percentage points higher refill rate in the text messaging group (P<.001). The results showed a strong benefit of using this text messaging solution to improve medication refill rates among Medicare patients. These findings also support using interactive text messaging as a cost-effective, convenient, and user-friendly solution for patient engagement. Program outcomes and insights can be used to enhance the design of future text-based solutions to improve health outcomes and promote adherence and long-term behavior change. ©Rena Brar Prayaga, Erwin W Jeong, Erin Feger, Harmony K Noble, Magdalen Kmiec, Ram S Prayaga. Originally published in JMIR Mhealth and Uhealth (http://mhealth.jmir.org), 30.01.2018.

  6. Excessive and addictive gaming control using counselling agent in online game design

    NASA Astrophysics Data System (ADS)

    Ididi, Italumeh O.; Hassan, Sa'adah; Ghani, Abdul Azim Abd; Ali, Norhayati Mohd

    2017-10-01

    In recent times, online game play has become a food for thought to concerned individuals, researchers and authorities of various countries due to its excessive and addictive usage. Although, various government have taken certain measures such as shutting down internet cafe at certain hours of the day, censoring the most brutal, offensive and aggressive sections of certain games before they are released. Researchers have advised developers on ways of limiting harm on players by suggesting design changes on time limit. Furthermore, researchers have also suggested that online game distributors ought to make available appropriate referral services. The impart of the above are yet to make any remarkable impact on players. In this paper, we have proposed a Counseling Agent model integrating informative and self-appraisal messages in online game design as a control measure. Informative and self-appraisal messaging in games have proven optimistic through making positive impact on player's thoughts and behavior towards gaming. These messages are expected to remind players about the negative impact of excessive and addictive gaming habits, as well as suggesting possible reductive solutions through message streaming.

  7. Effect of Message Type on the Visual Attention of Adults With Traumatic Brain Injury.

    PubMed

    Thiessen, Amber; Brown, Jessica; Beukelman, David; Hux, Karen; Myers, Angela

    2017-05-17

    The purpose of this investigation was to measure the effect of message type (i.e., action, naming) on the visual attention patterns of individuals with and without traumatic brain injury (TBI) when viewing grids composed of 3 types of images (i.e., icons, decontextualized photographs, and contextualized photographs). Fourteen adults with TBI and 14 without TBI-assigned either to an action or naming message condition-viewed grids composed of 3 different image types. Participants' task was to select/sustain visual fixation on the image they felt best represented a stated message (i.e., action or naming). With final fixation location serving as a proxy for selection, participants in the naming message condition selected decontextualized photographs significantly more often than the other 2 image types. Participants in the action message condition selected contextualized photographs significantly more frequently than the other 2 image types. Minimal differences were noted between participant groups. This investigation provides preliminary evidence of the relationship between image and message type. Clinicians involved in the selection of images used for message representation should consider the message being represented when designing supports for people with TBI. Further research is necessary to fully understand the relationship between images and message type.

  8. 78 FR 76841 - Agency Information Collection Activities; Submission for Office of Management and Budget Review...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-12-19

    ... to design effective communication strategies, messages, and labels. These communications will aim to..., as evaluative research, it will allow FDA to ascertain the effectiveness of the messages and the...

  9. Intelligent Gateway design and development : final report

    DOT National Transportation Integrated Search

    1996-10-01

    The U.S. Coast Guard (USCG) had communications requirements uncommon to other services. Currently, there were no Defense Message System (DMS) products that could be used to send messages to underway vessels with multiple modes of communications. The ...

  10. Distributed Processor/Memory Architectures Design Program

    DTIC Science & Technology

    1975-02-01

    Event Scheduling Plo 31 Globat LAl Message Input Event Sicheduling Fhou ..... ............... 106 32 It tc Iata Representation...298 138 GEX LEX Scheduling Phlmophy ....... ...................... 300 139 Executive Comirol Herarchy... Scheduler Subroutine lnterrelatiomhips . ..... ................. 312 145 Task Scheduler Message Scatuer. . ...... ....................... 315 146

  11. Message sensation and cognition values: factors of competition or integration?

    PubMed

    Xu, Jie

    2015-01-01

    Using the Activation Model of Information Exposure and Elaboration Likelihood Model as theoretical frameworks, this study explored the effects of message sensation value (MSV) and message cognition value (MCV) of antismoking public service announcements (PSAs) on ad processing and evaluation among young adults, and the difference between high sensation seekers and low sensation seekers in their perceptions and responses toward ads with different levels of sensation and cognition value. A 2 (MSV: high vs. low) × 2 (MCV: high vs. low) × 2 (need for sensation: high vs. low) mixed experimental design was conducted. Two physiological measures including skin conductance and heart rate were examined. Findings of this study show that MSV was not a distraction but a facilitator of message persuasiveness. These findings contribute to the activation model. In addition, need for sensation moderated the interaction effect of MSV and MCV on ad processing. Low sensation seekers were more likely to experience the interaction between MSV and MCV than high sensation seekers. Several observations related to the findings and implications for antismoking message designs are elaborated. Limitations and directions for future research are also outlined.

  12. Tobacco-prevention messages online: social marketing via the Web.

    PubMed

    Lin, Carolyn A; Hullman, Gwen A

    2005-01-01

    Antitobacco groups have joined millions of other commercial or noncommercial entities in developing a presence on the Web. These groups primarily represent the following different sponsorship categories: grassroots, medical, government, and corporate. To obtain a better understanding of the strengths and weaknesses in the message design of antitobacco Web sites, this project analyzed 100 antitobacco Web sites ranging across these four sponsorship categories. The results show that the tobacco industry sites posted just enough antismoking information to appease the antismoking publics. Medical organizations designed their Web sites as specialty sites and offered mostly scientific information. While the government sites resembled a clearinghouse for antitobacco related information, the grassroots sites represented the true advocacy outlets. In general, the industry sites provided the weakest persuasive messages and medical sites fared only slightly better. Government and grassroots sites rated most highly in presenting their antitobacco campaign messages on the Web.

  13. No drama: key elements to the success of an HIV/STI-prevention mass-media campaign.

    PubMed

    Pedrana, Alisa E; Hellard, Margaret E; Higgs, Peter; Asselin, Jason; Batrouney, Colin; Stoovè, Mark

    2014-05-01

    We qualitatively examined gay men's reactions to the national "Drama Downunder" HIV/STI social marketing campaign targeting gay men in Australia to identify key campaign elements that underpinned the demonstrated effectiveness of the campaign. We present findings from six qualitative focus groups held with 49 participants as part of the evaluation of the sexual-health-promotion campaign over 2008-2009. Participants identified attention-grabbing images, a humorous approach, positive and simple tailored messaging, and the use of mainstream media as campaign features crucial in normalizing sexual health testing, driving campaign engagement, and ensuring high message exposure. Our results suggest that designers of future campaigns should strive to balance positive and negative campaign images and messages, and find new ways to engage men with sexual health topics, particularly younger gay men. We discuss the implications of our findings about campaign effectiveness for future health-promotion campaigns and message design.

  14. ARC-2007-ACD07-0065-028

    NASA Image and Video Library

    2007-04-12

    Ames Video group during interviewing Dave Lathem, Harvard Smithsonian Center for Astrophysics, Cambridge, MR at the SETI Institute during a NASA Ames Kepler Mission conference. Dave Maurantonio, Ed Schilling, Bill Moede, and Eric Land, Ames/Planners Video crew (Kepler a search for habitable planets was selected for Discovery Program)

  15. Search for extraterrestrial intelligence (SETI)

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Morrison, P.; Billingham, J.; Wolfe, J.

    1977-01-01

    Findings are presented of a series of workshops on the existence of extraterrestrial intelligent life and ways in which extraterrestrial intelligence might be detected. The coverage includes the cosmic and cultural evolutions, search strategies, detection of other planetary systems, alternate methods of communication, and radio frequency interference. 17 references. (JFP)

  16. Experiential Education on the Edge: SETI Activities for the College Classroom

    ERIC Educational Resources Information Center

    Crider, Anthony; Weston, Anthony

    2012-01-01

    In a sophomore-level, interdisciplinary honors class, we introduced students to the Search for Extraterrestrial Intelligence through assigned readings, student presentations, classroom discussions, and multiple experiential activities. In this paper, we present four of these novel experiential activities. In the first, students suddenly find…

  17. Developing a theory driven text messaging intervention for addiction care with user driven content.

    PubMed

    Muench, Frederick; Weiss, Rebecca A; Kuerbis, Alexis; Morgenstern, Jon

    2013-03-01

    The number of text messaging interventions designed to initiate and support behavioral health changes have been steadily increasing over the past 5 years. Messaging interventions can be tailored and adapted to an individual's needs in their natural environment-fostering just-in-time therapies and making them a logical intervention for addiction continuing care. This study assessed the acceptability of using text messaging for substance abuse continuing care and the intervention preferences of individuals in substance abuse treatment in order to develop an interactive mobile text messaging intervention. Fifty individuals enrolled in intensive outpatient substance abuse treatment completed an assessment battery relating to preferred logistics of mobile interventions, behavior change strategies, and types of messages they thought would be most helpful to them at different time points. Results indicated that 98% participants were potentially interested in using text messaging as a continuing care strategy. Participants wrote different types of messages that they perceived might be most helpful, based on various hypothetical situations often encountered during the recovery process. Although individuals tended to prefer benefit driven over consequence driven messages, differences in the perceived benefits of change among individuals predicted message preference. Implications for the development of mobile messaging interventions for the addictions are discussed. (PsycINFO Database Record (c) 2013 APA, all rights reserved).

  18. How Online Peer-to-Peer Conversation Shapes the Effects of a Message About Healthy Sleep.

    PubMed

    Robbins, Rebecca; Niederdeppe, Jeff

    2017-02-01

    Conversation about health messages and campaigns is common, and message-related conversations are increasingly recognized as a consequential factor in shaping message effects. The evidence base is limited, however, about the conditions under which conversation may help or hinder health communication efforts. In this study, college students (N = 301) first watched a short sleep video and were randomly assigned to either talk with a partner in an online chat conversation or proceed directly to a short survey. Unknown to participants, the chat partner was a confederate coached to say positive things about sleep and the message ('positive' chat condition), negative things ('negative' chat condition), or unrelated things ('natural' chat condition). All respondents completed a short survey on beliefs about sleep, reactions to the message, and intentions to get adequate sleep. Respondents had greater intentions to engage in healthy sleep when they engaged in positive conversation following message exposure than when they engaged in negative conversation after the message (p < 0.001). Positive emotion experienced in response to the message and positive chat perceptions were significant predictors (p < 0.05) of intentions to achieve healthy sleep. Health message designers may benefit from understanding how messages are exchanged in peer-to-peer conversation to better predict and explain their effects.

  19. Text messaging interventions for individuals with mental health disorders including substance use: A systematic review.

    PubMed

    Watson, Tyler; Simpson, Scot; Hughes, Christine

    2016-09-30

    We completed a systematic review of the literature to characterize the impact of text messaging interventions on medication adherence or mental health related outcomes in people with mental health disorders including substance use. Four electronic databases were searched from January 1999 to October 2015. Seven studies met our inclusion criteria: three studies evaluated text messaging in patients with schizophrenia or schizoaffective disorder diagnosis, two studies evaluated text messaging in patients with chronic alcohol dependence, and two studies reviewed text messaging in patients with mood disorders. Six studies were randomized controlled trials and one was a prospective pilot study with pre-post intervention design. Text messaging frequency ranged from once weekly to twelve per day. The effect of text messaging on medication adherence was measured in five studies; one study reporting significant improvements in the text messaging intervention group. The effect of text messaging on mental health related outcomes was measured in all seven studies, with five studies showing significant improvements in a variety of psychiatric and social functioning assessments. Collectively, these studies suggest text messaging is a promising tool to support management of patients with mental illness. Further research examining theory-based text messaging interventions in larger samples of patients is required. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  20. How online peer-to-peer conversation shapes the effects of a message about healthy sleep

    PubMed Central

    Robbins, Rebecca; Niederdeppe, Jeff

    2016-01-01

    Conversation about health messages and campaigns is common, and message-related conversations are increasingly recognized as a consequential factor in shaping message effects. The evidence base is limited, however, about the conditions under which conversation may help or hinder health communication efforts. In this study, college students (N = 301) first watched a short sleep video and were randomly assigned to either talk with a partner in an online chat conversation or proceed directly to a short survey. Unknown to participants, the chat partner was a confederate coached to say positive things about sleep and the message (‘positive’ chat condition), negative things (‘negative’ chat condition), or unrelated things (‘natural’ chat condition). All respondents completed a short survey on beliefs about sleep, reactions to the message, and intentions to get adequate sleep. Respondents had greater intentions to engage in healthy sleep when they engaged in positive conversation following message exposure than when they engaged in negative conversation after the message (p < .001). Positive emotion experienced in response to the message and positive chat perceptions were significant predictors (p < .05) of intentions to achieve healthy sleep. Health message designers may benefit from understanding how messages are exchanged in peer-to-peer conversation to better predict and explain their effects. PMID:27492421

Top