SETI: Spreading the net

NASA Astrophysics Data System (ADS)

Carstairs, Ian R.

2002-12-01

Ian R Carstairs reports on efforts to extend the search for extraterrestrial intelligence to X and γ-ray regions. Traditional Search for Extra-Terrestrial Intelligence (SETI) strategies have used radio, microwave and, to a limited extent, optical searches. But this ignores the higher energy X and γ-ray regions that a technologically advanced extraterrestrial civilization might use to attract our attention - using messages encoded in discrete photon-counting exchange, much like the signals seen from pulsars. Here, the methods used in high-energy pulsar detection and analysis are reviewed and applied to this new SETI initiative.

The windows of SETI - Frequency and time in the search for extraterrestrial intelligence

NASA Technical Reports Server (NTRS)

Oliver, Bernard M.

1987-01-01

Since interstellar travel is not economically possible on the time scale of a human lifetime, communication with extraterrestrials can be achieved only by sending some form of energy or matter across space; photons (electromagnetic waves) are best. Of particular interest to SETI is the region from about 1,000-60,000 MHz known as the free-space microwave window. During the course of NASA's Cyclops program, it was pointed out that the hydrogen and hydroxyl lines bounded a band in which there were no other known lines. The threatened loss of the microwave window to earth-based services is discussed.

A bimodal search strategy for SETI

NASA Technical Reports Server (NTRS)

Gulkis, S.; Olsen, E. T.; Tarter, J.

1980-01-01

The search strategy and resultant observational plan which was developed to carry out a comprehensive Search for Extraterrestrial Intelligence (SETI) over that portion of the electromagnetic spectrum known as the terrestrial microwave window is described. The limiting sensitivity achieved was parameterized and calculated for Deep Space Network antennas as well as several radio astronomy observatories. A brief description of the instrumentation to be employed in the search and the classes of signals to be looked for is given. One observational goal is to survey the entire sky over a wide range of frequency to a relatively constant flux level. This survey ensures that all potential life sites are observed to some limiting equivalent isotropic radiated power depending upon their distance. A second goal is to survey a set of potential transmission sites selected a priori to be especially promising, achieving very high sensitivity over a smaller range of frequency.

Observational program options and system requirements for the search for extraterrestrial intelligence /SETI/

NASA Technical Reports Server (NTRS)

Billingham, J.; Wolfe, J. H.; Edelson, R. E.; Gulkis, S.; Sadin, S. R.

1978-01-01

The possibility that intelligent life may be widespread in the universe is now being investigated. A formula for estimating the number of coexisting communicative civilizations has been developed by Drake. A good way of conducting a search for extraterrestrial intelligence (SETI) is to examine the microwave window of the electromagnetic spectrum for narrow-band signals which such civilizations may be transmitting. Two specific search strategies are described. Both employ existing antennas equipped with sophisticated multichannel spectrum analyzers and pattern recognition devices. The Ames Research Center proposal is a high sensitivity, high-resolution search of nearby promising stars and selected sky areas in the 'water hole' (1400-1727 MHz). The Jet Propulsion Laboratory proposal is for a survey of most of the sky over a significant portion of the free-space microwave window at lower sensitivities and resolutions. The approaches are complementary and both are being pursued. The consummation of these programs could achieve one of the most profound discoveries in the history of human civilization, or at least will show the way to future efforts.

Exobiology and SETI from the lunar farside

NASA Technical Reports Server (NTRS)

Tarter, Jill C.; Rummel, John

1990-01-01

Within the Life Sciences Division of NASA, the Exobiology Program seeks to understand the origin, evolution and distribution of life in the universe. There are two feasible methods of searching for life beyond the earth. The first is to return to Mars and systematically explore its surface and subsurface with instrumentation capable of identifying extinct as well as extant life. The second is to search for advanced forms of life in other planetary systems that have developed a technology capable of modifying their environment in ways that make it detectable across the vast interstellar distances. The Exobiology Program is currently pursuing both of these options. If NASA's SETI (search for extraterrestrial intelligence) Microwave Observing Project of the 1990s fails to detect evidence of radio signals generated by an extraterrestrial technology, what might be the next step? The establishment of a permanent lunar base early in the next century may enable the construction of large aperture radio telescopes that can extend both the sensitivity and the frequency range of SETI observations. A lunar base may also provide the opportunity for construction of optical and IR telescopes intended for the direct detection of extrasolar planetary systems.

High resolution SETI: Experiences and prospects

NASA Astrophysics Data System (ADS)

Horowitz, Paul; Clubok, Ken

Megachannel spectroscopy with sub-Hertz resolution constitutes an attractive strategy for a microwave search for extraterrestrial intelligence (SETI), assuming the transmission of a narrowband radiofrequency beacon. Such resolution matches the properties of the interstellar medium, and the necessary Doppler corrections provide a high degree of interference rejection. We have constructed a frequency-agile receiver with an FFT-based 8 megachannel digital spectrum analyzer, on-line signal recognition, and multithreshold archiving. We are using it to conduct a meridian transit search of the northern sky at the Harvard-Smithsonian 26-m antenna, with a second identical system scheduled to begin observations in Argentina this month. Successive 400 kHz spectra, at 0.05 Hz resolution, are searched for features characteristic of an intentional narrowband beacon transmission. These spectra are centered on guessable frequencies (such as λ21 cm), referenced successively to the local standard of rest, the galactic barycenter, and the cosmic blackbody rest frame. This search has rejected interference admirably, but is greatly limited both in total frequency coverage and sensitivity to signals other than carriers. We summarize five years of high resolution SETI at Harvard, in the context of answering the questions "How useful is narrowband SETI, how serious are its limitations, what can be done to circumvent them, and in what direction should SETI evolve?" Increasingly powerful signal processing hardware, combined with ever-higher memory densities, are particularly relevant, permitting the construction of compact and affordable gigachannel spectrum analyzers covering hundreds of megahertz of instantaneous bandwidth.

The 1993 Finnish Interdisciplinary Seminar on SETI - A review of aims, approaches and conclusions

NASA Astrophysics Data System (ADS)

Seppanen, Jouko

1993-10-01

The communications of the International Interdisciplinary Seminar on SETI, held on March 6-7, 1993 in Vantaa, Finland, are reviewed and the contents and conclusions of papers summarized. The seminar was organized jointly by the Finnish Artificial Intelligence Society (FAIS), Finnish Astronomical Society, Ursa Astronomical Association and Heureka - The Finnish Science Centre. As the ninth in a series of intelligence-related seminars of FAIS, SETI was chosen as the topic for spring 1993, noting the new ten year NASA SETI program HRMS (High Resolution Micro-wave Survey), commenced on Columbus Day, October 12, 1992. The aims and the interdisciplinary format of the seminar are described, the main results and conclusions of papers are restated, and the seminar publications introduced. The summaries of papers are based on their abstracts and contain excerpts from texts.

Search for extraterrestrial intelligence/high resolution microwave survey team member

NASA Technical Reports Server (NTRS)

Steffes, Paul G.

1993-01-01

This semiannual status report describes activities conducted by the Principal Investigator during the first half of this third year of the NASA High Resolution Microwave Survey (HRMS) Investigator Working Group (IWG). As a (HRMS) Team Member with primary interest in the Sky Survey activity, this investigator attended IWG meetings at NASA/Ames and U.C.-Santa Cruz in Apr. and Aug. 1992, and has traveled independently to NRAO/Kitt Peak, Arizona (April 1993) and Woodbury, Georgia (July 1993). During the July 1993 visit to the Georgia Tech Research Corporation/Woodbury Research Facility, an experiment was conducted to study the effects of interference from C-band (3.7 - 4.2 GHz) geostationary spacecraft on the Sky Survey operation in that band. At the first IWG meeting in April of this year, results of a SETI observation conducted at the 203 GHz positronium hyperfine resonance using the NRAO facility at Kitt Peak, AZ, were presented, as well as updates on the development of the spaceborne RFI data bases developed for the project. At the second meeting, results of the study of interference from C-band geostationary spacecraft were presented. Likewise, a presentation was made at the accompanying 1993 Bioastronomy Symposium describing the SETI observation at the positronium hyperfine resonance.

[An encounter with extraterrestrial intelligence].

PubMed

Hisabayashi, Hisashi

2003-12-01

It is much easier to find extraterrestrial intelligence than to detect simple organisms living on other planets. However, it is hard to communicate with such intelligence without the mutual understanding of inter-stellar communication protocol. The radio SETI (The Search for Extra-Terrestrial Intelligence) was initiated with the pioneering work of F. Drake in 1960, one year after the historical SETI paper by Cocconi and Morrison. This talk explains that SETI evolves with two bases of science; the understanding of our universe and the development of technology. Since SETI has had strong connection with radio astronomy from its early beginning, the impacts of radio astronomical findings and technological breakthrough can be seen in many aspects of the SETI history. Topics of this talk include the detection of microwave 3 K background radiation in the universe. Interstellar atomic and molecular lines found in radio-wave spectra provide the evidence of pre-biotic chemical evolution in such region. Radio telescope imaging and spectral technique are closely associated with methodology of SETI. Topics of the talk extend to new Allen Telescope Array and projected Square Kilometer Array. Recent optical SETI and the discoveries of extra solar planets are also explained. In the end, the recent understanding of our universe is briefly introduced in terms of matter, dark matter and dark energy. Even our understanding of the universe has been evolutionarily revolved and accumulated after 1960, we must recognize that our universe is still poorly understood and that astronomy and SETI are required to proceed hand in hand.

SETI - A preliminary search for narrowband signals at microwave frequencies

NASA Technical Reports Server (NTRS)

Cuzzi, J. N.; Clark, T. A.; Tarter, J. C.; Black, D. C.

1977-01-01

In the search for intelligent signals of extraterrestrial origin, certain forms of signals merit immediate and special attention. Extremely narrowband signals of spectral width similar to our own television transmissions are most favored energetically and least likely to be confused with natural celestial emission. A search of selected stars has been initiated using observational and data processing techniques optimized for the detection of such signals. These techniques allow simultaneous observation of 10 to the 5th to 10 to the 6th channels within the observed spectral range. About two hundred nearby (within 80 LY) solar type stars have been observed at frequencies near the main microwave transitions of the hydroxyl radical. In addition, several molecular (hydroxyl) masers and other non-thermal sources have been observed in this way in order to uncover any possible fine spectral structure of natural origin and to investigate the potential of such an instrument for radioastronomy.

Extraterrestrial intelligence? The search is on

NASA Technical Reports Server (NTRS)

Coulter, Gary R.

1991-01-01

NASA's SETI-Microwave Observing Project, beginning on October 12, 1992, will search the closest solar-type stars for radio signals from extraterrestrial civilizations. When completed in the year 2000, the NASA search will have surpassed the search volume of all prior searches by a factor of 10 exp 10. The world's largest radio telescopes will be employed, in conjunction with the NASA Deep Space Network communications antennas. The program will be led by NASA-Ames, with substantial contribution by JPL.

SETI The Search for Extraterrestrial Intelligence.

ERIC Educational Resources Information Center

Jones, Barrie W.

1991-01-01

Discussed is the search for life on other planets similar to Earth based on the Drake equation. Described are search strategies and microwave searches. The reasons why people are searching are also discussed. (KR)

The recognition of extraterrestrial artificial signals

NASA Technical Reports Server (NTRS)

Seeger, C. L.

1980-01-01

Considerations in the design of receivers for the detection and recognition of artificial microwave signals of extraterrestrial origin are discussed. Following a review of the objectives of SETI and the probable reception and detection characteristics of extraterrestrial signals, means for the improvement of the sensitivity, signal-to-noise ratios and on-line data processing capabilities of SETI receivers are indicated. The characteristics of the signals likely to be present at the output of an ultra-low-noise microwave receiver are then examined, including the system background noise, terrestrial radiations, astrophysical radiations, accidental artificial radiations of terrestrial origin, and intentional radiations produced by humans and by extraterrestrial intelligence. The classes of extraterrestrial signals likely to be detected, beacons and leakage signals, are considered, and options in the specification of gating and thresholding for a high-spectral resolution, high-time-resolution signal discriminator are indicated. Possible tests for the nonhuman origin of a received signal are also pointed out.

The outlook for cosmic company.

PubMed

Shostak, S

2001-12-01

The last 100 million years or so has seen a continued increase in encephalization for several terrestrial species. Intelligence has survival value. Developments in astrobiology suggest that what was once considered enormously improbable, namely life, is now suspected of being ubiquitous. It may be that the evolution of intelligence is unlikely, but in a finite, breathtakingly large universe (10(22) stars) small probability likely does not matter. Even if nature is indifferent to producing intelligence, SETI might still succeed. Biological intelligence may be rare, but it has the potential for creating engineered synthetic intelligence, capable of rapid and directed self-evolution. The galaxy could be rife with such long-lived, communicating devices, even if intelligent protoplasm is both rare and fleeting. SETI is looking for narrow-band, microwave signals that are not produced naturally. Ultimately, SETI is more exploration than experimentation.

PiHi Observations at the ATA, Conventional and Unconventional SETI

NASA Astrophysics Data System (ADS)

Harp, Gerald; Wilcox, B.; Arbunich, J.; Blair, S.; Backus, P. R.; Tarter, J. C.; Shostak, S.; Jordan, J.; Kilsdonk, T.; Ackermann, R. F.; Ross, J.; ATA Team

2010-01-01

Many radio SETI searches focus on the frequency range where the HI (1.42 GHz) and OH lines (1.6-1.7 GHz) lines are landmarks delineating the water hole This is only a small fraction of the terrestrial microwave window (TMW) from 1-10 GHz. This survey occurs near the center of the TMW at 4.462336275 GHz or π times the HI frequency. We call this the PiHI ("pie high") survey. The inspiration for PiHI observations comes from Carl Sagan in his book, Contact. This survey builds upon and extends a previous survey at PiHI (Blair, D. G. et al. (1992), MNRAS, 257, 105) with greater sensitivity, resolution, and coverage. We survey the nearest 94 main sequence stars in the HabCat catalog (Turnbull, M. C. and Tarter, J. C. (2003), ApJS, 145, 181) with spectral classes between F9 and G7 (max. radius 62 pc). The ATA's flexibility allows simultaneous measurements of targeted observations on stars (with beamformers) and 1° FOV "blind” observations of the areas around target stars (with imaging correlator). The targeted observations are carried out with a high resolution (0.7 Hz) spectrometer and integration times on the order of 200 s. The spectral imaging correlator measures a 50 x 50 grid of points with 3 kHz spectral resolution. This survey shows several signals of minor interest were discovered, though none of the signals reported are continuously "on,” which is an important characteristic for the positive identification of an ETI signal. The ATA has been funded through generous grants from the Paul G. Allen Family Foundation, the SETI Institute, UC Berkeley, the National Science Foundation (Grant No. 0540599), Sun Microsystems, Xilinx, Nathan Myhrvold, Greg Papadopoulos, and other corporations and individual donors.

An assessment of the impact of radiofrequency interference on microwave SETI searches

NASA Technical Reports Server (NTRS)

Klein, M. J.; Gulkis, S.; Olsen, E. T.; Armstrong, E. F.; Jackson, E. B.

1992-01-01

Investigations are carried out at JPL on radiofrequency interferences at very low levels (-130 to -180 dBm) in various bands, especially the 1-2 GHz band. Extrapolation of interferences in the years to come is attempted.

An assessment of the impact of radiofrequency interference on microwave SETI searches.

PubMed

Klein, M J; Gulkis, S; Olsen, E T; Armstrong, E F; Jackson, E B

1992-01-01

Investigations are carried out at JPL on radiofrequency interferences at very low levels (-130 to -180 dBm) in various bands, especially the 1-2 GHz band. Extrapolation of interferences in the years to come is attempted.

A conceptual 34-meter antenna feed configuration for joint DSN/SETI use from 1 to 10 GHz

NASA Technical Reports Server (NTRS)

Slobin, S. D.

1986-01-01

The very satisfactory performance of a conceptual 34-m DSS-12 type HA-Dec antenna feed sysem over the frequency range of 1 to 10 GHz is demonstrated. A seven-feedhorn baseline design is developed which will allow Search for Extra-Terrestrial Intelligence (SETI) investigations using each horn over a 1.4:1 frequency range. A gain/system noise temperature (G/T) figure of merit is calculated for the frequency range of each horn; it is found that system performance down to 20 deg elevation is possible with a G/T degradation of less than 3 dB at every frequency. The design presented here will allow shared but independent antenna use by the Deep Space Network (DSN) and SETI with a minimum of operational impacts to DSN functions and no intrusions into the DSN microwave equipment configuration.

The Search for Extraterrestrial Intelligence.

ERIC Educational Resources Information Center

Jones, Barrie W.

2003-01-01

Traces the efforts of Searching for Extraterrestrial Technological Intelligence (SETI) since 1960 when a radio-telescope was used to see if any messages were being sent from the vicinity of two nearby stars. Describes attempts to detect microwave/optical signals and technological modification of the cosmic environment. (Author/KHR)

CCC and the Fermi paradox

NASA Astrophysics Data System (ADS)

Gurzadyan, V. G.; Penrose, R.

2016-01-01

Within the scheme of conformal cyclic cosmology (CCC), information can be transmitted from aeon to aeon. Accordingly, the "Fermi paradox" and the SETI programme --of communication by remote civilizations-- may be examined from a novel perspective: such information could, in principle, be encoded in the cosmic microwave background. The current empirical status of CCC is also discussed.

Pulsar-aided SETI experimental observations

NASA Technical Reports Server (NTRS)

Heidmann, J.; Biraud, F.; Tarter, J.

1989-01-01

The rotational frequencies of pulsars are used to select preferred radio frequencies for SETI. Pulsar rotational frequencies are converted into SETI frequencies in the 1-10 GHz Galactic radio window. Experimental observations using the frequencies are conducted for target stars closer than 25 parsecs, unknown targets in a globular cluster, and unknown targets in the Galaxy closer than 2.5 kpc. The status of these observations is discussed.

Two systems analyses of SETI. [microwave Search for Extra-Terrestrial Intelligence

NASA Technical Reports Server (NTRS)

Machol, R. E.

1976-01-01

The problem of receiving and identifying a single microwave signal transmitted by extraterrestrial intelligent beings is analyzed in the cases where the signal is designed to catch our attention and the signal is designed for internal purposes of another civilization. Six variables which yield uncertainty as to the exact signal which should be searched for are described: polarization, modulation, flux level, direction, frequency (including bandwidth and drift rate), and time. It is shown that if all reasonable variations of these parameters are to be examined sequentially for 1000 seconds, the search would take over a million times longer than the age of the Universe. Ways to simplify the search are considered, including widening the frequency bin, selecting specific targets, cutting the observation time, using a Fourier transform device for data processing, and building larger antennas as well as better low-noise receivers.

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, E. C. (Editor)

1987-01-01

Archival reports on developments in programs managed by JPL's Office of Telecommunications and Data Acquisition (TDA) are provided. Activities of the Deep Space Network (DSN) in space communications, radio navigation, radio science, and ground-based radio astronomy are reported. Also included are the plans, supporting research and technology, implementation and operations for the Ground Communications Facility (GCF). In geodynamics, the publication reports on the application of radio interferometry at microwave frequencies for geodynamic measurements. In the search for extraterrestrial intelligence (SETI), it reports on implementation and operations for searching the microwave spectrum.

Radio frequency interference at Jodrell Bank Observatory within the protected 21 cm band

NASA Technical Reports Server (NTRS)

Tarter, J.

1989-01-01

Radio frequency interference (RFI) will provide one of the most difficult challenges to systematic Searches for Extraterrestrial Intelligence (SETI) at microwave frequencies. The SETI-specific equipment is being optimized for the detection of signals generated by a technology rather than those generated by natural processes in the universe. If this equipment performs as expected, then it will inevitably detect many signals originating from terrestrial technology. If these terrestrial signals are too numerous and/or strong, the equipment will effectively be blinded to the (presumably) weaker extraterrestrial signals being sought. It is very difficult to assess how much of a problem RFI will actually represent to future observations, without employing the equipment and beginning the search. In 1983 a very high resolution spectrometer was placed at the Nuffield Radio Astronomy Laboratories at Jodrell Bank, England. This equipment permitted an investigation of the interference environment at Jodrell Bank, at that epoch, and at frequencies within the 21 cm band. This band was chosen because it has long been "protected" by international agreement; no transmitters should have been operating at those frequencies. The data collected at Jodrell Bank were expected to serve as a "best case" interference scenario and provide the minimum design requirements for SETI equipment that must function in the real and noisy environment. This paper describes the data collection and analysis along with some preliminary conclusions concerning the nature of the interference environment at Jodrell Bank.

Radio frequency interference at Jodrell Bank Observatory within the protected 21 cm band.

PubMed

Tarter, J

1989-01-01

Radio frequency interference (RFI) will provide one of the most difficult challenges to systematic Searches for Extraterrestrial Intelligence (SETI) at microwave frequencies. The SETI-specific equipment is being optimized for the detection of signals generated by a technology rather than those generated by natural processes in the universe. If this equipment performs as expected, then it will inevitably detect many signals originating from terrestrial technology. If these terrestrial signals are too numerous and/or strong, the equipment will effectively be blinded to the (presumably) weaker extraterrestrial signals being sought. It is very difficult to assess how much of a problem RFI will actually represent to future observations, without employing the equipment and beginning the search. In 1983 a very high resolution spectrometer was placed at the Nuffield Radio Astronomy Laboratories at Jodrell Bank, England. This equipment permitted an investigation of the interference environment at Jodrell Bank, at that epoch, and at frequencies within the 21 cm band. This band was chosen because it has long been "protected" by international agreement; no transmitters should have been operating at those frequencies. The data collected at Jodrell Bank were expected to serve as a "best case" interference scenario and provide the minimum design requirements for SETI equipment that must function in the real and noisy environment. This paper describes the data collection and analysis along with some preliminary conclusions concerning the nature of the interference environment at Jodrell Bank.

The Benefits of Adding SETI to the University Curriculum and What We Have Learned from a SETI Course Recently Offered at UCLA

NASA Astrophysics Data System (ADS)

Lesyna, Larry; Margot, Jean-Luc; Greenberg, Adam; Shinde, Akshay; Alladi, Yashaswi; Prasad MN, Srinivas; Bowman, Oliver; Fisher, Callum; Gyalay, Szilard; McKibbin, William; Miles, Brittany E.; Nguyen, Donald; Power, Conor; Ramani, Namrata; Raviprasad, Rashmi; Santana, Jesse

2017-01-01

We advocate for the inclusion of a full-term course entirely devoted to SETI in the university curriculum. SETI usually warrants only a few lectures in a traditional astronomy or astrobiology course. SETI’s rich interdisciplinary character serves astronomy students by introducing them to scientific and technological concepts that will aid them in their dissertation research or later in their careers. SETI is also an exciting topic that draws students from other disciplines and teaches them astronomical concepts that they might otherwise never encounter in their university studies. We have composed syllabi that illustrate the breadth and depth that SETI courses provide for advanced undergraduate or graduate students. The syllabi can also be used as a guide for an effective SETI course taught at a descriptive level.After a pilot course in 2015, UCLA formally offered a course titled "EPSS C179/279 - Search for Extraterrestrial Intelligence: Theory and Applications" in Spring 2016. The course was designed for advanced undergraduate students and graduate students in the science, technical, engineering, and mathematical fields. In 2016, 9 undergraduate students and 5 graduate students took the course. Students designed an observing sequence for the Arecibo and Green Bank telescopes, observed known planetary systems remotely, wrote a sophisticated and modular data processing pipeline, analyzed the data, and presented the results. In the process, they learned radio astronomy fundamentals, software development, signal processing, and statistics. The instructor believes that the students were eager to learn because of the engrossing nature of SETI. The students rated the course highly, in part because of the observing experience and the teamwork approach. The next offering will be in Spring 2017.See lxltech.com and seti.ucla.edu

Breakthrough Listen - A New Search for Life in the Universe

NASA Astrophysics Data System (ADS)

Worden, Pete

On July 20, 2015 Yuri Milner and Stephen Hawking announced a new set of scientific initiatives - a SETI search called Breakthrough Listen and a contest to devise potential messages in response to a detection entitled Breakthrough Message. These are the first of several privately-funded Breakthrough Initiatives, designed to answer the fundamental science questions surrounding the origin, extent and nature of life in the universe. The initiatives are managed by the Breakthrough Prize Foundation. With Breakthrough Listen, Radio SETI observations have begun at the Green Bank Radio Telescope (GBT) and optical SETI at the Lick Observatory Automated Planet Finder (APF). Observations will soon commence at the CSIRO Parkes Radio Telescope. Other SETI instruments and observations are under consideration. In addition, several other initiatives are under development including an expanded search for life in the universe.

Technical considerations on using the large Nancay radio telescope for SETI

NASA Technical Reports Server (NTRS)

Gulkis, S.; Biraud, F.; Heidmann, J.; Tarter, J.

1990-01-01

The Nancay decimetric Radio Telescope (NRT) in Nancay, France, is described, and its potential use for Search for Extraterrestrial Intelligence (SETI) observations is discussed. The conclusion reached is that the NRT is well suited for SETI observations because of its large collecting area, its large sky coverage, and its wideband frequency capability. However, a number of improvements are necessary in order to take full advantage of the system in carrying out an efficient SETI program. In particular, system sensitivity should be increased. This can be achieved through a series of improvements to the system, including lowering the ground pickup noise through the use of ground reflectors and more efficient feed design, and by using low-noise amplifier front ends.

Searching for Extraterrestrial Intelligence with the Square Kilometre Array

NASA Astrophysics Data System (ADS)

Siemion, A.; Benford, J.; Cheng-Jin, J.; Chennamangalam, J.; Cordes, J. M.; Falcke, H. D. E.; Garrington, S. T.; Garrett, M. A.; Gurvits, L.; Hoare, M.; Korpela, E.; Lazio, J.; Messerschmitt, D.; Morrison, I.; O'Brien, T.; Paragi, Z.; Penny, A.; Spitler, L.; Tarter, J.; Werthimer, D.

2015-04-01

The vast collecting area of the Square Kilometre Array (SKA), harnessed by sensitive receivers, flexible digital electronics and increased computational capacity, could permit the most sensitive and exhaustive search for technologically-produced radio emission from advanced extraterrestrial intelligence (SETI) ever performed. For example, SKA1-MID will be capable of detecting a source roughly analogous to terrestrial high-power radars (e.g. air route surveillance or ballistic missile warning radars, EIRP (EIRP = equivalent isotropic radiated power, ~10^17 erg sec^-1) at 10 pc in less than 15 minutes, and with a modest four beam SETI observing system could, in one minute, search every star in the primary beam out to ~100 pc for radio emission comparable to that emitted by the Arecibo Planetary Radar (EIRP ~2 x 10^20 erg sec^-1). The flexibility of the signal detection systems used for SETI searches with the SKA will allow new algorithms to be employed that will provide sensitivity to a much wider variety of signal types than previously searched for. Here we discuss the astrobiological and astrophysical motivations for radio SETI and describe how the technical capabilities of the SKA will explore the radio SETI parameter space. We detail several conceivable SETI experimental programs on all components of SKA1, including commensal, primary-user, targeted and survey programs and project the enhancements to them possible with SKA2. We also discuss target selection criteria for these programs, and in the case of commensal observing, how the varied use cases of other primary observers can be used to full advantage for SETI.

SETI: another way to find habitable worlds

NASA Astrophysics Data System (ADS)

Tarter, Jill

2003-10-01

There are currently eleven active SETI (search for extraterrestrial intelligence) programs on telescopes around the world. They operate at microwave and optical frequencies, as either sky surveys or targeted searches in the direction of (primarily) solar-type stars. Each is attempting to detect an electromagnetic biosignature of a technological civilization. Although detectable technologies will be far older than our own, these searches are constrained by our current understanding of physics and the terrestrial technologies available in the 21st century. Moore's Law suggests that most of these detection technologies will improve their capacity exponentially. Thus if any of the current strategies is valid, a thorough exploration of the Milky Way Galaxy should be possible within decades (not centuries), and success, or a significant null-result is predictable. Giving up, incorporating new search strategies based on emergent technologies, or adding beacon transmission to the listening strategies are all future possibilities.

Costs and Difficulties of Interstellar 'Messaging' and the Need for International Debate on Potential Risks

NASA Astrophysics Data System (ADS)

Billingham, J.; Benford, James

We advocate international consultations on societal and technical issues to address the risk of Messaging to Extraterrestrial Intelligence (METI) transmissions, and a moratorium on future transmissions until such issues are resolved. Instead, we recommend continuing to conduct SETI by listening, with no innate risk, while using powerful new search systems to give a better total probability of detection of beacons and messages than METI for the same cost, and with no need for a long obligatory wait for a response. Realistically, beacons are costly. In light of recent work on the economics of contact by radio, we offer alternatives to the current standard methods of SETI searches. METI transmissions to date are faint and very unlikely to be detected, even by nearby stars. We show that historical leakage from Earth has been undetectable for Earth-scale receiver systems. Future space microwave and laser power systems will likely be more detectable.

SETI Observations of Low Mass Stars at the SETI Institute

NASA Astrophysics Data System (ADS)

Harp, Gerald R.

2017-05-01

Are planets orbiting low-mass stars suitable for the development of life? Observations in the near future, including radio, will help to assess whether atmospheres do persist over long timescales for planets orbiting nearby M dwarfs, and clarify the nature of the radiation that penetrates to the surface of these planets. These are important ingredients for assessing planetary habitability, yet the question of habitability can be answered only with the positive measurement of an unambiguous biosignature. Radio and optical SETI observations capable of detecting technological activities of intelligent inhabitants could provide the most compelling evidence for the habitability of exoplanets orbiting M dwarfs. In this presentation we shall consider what information can be gleaned from our observations so far. The SETI Institute is currently undertaking a large survey of 20,000 low mass stars that is now about 30% complete. The frequency coverage on each star is about 450 MHz bandwidth (per star) over a range of selected frequencies from 1-10 GHz. From these observations we derive quantitative results relating to the probability that M dwarfs are actually inhabited.

At what wavelengths should we search for signals from extraterrestrial intelligence? (SETI/infrared communication/interstellar communication/extraterrestrial intelligence)

NASA Technical Reports Server (NTRS)

Townes, C. H.

1979-01-01

Searches for extraterrestrial intelligence concentrate on attempts to receive signals in the microwave region, the argument being given that communication occurs there at minimum broadcasted power. Such a conclusion is shown to result only under a restricted set of assumptions. If generalized types of detection are considered, in particular photon detection rather than linear detection alone, and if advantage is taken of the directivity of telescopes at short wavelengths, then somewhat less power is required for communication at infrared wavelengths than in the microwave region. Furthermore, a variety of parameters other than power alone can be chosen for optimization by an extraterrestrial civilization.

A Search for Brief Optical Flashes Associated with the SETI Target KIC 8462852

NASA Technical Reports Server (NTRS)

Abeysekara, A. U.; Archambault, S.; Archer, A.; Benbow, W.; Bird, R.; Buchovecky, M.; Buckley, J. H.; Byrum, K.; Cardenzana, J. V.; Cerruti, M.;

A Search for Brief Optical Flashes Associated with the SETI Target KIC 8462852

NASA Astrophysics Data System (ADS)

Abeysekara, A. U.; Archambault, S.; Archer, A.; Benbow, W.; Bird, R.; Buchovecky, M.; Buckley, J. H.; Byrum, K.; Cardenzana, J. V.; Cerruti, M.; Chen, X.; Christiansen, J. L.; Ciupik, L.; Cui, W.; Dickinson, H. J.; Eisch, J. D.; Errando, M.; Falcone, A.; Fegan, D. J.; Feng, Q.; Finley, J. P.; Fleischhack, H.; Fortin, P.; Fortson, L.; Furniss, A.; Gillanders, G. H.; Griffin, S.; Grube, J.; Gyuk, G.; Hütten, M.; Håkansson, N.; Hanna, D.; Holder, J.; Humensky, T. B.; Johnson, C. A.; Kaaret, P.; Kar, P.; Kelley-Hoskins, N.; Kertzman, M.; Kieda, D.; Krause, M.; Krennrich, F.; Kumar, S.; Lang, M. J.; Lin, T. T. Y.; Maier, G.; McArthur, S.; McCann, A.; Meagher, K.; Moriarty, P.; Mukherjee, R.; Nieto, D.; O'Brien, S.; O'Faoláin de Bhróithe, A.; Ong, R. A.; Otte, A. N.; Park, N.; Perkins, J. S.; Petrashyk, A.; Pohl, M.; Popkow, A.; Pueschel, E.; Quinn, J.; Ragan, K.; Ratliff, G.; Reynolds, P. T.; Richards, G. T.; Roache, E.; Santander, M.; Sembroski, G. H.; Shahinyan, K.; Staszak, D.; Telezhinsky, I.; Tucci, J. V.; Tyler, J.; Vincent, S.; Wakely, S. P.; Weiner, O. M.; Weinstein, A.; Williams, D. A.; Zitzer, B.

2016-02-01

The F-type star KIC 8462852 has recently been identified as an exceptional target for search for extraterrestrial intelligence (SETI) observations. We describe an analysis methodology for optical SETI, which we have used to analyze nine hours of serendipitous archival observations of KIC 8462852 made with the VERITAS gamma-ray observatory between 2009 and 2015. No evidence of pulsed optical beacons, above a pulse intensity at the Earth of approximately 1 {photon} {{{m}}}-2, is found. We also discuss the potential use of imaging atmospheric Cherenkov telescope arrays in searching for extremely short duration optical transients in general.

Cultural aspects of the search for extraterrestrial intelligence

NASA Astrophysics Data System (ADS)

Billingham, J.

SETI is an acronym which stands for the Search for Extraterrestrial Intelligence. The NASA SETI High Resolution Microwave Survey Project is a new and comprehensive search for evidence of microwave signals from extraterrestrial civilizations. It will formally begin on October 12, 1992, and last to the end of the century. The discovery of another form of intelligent life would be an important milestone for our civilization. In addition to the new scientific knowledge that we might acquire on the chemistry, physiology, behavior and evolutionary history of extraterrestrial life forms, we may also learn of the cultural achievements of another civilization, or indeed of many other civilizations. It is likely that the society that we detect will be much in advance of our own, so that they may long ago have passed through the evolutionary stage we are at now. The implications of such a discovery would have important consequences for our own future. This paper presents an analysis of some of the important areas which will require study as we approach the beginning of the NASA search. There are significant questions about the ease or difficulty of incorporating the new knowledge into the belief structures of different religions. Sociological and educational changes over time may equal or exceed those of the Copernican revolution. The status of the other civilization relative to ours is a challenging question for international space law. There are institutional and international questions on who will represent Earth in any future interstellar communication endeavors that we may attempt. There may be challenges in how we absorb the knowledge of an advanced technology. In political science we may have much to learn from their history, and what influence it may have on our own future. Last but not least, there is the effect of the discovery on individual and group psychology. These are the cultural aspects of SETI. Each area warrants further study, and recommendations are made as to the mechanisms which could be used to undertake such studies.

Manifestation of intelligence implications for SETI

NASA Technical Reports Server (NTRS)

Kuiper, T. B. H.

1986-01-01

The objectives of the SETI projects are discussed. Life, intelligence, and sapience are defined in order to characterize the phenomena. Dissipation and coherence are useful characteristics for detection. Consideration is given to electromagnetically observable phenomena, in particular spatial coherence.

SETI - The search for extraterrestrial intelligence - Plans and rationale

NASA Technical Reports Server (NTRS)

Wolfe, J. H.; Billingham, J.; Edelson, R. E.; Crow, R. B.; Gulkis, S.; Olsen, E. T.; Oliver, B. M.; Peterson, A. M.

1981-01-01

The methodology and instrumentation of a 10 yr search for extraterrestrial intelligence (SETI) program by NASA, comprising 5 yr for instrumentation development and 5 yr for observations, is described. A full sky survey in two polarizations between 1.2 and 10 GHz with resolution binwidths down to 32 Hz, and a two polarization can between 1.2-3 GHz with resolution binwidths down to 1 Hz of 700 nearby solar type stars within 20 light years of earth will extend the sensitivity of previous surveys by 300 times and cover 20,000 times more frequency space. EM signals are perceived as the only means for detecting life outside the solar system, and the SETI effort is driven by the empirical experience that once a physical process has been observed to occur, its occurrence elsewhere is assured. Further discussion is given of the history of searches for life in the Universe, the SETI search strategy, instrumentation, and signal identification.

Optical SETI: Moving Toward the Light

NASA Astrophysics Data System (ADS)

Ross, Monte; Kingsley, Stuart

In 2009, the SETI community celebrated a half-century since the classic paper by Giuseppe Cocconi and Philip Morrison in Nature, that described how we might look for radio transmissions from extraterrestrial civilizations. It is propitious that the publication of this book in 2010 marks both the 50th anniversary of Frank Drake's Project Ozma, and the 50th anniversary of the demonstration of the first (ruby) laser by Theodore Maiman. The invention of the laser was based on the maser work by Arthur Schawlow and Charles Townes and the simultaneous work of Gordon Gould. During this first half-century of SETI, most observing has been carried out in the radio spectrum, during which time there have been enormous developments in laser technology. Only during the past two decades has the optical approach to SETI, otherwise known as optical SETI, been given the attention it deserves.

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, E. C. (Editor)

1987-01-01

This quarterly publication (July-September 1987) provides archival reports on developments in programs managed by JPL's Office of Telecommunications and Data Acquisition (TDA). In space communications, radio navigation, radio science, and ground-based radio astronomy, it reports on activities of the Deep Space Network (DSN) and its associated Ground Communications Facility (GCF) in planning, in supporting research and technology, in implementation, and in operations. This work is performed for NASA's Office of Space Tracking and Data Systems (OSTDS). In geodynamics, the publication reports on the application of radio interferometry at microwave frequencies for geodynamic measurements. In the Search for Extraterrestrial Intelligence (SETI), it reports on implementation and operations for searching the microwave spectrum. The latter two programs are performed for NASA's Office of Space Science and Applications (OSSA).

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, E. C. (Editor)

1986-01-01

This quarterly publication (July-Sept. 1986) provides archival reports on developments in programs managed by JPL's Office of Telecommunications and Data Acquisition (TDA). In space communications, radio navigation, radio science, and ground-based radio astronomy, it reports on activities of the Deep Space Network (DSN) and its associated Ground Communications Facility (GCF) in planning, in supporting research and technology, in implementation, and in operations. This work is performed for NASA's Office of Space Tracking and Data Systems (OSTDS). In geodynamics, the publication reports on the application of radio interferometry at microwave frequencies for geodynamic measurements. In the search for extraterrestrial intelligence (SETI), it reports on implementation and operations for searching the microwave spectrum. The latter two programs are performed for NASA's Office of Space Science and Applications (OSSA).

THE FIRST VERY LONG BASELINE INTERFEROMETRIC SETI EXPERIMENT

DOE Office of Scientific and Technical Information (OSTI.GOV)

Rampadarath, H.; Morgan, J. S.; Tingay, S. J.

2012-08-15

The first Search for Extra-Terrestrial Intelligence (SETI) conducted with very long baseline interferometry (VLBI) is presented. By consideration of the basic principles of interferometry, we show that VLBI is efficient at discriminating between SETI signals and human generated radio frequency interference (RFI). The target for this study was the star Gliese 581, thought to have two planets within its habitable zone. On 2007 June 19, Gliese 581 was observed for 8 hr at 1230-1544 MHz with the Australian Long Baseline Array. The data set was searched for signals appearing on all interferometer baselines above five times the noise limit. Amore » total of 222 potential SETI signals were detected and by using automated data analysis techniques were ruled out as originating from the Gliese 581 system. From our results we place an upper limit of 7 MW Hz{sup -1} on the power output of any isotropic emitter located in the Gliese 581 system within this frequency range. This study shows that VLBI is ideal for targeted SETI including follow-up observations. The techniques presented are equally applicable to next-generation interferometers, such as the long baselines of the Square Kilometre Array.« less

OAST Space Theme Workshop. Volume 3: Working group summary. 3: Sensors (E-3). A. Statement. B. Technology needs (form 1). C. Priority assessment (form 2). D. Additional assessment

NASA Technical Reports Server (NTRS)

1976-01-01

Developments required to support the space power, SETI, solar system exploration and global services programs are identified. Instrumentation and calibration sensors (rather than scientific) are needed for the space power system. Highly sophisticated receivers for narrowband detection of microwave sensors and sensors for automated stellar cataloging to provide a mapping data base for SETI are needed. Various phases of solar system exploration require large area solid state imaging arrays from UV to IR; a long focal plane telescope; high energy particle detectors; advanced spectrometers; a gravitometer; and atmospheric distanalyzer; sensors for penetrometers; in-situ sensors for surface chemical analysis, life detection, spectroscopic and microscopic analyses of surface soils, and for meteorological measurements. Active and passive multiapplication sensors, advanced multispectral scanners with improved resolution in the UV and IR ranges, and laser techniques for advanced probing and oceanographic characterization will enhance for global services.

Lasers revisited - Their superior utility for interstellar beacons, communications, and travel

NASA Technical Reports Server (NTRS)

Rather, John D. G.

1991-01-01

This paper demonstrates reasons why research supporting SETI and Communication with Extraterrestrial Intelligence should be broadened to optical wavelengths rather than focusing almost entirely upon microwave wavelengths and technologies. New perceptions regarding the feasibility of laser technologies, along with reassessments of signal-to-noise considerations, show both the desirability and feasibility of optical interstellar transmissions, especially at IR and visible wavelengths. It is shown that utilization of the large bandwidths available at optical wavelengths greatly improves the possible use of such endeavors.

The NASA SETI sky survey: Recent developments

NASA Technical Reports Server (NTRS)

Klein, M. J.; Gulkis, S.; Olsen, E. T.; Renzetti, N. A.

1989-01-01

NASA's Search for Extraterrestrial Intelligence (SETI) project utilizes two complementary search strategies: a sky survey and a targeted search. The SETI team at the Jet Propulsion Laboratory (JPL) in Pasadena, California, has primary responsibility to develop and carry out the sky survey part. Described here is progress that has been made developing the major elements of the survey including a 2-million channel wideband spectrum analyzer system that is being designed and constructed by JPL for the Deep Space Network (DSN). The system will be a multiuser instrument; it will serve as a prototype for the SETI sky survey processor. This prototype system will be used to test the signal detection and observational strategies on DSN antennas in the near future.

Teaching Planetary Science as Part of the Search for Extraterrestrial Intelligence (SETI)

NASA Astrophysics Data System (ADS)

Margot, Jean-Luc; Greenberg, Adam H.

2017-10-01

In Spring 2016 and 2017, UCLA offered a course titled "EPSS C179/279 - Search for Extraterrestrial Intelligence: Theory and Applications". The course is designed for advanced undergraduate students and graduate students in the science, technical, engineering, and mathematical fields. Each year, students designed an observing sequence for the Green Bank telescope, observed known planetary systems remotely, wrote a sophisticated and modular data processing pipeline, analyzed the data, and presented their results. In 2016, 15 students participated in the course (9U, 5G; 11M, 3F) and observed 14 planetary systems in the Kepler field. In 2017, 17 students participated (15U, 2G; 10M, 7F) and observed 10 planetary systems in the Kepler field, TRAPPIST-1, and LHS 1140. In order to select suitable targets, students learned about planetary systems, planetary habitability, and planetary dynamics. In addition to planetary science fundamentals, students learned radio astronomy fundamentals, collaborative software development, signal processing techniques, and statistics. Evaluations indicate that the course is challenging but that students are eager to learn because of the engrossing nature of SETI. Students particularly value the teamwork approach, the observing experience, and working with their own data. The next offering of the course will be in Spring 2018. Additional information about our SETI work is available at seti.ucla.edu.

Status of the UC-Berkeley SETI efforts

NASA Astrophysics Data System (ADS)

Korpela, E. J.; Anderson, D. P.; Bankay, R.; Cobb, J.; Howard, A.; Lebofsky, M.; Siemion, A. P. V.; von Korff, J.; Werthimer, D.

2011-10-01

We summarize radio and optical SETI programs based at the University of California, Berkeley. The SEVENDIP optical pulse search looks for ns time scale pulses at visible wavelengths. It utilizes an automated 30 inch telescope, three ultra fast photo multiplier tubes and a coincidence detector. The target list includes F, G, K and M stars, globular cluster and galaxies. The ongoing SERENDIP V.v sky survey searches for radio signals at the 300 meter Arecibo Observatory. The currently installed configuration supports 128 million channels over a 200 MHz bandwidth with ~1.6 Hz spectral resolution. Frequency stepping allows the spectrometer to cover the full 300MHz band of the Arecibo L-band receivers. The final configuration will allow data from all 14 receivers in the Arecibo L-band Focal Array to be monitored simultaneously with over 1.8 billion channels. SETI@home uses the desktop computers of volunteers to analyze over 160 TB of data at taken at Arecibo. Over 6 million volunteers have run SETI@home during its 10 year history. The SETI@home sky survey is 10 times more sensitive than SERENDIP V.v but it covers only a 2.5 MHz band, centered on 1420 MHz. SETI@home searches a much wider parameter space, including 14 octaves of signal bandwidth and 15 octaves of pulse period with Doppler drift corrections from -100 Hz/s to +100 Hz/s. SETI@home is being expanded to analyze data collected during observations of Kepler objects of interest in May 2011. The Astropulse project is the first SETI search for μs time scale pulses in the radio spectrum. Because short pulses are dispersed by the interstellar medium, and the amount of dispersion is unknown, Astropulse must search through 30,000 possible dispersions. Substantial computing power is required to conduct this search, so the project uses volunteers and their personal computers to carry out the computation (using distributed computing similar to SETI@home). Keywords: radio instrumentation, FPGA spectrometers, SETI, optical SETI, Search for Extraterrestrial Intelligence, volunteer computing, radio transients, optical transients.

SETI observational program in Argentina

NASA Astrophysics Data System (ADS)

Raúl Colomb, F.; Cristina Martín, M.; Lemarchand, Guillermo A.

Due to the scarce SETI research in the Southern Hemisphere, we decided to begin an observation of a series of southern stars at 21 cm and 18 cm, using the facilities of the Instituto Argentino de Radioastronomía (IAR). One of the two 30 m radiotelescopes was used since October 1986, for a search of narrow frequency (2.2 kHz resolution) band signal in the direction of nearby stars. We have selected for this plan 78 stars between -40° and -90° of declination and distances less than 50 l.y. In this paper we present the first results of this program at HI and OH line. We describe a 320 h parasitic program at OH line using the data of Comet Halley observations. Following a suggestion of Dr I. Almár we began in November 1987, a series of observations around the SETI Ellipsoid originated in the SN1987A at 18 cm. We describe the observations around the stars HD21899 and HD100623, following a suggestion of Alexei Arkhipov. We have initiated contacts with The Planetary Society to expand our SETI activities. It is our hope that at the time of this Symposium we can announce the details of this agreement, which could include the construction of a 8.4 million channel ultranarrowband spectrum analyzer, designed by Professor Paul Horowitz of Harvard University. This agreement was announced on 8 October 1988 at The Planetary Society Toronto SETI Conference. The 8.4 million channel spectrum analyzer called META II, was built during 1989, at Harvard University by J. C. Olalde and E. Hurrell, under the supervision of Professor Paul Horowitz. META II was officially dedicated on 12 October 1990 and is in operation with the antenna 2 of the Instituto Argentino de Radioastronomía.

The Strategies for SETV and the Search for Exogenous Intelligent Life on Planet Earth

NASA Astrophysics Data System (ADS)

Teodorani, M.

2002-10-01

The main strategies of the present SETV (Search for Extraterrestrial Visitation) Project, one specific branch of the more general SETI project, are widely described and discussed, after showing the restrictions of the standard SETI procedures, such as the well-known Microwave Observing Project. An historical description of the first steps and scientific foundations of the SETV research is presented in detail, in particular: a) the first SETA (Search for Extraterrestrial Artifacts) theoretical studies and observational attempts that started at the end of the years -70; b) the theoretical concept of "interstellar migration" and the "diffusion equations" that, during the same years, were derived from a bio-astronomical application of stellar statistics and stellar evolution. Subsequently the main tasks and goals of the SETV project are introduced as they are conceived at the present time: the scientific search for robotic and/or inhabited probes that might be present both in the Solar System and on Earth. The possible reasons of interstellar migrations are discussed, together with propulsion systems that, according to most recent physics theories, might be employed to permit interstellar travel. A technical description of the necessary observational sensing devices of astrophysical kind, which are strategically and tactically intended to be employed to verify some theoretical predictions both in some critical areas of the Solar System and on Earth, is described. Concerning the possibility that space devices originated from exogenous intelligence too can visit Earth, the attention is drawn to some unknown aspects of still unexplained atmospheric anomalies. It is shown how a rigorous study of such anomalies can permit an important advancement in fundamental physics, which could come both from the understanding of the physical mechanism with which some (poorly understood so far) natural phenomena occur, and from the understanding of some exotic propulsion systems if they are produced by an extraterrestrial intelligence visiting our planet. The importance of studying the anomalies on Earth is to distinguish which ones of them might be possibly due to extraterrestrial intelligence, if this is really the case, and which ones are due to natural phenomena. The paper is accompanied with a rich bibliographic reference source concerning astronomy and physics general subjects, SETI, SETA, SETV, canonic (including Dyson theory) and exotic propulsion and transportation systems, and the physics of atmospheric anomalies.

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, Edward C. (Editor)

1991-01-01

A compilation is presented of articles on developments in programs managed by JPL's Office of Telecommunications and Data Acquisition. In space communications, radio navigation, radio science, and ground based radio and radar astronomy, activities of the Deep Space Network are reported in planning, in supporting research and technology, in implementation, and in operations. Also included is standards activity at JPL for space data and information systems and reimbursable DSN work performed for other space agencies through NASA. In the search for extraterrestrial intelligence (SETI), implementation and operations are reported for searching the microwave spectrum.

At what wavelengths should we search for signals from extraterrestrial intelligence?

PubMed Central

Townes, C. H.

1983-01-01

It has often been concluded that searches for extraterrestrial intelligence (SETI) should concentrate on attempts to receive signals in the microwave region, the argument being given that communication can occur there at minimum broadcasted power. Such a conclusion is shown to result only under a restricted set of assumptions. If generalized types of detection are considered—in particular, photon detection rather than linear detection alone—and if advantage is taken of the directivity of telescopes at short wavelengths, then somewhat less power is required for communication at infrared wavelengths than in the microwave region. Furthermore, a variety of parameters other than power alone may be chosen for optimization by an extraterrestrial civilization. Hence, while partially satisfying arguments may be given about optimal wavelengths for a search for signals from extraterrestrial intelligence, considerable uncertainty must remain. PMID:16593279

At what wavelengths should we search for signals from extraterrestrial intelligence?

PubMed

Townes, C H

1983-02-01

It has often been concluded that searches for extraterrestrial intelligence (SETI) should concentrate on attempts to receive signals in the microwave region, the argument being given that communication can occur there at minimum broadcasted power. Such a conclusion is shown to result only under a restricted set of assumptions. If generalized types of detection are considered-in particular, photon detection rather than linear detection alone-and if advantage is taken of the directivity of telescopes at short wavelengths, then somewhat less power is required for communication at infrared wavelengths than in the microwave region. Furthermore, a variety of parameters other than power alone may be chosen for optimization by an extraterrestrial civilization. Hence, while partially satisfying arguments may be given about optimal wavelengths for a search for signals from extraterrestrial intelligence, considerable uncertainty must remain.

SETI and the media: Views from inside and out

NASA Astrophysics Data System (ADS)

Tarter, Donald E.

Results are presented from a detailed questionnaire sent to members of the international SETI (Search for Extraterrestrial Intelligence) community and the international science media. Both groups are compared on the following dimensions: perceived importance of SETI, perceived level of information about SETI available to the media and public, perceived credibility of SETI, and attitudes toward information policy options to govern an announcement of a SETI discovery. The results indicate that SETI is perceived to be an extremely important endeavor, but it enjoys only marginal credibility among the public and the SETI community's professional constituencies. Both the SETI community and the media agree that an erroneous announcement of a discovery of extraterrestrial intelligence could be very damaging. In order to minimize the dangers of false announcement and to bring a degree of order to SETI, a scientific protocol agreement and the establishment of a contact verification committee have been recommended. Both received endorsement from the SETI community and the international science media. The science media feels that from its viewpoint, a contact verification committee would be a more effective way of assuring accurate information about SETI programs and discoveries.

Polyphase-discrete Fourier transform spectrum analysis for the Search for Extraterrestrial Intelligence sky survey

NASA Technical Reports Server (NTRS)

Zimmerman, G. A.; Gulkis, S.

1991-01-01

The sensitivity of a matched filter-detection system to a finite-duration continuous wave (CW) tone is compared with the sensitivities of a windowed discrete Fourier transform (DFT) system and an ideal bandpass filter-bank system. These comparisons are made in the context of the NASA Search for Extraterrestrial Intelligence (SETI) microwave observing project (MOP) sky survey. A review of the theory of polyphase-DFT filter banks and its relationship to the well-known windowed-DFT process is presented. The polyphase-DFT system approximates the ideal bandpass filter bank by using as few as eight filter taps per polyphase branch. An improvement in sensitivity of approx. 3 dB over a windowed-DFT system can be obtained by using the polyphase-DFT approach. Sidelobe rejection of the polyphase-DFT system is vastly superior to the windowed-DFT system, thereby improving its performance in the presence of radio frequency interference (RFI).

Intelligent signal analysis and recognition

NASA Technical Reports Server (NTRS)

Levinson, Robert; Helman, Daniel; Oswalt, Edward

1987-01-01

Progress in the research and development of self-organizing database system that can support the identification and characterization of signals in an RF environment is described. As the radio frequency spectrum becomes more crowded, there are a number of situations that require a characterization of the RF environment. This database system is designed to be practical in applications where communications and other instruments encounter a time varying and complex RF environment. The primary application of this system is the guidance and control of NASA's SETI Microwave Observing Project. Other possible applications include selection of telemety bands for communication with spacecraft, and the scheduling of antenna for radio astronomy are two examples where characterization of the RF environment is required. In these applications, the RF environment is constantly changing, and even experienced operators cannot quickly identify the multitude of signals that can be encountered. Some of these signals are repetitive, others appear to occur sporadically.

Radio Searches for Signatures of Advanced Extraterrestrial Life

NASA Astrophysics Data System (ADS)

Siemion, Andrew

Over the last several decades, observational astronomy has produced a flood of discoveries that suggest that the building blocks and circumstances that gave rise to life on Earth may be the rule rather than the exception. It has now been conclusively shown that planets are common and that some 5-15% of FGKM stars host planets existing in their host star's habitable zone. Further, terrestrial biology has demonstrated that life on our own planet can thrive in extraordinarily extreme environments, dramatically extending our notion of what constitutes habitability. The deeper question, yet unanswered, is whether or not life in any form has ever existed in an environment outside of the Earth. As humans, we are drawn to an even more profound question, that of whether or not extraterrestrial life may have evolved a curiosity about the universe similar to our own and the technology with which to explore it. Radio astronomy has long played a prominent role in searches for extraterrestrial intelligence (SETI), beginning with the first suggestions by Cocconi and Morrison (1959) that narrow-band radio signals near 1420 MHz might be effective tracers of advanced technology and early experiments along these lines by Frank Drake in 1961, continuing through to more recent investigations searching for several types of coherent radio signals indicative of technology at a wider range of frequencies. The motivations for radio searches for extraterrestrial intelligence have been throughly discussed in the literature, but the salient arguments are the following: 1. coherent radio emission is commonly produced by advanced technology (judging by Earth’s technological development), 2. electromagnetic radiation can convey information at the maximum velocity currently known to be possible, 3. radio photons are energetically cheap to produce, 4. certain types of coherent radio emissions are easily distinguished from astrophysical background sources, especially within the so-called ``terrestrial microwave window'' and 5. these emissions can transit vast regions of interstellar space relatively unaffected by gas, plasma and dust. Our group is conducting a variety of radio SETI at a wide range of frequencies, from 50 MHz to 230 GHz, using several facilities: the Dutch/European Low-Frequency Array (LOFAR), Arecibo Observatory, the Green Bank Telescope and the Combined Array for Research in Millimeter-wave Astronomy (CARMA). Our experiments employ a variety of strategies, including searches of nearby stars, stars with known exoplanets and the galactic center. We have also developed an observing pipeline that targets systems of multiple exoplanets at epochs in which two or more planets are aligned relative to Earth, which we have dubbed exoplanetary interplanetary communication (EPIC) SETI. Our detection algorithms are sensitive to a wide range of signal types, and we have developed numerous radio interference rejection techniques. Many of our experiments operate ``commensally'' with other science projects, providing thousands of hours of observations with the largest telescopes in the world. Here we present the status of our radio SETI efforts, discuss observations conducted to-date and review the various regions of parameter space probed by each experiment.

Studies of radio frequency interference at Parkes Observatory

NASA Astrophysics Data System (ADS)

Backus, Peter R.; Laroque, Sam; Tarter, Jill C.; Dreher, John; Gullers, Kent; Patrick, Alan; Heiligman, Gary

1997-01-01

From February through early June 1995, Project Phoenix conducted SETI observations of 209 stars over the frequency range from 1195 to 3005 MHz. A byproduct of this search is a unique data set suitable for studying the Radio Frequency Interference (RFI) environment at the Parkes 64-m telescope in New South Wales, Australia. RFI is an increasing problem for SETI and other radio astronomy observations conducted outside of the 'protected' frequency bands. The data analyzed for this paper were 'mean baseline' spectra in Left and Right Circular Polarization (LCP, RCP), integrated for either 138 or 276 s, covering a 10-MHz bandwidth with 15,552 channels at a resolution of 643 Hz. Channels were identified as contaminated by RFI when the power in the channel exceeded the mean noise by 3 percent. The 'spectral occupancy', the fraction of time RFI was seen, was determined for each channel. The RFI occupancy for LCP and RCP are distinctly different. Approximately 100 MHz of the spectrum was too heavily contaminated for SETI observations.

SETI as an educational tool

NASA Astrophysics Data System (ADS)

Vaile, R. A.

SETI offers an extraordinary catalyst in our search for a better education. While the glamour of movie images increased the general public awareness of the term "SETI", we are challenged to improve the level of public understanding of the fundamental scientific and technological issues involved in SETI. It is also critical to keep in mind the reality of human existence. No country seems entirely at peace, whether one considers cultural, trade, military, or heritage issues; no country seems content with the breadth and standards of education for following generations. However, SETI requires generations to participate across cultures, and this long-term human involvement must be sustained through both education and communication across many disciplines and different cultures. For both these major roles, SETI appears to offer a tantalising range and depth, both in educational tools, and in superb tests of communication skills. This paper considers the educational influence of roles evoked by SETI issues. We will briefly consider the range in expertise needed in SETI, the means of improving the public SETI awareness, and mechanisms through which such education may explore the consequences of any SETI result (whether judged as successful or not). Examples of the use of SETI in formal secondary and University education are briefly reviewed.

The Serendip piggyback SETI project

NASA Technical Reports Server (NTRS)

Lampton, Michael; Bowyer, Stuart; Werthimer, Dan; Donnelly, Charles; Herrick, Walter

1988-01-01

The Serendip project, an ongoing SETI program of monitoring and processing broadband radio signals acquired by existing radio astronomy observatories, are summarized. Serendip operates in a piggyback mode, making use of whatever observing plan is under way at its host observatory. The Serendip system at NRAO and the signature detection and identification techniques used by the project are described. The method used to reject terrestrial interference is discussed.

SETI at X-energies - parasitic searches from astrophysical observations.

NASA Astrophysics Data System (ADS)

Corbet, R. H. D.

1997-01-01

If a sufficiently advanced civilization can either modulate the emission from an X-ray binary, or make use of the natural high luminosity to power an artificial transmitter, these can serve as good beacons for interstellar communication without involving excessive energy costs to the broadcasting civilization. In addition, the small number of X-ray binaries in the Galaxy considerably reduces the number of targets that must be investigated compared to searches in other energy bands. Low mass X-ray binaries containing neutron stars in particular are considered as prime potential natural and artificial beacons and high time resolution (better than 1ms) observations are encouraged. All sky monitors provide the capability of detecting brief powerful artificial signals from isolated neutron stars. New capabilities of X-ray astronomy satellites developed for astrophysical purposes are enabling SETI in new parameter regimes. For example, the X-ray Timing Explorer satellite provides the capability of exploring the sub-millisecond region. Other planned X-ray astronomy satellites should provide significantly improved spectral resolution. While SETI at X-ray energies is highly speculative (and rather unfashionable) by using a parasitic approach little additional cost is involved. The inclusion of X-ray binaries in target lists for SETI at radio and other wavebands is also advocated.

SETI data controllers

NASA Technical Reports Server (NTRS)

Gosline, R. M.

1988-01-01

Three data controllers developed for the SETI project are described. Two are used primarily for recording and playback of SETI data from the Radio Science Surveillance System (RSSS). The third is used as a SETI station controller for DSS 13.

Computational problems and signal processing in SETI

NASA Technical Reports Server (NTRS)

Deans, Stanley R.; Cullers, D. K.; Stauduhar, Richard

1991-01-01

The Search for Extraterrestrial Intelligence (SETI), currently being planned at NASA, will require that an enormous amount of data (on the order of 10 exp 11 distinct signal paths for a typical observation) be analyzed in real time by special-purpose hardware. Even though the SETI system design is not based on maximum entropy and Bayesian methods (partly due to the real-time processing constraint), it is expected that enough data will be saved to be able to apply these and other methods off line where computational complexity is not an overriding issue. Interesting computational problems that relate directly to the system design for processing such an enormous amount of data have emerged. Some of these problems are discussed, along with the current status on their solution.

Mutual help in SETIs

NASA Astrophysics Data System (ADS)

Melia, F.; Frisch, D. H.

1985-06-01

Techniques to establish communication between earth and extraterrestrial intelligent beings are examined analytically, emphasizing that the success of searches for extraterrestrial intelligence (SETIs) depends on the selection by both sender and receiver of one of a few mutually helpful SETI strategies. An equation for estimating the probability that an SETI will result in the recognition of an ETI signal is developed, and numerical results for various SETI strategies are presented in tables. A minimum approach employing 10 40-m 20-kW dish antennas for a 30-yr SETI in a 2500-light-year disk is proposed.

Lick Observatory Optical SETI: targeted search and new directions.

PubMed

Stone, R P S; Wright, S A; Drake, F; Muñoz, M; Treffers, R; Werthimer, D

2005-10-01

Lick Observatory's Optical SETI (search for extraterrestrial intelligence) program has been in regular operation for 4.5 years. We have observed 4,605 stars of spectral types F-M within 200 light-years of Earth. Occasionally, we have appended objects of special interest, such as stars with known planetary systems. We have observed 14 candidate signals ("triple coincidences"), all but one of which are explained by transient local difficulties. Additional observations of the remaining candidate have failed to confirm arriving pulse events. We now plan to proceed in a more economical manner by operating in an unattended drift scan mode. Between operational and equipment modifications, efficiency will more than double.

Positive consequences of SETI before detection

NASA Astrophysics Data System (ADS)

Tough, A.

Even before a signal is detected, six positive consequences will result from the scientific search for extraterrestrial intelligence, usually called SETI. (1) Humanity's self-image: SETI has enlarged our view of ourselves and enhanced our sense of meaning. Increasingly, we feel a kinship with the civilizations whose signals we are trying to detect. (2) A fresh perspective: SETI forces us to think about how extraterrestrials might perceive us. This gives us a fresh perspective on our society's values, priorities, laws and foibles. (3) Questions: SETI is stimulating thought and discussion about several fundamental questions. (4) Education: some broad-gage educational programs have already been centered around SETI. (5) Tangible spin-offs: in addition to providing jobs for some people, SETI provides various spin-offs, such as search methods, computer software, data, and international scientific cooperation. (6) Future scenarios: SETI will increasingly stimulate us to think carefully about possible detection scenarios and their consequences, about our reply, and generally about the role of extraterrestrial communication in our long-term future. Such thinking leads, in turn, to fresh perspectives on the SETI enterprise itself.

Half a century of SETI in the USSR and Russia

NASA Astrophysics Data System (ADS)

Gindilis, Lev; Gurvits, Leonid

SETI studies in the USSR ascend back to the beginning of the 1960s. The stage for these studies have been set by the publication of the first edition of the book “The Universe, Life and Intelligence” by I.S. Shklovsky in 1962. Important milestones of early decades of the studies were the First All-Union Conference on extraterrestrial civilisations (Byurakan, 1964), the First International Symposium on CETI (Byurakan, 1971), the Zelenchukskaya Workshop (1975), Tallinn (1981) and Vilnius (1987) symposia, the Decennial US-USSR Conference on SETI (Santa Cruz, CA, 1991). The studies discussed at these forums ranged from developing criteria of “artificiality” of signals, analysing possible strategies of communication and broadcasting of messages on cosmic distances, methodology of search for artificial signals in various domains of the electro-magnetic spectrum, optimisation of frequency bands for search of and communication with ETI. A number of exploratory search projects have been conducted in radio and optical domains in the 1960s-80s. Theoretical studies were focused at developing optimal techniques for coding and decoding of interstellar messages, evaluation of astro-engineering dimension of the extraterrestrial intelligent activities, advancing philosophical aspects of the SETI problem. Later, in the 1990s and first decade of the third millennium, despite of general difficulties confronting scientific activities in Russia, SETI-oriented studies continued in the area of surveys of sun-like stars in Milky Way, search for Dyson spheres and optical signals with indications on artificiality. Several programmes of cosmic broadcasting were conducted too, including radio transmission toward selected stars. Serious re-thinking was given to incentives for passive and active involvement in SETI and CETI by cosmic civilisations. In our presentation, we will give a brief review of the past activities mentioned above and offer an outlook for further steps in advancing SETI. This outlook will be based on the advances of relevant scientific and technological areas, especially in astronomy. These developments are characterised by invention of new ultra-sensitive instruments and ability to process enormous amounts of experimental (observing) data, unthinkable in the recent past. All that would create a new basis for the continuation of SETI in the foreseeable future.

Amino acid sequence of a trypsin inhibitor from a Spirometra (Spirometra erinaceieuropaei).

PubMed

Sanda, A; Uchida, A; Itagaki, T; Kobayashi, H; Inokuchi, N; Koyama, T; Iwama, M; Ohgi, K; Irie, M

2001-12-01

A trypsin inhibitor that is highly homologous with bovine pancreatic trypsin inhibitor (BPTI) was co-purified along with RNase from Spirometra (Spirometra erinaceieuropaei). The amino acid sequence of this inhibitor (SETI) and the nucleotide sequence of the cDNA encoding this protein were determined by protein chemistry and gene technology. SETI contains 68 amino acid residues and has a molecular mass of 7,798 Da. SETI has 31 amino acid residues that are identical with BPTI's sequence, including 6 half-cystine and 5 aromatic amino acid residues. The active site Lys residue in BPTI is replaced by an Arg residue in SETI. SETI is an effective inhibitor of trypsin and moderately inhibits a-chymotrypsin, but less inhibits elastase or subtilisin. SETI was expressed by E. coli containing a PelB vector carrying the SETI encoding cDNA; an expression yield of 0.68 mg/l was obtained. The phylogenetic relationship of SETI and the other BPTI-like trypsin inhibitors was analyzed using most likelihood inference methods.

The windows of SETI--frequency and time in the search for extraterrestrial intelligence.

PubMed

Oliver, B M

1987-01-01

On Earth intelligent life evolved as a natural consequence of the events set in motion when the planet formed over 4 billion years ago. Since chemical evolution and solar-system formation appear to be occurring throughout the universe, we theorize that our universe may be rich with planets populated by intelligent beings who, like us, can search for evidence of other technological civilizations. Terrestrial civilization now has this capability. But if we do not begin the search soon, we'll lose the opportunity to do it from Earth as interfering signals of Earthly origin rapidly close the microwave window.

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, Edward C. (Editor)

1992-01-01

This quarterly publication provides archival reports on developments in programs managed by JPL's Telecommunications and Data Acquisition (TDA) Office. In the Search for Extraterrestrial Intelligence (SETI), the TDA Progress Report reports on implementation and operations for searching the microwave spectrum. In solar system radar, it reports on the uses of the Goldstone Solar System Radar for scientific exploration of the planets, their rings and satellites, asteroids, and comets. In radio astronomy, the areas of support include spectroscopy, very long baseline interferometry, and astrometry. These three programs are performed for NASA's Office of Space Science and Applications (OSSA) with the Office of Space Operations for funding DSN operational support.

SETI-ITALIA 2008: On-going searches and future prospects

NASA Astrophysics Data System (ADS)

Montebugnoli, S.; Bartolini, M.; Bianchi, G.; Cosmovici, C.; Monari, J.; Orlati, A.; Perini, F.; Pluchino, S.; Pupillo, G.; Salerno, E.; Schillirò, F.; Zoni, L.

2010-12-01

The Medicina Radioastronomical Station is located nearby Bologna, in Italy. It consists of two receiving antennas currently dedicated to the astronomical research at radio frequencies. The 32 m diameter parabolic dish performs observations from 1.4 to 22 GHz whereas the Northern Cross (a 30.000 m 2 wide T-shaped array transit antenna) works at 408 MHz. So far SETI observations have been performed using a SERENDIP IV high resolution spectrometer connected to the parabolic antenna. Data acquisition were performed meanwhile the antenna was employed in ordinary astronomical observations (piggy-back mode). An innovative method to search for possible extraterrestrial signals could be provided by using the UHF Northern Cross transit telescope. In this paper observational modalities and the required technological set-up are investigated.

Who are the SETI sceptics?

NASA Astrophysics Data System (ADS)

Ćirković, Milan M.

2013-08-01

Search for ExtraTerrestrial Intelligence (SETI) is now more than half a century old and has provoked enough discussion on technical, philosophical, and popular level, much of it critical. Historically, the criticism of SETI has been strong enough to heavily influence the course of research, so that there is a significant interest in discerning the nuances and fine points of critical argumentation. In this paper, I outline the two major forms of SETI scepticism, "fundamentalist" and "instrumentalist," which are often conflated in the published literature, both technical and popular. Precise delineation between these two types of scepticism is important for future research as a part of a wider taxonomic project, the build-up of SETI theory, as well as for smooth joining of SETI with the ongoing astrobiological revolution. Resolving the confusion in this respect is likely to lead to an improved atmosphere and heightened public image of future SETI searches and related activities.

The Order of the Dolphin: Origins of SETI

NASA Astrophysics Data System (ADS)

Temming, Maria; Crider, Anthony

2016-01-01

In 1961, the National Academy of Sciences organized a meeting on the search for extraterrestrial intelligence (SETI) at the National Radio Astronomy Observatory in Green Bank, West Virginia. The ten scientists who attended, including future SETI icons such as Frank Drake and Carl Sagan, represented a variety of scientific fields. At the conclusion of the meeting, the attendees adopted the moniker "The Order of the Dolphin," in honor of participant John Lilly's work on interspecies communication. Since this seminal meeting, researchers in each of the attendees' fields have contributed in some way to the search for intelligent life. This study investigates the circumstances that led to each attendee's invitation to Green Bank and explores SETI as the legacy of this meeting. We will focus in this talk on the SETI connections of two attendees, astronomer Otto Struve and physicist Philip Morrison, both in regards to their personal contributions to SETI and the influence of their work on subsequent SETI research. Specifically, we will examine proposals by Otto Struve for exoplanet discovery methods, and Philip Morrison for radio searches that laid the groundwork for modern SETI.

Searching for ET with Help from Three Million Volunteers: The SETI@Home, Serendip, Sevendip and Spck SETI Programs

NASA Astrophysics Data System (ADS)

Werthimer, Dan; Anderson, David; Bowyer, Stuart; Cobb, Jeff; Demorest, Paul

2002-01-01

We summarize results from two radio and two optical SETI programs based at the University of California, Berkeley. We discuss the most promising candidate signals from these searches and present plans for future SETI searches, including SERENDIP V and SETI@home II. The ongoing SERENDIP sky survey searches for radio signals at the 300 meter Arecibo Observatory. SERENDIP IV uses a 168 million channel spectrum analyser and a dedicated receiver to take data 24 hours a day, year round. The sky survey covers a 100 MHz band centered at the 21 cm line (1420 MHz) and declinations from -2 to +38 degrees. SETI@home uses desktop computers of 3.5 million volunteers to analyse 50 Terabytes of data taken at Arecibo. The SETI@home sky survey is 10 times more sensitive and searches a much wider variety of signal types than SERRENDIP IV but covers only a 2.5 MHz band. SETI@home is the planet's largest supercomputer, averaging 25 Tflops. SETI@home participants have contributed over a million years of computing time so far. The SEVENDIP optical pulse search looks for nS time scale pulses at optical wavelengths. It utilizes an automated 30 inch telescope, three ultra fast photo multiplier tubes and a coincidence detector. The target list includes F,G,K and M stars, globular cluster and galaxies. The SPOCK optical SETI program searches for narrow band continuous signals using spectra taken by Marcy and his colleagues in their planet search at Keck observatory.

Dysonian SETI as a "Shortcut" to Detecting Habitable Planets

NASA Astrophysics Data System (ADS)

Wright, J. T.

2016-12-01

The search for habitable planets is ultimately motivated by the search for inhabited planets. On Earth, the most telling signature of life is that of humanity's technology. The Search for Extraterrestrial Intelligence (SETI) is thus the "ultimate" search for habitable planets.In 1960 two seminal papers in SETI were published, providing two visions for SETI. Giuseppe Cocconi and Philip Morrison's proposed detecting deliberate radio signals ("communication SETI"), while Freeman Dyson ("artifact SETI"), proposed detecting the inevitable effects of massive energy supplies and artifacts on their surroundings. While communication SETI has now had many career-long practitioners and major efforts, artifact SETI has, until recently, not been a vibrant field of study. The launch of the Kepler and WISE satellites have greatly renewed interest in the field, however, and the recent Breakthrough Listen Initiative has provided new motivation for finding good targets for communication SETI. I will discuss the progress of the Ĝ Search for Extraterrestrial Civilizations with Large Energy Supplies, including its justification and motivation, waste heat search strategy and first results, and the framework for a search for megastructures via transit light curves. The last of these led to the identification of KIC 8462852 (a.k.a. "Tabby's Star") as a candidate ETI host. This star, discovered by Boyajian and the Zooniverse Planet Hunters, exhibits several apparently unique and so-far unexplained photometric properties, and continues to confound natural explanation.

An Opportunistic Search for Extraterrestrial Intelligence (SETI) with the Murchison Widefield Array

NASA Astrophysics Data System (ADS)

Tingay, S. J.; Tremblay, C.; Walsh, A.; Urquhart, R.

2016-08-01

A spectral line image cube generated from 115 minutes of MWA data that covers a field of view of 400 sq, deg. around the Galactic Center is used to perform the first Search for ExtraTerrestrial Intelligence (SETI) with the Murchison Widefield Array (MWA). Our work constitutes the first modern SETI experiment at low radio frequencies, here between 103 and 133 MHz, paving the way for large-scale searches with the MWA and, in the future, the low-frequency Square Kilometre Array. Limits of a few hundred mJy beam-1 for narrowband emission (10 kHz) are derived from our data, across our 400 sq. deg. field of view. Within this field, 45 exoplanets in 38 planetary systems are known. We extract spectra at the locations of these systems from our image cube to place limits on the presence of narrow line emission from these systems. We then derive minimum isotropic transmitter powers for these exoplanets; a small handful of the closest objects (10 s of pc) yield our best limits of order 1014 W (Equivalent Isotropic Radiated Power). These limits lie above the highest power directional transmitters near these frequencies currently operational on Earth. A SETI experiment with the MWA covering the full accessible sky and its full frequency range would require approximately one month of observing time. The MWA frequency range, its southern hemisphere location on an extraordinarily radio quiet site, its very large field of view, and its high sensitivity make it a unique facility for SETI.

Kardashev's Classification at 50+: A Fine Vehicle With Room for Improvement

NASA Astrophysics Data System (ADS)

Ćirković, M. M.

2015-12-01

We review the history and status of the famous classification of extraterrestrial civilizations given by the great Russian astrophysicist Nikolai Semenovich Kardashev, roughly half a century after it has been proposed. While Kardashev's classification (or Kardashev's scale) has often been seen as oversimplified, and multiple improvements, refinements, and alternatives to it have been suggested, it is still one of the major tools for serious theoretical investigation of SETI issues. During these 50+ years, several attempts at modifying or reforming the classification have been made; we review some of them here, together with presenting some of the scenarios which present difficulties to the standard version. Recent results in both theoretical and observational SETI studies, especially the {Ĝ infrared survey (2014-2015), have persuasively shown that the emphasis on detectability inherent in Kardashev's classification obtains new significance and freshness. Several new movements and conceptual frameworks, such as the Dysonian SETI, tally extremely well with these developments. So, the apparent simplicity of the classification is highly deceptive: Kardashev's work offers a wealth of still insufficiently studied methodological and epistemological ramifications and it remains, in both letter and spirit, perhaps the worthiest legacy of the SETI "founding fathers".

A near-infrared SETI experiment: instrument overview

NASA Astrophysics Data System (ADS)

Wright, Shelley A.; Werthimer, Dan; Treffers, Richard R.; Maire, Jérôme; Marcy, Geoffrey W.; Stone, Remington P. S.; Drake, Frank; Meyer, Elliot; Dorval, Patrick; Siemion, Andrew

2014-07-01

We are designing and constructing a new SETI (Search for Extraterrestrial Intelligence) instrument to search for direct evidence of interstellar communications via pulsed laser signals at near-infrared wavelengths. The new instrument design builds upon our past optical SETI experiences, and is the first step toward a new, more versatile and sophisticated generation of very fast optical and near-infrared pulse search devices. We present our instrumental design by giving an overview of the opto-mechanical design, detector selection and characterization, signal processing, and integration procedure. This project makes use of near-infrared (950 - 1650 nm) discrete amplification Avalanche Photodiodes (APD) that have > 1 GHz bandwidths with low noise characteristics and moderate gain (~104). We have investigated the use of single versus multiple detectors in our instrument (see Maire et al., this conference), and have optimized the system to have both high sensitivity and low false coincidence rates. Our design is optimized for use behind a 1m telescope and includes an optical camera for acquisition and guiding. A goal is to make our instrument relatively economical and easy to duplicate. We describe our observational setup and our initial search strategies for SETI targets, and for potential interesting compact astrophysical objects.

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, E. C. (Editor)

1990-01-01

Archival reports are given on developments in programs managed by JPL's Office of Telecommunications and Data Acquisition (TDA), including space communications, radio navigation, radio science, ground-based radio and radar astronomy, and the Deep Space Network (DSN) and its associated Ground Communications Facility (GCF) in planning, supporting research and technology, implementation, and operations. Also included is TDA-funded activity at JPL on data and information systems and reimbursable DSN work performed for other space agencies through NASA. In the search for extraterrestrial intelligence (SETI), implementation and operations for searching the microwave spectrum are reported. Use of the Goldstone Solar System Radar for scientific exploration of the planets, their rings and satellites, asteroids, and comets are discussed.

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, Edward C. (Editor)

1992-01-01

Archival reports on developments in programs managed by the Jet Propulsion Laboratory's (JPL's) Office of Telecommunications and Data Acquisition (TDA) are published in the TDA Progress Report. In the search for extraterrestrial intelligence (SETI), the TDA Progress Report reports on implementation and operations for searching the microwave spectrum. In solar system radar, it reports on the uses of the Goldstone Solar System Radar for scientific exploration of the planets, their rings and satellites, asteroids, and comets. In radio astronomy, the areas of support include spectroscopy, very long baseline interferometry, and astrometry. These three programs are performed for NASA's Office of Space Science and Applications (OSSA), with the Office of Space Operations funding DSN operational support.

SETI-Italia 2003 status report and first results of a KL transform algorithm for ETI signal detection

NASA Astrophysics Data System (ADS)

Montebugnoli, S.; Bortolotti, C.; Cattani, A.; Maccaferri, A.; Orlati, A.; Poloni, M.; Poppi, S.; Monari, J.; Roma, M.; Pari, P. P.; Teodorani, M.; Righini, S.; Maccone, C.; Caliendo, D.; Cosmovici, C. B.; D'Amico, N.

2006-02-01

SETI-Italia is the Italian national SETI Program. It is run as a part of the Italian Bioastronomy Project, by IRA (Istituto di Radioastronomia) a subsidiary of the Istituto Nazionale di Astrofisica. At the moment, Italy is the only European country conducting a continuous SETI “listening” program, while occasional SETI searches may be conducted in France and the Ukraine. Outside Europe, continuous SETI programs are conducted in the USA, Australia and Argentina. The SETI-Italia activities started early in 1998 with a Serendip IV system connected in piggy-back mode to the Medicina VLBI 32-m antenna dish. In the years 2002/2003, considerable efforts were devoted to set up a fast computational system capable of computing the KLT (Karhunen Loève transform). This is a virtually new mathematical procedure in SETI, and is much more general than the FFT. It can search for the presence of signals both narrow-band and wide-band embedded in noise both coloured and white. The mathematical features the KLT have already been described in this Conference by Claudio Maccone [Innovative SETI by the KLT, Pešek Lecture 2003, paper # IAA.9.1.01 presented in Bremen, in this 2003 International Astronautical Congress [1]; Telecommunications, KLT and Relativity, vol. 1, IPI Press, Colorado Springs, CO, 1994, ISBN #1-880930-04-8 [2].]. Our software implementation of the KLT follows these lines and also is indebted to some basic ideas put forward by Robert S. Dixon [On the detection of unknown signals, in: G. Seth Shostak (Ed.), Third Decennial US USSR Conference on SETI, Astronomical Society of the Pacific Conference Series, vol. 47, 1993, pp. 128 140] of the Ohio State Radio Observatory as early as 1993.

Project Phoenix and beyond. Pesek Lecture.

PubMed

Tarter, J

1997-01-01

Although there are no federally funded projects at this time, SETI (the search for extraterrestrial intelligence) is a vigorous exploratory science. There are currently eight observational programs on telescopes around the world, of which the Phoenix Project is the most comprehensive. Most of these projects are rooted in the conclusions of the pioneering studies of the early 1970's that are summarized in the Cyclops Report. Technology has experienced an exponential growth over the past two and a half decades. It is reasonable to reassess the Cyclops conclusions as SETI enters the next century. Listening for radio signals is still the preferred method of searching, however new technologies are making searches at other wavelengths possible and are modifying the ways in which the radio searches can and should be conducted. It may be economically feasible to undertake the construction of very large telescopes that can simultaneously provide multiple beams on the sky for use by SETI and the radioastronomy community.

A Scheme for Targeting Optical SETI Observations

NASA Astrophysics Data System (ADS)

Shostak, Seth

2004-06-01

In optical SETI (OSETI) experiments, it is generally assumed that signals will be deliberate, narrowly targeted beacons sent by extraterrestrial societies to large numbers of candidate star systems. If this is so, then it may be unrealistic to expect a high duty cycle for the received signal. Ergo, an advantage accrues to any OSETI scheme that realistically suggests where and when to search. In this paper, we elaborate a proposal (Castellano, Doyle, &McIntosh 2000) for selecting regions of sky for intensive optical SETI monitoring based on characteristics of our solar system that would be visible at great distance. This can enormously lessen the amount of sky that needs to be searched. In addition, this is an attractive approach for the transmitting society because it both increases the chances of reception and provides a large reduction in energy required. With good astrometric information, the transmitter need be no more powerful than an automobile tail light.

Pesek lecture project Phoenix and beyond

NASA Astrophysics Data System (ADS)

Tarter, Jill

Although there are no federally funded projects at this time, SETI (the search for extraterrestrial intelligence) is a vigorous exploratory science. There are currently eight observational programs on telescopes around the world, of which the Phoenix Project is the most comprehensive. Most of these projects are rooted in the conclusions of the pioneering studies of the early 1970's that are summarized in the Cyclops Report1. Technology has experienced an exponential growth over the past two and a half decades. It is reasonable to reassess the Cyclops conclusions as SETI enters the next century. Listening for radio signals is still the preferred method of searching, however new technologies are making searches at other wavelengths possible and are modifying the ways in which the radio searches can and should be conducted. It may be economically feasible to undertake the construction of very large telescopes that can simultaneously provide multiple beams on the sky for use by SETI and the radioastronomy community.

Risk and value analysis of SETI

NASA Technical Reports Server (NTRS)

Billingham, J.

1990-01-01

This paper attempts to apply a traditional risk and value analysis to the Search for Extraterrestrial Intelligence--SETI. In view of the difficulties of assessing the probability of success, a comparison is made between SETI and a previous search for extraterrestrial life, the biological component of Project Viking. Our application of simple Utility Theory, given some reasonable assumptions, suggests that SETI is at least as worthwhile as the biological experiment on Viking.

Risk and value analysis of SETI.

PubMed

Billingham, J

1990-01-01

This paper attempts to apply a traditional risk and value analysis to the Search for Extraterrestrial Intelligence--SETI. In view of the difficulties of assessing the probability of success, a comparison is made between SETI and a previous search for extraterrestrial life, the biological component of Project Viking. Our application of simple Utility Theory, given some reasonable assumptions, suggests that SETI is at least as worthwhile as the biological experiment on Viking.

Project PHOENIX SETI Observations at Parkes

NASA Astrophysics Data System (ADS)

Backus, P. R.

1995-12-01

For sixteen weeks (February to June of 1995), Project Phoenix had the exclusive use of the 64 m Parkes radio telescope in New South Wales, Australia, as well as another element of the Australian Telescope National Facility (ATNF), the 22 m Mopra telescope, 200 km to the north at Coonabarabran. With these two telescopes, we conducted a targeted search of nearly two hundred solar-type stars covering the frequency range from 1.2 to 3 GHz. The signal detection system was optimized to detect narrowband signals (presumed to be transmitted by another technological civilization) originating in the vicinity of these targets. The system was sensitive to signals that were continuously present, or pulsed regularly, even if their frequencies drifted, or changed slowly in time. Many signals of precisely this nature were detected, but all were coming from our own technology! All manner of transmitters, from microwave ovens to satellite downlinks, are rapidly making this naturally quiet portion of the electromagnetic spectrum extremely noisy. The use of the two widely separated telescopes as a pseudo-interferometer was essential to discriminate against signals of terrestrial origin. The architecture and performance of the system and the results of the observing campaign are presented in this paper.

Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

PubMed

Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

2006-02-01

Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

AN OPPORTUNISTIC SEARCH FOR EXTRATERRESTRIAL INTELLIGENCE (SETI) WITH THE MURCHISON WIDEFIELD ARRAY

DOE Office of Scientific and Technical Information (OSTI.GOV)

Tingay, S. J.; Tremblay, C.; Walsh, A.

A spectral line image cube generated from 115 minutes of MWA data that covers a field of view of 400 sq, deg. around the Galactic Center is used to perform the first Search for ExtraTerrestrial Intelligence (SETI) with the Murchison Widefield Array (MWA). Our work constitutes the first modern SETI experiment at low radio frequencies, here between 103 and 133 MHz, paving the way for large-scale searches with the MWA and, in the future, the low-frequency Square Kilometre Array. Limits of a few hundred mJy beam{sup −1} for narrowband emission (10 kHz) are derived from our data, across our 400more » sq. deg. field of view. Within this field, 45 exoplanets in 38 planetary systems are known. We extract spectra at the locations of these systems from our image cube to place limits on the presence of narrow line emission from these systems. We then derive minimum isotropic transmitter powers for these exoplanets; a small handful of the closest objects (10 s of pc) yield our best limits of order 10{sup 14} W (Equivalent Isotropic Radiated Power). These limits lie above the highest power directional transmitters near these frequencies currently operational on Earth. A SETI experiment with the MWA covering the full accessible sky and its full frequency range would require approximately one month of observing time. The MWA frequency range, its southern hemisphere location on an extraordinarily radio quiet site, its very large field of view, and its high sensitivity make it a unique facility for SETI.« less

SETI reloaded: Next generation radio telescopes, transients and cognitive computing

NASA Astrophysics Data System (ADS)

Garrett, Michael A.

2015-08-01

The Search for Extra-terrestrial Intelligence (SETI) using radio telescopes is an area of research that is now more than 50 years old. Thus far, both targeted and wide-area surveys have yet to detect artificial signals from intelligent civilisations. In this paper, I argue that the incidence of co-existing intelligent and communicating civilisations is probably small in the Milky Way. While this makes successful SETI searches a very difficult pursuit indeed, the huge impact of even a single detection requires us to continue the search. A substantial increase in the overall performance of radio telescopes (and in particular future wide-field instruments such as the Square Kilometre Array - SKA), provide renewed optimism in the field. Evidence for this is already to be seen in the success of SETI researchers in acquiring observations on some of the world's most sensitive radio telescope facilities via open, peer-reviewed processes. The increasing interest in the dynamic radio sky, and our ability to detect new and rapid transient phenomena such as Fast Radio Bursts (FRB) is also greatly encouraging. While the nature of FRBs is not yet fully understood, I argue they are unlikely to be the signature of distant extra-terrestrial civilisations. As astronomers face a data avalanche on all sides, advances made in related areas such as advanced Big Data analytics, and cognitive computing are crucial to enable serendipitous discoveries to be made. In any case, as the era of the SKA fast approaches, the prospects of a SETI detection have never been better.

Observational Research on Star and Planetary System Formation

NASA Technical Reports Server (NTRS)

Simpson, Janet P.

1998-01-01

Institute scientists collaborate with a number of NASA Ames scientists on observational studies of star and planetary system formation to their mutual benefit. As part of this collaboration, SETI scientists have, from 1988 to the present: (1) contributed to the technical studies at NASA Ames of the Stratospheric Observatory for Infrared Astronomy (SOFIA), an infrared 2.5 meter telescope in a Boeing 747, which will replace the Kuiper Airborne Observatory (KAO), a 0.9 meter telescope in a Lockheed C-141. SOFIA will be an important facility for the future exploration of the formation of stars and planetary systems, and the origins of life, and as such will be an important future facility to SETI scientists; (2) worked with the Laboratory Astrophysics Group at Ames, carrying out laboratory studies of the spectroscopic properties of ices and pre-biotic organics, which could be formed in the interstellar or interplanetary media; (3) helped develop a photometric approach for determining the Frequency of Earth-Sized Inner Planets (FRESIP) around solar-like stars, a project (now called Kepler) which complements the current efforts of the SETI Institute to find evidence for extraterrestrial intelligence; and (4) carried out independent observational research, in particular research on the formation of stars and planetary systems using both ground-based telescopes as well as the KAO.

Observational Research on Star and Planetary System Formation

NASA Astrophysics Data System (ADS)

Simpson, Janet P.

1998-07-01

Institute scientists collaborate with a number of NASA Ames scientists on observational studies of star and planetary system formation to their mutual benefit. As part of this collaboration, SETI scientists have, from 1988 to the present: (1) contributed to the technical studies at NASA Ames of the Stratospheric Observatory for Infrared Astronomy (SOFIA), an infrared 2.5 meter telescope in a Boeing 747, which will replace the Kuiper Airborne Observatory (KAO), a 0.9 meter telescope in a Lockheed C-141. SOFIA will be an important facility for the future exploration of the formation of stars and planetary systems, and the origins of life, and as such will be an important future facility to SETI scientists; (2) worked with the Laboratory Astrophysics Group at Ames, carrying out laboratory studies of the spectroscopic properties of ices and pre-biotic organics, which could be formed in the interstellar or interplanetary media; (3) helped develop a photometric approach for determining the Frequency of Earth-Sized Inner Planets (FRESIP) around solar-like stars, a project (now called Kepler) which complements the current efforts of the SETI Institute to find evidence for extraterrestrial intelligence; and (4) carried out independent observational research, in particular research on the formation of stars and planetary systems using both ground-based telescopes as well as the KAO.

The SERENDIP 2 SETI project: Current status

NASA Technical Reports Server (NTRS)

Bowyer, C. S.; Werthimer, D.; Donnelly, C.; Herrick, W.; Lampton, M.

1991-01-01

Over the past 30 years, interest in extraterrestrial intelligence has progressed from philosophical discussion to rigorous scientific endeavors attempting to make contact. Since it is impossible to assess the probability of success and the amount of telescope time needed for detection, Search for Extraterrestrial Intelligence (SETI) Projects are plagued with the problem of attaining the large amounts of time needed on the world's precious few large radio telescopes. To circumvent this problem, the Search for Extraterrestrial Radio Emissions from Nearby Developed Intelligent Populations (SERENDIP) instrument operates autonomously in a piggyback mode utilizing whatever observing plan is chosen by the primary observer. In this way, large quantities of high-quality data can be collected in a cost-effective and unobtrusive manner. During normal operations, SERENDIP logs statistically significant events for further offline analysis. Due to the large number of terrestrial and near-space transmitters on earth, a major element of the SERENDIP project involves identifying and rejecting spurious signals from these sources. Another major element of the SERENDIP Project (as well as most other SETI efforts) is detecting extraterrestrial intelligence (ETI) signals. Events selected as candidate ETI signals are studied further in a targeted search program which utilizes between 24 to 48 hours of dedicated telescope time each year.

Imaging the Alien - The Portrayal of Extraterrestrial Intelligence and SETI in Science Fiction

NASA Astrophysics Data System (ADS)

Baxter, S.

Concepts of extraterrestrial intelligence as explored in science fiction are reviewed. In particular, modern fiction based on the scenarios envisaged in SETI methodologies is described. The intention is to help make this work accessible to specialists such as the SETI and astrobiology communities. While SF is primarily fiction and is meant to entertain, the more thoughtful of such works may serve as a bank of thought experiments to assist in the development of future SETI strategies and policies.

SETI with Help from Five Million Volunteers: The Berkeley SETI Efforts

NASA Astrophysics Data System (ADS)

Korpela, E. J.; Anderson, D. P.; Bankay, R.; Cobb, J.; Foster, G.; Howard, A.; Lebofsky, M.; Marcy, G.; Parsons, A.; Siemion, A.; von Korff, J.; Werthimer, D.; Douglas, K. A.

2009-12-01

We summarize radio and optical SETI programs based at the University of California, Berkeley. The ongoing SERENDIP V sky survey searches for radio signals at the 300 meter Arecibo Observatory. The currently installed configuration supports 128 million channels over a 200 MHz bandwidth with 1.6 Hz spectral resolution. Frequency stepping allows the spectrometer to cover the full 300 MHz band of the Arecibo L-band receivers. The final configuration will allow data from all 14 receivers in the Arecibo L-band Focal Array to be monitored simultaneously with over 1.8 billion simultaneous channels. SETI@home uses desktop computers volunteers to analyze over 100 TB of at taken at Arecibo. Over 5 million volunteers have run SETI@home during its 10 year history. The SETI@home sky survey is 10 times more sensitive than SERENDIP V but it covers only a 2.5 MHz band, centered on 1420 MHz. SETI@home searches a much wider parameter space, including 14 octaves of signal bandwidth and 15 octaves of pulse period with Doppler drift corrections from -100 Hz/s to +100 Hz/s. The ASTROPULSE project is the first SETI search for μs time scale pulses in the radio spectrum. Because short pulses are dispersed by the interstellar medium, and amount of dispersion is unknown, ASTROPULSE must search through 30,000 possible dispersions. Substantial computing power is required to conduct this search, so the project will use volunteers and their personal computers to carry out the computation (using distributed computing similar to SETI@home). The SEVENDIP optical pulse search looks for ns time scale pulses at visible wavelengths. It utilizes an automated 30 inch telescope, three ultra fast photo multiplier tubes and a coincidence detector. The target list includes F,G,K and M stars, globular cluster and galaxies.

Design for minimum energy in interstellar communication

NASA Astrophysics Data System (ADS)

Messerschmitt, David G.

2015-02-01

Microwave digital communication at interstellar distances is the foundation of extraterrestrial civilization (SETI and METI) communication of information-bearing signals. Large distances demand large transmitted power and/or large antennas, while the propagation is transparent over a wide bandwidth. Recognizing a fundamental tradeoff, reduced energy delivered to the receiver at the expense of wide bandwidth (the opposite of terrestrial objectives) is advantageous. Wide bandwidth also results in simpler design and implementation, allowing circumvention of dispersion and scattering arising in the interstellar medium and motion effects and obviating any related processing. The minimum energy delivered to the receiver per bit of information is determined by cosmic microwave background alone. By mapping a single bit onto a carrier burst, the Morse code invented for the telegraph in 1836 comes closer to this minimum energy than approaches used in modern terrestrial radio. Rather than the terrestrial approach of adding phases and amplitudes increases information capacity while minimizing bandwidth, adding multiple time-frequency locations for carrier bursts increases capacity while minimizing energy per information bit. The resulting location code is simple and yet can approach the minimum energy as bandwidth is expanded. It is consistent with easy discovery, since carrier bursts are energetic and straightforward modifications to post-detection pattern recognition can identify burst patterns. Time and frequency coherence constraints leading to simple signal discovery are addressed, and observations of the interstellar medium by transmitter and receiver constrain the burst parameters and limit the search scope.

The Search for Extraterrestrial Intelligence (SETI)

NASA Astrophysics Data System (ADS)

Tarter, Jill

The search for evidence of extraterrestrial intelligence is placed in the broader astronomical context of the search for extrasolar planets and biomarkers of primitive life elsewhere in the universe. A decision tree of possible search strategies is presented as well as a brief history of the search for extraterrestrial intelligence (SETI) projects since 1960. The characteristics of 14 SETI projects currently operating on telescopes are discussed and compared using one of many possible figures of merit. Plans for SETI searches in the immediate and more distant future are outlined. Plans for success, the significance of null results, and some opinions on deliberate transmission of signals (as well as listening) are also included. SETI results to date are negative, but in reality, not much searching has yet been done.

Dysonian Approach to SETI: A Fruitful Middle Ground?

NASA Astrophysics Data System (ADS)

Bradbury, R. J.; Cirkovic, M. M.; Dvorsky, G.

We critically assess the prevailing currents in the Search for Extraterrestrial Intelligence (SETI), embodied in the notion of radio-searches for intentional artificial signals as envisioned by pioneers such as Frank Drake, Philip Morrison, Michael Papagiannis and others. In particular, we emphasize (1) the necessity of integrating SETI into a wider astrobiological and future studies context, (2) the relevance of and lessons to be learnt from the anti-SETI arguments, in particular Fermi's paradox, and (3) a need for complementary approach which we dub the Dysonian SETI. It is meaningfully derived from the inventive and visionary ideas of Freeman J. Dyson and his imaginative precursors, like Konstantin E. Tsiolkovsky, Olaf Stapledon, Nikola Tesla or John B. S. Haldane, who suggested macro-engineering projects as the focal points in the context of extrapolations about the future of humanity and, by analogy, other intelligent species. We consider practical ramifications of the Dysonian SETI and indicate some of the promising directions for future work.

Five Years of SETI with the Allen Telescope Array: Lessons Learned

NASA Astrophysics Data System (ADS)

Harp, Gerald

2016-01-01

We discuss recent observations at the Allen Telescope Array (ATA) supporting a wide ranging Search for Extraterrestrial Intelligence (SETI). The ATA supports observations over the frequency range 1-10 GHz with three simultaneous phased array beams used in an anticoincidence detector for false positive rejection. Here we summarize observational results over the years 2011-2015 covering multiple campaigns of exoplanet stars, the galactic plane, infrared excess targets, etc. Approximately 2 x 108 signals were identified and classified over more than 5000 hours of observation. From these results we consider various approaches to the rapid identification of human generated interference in the process of the search for a signal with origins outside the radius of the Moon's orbit. We conclude that the multi-beam technique is superb tool for answering the very difficult question of the direction of origin of signals. Data-based simulations of future instruments with more than 3 beams are compared.

Goldstone field test activities: Target search

NASA Technical Reports Server (NTRS)

Tarter, J.

1986-01-01

In March of this year prototype SETI equipment was installed at DSS13, the 26 meter research and development antenna at NASA's Goldstone complex of satellite tracking dishes. The SETI equipment will remain at this site at least through the end of the summer so that the hardware and software developed for signal detection and recognition can be fully tested in a dynamic observatory environment. The field tests are expected to help understand which strategies for observing and which signal recognition algorithms perform best in the presence of strong man-made interfering signals (RFI) and natural astronomical sources.

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, E. C. (Editor)

1992-01-01

Archival reports on developments in programs managed by JPL's Office of Telecommunications and Data Acquisition (TDA) are provided. In space communications, radio navigation, radio science, and ground-based radio and radar astronomy, it reports on activities of the Deep Space Network (DSN) in planning, in supporting research and technology, in implementation, and in operations. Also included is standards activity at JPL for space data and information. In the search for extraterrestrial intelligence (SETI), the TDA Progress Report reports on implementation and operations for searching the microwave spectrum. Topics covered include tracking and ground-based navigation; communications, spacecraft-ground; station control and system technology; capabilities for new projects; network upgrade and sustaining; network operations and operations support; and TDA program management and analysis.

From Ozma to Cyclops: The Beginnings of American SETI, 1959-70

NASA Astrophysics Data System (ADS)

Sullivan, W. T.

2002-12-01

The modern era in SETI (Search for Extraterrstrial Intelligence) began with two independent proposals in the late 1950s. In 1959 Phillip Morrison and Guiseppe Cocconi at Cornell published a short theoretical paper in ``Nature," while simultaneously Frank Drake at the brand-new NRAO in West Virginia developed a receiver for the first radio observations, called Project Ozma. In 1960 Drake monitored two nearby solar-like stars, Tau Ceti and Epsilon Eridani, for several months with a scanning one-channel radiometer at 21-cm on an 85-ft diameter dish. Drake's interest, along with that of his boss Otto Struve, then led to a remarkable small meeting at Green Bank in 1961, at which time the Drake Equation was first put forth as an organizing concept for estimating the possible number of extraterrestrial civilizations. The next milestone was the appearance of ``Intelligent Life in the Universe" by Iosif Shklovsky and Carl Sagan (1966), which widely circulated the idea of SETI. The growth of NASA's exobiology program (although primarily focused on microbial life and the origin of life) throughout the 1960s also legitimized the field and culminated in the Viking mission to Mars in 1976. In 1970 NASA sponsored a large summer workshop charged with the task of designing a feasible radio telescope for SETI. The resulting report, ``Project Cyclops: A Design Study of a System for Detecting Extraterrestrial Intelligent Life" (1971), was the first detailed look at all aspects of the problem, and set the tone for future NASA involvement in SETI. This talk will briefly cover this history, in particular the radio astronomy aspects, and will include a portion of a tape recording of a talk given by Drake in 1960 even as Project Ozma was in progress.

SETI-3: the Search for ExtraTerrestrial Intelligence. A selection of papers from 1987-1990 Symposia of the International Academy of Astronautics held during the 38th-41st Congress (Brighton, Bangalore, Malaga, Dresden) of the International Astronautical Federation.

PubMed

1992-01-01

This special issue of Acta Astronautica is a compilation of selected papers presented at Review Meetings on SETI at the 1987-1990 International Academy of Astronautics Congresses. Papers are drawn from seven areas: bioastronomical context, SETI technology, SETI searches, radio frequency interferences, possibilities for newer instrumentation, interdisciplinary connections, and public relations. Two papers presented at the Pesek Lecture are included.

The Breakthrough Listen Search for Intelligent Life: the first SETI results and other future science.

NASA Astrophysics Data System (ADS)

Enriquez, J. Emilio; Breakthrough Listen Team

2018-01-01

The Breakthrough Listen (BL) Initiative is the largest campaign in human history on the search for extraterrestrial intelligence. The work presented here is the first BL search for engineered signals. This comprises a sample of 692 nearby stars within 50 pc. We used the Green Bank Telescope (GBT) to conduct observations over 1.1-1.9 GHz (L-band). Our observing strategy allows us to reject most of the detected signals as terrestrial interference. During the analysis, eleven stars show events that passed our thresholding algorithm, but detailed analysis of their properties indicates they are consistent with known examples of anthropogenic radio frequency interference. This small number of false positives and their understood properties give confidence on the techniques used for this search. We conclude that, at the time of our observations none of the observed systems host high-duty-cycle radio transmitters emitting at the observed frequencies with an EIRP of 10^13 W, readily achievable by our own civilization.We can place limits on the presence of engineered signals from putative extraterrestrial civilizations inhabiting the environs of the target stars. Our results suggest that fewer than ~0.1% of the stellar systems within 50 pc possess the type of transmitters searched in this survey. This work provides the most stringent limit on the number of low power radio transmitters around nearby stars to date. We explored several metics to compare our results to previous SETI efforts. We developed a new figure-of-merit that can encompass a wider set of parameters and can be used on future SETI experiments for a meaningful comparison.We note that the current BL state-of-the-art digital backend installed at the Green Bank Observatory is the fastest ever used for a SETI experiment by a factor of a few. Here we will describe the potential use of the BL backend by other groups on complementary science, as well as a mention the ongoing and potential collaborations focused in particular in the study of astrophysically powered radio emission from stars targeted by our program.

All Over the World: Mid-Twentieth Century Radio Astronomy and the Origin of the International SETI Network

NASA Astrophysics Data System (ADS)

Charbonneau, Rebecca

2018-01-01

Cold War mythology is rife with stories about secrecy, competition, espionage, and animosity. Yet the history behind the myth-- the overlooked scientists collaborating outside of the aims of the state-- also tells an interesting story. This paper examines the challenges of international scientific collaboration during the Cold War, focusing especially on a case study concerning Soviet radio astronomer Iosif Samuilovich Shklovskii and U.S. astrophysicist Carl Sagan, and their collaborative work on the search for extraterrestrial intelligence (SETI). Despite the hyper-politics that instigated and fueled the Space Race, SETI was held up as an ideal internationalist science, with the lofty goal of uniting all of humanity by situating it within a cosmic community. Although the internationalism of SETI discourse is not entirely unfounded due to its roots in international collaboration, further research indicates that such internationalism was in reality instilled with geopolitics, international conflict, and even espionage. That said, however, the cultural and philosophical perspectives of individual SETI scientists led them to operate within the tensions between national and ideological restraints and their own personal philosophical perspectives. In reviewing the letters of correspondence, conference proceedings, interviews, transcripts of lectures, and autobiographical writings of early-SETI radio astronomers, this paper ultimately argues that, although SETI was not the ideal internationalist science it was portrayed as, SETI pioneers were able to connect and form international networks within a contentious system which often centred on the restriction of free information and international collaboration through their mutual unconventional scientific interests, and facilitated by their personal utopian futurist philosophies.

Objectives and first results of the NASA SETI sky survey field tests at Goldstone

NASA Technical Reports Server (NTRS)

Gulkis, S.; Klein, M. J.; Olsen, E. T.; Crow, R. B.; Gosline, R. M.; Downs, G. S.; Quirk, M. P.; Lokshin, A.; Solomon, J.

1986-01-01

Field tests of SETI (Search for Extraterrestrial Intelligence) prototype hardware and software began in March 1985 at Goldstone. With emphasis on the sky survey component of the NASA SETI search strategy, the article describes the survey characteristics, the detection strategy, and preliminary results of system tests.

Writing Parallel Parameter Sweep Applications with pMatlab

DTIC Science & Technology

2011-01-01

formulate this type of problem in a leader-worker paradigm. The SETI @Home project is a well- known leader-worker parallel application [1]. The SETI ...their results back to the SETI @Home servers when they are done computing the job. Because each job is independent, it does not matter if the 415th job

The problem of active SETI: An overview

NASA Astrophysics Data System (ADS)

Musso, Paolo

2012-09-01

In the present paper (originally presented at the First IAA Symposium on Searching for Life Signatures hold at the UNESCO on 22-26 September 2008) I try to summarize the results of all my previous studies on active SETI and its possible dangers for us, also considering some new topics, in order to provide a possibly complete overview of the whole matter. First, I try to evaluate the possible risks of an indirect contact with aliens, from the social, cultural, and religious point of view; then, the possible risks related with receiving information about alien science and technology; finally, the risk that active SETI could increase the probability of a physical contact with hostile aliens. My conclusion is that active SETI is very unlikely to be dangerous for us, but, at present, such a possibility cannot be completely excluded. Surprisingly, it turns out that a very important point to be assessed in order to improve our evaluation of active SETI is the pace of our technological progress. Some suggestions about the policy that international community should adopt towards active SETI are also included.

Innovative SETI by the KLT

NASA Astrophysics Data System (ADS)

Maccone, C.

SETI searches are, by definition, the extraction of very weak radio signals out of the cosmic background noise. When SETI was born in 1959, it was "natural" to attempt this extraction by the only detection algorithm well known at the time: the Fourier Transform (FT). In fact: 1) SETI radio astronomers had adopted the viewpoint that a candidate ET signal would necessarily be a sinusoidal carrier, i.e. a very narrow-band signal. Over such a narrow band, the background noise is necessarily white. And so, the basic assumption behind the FT that the background noise must be white was "perfectly matched" to SETI for the next fifty years! 2) In addition, the Americans, J. W. Cooley and J. W. Tukey discovered in April 1965 that all the FT computations could be speeded up to N*ln(N) (rather than N2) (N is the number of numbers to be processed) by their own Fast Fourier Transform (FFT). Then, SETI radio astronomers all over the world gladly and unquestioningly adopted the new FFT forever. In 1983, however, the French SETI radio astronomer, François Biraud, dared to challenge this view (ref. [6]). He argued that we only can make guesses about ET's telecommunication systems, and that the shifting trend on Earth was from narrow-band to wide-band telecommunications. Thus, a new transform, other than the FFT, was needed that could detect signals over both narrow and wide bands, regardless of the colored noise distribution over any finite bandwidth. Such a transform had actually been pointed out as early as 1946 by the Finn mathematician, Kari Karhunen, and the French mathematician, Michel Loève, and is thus named KLT for them. In conclusion, François Biraud suggested to "look for the unknown in SETI" by adopting the KLT rather than the FFT. The same ideas were reached independently by this author also, and starting 1987, he too was "preaching the KLT": first at the SETI Institute, then (since 1990) at the Italian CNR (now called INAF) SETI facilities at Medicina, near Bologna. Their director, Stelio Montebugnoli, was willing to pay attention to him. Little by little, bright students succeeded in programming the KLT algorithm for the Medicina radio telescopes. Finally, by the year 2000, the advent of programmable cards, mastered by Montebugnoli, made the "miracle" happen. The KLT for SETI is now a reality at the SETI-Italia facilities and for the first time in history. This paper describes the KLT with a final section devoted to the advantages of installing the KLT on LOFAR and the SKA, i.e. to detecting leakage from nearby stars. Bursts, Pulses and Flickering: Wide-field monitoring of the dynamic radio sky Kerastari, Tripolis, Greece 12-15 June, 2007

SETI meets a social intelligence: Dolphins as a model for real-time interaction and communication with a sentient species

NASA Astrophysics Data System (ADS)

Herzing, Denise L.

2010-12-01

In the past SETI has focused on the reception and deciphering of radio signals from potential remote civilizations. It is conceivable that real-time contact and interaction with a social intelligence may occur in the future. A serious look at the development of relationship, and deciphering of communication signals within and between a non-terrestrial, non-primate sentient species is relevant. Since 1985 a resident community of free-ranging Atlantic spotted dolphins has been observed regularly in the Bahamas. Life history, relationships, regular interspecific interactions with bottlenose dolphins, and multi-modal underwater communication signals have been documented. Dolphins display social communication signals modified for water, their body types, and sensory systems. Like anthropologists, human researchers engage in benign observation in the water and interact with these dolphins to develop rapport and trust. Many individual dolphins have been known for over 20 years. Learning the culturally appropriate etiquette has been important in the relationship with this alien society. To engage humans in interaction the dolphins often initiate spontaneous displays, mimicry, imitation, and synchrony. These elements may be emergent/universal features of one intelligent species contacting another for the intention of initiating interaction. This should be a consideration for real-time contact and interaction for future SETI work.

Evolution of a Planetary System. SETI Academy Planet Project.

ERIC Educational Resources Information Center

Search for Extraterrestrial Intelligence Inst., Mountain View, CA.

The SETI Academy Planet Project provides an exciting, informative, and creative series of activities for elementary students (grades 5-6) in these activities each student plays the role of a cadet at the SETI Academy, a fictitious institution. This unit examines the evolution of stars and planets which is an important aspect of the search for…

Promoting SETI in the UK

NASA Astrophysics Data System (ADS)

Penny, Alan

2013-10-01

MEETING REPORT What does the UK presently do in the search for extraterrestrial intelligence and what are the plans for the future? Alan Penny reports on a meeting of UK academics active in SETI, held as sessions in the recent National Astronomy Meeting in Scotland - and the formation of the UK SETI Research Network to promote UK academic work.

Spin-Off Successes of SETI Research at Berkeley

NASA Astrophysics Data System (ADS)

Douglas, K. A.; Anderson, D. P.; Bankay, R.; Chen, H.; Cobb, J.; Korpela, E. J.; Lebofsky, M.; Parsons, A.; von Korff, J.; Werthimer, D.

2009-12-01

Our group contributes to the Search for Extra-Terrestrial Intelligence (SETI) by developing and using world-class signal processing computers to analyze data collected on the Arecibo telescope. Although no patterned signal of extra-terrestrial origin has yet been detected, and the immediate prospects for making such a detection are highly uncertain, the SETI@home project has nonetheless proven the value of pursuing such research through its impact on the fields of distributed computing, real-time signal processing, and radio astronomy. The SETI@home project has spun off the Center for Astronomy Signal Processing and Electronics Research (CASPER) and the Berkeley Open Infrastructure for Networked Computing (BOINC), both of which are responsible for catalyzing a smorgasbord of new research in scientific disciplines in countries around the world. Futhermore, the data collected and archived for the SETI@home project is proving valuable in data-mining experiments for mapping neutral galatic hydrogen and for detecting black-hole evaporation.

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, Edward C. (Editor)

1991-01-01

This quarterly publication provides archival reports on developments in programs managed by JPL's Office of Telecommunications and Data Acquisition (TDA). In space communications, radio navigation, radio science, and ground-based radio and radar astronomy, it reports on activities of the Deep Space Network (DSN). Also included is standards activity at JPL for space data and information systems and reimbursable DSN work performed for other space agencies through NASA. In the search for extraterrestrial intelligence (SETI), 'The TDA Progress Report' reports on implementation and operations for searching the microwave spectrum. In solar system radar, it reports on the uses of the Goldstone Solar System Radar for scientific exploration of the planets, their rings and satellites, asteroids, and comets. In radio astronomy, the areas of support include spectroscopy, very long baseline interferometry, and astrometry.

Ultrastructure of identified fast excitatory, slow excitatory and inhibitory neuromuscular junctions in the locust.

PubMed

Titmus, M J

1981-06-01

The specialized jumping muscle of the locust, the metathoracic extensor tibiae (ETi), is innervated by four physiologically different motoneurons, including FETi, a phasic excitor, SETi, a tonic excitor, and CI, a tonic common inhibitor. FETi neuromuscular junctions were examined in three phasic ETi bundles innervated by FETi. FETi terminals were characterized by patchy contacts on to granular sarcoplasm. The ETi accessory extensor, innervated by both SETi and CI, contains two morphologically different types of axon ending. When this muscle was soaked in horseradish peroxidase, stimulation of SETi led to selective uptake in vesicles in terminals similar to those of FETi axons but containing smaller vesicles, while stimulation by CI caused increased uptake into terminals with more extensive contact directly on to fibrillar sarcoplasm. As has been observed in excitatory and inhibitory synapses in some crustacean and vertebrate nervous systems, the synaptic vesicles in the locust excitatory endings are round and electron-lucent while those in the inhibitory endings are more irregular in shape. The tonic neuromuscular junctions, SETi and CI, are more densely packed with vesicles, larger in cross-sectional area and appear to be of more complex shape than the smaller, vesicle-sparse, phasic FETi terminals. Following long duration stimulation at 10 Hz, the tonic neuromuscular junctions showed little morphological change. FETi endings, which fatigue within minutes at the same stimulation frequency, showed a 20% decrease in synaptic vesicle density and an increase in irregularly shaped membrane inclusions.

SETI Observations of Exoplanets with the Allen Telescope Array

NASA Astrophysics Data System (ADS)

Harp, G. R.; Richards, Jon; Tarter, Jill C.; Dreher, John; Jordan, Jane; Shostak, Seth; Smolek, Ken; Kilsdonk, Tom; Wilcox, Bethany R.; Wimberly, M. K. R.; Ross, John; Barott, W. C.; Ackermann, R. F.; Blair, Samantha

2016-12-01

We report radio SETI observations on a large number of known exoplanets and other nearby star systems using the Allen Telescope Array (ATA). Observations were made over about 19000 hr from 2009 May to 2015 December. This search focused on narrowband radio signals from a set totaling 9293 stars, including 2015 exoplanet stars and Kepler objects of interest and an additional 65 whose planets may be close to their habitable zones. The ATA observations were made using multiple synthesized beams and an anticoincidence filter to help identify terrestrial radio interference. Stars were observed over frequencies from 1 to 9 GHz in multiple bands that avoid strong terrestrial communication frequencies. Data were processed in near-real time for narrowband (0.7-100 Hz) continuous and pulsed signals with transmitter/receiver relative accelerations from -0.3 to 0.3 m s-2. A total of 1.9 × 108 unique signals requiring immediate follow-up were detected in observations covering more than 8 × 106 star-MHz. We detected no persistent signals from extraterrestrial technology exceeding our frequency-dependent sensitivity threshold of 180-310 × 10-26 W m-2.

SETI via Leakage from Light Sails in Exoplanetary Systems

NASA Astrophysics Data System (ADS)

Guillochon, James; Loeb, Abraham

2015-10-01

The primary challenge of rocket propulsion is the burden of needing to accelerate the spacecraft’s own fuel, resulting in only a logarithmic gain in maximum speed as propellant is added to the spacecraft. Light sails offer an attractive alternative in which fuel is not carried by the spacecraft, with acceleration being provided by an external source of light. By artificially illuminating the spacecraft with beamed radiation, speeds are only limited by the area of the sail, heat resistance of its material, and power use of the accelerating apparatus. In this paper, we show that leakage from a light sail propulsion apparatus in operation around a solar system analogue would be detectable. To demonstrate this, we model the launch and arrival of a microwave beam-driven light sail constructed for transit between planets in orbit around a single star, and find an optimal beam frequency on the order of tens of GHz. Leakage from these beams yields transients with flux densities of Jy and durations of tens of seconds at 100 pc. Because most travel within a planetary system would be conducted between the habitable worlds within that system, multiply transiting exoplanetary systems offer the greatest chance of detection, especially when the planets are in projected conjunction as viewed from Earth. If interplanetary travel via beam-driven light sails is commonly employed in our galaxy, this activity could be revealed by radio follow-up of nearby transiting exoplanetary systems. The expected signal properties define a new strategy in the search for extraterrestrial intelligence (SETI).

SETI in vivo: testing the we-are-them hypothesis

NASA Astrophysics Data System (ADS)

Makukov, Maxim A.; Shcherbak, Vladimir I.

2018-04-01

After it was proposed that life on Earth might descend from seeding by an earlier extraterrestrial civilization motivated to secure and spread life, some authors noted that this alternative offers a testable implication: microbial seeds could be intentionally supplied with a durable signature that might be found in extant organisms. In particular, it was suggested that the optimal location for such an artefact is the genetic code, as the least evolving part of cells. However, as the mainstream view goes, this scenario is too speculative and cannot be meaningfully tested because encoding/decoding a signature within the genetic code is something ill-defined, so any retrieval attempt is doomed to guesswork. Here we refresh the seeded-Earth hypothesis in light of recent observations, and discuss the motivation for inserting a signature. We then show that `biological SETI' involves even weaker assumptions than traditional SETI and admits a well-defined methodological framework. After assessing the possibility in terms of molecular and evolutionary biology, we formalize the approach and, adopting the standard guideline of SETI that encoding/decoding should follow from first principles and be convention-free, develop a universal retrieval strategy. Applied to the canonical genetic code, it reveals a non-trivial precision structure of interlocked logical and numerical attributes of systematic character (previously we found these heuristically). To assess this result in view of the initial assumption, we perform statistical, comparison, interdependence and semiotic analyses. Statistical analysis reveals no causal connection of the result to evolutionary models of the genetic code, interdependence analysis precludes overinterpretation, and comparison analysis shows that known variations of the code lack any precision-logic structures, in agreement with these variations being post-LUCA (i.e. post-seeding) evolutionary deviations from the canonical code. Finally, semiotic analysis shows that not only the found attributes are consistent with the initial assumption, but that they make perfect sense from SETI perspective, as they ultimately maintain some of the most universal codes of culture.

Innovation in Primary School Construction: Community Participation in Seti Zone, Nepal. Educational Building Report 20. A Case Study.

ERIC Educational Resources Information Center

Tamang, H. D.; Dharam, K. C.

Nepal is one of the poorest countries in the world. In 1981 the Education for Rural Development in Seti Zone Project--more commonly known as the "Seti Project"--was part of the Nepalese government's effort to develop a system of basic education in that far western region of Nepal. The early success of the project provided the impetus for…

M855A1 Enhanced Performance Round (EPR) Media Day

DTIC Science & Technology

2011-05-04

Distribution is unlimited. Other requests shall be referred to the Office of the Project Manager for Maneuver Ammunition Systems, ATTN: SFAE-AMO-MAS- SETI ... SETI ,Picatinny,NJ,07806-5000 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10. SPONSOR/MONITOR’S...the Project Manager for Maneuver Ammunition Systems, ATTN: SFAE- AMO-MAS- SETI , Picatinny, NJ Distribution Statement A: Approved for Public Release

Mindmodeling@Home. . . and Anywhere Else You Have Idle Processors

DTIC Science & Technology

2009-07-01

the continuous growth rate of end-user processing capability around the world. The first volunteer computing project was SETI @Home. It was... SETI @Home remains the longest running and one of the most popular volunteer computing projects in the world. This actually is an impressive feat...volunteer computing projects available to those interested in donating their idle processor time to scientific pursuits. Most of them, including SETI

Supporting Research and Technology Activities for a Microwave Observing Program to Search for Extraterrestrial Intelligence

NASA Technical Reports Server (NTRS)

Tarter, Jill; Backus, Peter

1995-01-01

Curriculum materials based on the search for extraterrestrial intelligence (SETI) were developed for grades 3 through 9 science classes. The project was supported in part by NASA. Six teacher's guides, plus ancillary visuals, addressing topics in astronomy, biology, chemistry, geosciences, and physics as well as mathematics, social sciences, and language arts, were designed by a team of teachers, scientists. curriculum developers, and artists. First drafts were piloted by 10 design team teachers; revised drafts were field tested by 109 teachers in 30 states. Extensive feedback from these teachers and their students and reviews by scientists were used to revise materials prior to submission to the publisher. The field test teachers overall ranking of all guides (data from individual lesson feedback forms) was 431 on a one low to five high scale; 85% found the content appropriate to course and grade level and 75% indicated they had no reservations about using the materials again or recommending them to colleagues. The ratio of liked to disliked student responses (from 1305 student letters) was 70:30. Most recommendations from the teachers, students, and science reviewers were incorporated in the final versions for the guides, published by Libraries Unlimited/Teacher Ideas Press, 1995.

Dynamics of neurons controlling movements of a locust hind leg. III. Extensor tibiae motor neurons.

PubMed

Newland, P L; Kondoh, Y

1997-06-01

Imposed movements of the apodeme of the femoral chordotonal organ (FeCO) of the locust hind leg elicit resistance reflexes in extensor and flexor tibiae motor neurons. The synaptic responses of the fast and slow extensor tibiae motor neurons (FETi and SETi, respectively) and the spike responses of SETi were analyzed with the use of the Wiener kernel white noise method to determine their response properties. The first-order Wiener kernels computed from soma recordings were essentially monophasic, or low passed, indicating that the motor neurons were primarily sensitive to the position of the tibia about the femorotibial joint. The responses of both extensor motor neurons had large nonlinear components. The second-order kernels of the synaptic responses of FETi and SETi had large on-diagonal peaks with two small off-diagonal valleys. That of SETi had an additional elongated valley on the diagonal, which was accompanied by two off-diagonal depolarizing peaks at a cutoff frequency of 58 Hz. These second-order components represent a half-wave rectification of the position-sensitive depolarizing response in FETi and SETi, and a delayed inhibitory input to SETi, indicating that both motor neurons were directionally sensitive. Model predictions of the responses of the motor neurons showed that the first-order (linear) characterization poorly predicted the actual responses of FETi and SETi to FeCO stimulation, whereas the addition of the second-order (nonlinear) term markedly improved the performance of the model. Simultaneous recordings from the soma and a neuropilar process of FETi showed that its synaptic responses to FeCO stimulation were phase delayed by about -30 degrees at 20 Hz, and reduced in amplitude by 30-40% when recorded in the soma. Similar configurations of the first and second-order kernels indicated that the primary process of FETi acted as a low-pass filter. Cross-correlation between a white noise stimulus and a unitized spike discharge of SETi again produced well-defined first- and second-order kernels that showed that the SETi spike response was also dependent on positional inputs. An elongated negative valley on the diagonal, characteristic of the second-order kernel of the synaptic response in SETi, was absent in the kernel from the spike component, suggesting that information is lost in the spike production process. The functional significance of these results is discussed in relation to the behavior of the locust.

Which colors would extraterrestrial civilizations use to transmit signals?: The ;magic wavelengths; for optical SETI

NASA Astrophysics Data System (ADS)

Narusawa, Shin-ya; Aota, Tatusya; Kishimoto, Ryo

2018-04-01

In the case of radio SETI, there are predicted frequencies which extraterrestrial beings select to send messages to other civilizations. Those are called ;magic frequencies. Considering the optical region, terrestrial technologies can not transmit arbitrary wavelengths of high-power optical lasers, easily. In this article, we discuss communications among civilizations with the same level of technology as us to enhance the persuasive power. It might be possible to make a reasonable assumption about the laser wavelengths transmitted by extraterrestrial intelligences to benefit optical SETI (OSETI) methods. Therefore, we propose some ;magic wavelengths; for spectroscopic OSETI observations in this article. From the senders point of view, we argue that the most favorable wavelength used for interstellar communication would be the one of YAG lasers, at 1.064 μm or its Second Harmonic Generation (532.1 nm). On the contrary, there are basic absorption lines in the optical spectra, which are frequently observed by astrophysicists on Earth. It is possible that the extraterrestrials used lasers, which wavelengths are tuned to such absorption lines for sending messages. In that case, there is a possibility that SHG and/or Sum Frequency Generation of YAG and YLF lasers are used. We propose three lines at, 393.8 nm (near the Ca K line), 656.5 nm (near the Hα line) and 589.1 nm (Na D2 line) as the magic wavelengths.

MindModeling@Home . . . and Anywhere Else You Have Idle Processors

DTIC Science & Technology

2009-12-01

was SETI @Home. It was established in 1999 for the purpose of demonstrating the utility of “distributed grid computing” by providing a mechanism for...the public imagination, and SETI @Home remains the longest running and one of the most popular volunteer computing projects in the world. This...pursuits. Most of them, including SETI @Home, run on a software architecture called the Berkeley Open Infrastructure for Network Computing (BOINC). Some of

Kurzweil's Singularity as a part of Evo-SETI Theory

NASA Astrophysics Data System (ADS)

Maccone, Claudio

2017-03-01

Ray Kurzweil's famous 2006 book "The Singularity Is Near" predicted that the Singularity (i.e. computers taking over humans) would occur around the year 2045. In this paper we prove that Kurzweil's prediction is in agreement with the "Evo-SETI" (Evolution and SETI)" mathematical model that this author has developed over the last five years in a series of mathematical papers published in both Acta Astronautica and the International Journal of Astrobiology.

Searching for Good Science - The Cancellation of NASA's SETI Program

NASA Astrophysics Data System (ADS)

Garber, S. J.

On Columbus Day, 1992, the National Aeronautics and Space Administration (NASA) formally initiated a radio astronomy program called SETI (Search for Extraterrestrial Intelligence). Less than a year later, Congress abruptly canceled the program. Why? While there was and still is a debate over the likelihood of finding intelligent extraterrestrial life, virtually all informed parties agreed that the SETI program constituted worthwhile, valid science. Yet, fervor over the federal budget deficit, lack of support from other scientists and aerospace contractors and a significant history of unfounded associations with nonscientific elements combined with bad timing in fall 1993 to make the program an easy target to eliminate. Thus SETI was a relative anomaly in terms of a small, scientifically valid program that was canceled for political expediency.

Do potential SETI signals need to be decontaminated?

NASA Astrophysics Data System (ADS)

Carrigan, Richard A., Jr.

2006-01-01

Biological contamination from space samples is a remote but accepted possibility. Signals received by searches for extraterrestrial intelligence (SETI) could also contain harmful information in the spirit of a computer virus, the so-called "SETI Hacker" hypothesis. Over the last four decades extraterrestrial intelligence searches have given little consideration to this possibility. Some argue that information in an extraterrestrial signal could not attack a terrestrial computer because the computer logic and code is idiosyncratic and constitutes an impenetrable firewall. Suggestions are given on how to probe these arguments. Measures for decontaminating extraterrestrial intelligence signals (ETI) are discussed. Modifications to the current SETI detection protocol may be appropriate. Beyond that, the potential character of ETI message content requires much broader discussion.

A SETI Search of Nearby Solar-Type Stars at the 203-GHz Positronium Hyperfine Resonance

NASA Technical Reports Server (NTRS)

Steffes, Paul G.; DeBoer, David R.

1994-01-01

The development of advanced millimeter-wave technology has made it possible to construct low-noise receivers and high-power transmitters comparable to those available at much lower frequencies. This technology, plus certain physical characteristics of the millimeter-wave spectrum, suggests possible advantages for use of this wavelength range for interstellar communications. As a result, a Search for ExtraTerrestrial Intelligence(SETI) type search has been conducted for narrow-bandwidth signals at frequencies near the positronium hyperfine spectral line (203.385 GHz), a potential natural reference frequency. A total of 40 solar-type stars within 23 parsecs were observed, in addition to three locations near the galactic center. No detections were made at the detection threshold of 2.3 x 10(exp -19) W/sq m in each of two orthogonal linear polarizations Future observations will be made with a higher resolution Fast Fourier Transform Spectrum Analyzer (FFTSA), which should improve sensitivity by an order of magnitude and reduce required observing time.

Undergraduate Research at SETI in Astrobiology

NASA Astrophysics Data System (ADS)

Kress, Monika; Phillips, C.; DeVore, E.; Hubickyj, O.

2012-05-01

The SETI Institute and San Jose State University (SJSU) have begun a partnership (URSA: Undergraduate Research at the SETI Institute in Astrobiology) in which undergraduate science and engineering majors from SJSU participate in research at the SETI Institute during the academic year. We are currently in our second year of the three-year NASA-funded grant. The goal of this program is to expose future scientists, engineers and educators to the science of astrobiology and to NASA in general, and by so doing, to prepare them for the transition to their future career in the Silicon Valley or beyond. The URSA students are mentored by a SETI Institute scientist who conducts research at the SETI Institute headquarters or nearby at NASA Ames Research Center. The SETI Institute is a private, nonprofit organization dedicated to scientific research, education and public outreach. Its mission is to explore, understand and explain the origin, nature and prevalence of life in the universe. SJSU is a large urban public university that serves the greater Silicon Valley area in California. Students at SJSU come from diverse ethnic, cultural and socioeconomic backgrounds. Many of them face financial pressures that force them to pursue part-time work. URSA students are paid to work for 10 hours/week during the academic year, and also participate in monthly group meetings where they practice their presentation skills and discuss future plans. We encourage underserved and underrepresented students, including women, minority, and those who are the first in their family to go to college, to apply to the URSA program and provide ongoing mentoring and support as needed. While preparing students for graduate school is not a primary goal, some of our students have gone on to MS or PhD programs or plan to do so. The URSA program is funded by NASA EPOESS.

Distributions of nerve and muscle fibre types in locust jumping muscle.

PubMed

Hoyle, G

1978-04-01

Muscle fibres of the locust extensor tibiae (jumping muscle) were examined by interference microscopy and by electron microscopy. The electrical responses of single fibres and the mechanical responses of bundles or selected regions to the nerve fibres were examined. Four axons innervate the muscle: fast (FETi), slow (SETi), common inhibitor (CI) and dorsal unpaired median (DUMETi). Their distributions were examined by combined electrophysiological tracing and EM sectioning. The mean diameter of muscle fibres in different regions varies from 40 to 140 micrometer and is related to the local leg thickness rather than muscle fibre type. The fine structure of a fibre is related to its innervation. Fibres innervated by FETi but not SETi are of fast type ultrastructurally. Fibres innervated by SETi but not by FETi are of slow type ultrastructurally. Fibres innervated by both axons are generally intermediate between the extremes though more nearly of fast type than slow. Distal slow muscle fibres have much slower relaxation rates than do proximal ones. The most proximal bundles are of mixed muscle fibre type. There is an abrupt transition from a mixed population to homogeneous fast type, in the muscle units immediately distal to the most proximal bundles. This transition is associated with the presence of DUMETi terminals on some of the fibres distal to the transition point. There are no SETi endings on these same fibres. Fibres innervated by both SETi and FETi are scattered throughout the leg, but are commonest in the dorsal bundles. The percentage of these increases progressively passing distally. The most distal muscle fibres are innervated by SETi but not by FETi. It is concluded that different regions of the muscle will play different roles functionally since they are differentially sensitive to the pattern of SETi discharge.

Selectivity of the uptake of glutamate and GABA in two morphologically distinct insect neuromuscular synapses.

PubMed

van Marle, J; Piek, T; Lammertse, T; Lind, A; Van Weeren-Kramer, J

1985-11-25

The common inhibitor (CI) and slow excitor tibiae (SETi) innervated slow muscles 135cd of the locust Schistocerca gregaria were incubated under high-affinity uptake conditions either in [3H]GABA or in [3H]glutamate. [3H]GABA is accumulated in the glia of the nerve endings of the CI as well as the SETi; however, it is accumulated only in the terminal axons of the CI, not in the terminal axons of the SETi. The grain densities above the glia and above the CI terminal axons are approximately 2 grains/micron2. After incubation in [3H]glutamate the grain densities above the CI terminal axons and the SETi terminal axons are approximately 4 grains/micron2; the grain densities above the glia of both types of nerve endings are approximately 17 grains/micron2. The relatively high labeling (3 grains/micron2) of the muscles after incubation in the presence of glutamate is ascribed to the high metabolic requirements of slow muscles. The conclusion is drawn that a high-affinity uptake system for GABA is present in the CI terminal axons and in the glia of both the CI and SETi nerve endings. However, while the glutamate uptake in the CI and SETi nerve endings of the slow 135cd is comparable to the high-affinity uptake of glutamate in the fast excitor tibiae (FETi) nerve endings of the fast retractor unguis muscle, a high-affinity uptake of glutamate was only demonstrated in the glia of both types of nerve endings. A high-affinity uptake in the terminal axons of the CI and SETi may be masked by an extensively low-affinity uptake of glutamate by the muscles.

Toward understanding the active SETI debate: Insights from risk communication and perception

NASA Astrophysics Data System (ADS)

Korbitz, Adam

2014-12-01

Insights from the robust field of risk communication and perception have to date been almost totally absent from the policy debate regarding the relative risks and merits of Active SETI or Messaging to Extraterrestrial Intelligence (METI). For many years, the practice (or proposed practice) of Active SETI has generated a vigorous and sometimes heated policy debate within the scientific community. There have also been some negative reactions in the media toward the activities of those engaged in Active SETI. Risk communication is a scientific approach to communication regarding situations involving potentially sensitive or controversial situations in which there may be high public concern and low public trust. The discipline has found wide acceptance and utility in fields such as public health, industrial regulation and environmental protection. Insights from the scientific field of risk communication (such as omission bias, loss aversion, the availability heuristic, probability neglect, and the general human preference for voluntary over involuntary risks) may help those who have participated in either side of the debate over Active SETI to better understand why the debate has taken on this posture. Principles of risk communication and risk perception may also help those engaged in Active SETI to communicate more effectively with other scientists, the public, with the media, and with policy makers regarding their activities and to better understand and respond to concerns expressed regarding the activity.

A search strategy for SETI - The search for extraterrestrial intelligence

NASA Technical Reports Server (NTRS)

Billingham, J.; Wolfe, J.; Edelson, R.; Gulkis, S.; Olsen, E.; Oliver, B.; Tarter, J.; Seeger, C.

1980-01-01

A search strategy is proposed for the detection of signals of extraterrestrial intelligent origin. It constitutes an exploration of a well defined volume of search space in the microwave region of the spectrum and envisages the use of a combination of sky survey and targeted star approaches. It is predicated on the use of existing antennas equipped with sophisticated multichannel spectrum analyzers and signal processing systems operating in the digital mode. The entire sky would be surveyed between 1 and 10 GHz with resolution bin widths down to 32 Hz. More than 700 nearby solar type stars and other selected interesting directions would be searched between 1 GHz and 3 GHz with bin widths down to 1 Hz. Particular emphasis would be placed on those solar type stars that are within 20 light years of earth.

The art and science of interstellar message composition: a report on international workshops to encourage multidisciplinary discussion

NASA Astrophysics Data System (ADS)

Vakoch, Douglas A.

2011-02-01

Throughout the history of the Search for Extraterrestrial Intelligence (SETI), there has been widespread recognition of the profound societal implications of detecting intelligence beyond Earth. At the SETI Institute, interstellar message construction serves as the focus of a multidisciplinary attempt to prepare for the cultural impact of signal detection and the critical events that would follow. Interstellar message construction at the SETI Institute builds upon the recommendations of the 1991-1992 Workshops on the Cultural Aspects of SETI, while also exploring opportunities for multidisciplinary contributions on new topics. Through a series of international workshops in Toulouse, Paris, Zagreb, Washington, and Bremen, the SETI Institute and partner organizations have fostered broad-based discussion about some of the most important decisions that would follow detection of extraterrestrial intelligence, including "should we reply?" and if so, " what should we say, and how might we say it?". Several of the themes addressed at these workshops will be highlighted, including the relationship between art and science in designing messages, the value of interactive messages, and the importance of better understanding the nature of language.

Analysis of a crossed Bragg cell acousto-optical spectrometer for SETI

NASA Technical Reports Server (NTRS)

Gulkis, S.

1989-01-01

The search for radio signals from extraterrestrial intelligent beings (SETI) requires the use of large instantaneous bandwidth (500 MHz) and high resolution (20 Hz) spectrometers. Digital systems with a high degree of modularity can be used to provide this capability, and this method has been widely discussed. Another technique for meeting the SETI requirement is to use a crossed Bragg cell spectrometer as described by Psaltis and Casasent. This technique makes use of the Folded Spectrum concept, introduced by Thomas. The Folded Spectrum is a 2-D Fourier Transform of a raster scanned 1-D signal. It is directly related to the long 1-D spectrum of the original signal and is ideally suited for optical signal processing. The folded spectrum technique has received little attention to date, primarily because early systems made use of photographic film which are unsuitable for the real time data analysis and voluminous data requirements of SETI. An analysis of the crossed Bragg cell spectrometer is presented as a method to achieve the spectral processing requirements for SETI. Systematic noise contributions unique to the Bragg cell system will be discussed.

Analysis of a crossed Bragg cell acousto-optical spectrometer for SETI.

PubMed

Gulkis, S

1989-01-01

The search for radio signals from extraterrestrial intelligent beings (SETI) requires the use of large instantaneous bandwidth (500 MHz) and high resolution (20 Hz) spectrometers. Digital systems with a high degree of modularity can be used to provide this capability, and this method has been widely discussed. Another technique for meeting the SETI requirement is to use a crossed Bragg cell spectrometer as described by Psaltis and Casasent. This technique makes use of the Folded Spectrum concept, introduced by Thomas. The Folded Spectrum is a 2-D Fourier Transform of a raster scanned 1-D signal. It is directly related to the long 1-D spectrum of the original signal and is ideally suited for optical signal processing. The folded spectrum technique has received little attention to date, primarily because early systems made use of photographic film which are unsuitable for the real time data analysis and voluminous data requirements of SETI. An analysis of the crossed Bragg cell spectrometer is presented as a method to achieve the spectral processing requirements for SETI. Systematic noise contributions unique to the Bragg cell system will be discussed.

Analysis of a crossed Bragg cell acousto-optical spectrometer for SETI

NASA Astrophysics Data System (ADS)

Gulkis, Samuel

The search for radio signals from extraterrestrial intelligent beings (SETI) requires the use of large instantaneous bandwidth (500 MHz) and high resolution (20 Hz) spectrometers. Digital systems with a high degree of modularity can be used to provide this capability, and this method has been widely discussed. Another technique for meeting the SETI requirement is to use a crossed Bragg cell spectrometer as described by Psaltis and Casasent. This technique makes use of the Folded Spectrum concept, introduced by Thomas. The Folded Spectrum is a 2-D Fourier Transform of a raster scanned 1-D signal. It is directly related to the long 1-D spectrum of the original signal and is ideally suited for optical signal processing. The folded spectrum technique has received little attention to date, primarily because early systems made use of photographic film which are unsuitable for the real time data analysis and voluminous data requirements of SETI. An analysis of the crossed Bragg cell spectrometer is presented as a method to achieve the spectral processing requirements for SETI. Systematic noise contributions unique to the Bragg cell system will be discussed.

The Search for Extraterrestrial Intelligence (SETI) and Whether to send 'Messages' (METI): A Case for Conversation, Patience and Due Diligence

NASA Astrophysics Data System (ADS)

Brin, D.

Understanding the controversy over "Messages to Extra Terrestrial Intelligence" or METI requires a grounding in the history and rationale of SETI (Search for ETI). Insights since the turn of the century have changed SETI's scientific basis. Continued null results from the radio search do not invalidate continuing effort, but they do raise questions about long-held assumptions. Modified search strategies are discussed. The Great Silence or Fermi Paradox is appraised, along with the disruptive plausibility of interstellar travel. Psychological motivations for METI are considered. With this underpinning, we consider why a small cadre of SETI-ist radio astronomers have resisted the notion of international consultations before humanity takes a brash and irreversible step into METI, shouting our presence into the cosmos.

A SETI experiment. [Search for Extra Terrestrial Intelligence

NASA Technical Reports Server (NTRS)

Mclaughlin, W. I.

1986-01-01

In order to increase the probability of contact in the search for extraterrestrial intelligence (SETI), it has been proposed to search more intensively in certain regions of the electromagnetic spectrum ('the water hole'). The present paper describes a similar narrowing of the search in the time domain. Application of this strategy results in the SETI experiments searching for signals from the Tau Ceti system late in 1986 and early in 1987, and from the Epsilon Eridani system in mid 1988.

The Scientific Search for Extraterrestrial Intelligence: a Sociological Analysis.

NASA Astrophysics Data System (ADS)

Romesberg, Daniel Ray

1992-01-01

This study examines the search for extraterrestrial intelligence, as it has been conducted by scientists over the past century. The following questions are explored: (1) What are the historical patterns of American scientific interest in extraterrestrial intelligence? From a sociology of science perspective, how can these patterns of interest be explained? (2) Who are the most prominent scientists involved in SETI? What are their academic backgrounds? (3) How has the rather exotic idea of extraterrestrial intelligence managed to penetrate the realm of respectable science?. In order to measure the historical fluctuations of scientific interest in extraterrestrial intelligence, a frequency distribution of relevant articles published in American scientific journals over the past century has been constructed. The core scholars of the "extraterrestrial" field have been determined via citation analysis, in a selected portion of the scientific literature. An analysis of recent scientific literature on the Search for Extraterrestrial Intelligence (SETI) has revealed a number of tactics of legitimation and de-legitimation used by SETI proponents, as well as opponents. This study has generated the following findings: (1) Historically, there are three factors which tend to stimulate general scientific interest in extraterrestrial intelligence: First, the strong demonstration of the plausibility of extraterrestrial intelligence, or life, especially in a tangible, and therefore studiable location. Scientific laboratories are primary agents of plausibility here. Second, the organized political activity of SETI scientists. Third, the availability of government funding for searches for extraterrestrial intelligence, or life. (2) Statistically, the leading scholars of modern SETI are Sagan, Drake and Morrison. The field itself tends to be dominated by astronomers and physicists. (3) Because SETI has no concrete data, and is easily stigmatized as an illegitimate scientific activity, it must engage in an intense campaign of scientific legitimation. Most importantly, SETI scientists must try to resemble scientists who are engaged in "normal," respectable scientific activities. (4) The sociological study of SETI's history demonstrates the strengths and limits of the constructivist and realist approaches to the sociology of science. It suggests that sociological analyses of science should attempt to incorporate both analytical perspectives.

ARC-2007-ACD07-0152-030

NASA Image and Video Library

2007-08-12

Perseid Meteor flight on Google's Gulfstream Aircraft. P.I. Peter Jenniskens, SETI Group Peter Jenniskens, SETI - briefing w/L-R; J Nott, P Jenniskens, M Koop, D Holman and two Apex Aviation Corp reps.

A Serendipitous MWA Search for Narrowband Signals from ‘Oumuamua

NASA Astrophysics Data System (ADS)

Tingay, S. J.; Kaplan, D. L.; Lenc, E.; Croft, S.; McKinley, B.; Beardsley, A.; Crosse, B.; Emrich, D.; Franzen, T. M. O.; Gaensler, B. M.; Horsley, L.; Johnston-Hollitt, M.; Kenney, D.; Morales, M. F.; Pallot, D.; Steele, K.; Trott, C. M.; Walker, M.; Wayth, R. B.; Williams, A.; Wu, C.

2018-04-01

We examine data from the Murchison Widefield Array (MWA) in the frequency range 72–102 MHz for a field of view that serendipitously contained the interstellar object ‘Oumuamua on 2017 November 28. Observations took place with a time resolution of 0.5 s and a frequency resolution of 10 kHz. Based on the interesting but highly unlikely suggestion that ‘Oumuamua is an interstellar spacecraft, due to some unusual orbital and morphological characteristics, we examine our data for signals that might indicate the presence of intelligent life associated with ‘Oumuamua. We searched our radio data for (1) impulsive narrowband signals, (2) persistent narrowband signals, and (3) impulsive broadband signals. We found no such signals with nonterrestrial origins and make estimates of the upper limits on equivalent isotropic radiated power (EIRP) for these three cases of approximately 7 kW, 840 W, and 100 kW, respectively. These transmitter powers are well within the capabilities of human technologies, and are therefore plausible for alien civilizations. While the chances of positive detection in any given search for extraterrestrial intelligence (SETI) experiment are vanishingly small, the characteristics of new generation telescopes such as the MWA (and, in the future, the Square Kilometre Array) make certain classes of SETI experiments easy, or even a trivial by-product of astrophysical observations. This means that the future costs of SETI experiments are very low, allowing large target lists to partially balance the low probability of a positive detection.

A Half-century of SETI Science

NASA Astrophysics Data System (ADS)

Shuch, H. Paul

We begin our journey with a brief review of half a century of SETI science. The material in this introductory chapter is offered for the benefit of those educated laypersons whose enthusiasm for the Search for Extraterrestrial Intelligence exceeds their detailed knowledge of the relevant technologies. It is my hope that readers of this volume will better appreciate the material which follows if they first have a basic understanding of SETI concepts. Hence, I offer an overview, which is intended not to be exhaustive, but rather representative. Together, we will explore the nature of radio telescopes, experimental design strategies, SETI instrumentation, signal analysis, and the hallmarks of artificiality that allow us to differentiate between natural astrophysical emissions and intelligent interstellar transmissions. If you are already a technical specialist in these areas, feel free to bypass this introduction, and proceed directly to the subsequent chapters.

SETI VIA LEAKAGE FROM LIGHT SAILS IN EXOPLANETARY SYSTEMS

DOE Office of Scientific and Technical Information (OSTI.GOV)

Guillochon, James; Loeb, Abraham, E-mail: jguillochon@cfa.harvard.edu, E-mail: aloeb@cfa.harvard.edu

The primary challenge of rocket propulsion is the burden of needing to accelerate the spacecraft’s own fuel, resulting in only a logarithmic gain in maximum speed as propellant is added to the spacecraft. Light sails offer an attractive alternative in which fuel is not carried by the spacecraft, with acceleration being provided by an external source of light. By artificially illuminating the spacecraft with beamed radiation, speeds are only limited by the area of the sail, heat resistance of its material, and power use of the accelerating apparatus. In this paper, we show that leakage from a light sail propulsionmore » apparatus in operation around a solar system analogue would be detectable. To demonstrate this, we model the launch and arrival of a microwave beam-driven light sail constructed for transit between planets in orbit around a single star, and find an optimal beam frequency on the order of tens of GHz. Leakage from these beams yields transients with flux densities of Jy and durations of tens of seconds at 100 pc. Because most travel within a planetary system would be conducted between the habitable worlds within that system, multiply transiting exoplanetary systems offer the greatest chance of detection, especially when the planets are in projected conjunction as viewed from Earth. If interplanetary travel via beam-driven light sails is commonly employed in our galaxy, this activity could be revealed by radio follow-up of nearby transiting exoplanetary systems. The expected signal properties define a new strategy in the search for extraterrestrial intelligence (SETI)« less

Wideband waveguide polarizer development for SETI

NASA Technical Reports Server (NTRS)

Lee, P.; Stanton, P.

1991-01-01

A wideband polarizer for the Deep Space Network (DSN) 34 meter beam waveguide antenna is needed for the Search for Extraterrestrial Intelligence (SETI) project. The results of a computer analysis of a wideband polarizer are presented.

What is SETI?

PubMed

Tarter, J

2001-12-01

This paper describes the efforts of SETI that are going on around the world. It presents a brief rationale for the choice of methodology and the limits that can be set on the basis of such results to date.

The Breakthrough Listen Initiative and the Future of the Search for Intelligent Life

NASA Astrophysics Data System (ADS)

Enriquez, J. Emilio; Siemion, Andrew; Falcke, Heino; Croft, Steve; DeBoer, David R.; Gajjar, Vishal; Hickish, Jack; Isaacson, Howard T.; Lebofsky, Matt; MacMahon, David; Price, Danny C.; Tellis, Nate; Werthimer, Dan; ter Veen, Sander; Garrett, Michael A.; Hellbourg, Greg

2017-01-01

Unprecedented recent results in the fields of exoplanets and astrobiology have dramatically increased the interest in the potential existence of intelligent life elsewhere in the galaxy. Additionally, the capabilities of modern Searches for Extraterrestrial Intelligence (SETI) have increased tremendously. Much of this improvement is due to the ongoing development of wide bandwidth radio instruments and the Moore’s Law increase in computational power over the previous decades. Together, these instrumentation improvements allow for narrow band signal searches of billions of frequency channels at once.The Breakthrough Listen Initiative (BL) was launched on July 20, 2015 at the Royal Society in London, UK with a charge to conduct the most comprehensive and sensitive search for advanced life in humanity’s history. Here we detail important milestones achieved during the first year of the program, describe the key BL SETI surveys and briefly describe current facilities, including the Green Bank Telescope, the Automated Planet Finder and the Parkes Observatory.Complementary to the BL initiative (at a smaller scale), pioneering SETI work at low radio frequencies (20-250 MHz) is being undertaken with the LOw Frequency ARray (LOFAR). This program uses simple fixed-stationary antennas and multiple phased-array beams formed in a supercomputer to search many targets at once and will lay the groundwork for future searches with SKA1-low and mid frequency aperture array pathfinders. We will present the results of a volume complete sample of nearby stars (< 5pc) observed with LOFAR, searching for drifting narrow band signals with expected Doppler drifts covering a wide range of potential transmitter host planets.We conclude with a brief view towards future SETI searches with upcoming next-generation radio facilities such as SKA and ngVLA.

Reoptimization of the Ohio State University radio telescope for the NASA SETI program

NASA Technical Reports Server (NTRS)

Dixon, R. S.

1991-01-01

The Ohio State University radiotelescope is the second largest radio telescope in the United States, equivalent in collecting area (2200 sq m) to a 175-foot diameter dish. For the past 17 years it has been dedicated fulltime to SETI, and it is now being considered by NASA for selection as the NASA dedicated SETI observatory. The telescope was originally designed, optimized, and used as an all-sky survey instrument to create detailed maps and catalogs of the radio astronomical sky. For the SETI Program, some re-optimizations are required. Right ascension tracking for one to two hours (depending on the declination) was achieved by exploiting the exceptionally large f/d ratio of the telescope. The feed horns were mounted on a large moveable, rubber-tired cart which is capable of a total motion of 100 feet. The cart can carry many horns, making possible simultaneous observations at many sky directions and frequency ranges. Rapid declination movement and its automation will be accomplished through simplification of the existing braking system, and replacement of older mechanical sensors by modern electronic inclinometers and proximity detectors. Circular polarization capability will be achieved through an increase in the number of horizontal wires in the reflector mesh, or addition of a finer mesh on top of the existing one. The telescope has great inherent resistance to radio frequency interference, due to its ground-mounted feed horns and shielding by the large reflectors of half the horizon. The resistance was recently increased further by installation of rolled-edges and diffraction-trapping gratings on the feed horns. If further shielding should be required, inexpensive side shields could be added to the telescope, making it a totally closed structure on all four sides.

Educating the next generation of SETI scientists: Voyages through time

NASA Astrophysics Data System (ADS)

DeVore, Edna; Tarter, Jill; Fisher, Jane; O'Sullivan, Kathleen; Pendleton, Yvonne; Taylor, Sam; Burke, Margaret

2003-08-01

The search for extraterrestrial intelligence (SETI) could succeed tomorrow, or not for many generations, or never. SETI scientists are very cognizant of the need to train the next generation of researchers who can carry on this vast scientific exploration. Previously, the SETI Institute has met this challenge by developing supplementary teacher's guides for elementary and middle schools called "Life In the Universe" and published by Teacher Ideas Press. Currently, we are engaged in a far more challenging project that is funded primarily by the National Science Foundation (NSF). The SETI Institute is creating a year long, interdisciplinary, high school science curriculum called "Voyages Through Time: Everything Evolves". We are using the theme of evolution to weave a panoramic vista for students that begins with the origin of the universe, encompasses our own origin and evolution, and looks at the evolution of technology and our possible future. By integrating different scientific and technical disciplines to explore how we answer fundamentally important questions, we hope to excite and motivate high school students with the opportunities offered by the way science is practiced today. We invite them to plan a future in which they help to enrich the answers to the big questions: Where did I come from? Where am I going? is anybody else out there? Voyages Through Time consists of six modules on CD-ROMs for teachers and students that have been extensively tested both regionally and nationally. Publication is expected in 2003. The partners in the development of this curriculum are the SETI Institute, NASA Ames Research Center, California Academy of Sciences, and San Francisco State University. Voyages Through Time is funded by the NSF (IMD # 9730693) with additional support from NASA, Hewlett Packard Company, The Foundation for Microbiology, and the Federated Charitable Campaign. For further information, visit: http://www.seti.org/education/Welcome.html.

Efficiency in SETI

NASA Astrophysics Data System (ADS)

Shostak, Seth

2011-02-01

While modern SETI experiments are often highly sensitive, reaching detection limits of 10 -25 W/m 2 Hz in the radio, interstellar distances imply that if extraterrestrial societies are using isotropic or broad-beamed transmitters, the power requirements for their emissions are enormous. Indeed, isotropic transmissions to the entire Galaxy, sufficiently intense to be detectable by our current searches, would consume power comparable to the stellar insolation of an Earth-size planet. In this paper we consider how knowledge can be traded for power, and how, and to what degree, astronomical accuracy can reduce the energy costs of a comprehensive transmission program by putative extraterrestrials. Indeed, an exploration of how far this trade-off might be taken suggests that extraterrestrial transmitting strategies of civilizations only modestly more advanced than our own would be, as are our SETI receiving experiments, inexpensive enough to allow multiple efforts. We explore the consequences this supposition has for our SETI listening experiments.

VLSI processors for signal detection in SETI

NASA Technical Reports Server (NTRS)

Duluk, J. F.; Linscott, I. R.; Peterson, A. M.; Burr, J.; Ekroot, B.; Twicken, J.

1989-01-01

The objective of the Search for Extraterrestrial Intelligence (SETI) is to locate an artificially created signal coming from a distant star. This is done in two steps: (1) spectral analysis of an incoming radio frequency band, and (2) pattern detection for narrow-band signals. Both steps are computationally expensive and require the development of specially designed computer architectures. To reduce the size and cost of the SETI signal detection machine, two custom VLSI chips are under development. The first chip, the SETI DSP Engine, is used in the spectrum analyzer and is specially designed to compute Discrete Fourier Transforms (DFTs). It is a high-speed arithmetic processor that has two adders, one multiplier-accumulator, and three four-port memories. The second chip is a new type of Content-Addressable Memory. It is the heart of an associative processor that is used for pattern detection. Both chips incorporate many innovative circuits and architectural features.

VLSI processors for signal detection in SETI.

PubMed

Duluk, J F; Linscott, I R; Peterson, A M; Burr, J; Ekroot, B; Twicken, J

1989-01-01

The objective of the Search for Extraterrestrial Intelligence (SETI) is to locate an artificially created signal coming from a distant star. This is done in two steps: (1) spectral analysis of an incoming radio frequency band, and (2) pattern detection for narrow-band signals. Both steps are computationally expensive and require the development of specially designed computer architectures. To reduce the size and cost of the SETI signal detection machine, two custom VLSI chips are under development. The first chip, the SETI DSP Engine, is used in the spectrum analyzer and is specially designed to compute Discrete Fourier Transforms (DFTs). It is a high-speed arithmetic processor that has two adders, one multiplier-accumulator, and three four-port memories. The second chip is a new type of Content-Addressable Memory. It is the heart of an associative processor that is used for pattern detection. Both chips incorporate many innovative circuits and architectural features.

Evo-SETI Theory and Information Gap among Civilizations

NASA Astrophysics Data System (ADS)

Maccone, Claudio

2016-05-01

In a series of recent papers (Refs. [1] through [9]) this author gave the equations of his mathematical model of Evolution and SETI, simply called "Evo-SETI". Key features of Evo-SETI are: 1) The Statistical Drake Equation is the extension of the classical Drake equation into Statistics. Probability distributions of the number of ET civilizations in the Galaxy (lognormals) were given, and so is the probable distribution of the distance of ETs from us. 2) Darwinian Evolution is re-defined as a Geometric Brownian Motion (GBM) in the number of living species on Earth over the last 3.5 billion years. Its mean value grew exponentially in time and Mass Extinctions of the past are accounted for as unpredictable low GBM values. 3) The exponential growth of the number of species during Evolution is the geometric locus of the peaks of a one-parameter family of lognormal distributions (b-lognormals, starting each at a different time b=birth) constrained between the time axis and the exponential mean value. This accounts for cladistics (i.e. Evolution Lineages). The above key features of Evo-SETI Theory were already discussed by this author in Refs. [1] through [9]. Now about this paper's "novelties". 4) The lifespan of a living being, let it be a cell, an animal, a human, a historic human society, or even an ET society, is mathematically described as a finite b-lognormal. This author then described mathematically the historical development of eight human historic civilizations, from Ancient Greece to the USA, by virtue of b-lognormals. 5) Finally, the b-lognormal's entropy is the measure of a civilization's advancement level. By measuring the entropy difference between Aztecs and Spaniards in 1519, this author was able to account mathematically for the 20-million-Aztecs defeat by a few thousand Spaniards, due to the latter's technological (i.e. entropic) superiority. The same might unfortunately happen to Humans when they will face an ET superior civilization for the first time. Now the question is: whenever a new exoplanet is discovered, where does that exoplanet stand in its evolution towards life as we have it on Earth nowadays, or beyond? This is the central question of SETI. This author hopes that his Evo-SETI Theory will help addressing this question when SETI astronomers will succeed in finding the first "life signatures" or even ET Civilizations.

Fermi paradox and alternative strategies for SETI programs - The anthropic principle and the search for close solar analogs

NASA Astrophysics Data System (ADS)

Fracassini, Massimo; Pasinetti Fracassini, Laura E.; Pasinetti, Antonio L.

1988-07-01

The Anthropic Principle, a new trend of modern cosmology, claims that the origin of life and the development of intelligent beings on the Earth is the result of highly selective biological processes, strictly tuned in the fundamental physical characteristics of the Universe. This principle could account for the failure of some programs of search for extraterrestrial intelligences (SETI) and suggests the search for strict solar analogs as a primary target for SETI strategies. In this connection, the authors have selected 22 solar analogs and discussed their choice.

A strategic 'viewfinder' for SETI research

NASA Astrophysics Data System (ADS)

Teodorani, Massimo

2014-12-01

One of the most important reasons why unsuccessful results have been obtained so far by the SETI Project is due to the fact that no sure targets to aim at have been available up-to the present state of research. All-sky surveys, even if very accurate and complete, might result to be time-consuming. SETI needs at least one effective 'viewfinder' in order that a true targeted research is carried out with a possible success. The best foundation to get this can be identified with the search for the evidence of extraterrestrial astro-engineering activity in form of the Dyson spheres predicted by theory. The existence of such stellar objects can be ascertained by finding the evidence of two main signatures in stars of solar spectral type: infrared excess and anomalous light curves due to transiting artificial objects. These are probably the most powerful viewfinders in order to allow SETI techniques for intelligent signal search to be aimed at more appropriate targets. This paper is not intended to be a research paper but rather a review paper whose goal is not to present calculations and/or operational research but rather to be a research proposal for a more focused research in SETI just using Dyson Spheres as crucial markers.

A directed search for extraterrestrial laser signals

NASA Technical Reports Server (NTRS)

Betz, A.

1991-01-01

The focus of NASA's Search for Extraterrestrial Intelligence (SETI) Program is on microwave frequencies, where receivers have the best sensitivities for the detection of narrowband signals. Such receivers, when coupled to existing radio telescopes, form an optimal system for broad area searches over the sky. For a directed search, however, such as toward specific stars, calculations show that infrared wavelengths can be equally as effective as radio wavelengths for establishing an interstellar communication link. This is true because infrared telescopes have higher directivities (gains) that effectively compensate for the lower sensitivities of infrared receivers. The result is that, for a given level of transmitted power, the signal to noise ratio for communications is equally as good at infrared and radio wavelengths. It should also be noted that the overall sensitivities of both receiver systems are quite close to their respective fundamental limits: background thermal noise for the radio frequency system and quantum noise for the infrared receiver. Consequently, the choice of an optimum communication frequency may well be determined more by the achievable power levels of transmitters rather than the ultimate sensitivities of receivers at any specific frequency. In the infrared, CO2 laser transmitters with power levels greater than 1 MW can already be built on Earth. For a slightly more advanced civilization, a similar but enormously more powerful laser may be possible using a planetary atmosphere rich in CO2. Because of these possibilities and our own ignorance of what is really the optimum search frequency, a search for narrowband signals at infrared frequencies should be a part of a balanced SETI Program. Detection of narrowband infrared signals is best done with a heterodyne receiver functionally identical to a microwave spectral line receiver. We have built such a receiver for the detection of CO2 laser radiation at wavelengths near 10 microns. The spectrometer uses a high-speed HgCdTe diode as the photomixer and a small CO2 laser as the local oscillator. Output signals in the intermediate frequency range 0.1-2.6 GHz are processed by a 1000-channel acousto-optic signal processor. The receiver is being used on a 1.5-m telescope on Mt. Wilson to survey a selected sample of 150 nearby stars. The current status of the work is discussed along with future project plans.

ARC-2009-ACD09-0108-048

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-046

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-049

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-047

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Photo Credit: NASA/SETI/P. Jenniskens

Representing culture in interstellar messages

NASA Astrophysics Data System (ADS)

Vakoch, Douglas A.

2008-09-01

As scholars involved with the Search for Extraterrestrial Intelligence (SETI) have contemplated how we might portray humankind in any messages sent to civilizations beyond Earth, one of the challenges they face is adequately representing the diversity of human cultures. For example, in a 2003 workshop in Paris sponsored by the SETI Institute, the International Academy of Astronautics (IAA) SETI Permanent Study Group, the International Society for the Arts, Sciences and Technology (ISAST), and the John Templeton Foundation, a varied group of artists, scientists, and scholars from the humanities considered how to encode notions of altruism in interstellar messages . Though the group represented 10 countries, most were from Europe and North America, leading to the group's recommendation that subsequent discussions on the topic should include more globally representative perspectives. As a result, the IAA Study Group on Interstellar Message Construction and the SETI Institute sponsored a follow-up workshop in Santa Fe, New Mexico, USA in February 2005. The Santa Fe workshop brought together scholars from a range of disciplines including anthropology, archaeology, chemistry, communication science, philosophy, and psychology. Participants included scholars familiar with interstellar message design as well as specialists in cross-cultural research who had participated in the Symposium on Altruism in Cross-cultural Perspective, held just prior to the workshop during the annual conference of the Society for Cross-cultural Research . The workshop included discussion of how cultural understandings of altruism can complement and critique the more biologically based models of altruism proposed for interstellar messages at the 2003 Paris workshop. This paper, written by the chair of both the Paris and Santa Fe workshops, will explore the challenges of communicating concepts of altruism that draw on both biological and cultural models.

A symbiotic approach to SETI observations: use of maps from the Westerbork Synthesis Radio Telescope

NASA Technical Reports Server (NTRS)

Tarter, J. C.; Israel, F. P.

1982-01-01

High spatial resolution continuum radio maps produced by the Westerbork Synthesis Radio Telescope (WSRT) of The Netherlands at frequencies near the 21 cm HI line have been examined for anomalous sources of emmission coincident with the locations of nearby bright stars. From a total of 542 stellar positions investigated, no candidates for radio stars or ETI signals were discovered to formal limits on the minimum detectable signal ranging from 7.7 x 10(-22) W/m2 to 6.4 x 10(-24) W/m2. This preliminary study has verified that data collected by radio astronomers at large synthesis arrays can profitably be analysed for SETI signals (in a non-interfering manner) provided only that the data are available in the form of a more or less standard two dimensional map format.

A symbiotic approach to SETI observations: use of maps from the Westerbork Synthesis Radio Telescope.

PubMed

Tarter, J C; Israel, F P

1982-01-01

High spatial resolution continuum radio maps produced by the Westerbork Synthesis Radio Telescope (WSRT) of The Netherlands at frequencies near the 21 cm HI line have been examined for anomalous sources of emmission coincident with the locations of nearby bright stars. From a total of 542 stellar positions investigated, no candidates for radio stars or ETI signals were discovered to formal limits on the minimum detectable signal ranging from 7.7 x 10(-22) W/m2 to 6.4 x 10(-24) W/m2. This preliminary study has verified that data collected by radio astronomers at large synthesis arrays can profitably be analysed for SETI signals (in a non-interfering manner) provided only that the data are available in the form of a more or less standard two dimensional map format.

ARC-2009-ACD09-0108-043

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Pyramids Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-005

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (find) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-002

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (search team) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-037

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Peter Jenniskens Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-012

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (group photo) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-033

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Nubian House) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-019

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite #4) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-018

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-008

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (first find) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-020

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Meteorite #14) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-015

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Marble Mountain) Photo Credit: NASA/SETI/P. Jenniskens

SETI at the Nancay radiotelescope.

PubMed

Biraud, F

1983-11-01

The Nancay (France) radiotelescope has been used in June, 1981, to search for artificial monochromatic signals from 102 nearby stars, without success. A different approach to SETI is also considered based on the properties of wide band signals. A detection procedure, through Karhunen-Loeve analysis, is suggested.

SETI in the future - Toward other possible searches

NASA Technical Reports Server (NTRS)

Rummel, John D.

1992-01-01

The future prospects of SETI as a scientific endeavor, both in its own right and with respect to the side benefits to science and society, are discussed. Specifically, the consequences of a successful detection and the prospects for follow-on studies in exobiology are addressed.

ARC-2009-ACD09-0108-007

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (find # 1) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-034

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (perified wood) Photo Credit: NASA/SETI/P. Jenniskens

Anthropological Contributions to the Search for Extraterrestrial Intelligence

NASA Astrophysics Data System (ADS)

Vakoch, D. A.

2009-12-01

Three recent annual conferences of the American Anthropological Association (AAA) have included symposia on the Search for Extraterrestrial Intelligence (SETI). This paper reviews these symposia, which dealt with themes associated with the overarching AAA conference themes for each year: in 2004, the SETI session addressed Anthropology, Archaeology, and Interstellar Communication: Science and the Knowledge of Distant Worlds; in 2005, it dealt with Historical Perspectives on Anthropology and SETI; and in 2006, the session examined Culture, Anthropology, and SETI. Among the topics considered in these symposia were analogues for contact with extraterrestrial intelligence (ETI), examining anthropologists’ experience in the field encountering other cultures-past and present. Similarly, the methodologies of archaeologists provide analogies for making contact with temporally distant civilizations, based on reconstructions from fragmentary information. Case studies helped make such analogies concrete in the symposia. The challenges of comprehending intelligences with different mental worlds was explored through a study of the meetings of Neanderthals and Homo sapiens, for example, while the decryption of Mayan hieroglyphics provided lessons on understanding others of own species.

The Search for Extraterrestrial Intelligence in the 1960s: Science in Popular Culture

NASA Astrophysics Data System (ADS)

Smith, Sierra

2012-01-01

Building upon the advancement of technology during the Second World War and the important scientific discoveries which have been made about the structure and components of the universe, scientists, especially in radio astronomy and physics, began seriously addressing the possibility of extraterrestrial intelligence in the 1960s. The Search for Extraterrestrial Intelligence (SETI) quickly became one of the most controversial scientific issues in the post Second World War period. The controversy played out, not only in scientific and technical journals, but in newspapers and in popular literature. Proponents for SETI, including Frank Drake, Carl Sagan, and Philip Morrison, actively used a strategy of engagement with the public by using popular media to lobby for exposure and funding. This paper will examine the use of popular media by scientists interested in SETI to popularize and heighten public awareness and also to examine the effects of popularization on SETI's early development. My research has been generously supported by the National Radio Astronomy Observatory.

Life in the Universe - Astronomy and Planetary Science Research Experience for Undergraduates at the SETI Institute

NASA Astrophysics Data System (ADS)

Chiar, J.; Phillips, C. B.; Rudolph, A.; Bonaccorsi, R.; Tarter, J.; Harp, G.; Caldwell, D. A.; DeVore, E. K.

2016-12-01

The SETI Institute hosts an Astrobiology Research Experience for Undergraduates (REU) program. Beginning in 2013, we partnered with the Physics and Astronomy Dept. at Cal Poly Pomona, a Hispanic-serving university, to recruit underserved students. Over 11 years, we have served 155 students. We focus on Astrobiology since the Institute's mission is to explore, understand and explain the origin, nature and prevalence of life in the universe. Our REU students work with mentors at the Institute - a non-profit organization located in California's Silicon Valley-and at the nearby NASA Ames Research Center. Projects span research on survival of microbes under extreme conditions, planetary geology, astronomy, the Search for Extraterrestrial Intelligence (SETI), extrasolar planets and more. The REU program begins with an introductory lectures by Institute scientists covering the diverse astrobiology subfields. A week-long field trip to the SETI Institute's Allen Telescope Array (Hat Creek Radio Astronomy Observatory in Northern California) and field experiences at hydrothermal systems at nearby Lassen Volcanic National Park immerses students in radio astronomy and SETI, and extremophile environments that are research sites for astrobiologists. Field trips expose students to diverse environments and allow them to investigate planetary analogs as our scientists do. Students also participate in local trips to the California Academy of Sciences and other nearby locations of scientific interest, and attend the weekly scientific colloquium hosted by the SETI Institute at Microsoft, other seminars and lectures at SETI Institute and NASA Ames. The students meet and present at a weekly journal club where they hone their presentation skills, as well as share their research progress. At the end of the summer, the REU interns present their research projects at a session of the Institute's colloquium. As a final project, students prepare a 2-page formal abstract and 15-minute presentation that mirrors the requirements for professional conference presentations. In collaboration with the mentors, successful projects are selected and funded for submission to national scientific conferences during the subsequent academic year. This program is funded by the NSF AST Grant # 1359346.

A real-time KLT implementation for radio-SETI applications

NASA Astrophysics Data System (ADS)

Melis, Andrea; Concu, Raimondo; Pari, Pierpaolo; Maccone, Claudio; Montebugnoli, Stelio; Possenti, Andrea; Valente, Giuseppe; Antonietti, Nicoló; Perrodin, Delphine; Migoni, Carlo; Murgia, Matteo; Trois, Alessio; Barbaro, Massimo; Bocchinu, Alessandro; Casu, Silvia; Lunesu, Maria Ilaria; Monari, Jader; Navarrini, Alessandro; Pisanu, Tonino; Schilliró, Francesco; Vacca, Valentina

2016-07-01

SETI, the Search for ExtraTerrestrial Intelligence, is the search for radio signals emitted by alien civilizations living in the Galaxy. Narrow-band FFT-based approaches have been preferred in SETI, since their computation time only grows like N*lnN, where N is the number of time samples. On the contrary, a wide-band approach based on the Kahrunen-Lo`eve Transform (KLT) algorithm would be preferable, but it would scale like N*N. In this paper, we describe a hardware-software infrastructure based on FPGA boards and GPU-based PCs that circumvents this computation-time problem allowing for a real-time KLT.

Field test results with the targeted search MCSA. [multi-channel spectrum analyzer for SETI

NASA Technical Reports Server (NTRS)

Tarter, J. C.

1988-01-01

In April 1985, a 74,000 channel prototype of the multichannel spectrum analyzer (MCSA) that NASA plans to use in a systematic search for extraterrestrial intelligence (SETI) was installed at DSS13, a 26 meter R&D antenna facility at the Goldstone Deep Space Network (DSN) site. Since that time the instrumentation has been used to validate the performance of signal detection algorithms using locally injected signals and the weak carriers from distant spacecraft. This paper describes results from the Goldstone Field Tests and plans to move the prototype equipment to other sites where SETI may be conducted in the future.

ETI, SETI and today's public opinion

NASA Astrophysics Data System (ADS)

Pinotti, Roberto

During the last three decades the general public's initial opinions about ETI and SETI changed, turning ignorance, fear and superficiality into a gradual understanding of the importance of these concepts. After a brief analysis of this changing psycho-sociological attitude, the paper provides an "estimate of the situation" about general interest for ETI and SETI, suggesting a growing awareness in today's public opinion. Science fiction movies like Close Encounters of the Third Kind and E.T. the Extra-Terrestrial and popular interest in UFOs as visitors from outer space played a major role in the average man's acceptance of the reality of extra-terrestrial life and its meaning for mankind.

ARC-2009-ACD09-0108-017

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite-brick-reenactment) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-016

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Mauwia checks on find) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-023

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite 3rd-bigone) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-004

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (El-Mahata-Sitah 1) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-040

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Peter Jenniskens meteorite. Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-006

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (find #11 & 12) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-010

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (first one recovered) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-045

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. searching in the desert Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-013

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (line 3rd day) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-021

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite 3rd) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-014

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Lunch at Marble Mountain) Photo Credit: NASA/SETI/P. Jenniskens

Signal processing in SETI.

PubMed

Cullers, D K; Linscott, I R; Oliver, B M

1985-11-01

The development of a multi-channel spectrum analyzer (MCSA) for the SETI program is described. The spectrum analyzer is designed for both all-sky surveys and targeted searches. The mechanisms of the MCSA are explained and a diagram is provided. Detection of continuous wave signals, pulses, and patterns is examined.

ARC-2009-ACD09-0108-003

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Dr Mauwia Shaddad) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-031

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Meteorite search 1) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-024

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite 3rd-geologist) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-022

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite 3rd-22) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-009

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (first one found) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-001

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (approch station 6) Photo Credit: NASA/SETI/P. Jenniskens

Visions of human futures in space and SETI

NASA Astrophysics Data System (ADS)

Wright, Jason T.; Oman-Reagan, Michael P.

2018-04-01

We discuss how visions for the futures of humanity in space and SETI are intertwined, and are shaped by prior work in the fields and by science fiction. This appears in the language used in the fields, and in the sometimes implicit assumptions made in discussions of them. We give examples from articulations of the so-called Fermi Paradox, discussions of the settlement of the Solar System (in the near future) and the Galaxy (in the far future), and METI. We argue that science fiction, especially the campy variety, is a significant contributor to the `giggle factor' that hinders serious discussion and funding for SETI and Solar System settlement projects. We argue that humanity's long-term future in space will be shaped by our short-term visions for who goes there and how. Because of the way they entered the fields, we recommend avoiding the term `colony' and its cognates when discussing the settlement of space, as well as other terms with similar pedigrees. We offer examples of science fiction and other writing that broaden and challenge our visions of human futures in space and SETI. In an appendix, we use an analogy with the well-funded and relatively uncontroversial searches for the dark matter particle to argue that SETI's lack of funding in the national science portfolio is primarily a problem of perception, not inherent merit.

ARC-2009-ACD09-0108-039

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Peter Jenniskens pointing - finds the brick) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-038

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Peter Jenniskens finds the brick. Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-011

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Girls dormatory at station 6) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-028

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. 9meteorite 3rd trip-strange) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-025

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (Meteorite 3rd-several at once) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-027

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite 3rd trip-Insitu.) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-036

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Peter Jenniskens finds meteorites 1) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-035

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. Peter Jenniskens examines 2nd trip finds) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-026

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (emteorite 3rd-three found) Photo Credit: NASA/SETI/P. Jenniskens

Risk and value analysis of SETI

NASA Technical Reports Server (NTRS)

Billingham, J.

1986-01-01

The risks, values, and costs of the SETI project are evaluated and compared with those of the Viking project. Examination of the scientific values, side benefits, and costs of the two projects reveal that both projects provide equal benefits at equal costs. The probability of scientific and technical success is analyzed.

ARC-2009-ACD09-0108-030

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite find 3rd trip 1) Photo Credit: NASA/SETI/P. Jenniskens

ARC-2009-ACD09-0108-029

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (meteorite find - bus gets stuck) Photo Credit: NASA/SETI/P. Jenniskens

A New Approach Towards Deployment of Far Side Lunar SETI Using a Tethered Link to a Near Side Antenna

NASA Astrophysics Data System (ADS)

Datta, L. V.; Guven, U.; Goel, E.

2017-10-01

Keeping in pace with the recent growth in interest in deployable space telescopes for detection of extra-solar objects, we suggest a feasible approach to make a lunar far side SETI mission a reality with the technology. available today.

OPTICAL SETI OBSERVATIONS OF THE ANOMALOUS STAR KIC 8462852

DOE Office of Scientific and Technical Information (OSTI.GOV)

Schuetz, Marlin; Vakoch, Douglas A.; Shostak, Seth

To explore the hypothesis that KIC 8462852's aperiodic dimming is caused by artificial megastructures in orbit, rather than a natural cause such as cometary fragments in a highly elliptical orbit, we searched for electromagnetic signals from KIC 8462852 indicative of extraterrestrial intelligence. The primary observations were in the visible optical regime using the Boquete Optical SETI Observatory in Panama. In addition, as a recommended preparatory exercise for the possible future detection of a candidate signal, three of six observing runs simultaneously searched radio frequencies at the Allen Telescope Array in California. No periodic optical signals greater than 67 photons m{supmore » −2} within a time frame of 25 ns were seen. If, for example, any inhabitants of KIC 8462852 were targeting our solar system with 5 MJ laser pulses, locally illuminating an approximately 3 au diameter disk, the signal could have been detected at the Boquete Observatory. The limits on narrowband radio signals were 180–300 Jy Hz at 1 and 8 GHz, respectively. While the power requirement for a detectable, isotropic narrowband radio transmission from KIC 8462852 is quite high, even modest targeting on the part of the putative extraterrestrials can lower this power substantially.« less

Optical SETI Observations of the Anomalous Star KIC 8462852

NASA Astrophysics Data System (ADS)

Schuetz, Marlin; Vakoch, Douglas A.; Shostak, Seth; Richards, Jon

2016-07-01

To explore the hypothesis that KIC 8462852's aperiodic dimming is caused by artificial megastructures in orbit, rather than a natural cause such as cometary fragments in a highly elliptical orbit, we searched for electromagnetic signals from KIC 8462852 indicative of extraterrestrial intelligence. The primary observations were in the visible optical regime using the Boquete Optical SETI Observatory in Panama. In addition, as a recommended preparatory exercise for the possible future detection of a candidate signal, three of six observing runs simultaneously searched radio frequencies at the Allen Telescope Array in California. No periodic optical signals greater than 67 photons m-2 within a time frame of 25 ns were seen. If, for example, any inhabitants of KIC 8462852 were targeting our solar system with 5 MJ laser pulses, locally illuminating an approximately 3 au diameter disk, the signal could have been detected at the Boquete Observatory. The limits on narrowband radio signals were 180-300 Jy Hz at 1 and 8 GHz, respectively. While the power requirement for a detectable, isotropic narrowband radio transmission from KIC 8462852 is quite high, even modest targeting on the part of the putative extraterrestrials can lower this power substantially.

The Search for Extraterrestrial Intelligence

NASA Technical Reports Server (NTRS)

Tucher, A.

1985-01-01

The development of NASA's SETI project and strategies for searching radio signals are reviewed. A computer program was written in FORTRAN to set up data from observations taken at Jodrell Bank. These data are to be used with a larger program to find the average radio signal strength at each of the approximately 63,000 channels.

Introduction to the METI Issues

NASA Astrophysics Data System (ADS)

Benford, J.

Understanding the controversy over "Messages to Extra Terrestrial Intelligence" or METI requires a grounding in the history and rationale of SETI (Search for ETI). Insights since the turn of the century have changed SETI's scientific basis. Continued null results from the radio search do not invalidate continuing effort, but they do raise questions about long-held assumptions. Modified search strategies are discussed. The Great Silence or Fermi Paradox is appraised, along with the disruptive plausibility of interstellar travel. Psychological motivations for METI are considered. With this underpinning, we consider why a small cadre of SETI-ist radio astronomers have resisted the notion of international consultations before humanity takes a brash and irreversible step into METI, shouting our presence into the cosmos.

Searching for extraterrestrial intelligence - The ultimate exploration

NASA Technical Reports Server (NTRS)

Black, D.; Tarter, J.; Cuzzi, J. N.; Conners, M.; Clark, T. A.

1977-01-01

A survey highlighting the central issues of the SETI program (Search for Extraterrestrial Intelligence), including its rationale, scope, search problems, and goals is presented. Electromagnetic radiation is suggested as the most likely means via which knowledge of extraterrestrial intelligence will be obtained, and the variables governing these signals are discussed, including: signal frequency and polarization, state, possible coordinates, and signal duration. The modern history of SETI and NASA's involvement is briefly reviewed, and the search strategies used by the Jet Propulsion Laboratory and the Ames Research Center are discussed and compared. Some of the potential scientific and cultural impacts of the SETI program are mentioned, noting advancements in technological, biological, and chemical research.

The search for extra-terrestrial intelligence.

PubMed

Drake, Frank

2011-02-13

Modern history of the search for extra-terrestrial intelligence is reviewed. The history of radio searches is discussed, as well as the major advances that have occurred in radio searches and prospects for new instruments and search strategies. Recent recognition that searches for optical and infrared signals make sense, and the reasons for this are described, as well as the equipment and special detection methods used in optical searches. The long-range future of the search for extra-terrestrial intelligence (SETI) is discussed in the context of the history of rapid change, on the cosmic and even the human time scale, of the paradigms guiding SETI searches. This suggests that SETI searches be conducted with a very open mind.

Radio SETI Observations of the Anomalous Star KIC 8462852

NASA Astrophysics Data System (ADS)

Harp, G. R.; Richards, Jon; Shostak, Seth; Tarter, J. C.; Vakoch, Douglas A.; Munson, Chris

2016-07-01

We report on a search for the presence of signals from extraterrestrial intelligence in the direction of the star system KIC 8462852. Observations were made at radio frequencies between 1 and 10 GHz using the Allen Telescope Array. No narrowband radio signals were found at a level of 180-300 Jy in a 1 Hz channel, or medium band signals above 10 Jy in a 100 kHz channel.

The next steps in Seti-Italia science and technology

NASA Astrophysics Data System (ADS)

Montebugnoli, Stelio; Cosmovici, Cristiano; Monari, Jader; Pluchino, Salvatore; Zoni, Luca; Bartolini, Marco; Orlati, Andrea; Salerno, Emma; Schillirò, Francesco; Pupillo, Giuseppe; Perini, Federico; Bianchi, Germano; Tani, Mattia; Amico, Leonardo

2010-02-01

The Italian Medicina Radioastronomy Station (nearby Bologna) is equipped with two antennas: the 32 mt (VLBI) dish and the Northern Cross, a large T-shaped parabolic/cylindrical antenna (30.000 sqm). So far Seti observations have been performed using a SERENDIP IV high resolution spectrometer connected to the VLBI dish in "piggy back" mode configuration. In order to facilitate data interpretation and to introduce innovative methods to search for possible extraterrestrial signals, we are planning to make use of the large UHF Northern Cross transit telescope. Sky observations performed at least within two months, could provide for each day a number of matrices labeled according to the observing sidereal time. The entire set of matrices will be characterized by an averaged spectrum on each row per day. Keeping constant the transit antenna declination, a coherent signal coming from a definite position of the sky, would produce a "flag on" in the same submatrix at the same sidereal time. Detections collected in this way could be considered "confirmed" since they always come from the same region of the sky and are observed regularly. An extremely powerful processing board based on a multi-FPGAs (Field Programmable Gate Array) core was developed and is now under programming. This is conceived to be the processing core for this new kind of investigations.

The West Virginia Special Education Technology Integration Specialist (SETIS) Program: 2012-2014 Evaluation Report

ERIC Educational Resources Information Center

Stohr, Amber D.

2015-01-01

The Special Education Technology Integration Specialist (SETIS) program provides professional development for special education teachers to assist them in achieving proficiency with 21st Century Technology Tools. The program completed its eighth and ninth rounds during the 2012-2013 and 2013-2014 school years, training more than 30 special…

On Predictability of System Anomalies in Real World

DTIC Science & Technology

2011-08-01

distributed system SETI @home [44]. Different from the above work, this work focuses on quantifying the predictability of real-world system anomalies. V...J.-M. Vincent, and D. Anderson, “Mining for statistical models of availability in large-scale distributed systems: An empirical study of seti @home,” in Proc. of MASCOTS, sept. 2009.

ARC-2009-ACD09-0108-032

NASA Image and Video Library

2009-02-08

An SUV-sized Asteroid 2008TC# Impacts on October 7, 2008 in the Nubian Desert, Northern Sudan: Dr. Peter Jenniskens, NASA/SETI joined Muawia Shaddas of the University of Khartoum in leading an expedition on a search for samples. (image used as cover for March 26, 2009 journal Nature) Photo Credit: NASA/SETI/P. Jenniskens

Octopamine mediated relaxation of maintained and catch tension in locust skeletal muscle.

PubMed

Evans, P D; Siegler, M V

1982-03-01

1. The modulatory actions of an identified octopaminergic neurone (DUMETi) that projects to the extensor-tibiae muscle of the locust hind leg depend upon the frequency of stimulation of the slow motoneurone (SETi) to this muscle. 2. At low frequencies of SETi stimulation (1Hz and below) the predominant modulatory effects are increases in the amplitude and relaxation rate of twitch tension. At higher frequencies, where twitches summate but tetanus is incomplete (up to 20 Hz), the reduction of maintained tension becomes considerably more important. 3. Both octopamine application and DUMETi stimulation reduce the amount of catch tension displayed by the extensor muscle when SETi is fired in a variety of different stimulus patterns. The extensor-tibiae muscle is itself 'pattern sensitive' since is shows a 'positive spacing effect' when SETi is stimulated at an average frequency of 1 Hz. 4. It is suggested that a primary function of DUMETi is to change the response of the muscle from one that favours maintenance of posture to one that favours rapid changes in joint position or force, such as might occur during locomotion.

Octopamine mediated relaxation of maintained and catch tension in locust skeletal muscle.

PubMed Central

Evans, P D; Siegler, M V

1982-01-01

1. The modulatory actions of an identified octopaminergic neurone (DUMETi) that projects to the extensor-tibiae muscle of the locust hind leg depend upon the frequency of stimulation of the slow motoneurone (SETi) to this muscle. 2. At low frequencies of SETi stimulation (1Hz and below) the predominant modulatory effects are increases in the amplitude and relaxation rate of twitch tension. At higher frequencies, where twitches summate but tetanus is incomplete (up to 20 Hz), the reduction of maintained tension becomes considerably more important. 3. Both octopamine application and DUMETi stimulation reduce the amount of catch tension displayed by the extensor muscle when SETi is fired in a variety of different stimulus patterns. The extensor-tibiae muscle is itself 'pattern sensitive' since is shows a 'positive spacing effect' when SETi is stimulated at an average frequency of 1 Hz. 4. It is suggested that a primary function of DUMETi is to change the response of the muscle from one that favours maintenance of posture to one that favours rapid changes in joint position or force, such as might occur during locomotion. PMID:6808122

Intrinsic rhythm and basic tonus in insect skeletal muscle.

PubMed

Hoyle, G

1978-04-01

The jumping muscle of orthopterous insects contains fibres that possess an intrinsic rhythm (IR) of slow contraction. The contributing fibres are generally synchronized, but as many as three or four pacemakers are present. The frequency, amplitude and duration of IR contractions fluctuate erratically over a 24 h period. Metathoracic DUM neurone bursts suppress IR for a few minutes. Other, unidentified dorsal neurones enhance its amplitude. In addition to IR, the extensor tibiae shows intrinsic basic tonus (BT). BT is relaxed for several s by low-frequency burst output from unidentified metathoracic dorsal neurones. DUM neurone bursts may enhance extensor BT, relax it, or leave it unaffected. The effects on IR of various regimes of activity in the slow extensor tibiae (SETi) and the common inhibitor (CI) axons were examined. CI affects IR when stimulated at frequencies above 2 Hz. It causes amplitude depression and reduced duration of individual IR contractions as well as increased frequency. At 30 Hz and above, CI completely suppresses IR. An enhanced IR contraction starts within a few milliseconds of the termination of a CI train. At low frequencies (below 10 Hz) SETi causes increased frequency and decreased amplitude of IR, with a depressed IR contraction following cessation of the SETi burst. At frequencies above 15 Hz the SETi-evoked contraction dominates tension development, though IR summates with it during the rising phase. In quiescent preparations not showing IR, SETi stimulation at 10 Hz often started up IR. Single SETi or FETi impulses can initiate an IR contraction, and cause altered phasing, with up to a quintupling of frequency. After a critical period has elapsed following the onset of an IR contraction, a single single impulse in any one of the three axons will terminate it abruptly. The early termination is followed by a reduced interval which is proportional to the reduced IR contraction time. The rhythm of accumulated readiness to go into an IR contraction is independent of the pacemaker rhythm that initiates the contraction.

Some perspectives on research into the biological response to non-ionizing electromagnetic radiation. [relation to SETI, SPS, and other government projects

NASA Technical Reports Server (NTRS)

Sharp, J. C.

1979-01-01

Research on the biological effects of RF radiation in the United States has undergone a series of swings during the last three decades. The resurgence of research during the past decade is examined in the light of two projects: the proposed Space Power Station and SETI.

SETI group let by Barney Oliver, John Wolfe and John Billingham (in middle standing) lead a 1976

NASA Technical Reports Server (NTRS)

1976-01-01

SETI group let by Barney Oliver, John Wolfe and John Billingham (in middle standing) lead a 1976 discussion on the best strategies in the Search for Extraterrestrial Intelligence. Joining the discussion are L-R; Charles Seeger, Dario Black, Mary Connors, (Oliver, Wolfe, Billingham) and Larry Lesyna, (seated) Mark Stull.

SETI-EC: SETI Encryption Code

NASA Astrophysics Data System (ADS)

Heller, René

2018-03-01

The SETI Encryption code, written in Python, creates a message for use in testing the decryptability of a simulated incoming interstellar message. The code uses images in a portable bit map (PBM) format, then writes the corresponding bits into the message, and finally returns both a PBM image and a text (TXT) file of the entire message. The natural constants (c, G, h) and the wavelength of the message are defined in the first few lines of the code, followed by the reading of the input files and their conversion into 757 strings of 359 bits to give one page. Each header of a page, i.e. the little-endian binary code translation of the tempo-spatial yardstick, is calculated and written on-the-fly for each page.

Millions and Billions of Channels

NASA Astrophysics Data System (ADS)

Leigh, Darren; Horowitz, Paul

The history of the Harvard SETI group is inextricably linked with the history of Paul Horowitz. Horowitz became enamored with SETI as a student at Harvard, reading Ed Purcell's paper "Radio Astronomy and Communication Through Space" (Purcell, 1960), discussing with his roommates a class that Carl Sagan was teaching there using a draft of Shklovskii and Sagan's "Intelligent Life in the Universe" (Shklovskii and Sagan, 1966) as a text, and finally attending a Loeb Lecture series at Harvard by Frank Drake (Drake, 1969). The series was officially about pulsars but Drake did manage to slip in one inspiring talk about SETI. Horowitz says that "It was this lecture that launched me into this field; it was a revelation that you could go beyond idle speculation - you could actually calculate stuff."

OAST Space Theme Workshop. Volume 2: Theme summary. 3: Search for extraterrestrial intelligence (no. 9). A: Theme statement. B. 26 April 1976 presentation. C. Summary. D. Newer initiatives (form 4). E. Initiative actions (form 5)

NASA Technical Reports Server (NTRS)

1976-01-01

Preliminary (1977-1983), intermediate (1982-1988), and long term (1989+) phases of the search for extraterrestrial intelligence (SETI) program are examined as well as the benefits to be derived in radioastronomy and the problems to be surmounted in radio frequency interference. The priorities, intrinsic value, criteria, and strategy for the search are discussed for both terrestrial and lunar-based CYCLOPS and for a space SETI system located at lunar liberation point L4. New initiatives related to antenna independent technology, multichannel analyzers, and radio frequency interference shielding are listed. Projected SETI program costs are included.

Analysis of a crossed Bragg-cell acousto optical spectrometer for SETI

NASA Technical Reports Server (NTRS)

Gulkis, S.

1986-01-01

The search for radio signals from extraterrestrial intelligent (SETI) beings requires the use of large instantaneous bandwidth (500 MHz) and high resolution (20 Hz) spectrometers. Digital systems with a high degree of modularity can be used to provide this capability, and this method has been widely discussed. Another technique for meeting the SETI requirement is to use a crossed Bragg-cell spectrometer as described by Psaltis and Casasent (1979). This technique makes use of the Folded Spectrum concept, introduced by Thomas (1966). The Folded Spectrum is a two-dimensional Fourier Transform of a raster scanned one-dimensional signal. It is directly related to the long one-dimensional spectrum of the original signal and is ideally suited for optical signal processing.

Analysis of a crossed Bragg-cell acousto optical spectrometer for SETI

NASA Astrophysics Data System (ADS)

Gulkis, S.

1986-10-01

The search for radio signals from extraterrestrial intelligent (SETI) beings requires the use of large instantaneous bandwidth (500 MHz) and high resolution (20 Hz) spectrometers. Digital systems with a high degree of modularity can be used to provide this capability, and this method has been widely discussed. Another technique for meeting the SETI requirement is to use a crossed Bragg-cell spectrometer as described by Psaltis and Casasent (1979). This technique makes use of the Folded Spectrum concept, introduced by Thomas (1966). The Folded Spectrum is a two-dimensional Fourier Transform of a raster scanned one-dimensional signal. It is directly related to the long one-dimensional spectrum of the original signal and is ideally suited for optical signal processing.

Ultranarrowband searches for extraterrestrial intelligence with dedicated signal-processing hardware.

PubMed

Horowitz, P; Matthews, B S; Forster, J; Linscott, I; Teague, C C; Chen, K; Backus, P

1986-01-01

Multichannel spectroscopy with millihertz resolution constitutes an attractive strategy for a microwave search for extraterrestrial intelligence (SETI), assuming the transmission of a narrow-band radiofrequency beacon. Such resolution matches the properties of the interstellar medium, and the necessary receiver Doppler corrections provide a high degree of interference rejection. We have constructed a frequency-agile swept receiver with an 8,388,608-channel spectrum analyzer, on-line signal recognition, and multithreshold archiving. A search of 250 Sun-like stars at 1.4 and 2.8 GHz has been carried out with the Arecibo 305-m antenna, and a meridian transit search of the northern sky is in progress at the Harvard-Smithsonian 26-m antenna. Successive spectra of 400 kHz at 0.05 Hz resolution are searched for features characteristic of an intentional narrowband beacon transmission. These spectra are centered on guessable ("magic") frequencies (such as the 21-cm hydrogen hyperfine line), referenced successively to the local standard of rest, the galactic barycenter, and the cosmic blackbody rest frame.

The Search for Life in the Universe: The Past Through the Future

NASA Astrophysics Data System (ADS)

Lebofsky, L. A.; Lebofsky, A.; Lebofsky, M.; Lebofsky, N. R.

2003-05-01

``Are we alone?'' This is a question that has been asked by humans for thousands of years. More than any other topic in science, the search for life in the Universe has captured the imagination. Now, for the first time in history, we are on the verge of answering this question. The search for life beyond the Earth can be seen as far back as the 17th century writings of Bishops F. Godwin and J. Wilkins and S. Cyrano de Bergerac to the early 20th century's H. G. Wells. From a scientific perspective, this search led to the formulation of the Drake Equation which in turn has led to a number of projects that are searching for signs of intelligent life beyond the Earth, the Search for Extraterrestrial Intelligence. SETI@home reaches millions of users, including thousands of K-12 teachers across the nation. We are developing a project that will enhance the SETI@home web site located at UC Berkeley. The project unites the resources of the SETI@home distributed computing community web site, university settings, and informal science learning centers. It will reach approximately 100,000 learners. The goal is to increase public understanding of math and science and to create and strengthen the connections between informal and formal learning communities. We will present a variety of ways that the Drake Equation and SETI@home can enhance the public and student understanding of the search for life in the Universe, from its roots in literature, to the development (and evolution) of the Drake Equation, to the actual search for life with SETI.

The Ĝ infrared search for extraterrestrial civilizations with large energy supplies. I. Background and justification

DOE Office of Scientific and Technical Information (OSTI.GOV)

Wright, J. T.; Mullan, B.; Sigurdsson, S.

We motivate the Ĝ infrared search for extraterrestrial civilizations with large energy supplies. We discuss some philosophical difficulties of the search for extraterrestrial intelligence (SETI), and how communication SETI circumvents them. We review 'Dysonian SETI', the search for artifacts of alien civilizations, and find that it is highly complementary to traditional communication SETI; the two together might succeed where either one alone has not. We discuss the argument of Hart that spacefaring life in the Milky Way should be either galaxy-spanning or non-existent, and examine a portion of his argument that we call the 'monocultural fallacy'. We discuss some rebuttalsmore » to Hart that invoke sustainability and predict long Galaxy colonization timescales. We find that the maximum Galaxy colonization timescale is actually much shorter than previous work has found (<10{sup 9} yr), and that many 'sustainability' counter-arguments to Hart's thesis suffer from the monocultural fallacy. We extend Hart's argument to alien energy supplies and argue that detectably large energy supplies can plausibly be expected to exist because life has the potential for exponential growth until checked by resources or other limitations, and intelligence implies the ability to overcome such limitations. As such, if Hart's thesis is correct, then searches for large alien civilizations in other galaxies may be fruitful; if it is incorrect, then searches for civilizations within the Milky Way are more likely to succeed than Hart argued. We review some past Dysonian SETI efforts and discuss the promise of new mid-infrared surveys, such as that of WISE.« less

The Ĝ Infrared Search for Extraterrestrial Civilizations with Large Energy Supplies. I. Background and Justification

NASA Astrophysics Data System (ADS)

Wright, J. T.; Mullan, B.; Sigurdsson, S.; Povich, M. S.

2014-09-01

We motivate the Ĝ infrared search for extraterrestrial civilizations with large energy supplies. We discuss some philosophical difficulties of the search for extraterrestrial intelligence (SETI), and how communication SETI circumvents them. We review "Dysonian SETI," the search for artifacts of alien civilizations, and find that it is highly complementary to traditional communication SETI; the two together might succeed where either one alone has not. We discuss the argument of Hart that spacefaring life in the Milky Way should be either galaxy-spanning or non-existent, and examine a portion of his argument that we call the "monocultural fallacy." We discuss some rebuttals to Hart that invoke sustainability and predict long Galaxy colonization timescales. We find that the maximum Galaxy colonization timescale is actually much shorter than previous work has found (<109 yr), and that many "sustainability" counter-arguments to Hart's thesis suffer from the monocultural fallacy. We extend Hart's argument to alien energy supplies and argue that detectably large energy supplies can plausibly be expected to exist because life has the potential for exponential growth until checked by resources or other limitations, and intelligence implies the ability to overcome such limitations. As such, if Hart's thesis is correct, then searches for large alien civilizations in other galaxies may be fruitful; if it is incorrect, then searches for civilizations within the Milky Way are more likely to succeed than Hart argued. We review some past Dysonian SETI efforts and discuss the promise of new mid-infrared surveys, such as that of WISE.

New CCIR report on SETI

NASA Technical Reports Server (NTRS)

Degroot, N. F.

1988-01-01

Since 1978, the reports and recommendations of the Comite Consultatif International des Radiocommunications (CCIR) have included a document describing SETI (the Search for Extraterrestrial Intelligence) in the context of radio frequency management. A new report to replace the old one was adopted by a CCIR study group; both reports were written at JPL. Following introductory and background material, the text of the new report is given.

Responsibility, capability, and Active SETI: Policy, law, ethics, and communication with extraterrestrial intelligence

NASA Astrophysics Data System (ADS)

Vakoch, Douglas A.

2011-02-01

With recently growing interest in the Active Search for Extraterrestrial Intelligence (SETI), in which humankind would send intentional signals to extraterrestrial civilizations, there have been increased concerns about appropriate policy, as well as the role of space law and ethics in guiding such activities. Implicit in these discussions are notions of responsibility and capability that affect judgments about whether humans or other civilizations should initiate transmissions. Existing protocols that guide SETI research address transmissions from Earth, but there is debate over whether these guidelines should inform de novo transmissions as well. Relevant responsibilities to address include (1) looking out for the interests of humankind as a whole, (2) being truthful in interstellar messages, and (3) benefiting extraterrestrial civilizations. Our capabilities as a species and a civilization affect how well we can fulfill responsibilities, as seen when we consider whether we will be able to reach consensus about message contents (and whether that would be desirable), and whether we have the capacity to decode messages from beings that rely on different sensory modalities. The interplay of these responsibilities and capabilities suggests that humankind should place increased emphasis on Active SETI.

SETI target selection.

PubMed

Latham, D W; Soderblom, D R

1995-01-01

The NASA High Resolution Microwave Survey consists of two complementary elements: a Sky Survey of the entire sky to a moderate level of sensitivity; and a Targeted Search of nearby stars, one at a time, to a much deeper level of sensitivity. In this paper we propose strategies for target selection. We have two goals: to improve the chances of successful detection of signals from technical civilizations that inhabit planets around solar-type stars, and to minimize the chances of missing signals from unexpected sites. For the main Targeted Search survey of approximately 1000 nearby solar-type stars, we argue that the selection criteria should be heavily biased by what we know about the origin and evolution of life here on Earth. We propose that observations of stars with stellar companions orbiting near the habitable zone should be de-emphasized, because such companions would prevent the formation of habitable planets. We also propose that observations of stars younger than about three billion years should be de-emphasized in favor of older stars, because our own technical civilization took longer than three billion years to evolve here on Earth. To provide the information needed for the preparation of specific target lists, we have undertaken an inventory of a large sample of solar-type stars out to a distance of 60 pc, with the goal of characterizing the relevant astrophysical properties of these stars, especially their ages and companionship. To complement the main survey, we propose that a modest sample of the nearest stars should be observed without any selection biases whatsoever. Finally, we argue that efforts to identify stars with planetary systems should be expanded. If found, such systems should receive intensive scrutiny.

Neuromuscular transmission in a primitive insect: modulation by octopamine, and catch-like tension.

PubMed

Hoyle, G

1984-01-01

The third pair of legs of the primitive New Zealand orthopteran insect, the " weta ", has and innervation and muscle cell distribution exactly similar to that of locusts, but wetas do not jump. Neuromuscular transmission to the slow excitatory axon ( SETi ) is potentiated more than 10-fold by the natural modulator octopamine (OCT). A brief burst of SETi impulses following infusion of as little as 10(-8) M OCT is followed by a very long-lasting plateau of catch-like tension (CT). The plateau is abruptly relaxed by a single inhibitory impulse, or even by a single SETi impulse if this arrives no sooner than about 30 sec following excitation. CT is used by wetas in a defense posture. Locusts and grasshoppers have a different type of modulation by OCT.

Elicitation and abrupt termination of behaviorally significant catchlike tension in a primitive insect.

PubMed

Hoyle, G; Field, L H

1983-07-01

Sustained steady contractural or catchlike tension (CT) occurs in the metathoracic extensor tibiae muscle of the primitive insect the weta (Orthoptera: Stenopelmatidae) during its characteristic leg-extension defense behavior or following leg-position conditioning. Similar action occurs occasionally in semi-intact preparations and is abruptly turned off by a single peripheral inhibitory impulse. These phenomena were reproduced routinely by first infusing saline containing 10(-8) M (or stronger) octopamine into the muscle for 12 min, and then stimulating the slow excitatory motor neuron SETi with a brief burst. Direct stimulation of the dorsal unpaired median neuron, innervating the extensor tibiae (DUMETi) prior to SETi stimulation, also led to CT. Both octopamine and DUMETi markedly enhanced the tension developed in response to a burst of impulses in SETi.

Climate Change Impacts on the Cryosphere of Mountain Regions: Validation of a Novel Model Using the Alaska Range

NASA Astrophysics Data System (ADS)

Mosier, T. M.; Hill, D. F.; Sharp, K. V.

2015-12-01

Mountain regions are natural water towers, storing water seasonally as snowpack and for much longer as glaciers. Understanding the response of these systems to climate change is necessary in order to make informed decisions about prevention or mitigation measures. Yet, mountain regions are often data sparse, leading many researchers to implement simple or enhanced temperature index (ETI) models to simulate cryosphere processes. These model structures do not account for the thermal inertia of snowpack and glaciers and do not robustly capture differences in system response to climate regimes that differ from those the model was calibrated for. For instance, a temperature index calibration parameter will differ substantially in cold-dry conditions versus warm-wet ones. To overcome these issues, we have developed a cryosphere hydrology model, called the Significantly Enhanced Temperature Index (SETI), which uses an energy balance structure but parameterizes energy balance components in terms of minimum, maximum and mean temperature, precipitation, and geometric inputs using established relationships. Additionally, the SETI model includes a glacier sliding model and can therefore be used to estimate long-term glacier response to climate change. Sensitivity of the SETI model to changing climate is compared with an ETI and a simple temperature index model for several partially-glaciated watersheds within Alaska, including Wolverine glacier where multi-decadal glacier stake measurements are available, to highlight the additional fidelity attributed to the increased complexity of the SETI structure. The SETI model is then applied to the entire Alaska Range region for an ensemble of global climate models (GCMs), using representative concentration pathways 4.5 and 8.5. Comparing model runs based on ensembles of GCM projections to historic conditions, total annual snowfall within the Alaska region is not expected to change appreciably, but the spatial distribution of snow shifts towards higher elevations and for a large portion of the region the duration of snow cover decreases. The changes in temperature and snow distribution also lead to spatially heterogeneous responses by glaciers within the region. The SETI model is designed to be easy to apply for any mountain region where cryospheric processes dominate.

Astrobiological complexity with probabilistic cellular automata.

PubMed

Vukotić, Branislav; Ćirković, Milan M

2012-08-01

The search for extraterrestrial life and intelligence constitutes one of the major endeavors in science, but has yet been quantitatively modeled only rarely and in a cursory and superficial fashion. We argue that probabilistic cellular automata (PCA) represent the best quantitative framework for modeling the astrobiological history of the Milky Way and its Galactic Habitable Zone. The relevant astrobiological parameters are to be modeled as the elements of the input probability matrix for the PCA kernel. With the underlying simplicity of the cellular automata constructs, this approach enables a quick analysis of large and ambiguous space of the input parameters. We perform a simple clustering analysis of typical astrobiological histories with "Copernican" choice of input parameters and discuss the relevant boundary conditions of practical importance for planning and guiding empirical astrobiological and SETI projects. In addition to showing how the present framework is adaptable to more complex situations and updated observational databases from current and near-future space missions, we demonstrate how numerical results could offer a cautious rationale for continuation of practical SETI searches.

The Search for Life in the Universe: The Past Through the Future

NASA Astrophysics Data System (ADS)

Lebofsky, L. A.; Lebofsky, A.; Lebofsky, M.; Lebofsky, N. R.

2003-05-01

``Are we alone?" This is a question that has been asked by humans for thousands of years. More than any other topic in science, the search for life in the Universe has captured everyone's imagination. Now, for the first time in history, we are on the verge of answering this question. The search for life beyond the Earth can be seen as far back as the 16th century writings of J. Kepler, Bishops F. Godwin and J. Wilkins, and S. Cyrano de Bergerac to the early 20th century's H. G. Wells. From a scientific perspective, this search led to the formulation of the Drake Equation which in turn has led to a number of projects that are searching for signs of intelligent life beyond the Earth, the Search for Extraterrestrial Intellegence. SETI@home reaches millions of users, including thousands of K-12 teachers across the nation. We are developing a project that will enhance the SETI@home web site located at UC Berkeley. The project unites the resources of the SETI@home distributed computing community web site , university settings, and informal science learning centers. It will reach approximately 100,000 learners. The goal is to increase public understanding of math and science and to create and strengthen the connections between informal and formal learning communities. We will present a variety of ways that the Drake Equation and SETI@home can enhance the public and student understanding of the search for life in the Universe, from its roots in literature, to the development (and evolution) of the Drake Equation, to the actual search for life with SETI.

SETI from the moon: an invitation to COSPAR

NASA Astrophysics Data System (ADS)

Heidmann, J.

After presenting arguments for SETI (Search for ExtraTerrestrial Intelligence) work to be done well into the 21st century, and in view of the dramatic increase of blinding human-made radiofrequency interference, this author proposed that a well defined locale on the farside of the Moon - crater Saha - be preserved for the next 20-30 years not only for SETI but also for future high-sensitivity radioastronomy. The long-term programmatic issues were presented at the Lunar Exploration Symposium of the Jerusalem 1994 International Astronautical Federation Congress. The legal questions raised were delineated at the International Institute of Space Law (IISL) Colloquium of the same Jerusalem Congress. Numerous suggestions were given for an action strategy, in particular to present a proposal at a COSPAR venue. In the words of IISL Director A.A. Cocca: ``This reservation of a lunar zone for scientific activities, and its further utilization aiming at the common good of humanity, must be recognized, and constitutes a precedent.'' At the Hamburg 1995 European Geophysical Society XXth GA, we pointed out that this Saha project could offer interesting possibilities for a symbiosis with the `Science on the Moon Exobiology' teams. We also presented it at the Berlin 1996 European Space Agency/Deutsche Forschungsanstalt für Luft und Raumfahrt `International Moon Workshop' to geologists and to bioastrononomers at the Capri 1996 Bioastronomy International Astronomical Union Colloquium #161. At the 1995 IAF Congress in Oslo, the SETI Committee of the International Academy of Astronautics took action for the future benefit of humankind by setting-up a Sub-committee for `A SETI Lunar Study', chaired by the author. We hope that, in view of these initial endeavors, COSPAR may become interested in this Saha proposal and supports it.

Evolutionary contingency and SETI revisited

NASA Astrophysics Data System (ADS)

Cirkovic, Milan M.

2014-07-01

The well-known argument against the Search for ExtraTerrestrial Intelligence (SETI) due to George Gaylord Simpson is re-analyzed almost half a century later, in the light of our improved understanding of preconditions for the emergence of life and intelligence brought about by the ongoing "astrobiological revolution". Simpson's argument has been enormously influential, in particular in biological circles, and it arguably fueled the most serious opposition to SETI programmes and their funding. I argue that both proponents and opponents of Simpson's argument have occasionally mispresented its core content. Proponents often oversimplify it as just another consequence of biological contingency, thus leaving their position open to general arguments limiting the scope of contingency in evolution (such as the recent argument of Geerat Vermeij based on selection effects in the fossil record). They also tend to neglect that the argument has been presented as essentially atemporal, while referring to entities and processes that are likely to change over time; this has become even less justifiable as our astrobiological knowledge increased in recent years. Opponents have failed to see that the weaknesses in Simpson's position could be removed by restructuring of the argument; I suggest one way of such restructuring, envisioned long ago in the fictional context by Stanislaw Lem. While no firm consensus has emerged on the validity of Simpson's argument so far, I suggest that, contrary to the original motivation, today it is less an anti-SETI argument, and more an astrobiological research programme. In this research programme, SETI could be generalized into a platform for testing some of the deepest assumptions about evolutionary continuity and the relative role of contingency versus convergence on unprecedented spatial and temporal scales.

Embryonic development of the innervation of the locust extensor tibiae muscle by identified neurons: formation and elimination of inappropriate axon branches.

PubMed

Myers, C M; Whitington, P M; Ball, E E

1990-01-01

Intracellular dye fills have been used to reveal the pattern of embryonic growth of each of the four neurons which innervate the extensor tibiae muscle (ETi) of the hind leg of the locust. The growth cone of the slow extensor tibiae motoneuron (SETi), the first of the four neurons to leave the central nervous system, pioneers nerve 3 (N3). The fast extensor motoneuron (FETi), the next neuron to grow out, follows earlier outgrowing motoneurons into the periphery in nerve 5 (N5) and then rejoins SETi in N3. As it transfers from N5 to N3, it is transiently dye-coupled to the Tr1 pioneer neuron which spans the gap between the two nerves. It then follows SETi onto the ETi muscle in the femur. The common inhibitory neuron and the dorsal unpaired median neuron (DUMETi) follow SETi and FETi in nerves 3B2 and 5B1, respectively. SETi's growth cone requires almost twice as long to reach ETi as those of the three later motoneurons, all of which follow preexisting neural pathways. At least three of the four developing motoneurons form one or more axon branches not found in the adult. These branches may occur (1) at segmental boundaries; (2) where the nerve, which the growth cone is following, itself branches or the growth cone encounters another nerve; or (3) when the axon continues to grow beyond its target muscle. These findings contrast with the apparent absence of inappropriate axon branches in another developing locust neuromuscular system and during the innervation of zebrafish myotomes, but resemble in some ways the transient production of inappropriate axonal branches reported for embryonic leech motoneurons.

Alien Mindscapes-A Perspective on the Search for Extraterrestrial Intelligence.

PubMed

Cabrol, Nathalie A

2016-09-01

Advances in planetary and space sciences, astrobiology, and life and cognitive sciences, combined with developments in communication theory, bioneural computing, machine learning, and big data analysis, create new opportunities to explore the probabilistic nature of alien life. Brought together in a multidisciplinary approach, they have the potential to support an integrated and expanded Search for Extraterrestrial Intelligence (SETI (1) ), a search that includes looking for life as we do not know it. This approach will augment the odds of detecting a signal by broadening our understanding of the evolutionary and systemic components in the search for extraterrestrial intelligence (ETI), provide more targets for radio and optical SETI, and identify new ways of decoding and coding messages using universal markers. SETI-Astrobiology-Coevolution of Earth and life-Planetary habitability and biosignatures. Astrobiology 16, 661-676.

Enlivening Introductory Physics With SETI

NASA Astrophysics Data System (ADS)

Hobson, Art

2001-04-01

The search for extraterrestrial intelligence (SETI), popular for years in astronomy courses, is also an excellent topic in physics literacy courses. Space travel, relativity, scientific methodology, pseudoscience, and physics-related societal topics can all be taught within the SETI context. Fermi's question (see Kuiper and Brin, Extraterrestrial Civilization, AAPT 1989, p. 67) is especially appropriate. Enrico Fermi, speculating in 1950 on the number of technological civilizations in our galaxy, concluded that we should have been visited long ago and many times over. Thus one might ask, paraphrasing Fermi, "Where is everybody?" Fermi concluded that either interstellar travel is impossible, or is always judged not to be worth the effort, or technological civilization doesn't last long enough for it to happen. Whether one agrees with Fermi or not, the great physicist's third suggestion is a sobering perspective on the sustainability of Earth-based civilization.

Back to the future: SETI before the space age

NASA Astrophysics Data System (ADS)

Dick, Steven J.

1995-02-01

In the late 1890s and early 1900s, before the advent of formalized search for extraterrestrial intelligence (SETI) programs, scientists such as Nikola Tesla and Gulielmo Marconi reported evidence of extraterrestrial radio signals. This paper reviews the history of 'interstellar/interplanetary radio communication'. The investigations of David P. Todd and Donald Menzel are discussed, and the fields of radio communication and radio astronomy are mentioned briefly.

Searching for alien artifacts on the moon

NASA Astrophysics Data System (ADS)

Davies, P. C. W.; Wagner, R. V.

2013-08-01

The Search for Extraterrestrial Intelligence (SETI) has a low probability of success, but it would have a high impact if successful. Therefore it makes sense to widen the search as much as possible within the confines of the modest budget and limited resources currently available. To date, SETI has been dominated by the paradigm of seeking deliberately beamed radio messages. However, indirect evidence for extraterrestrial intelligence could come from any incontrovertible signatures of non-human technology. Existing searchable databases from astronomy, biology, earth and planetary sciences all offer low-cost opportunities to seek a footprint of extraterrestrial technology. In this paper we take as a case study one particular new and rapidly-expanding database: the photographic mapping of the Moon's surface by the Lunar Reconnaissance Orbiter (LRO) to 0.5 m resolution. Although there is only a tiny probability that alien technology would have left traces on the moon in the form of an artifact or surface modification of lunar features, this location has the virtue of being close, and of preserving traces for an immense duration. Systematic scrutiny of the LRO photographic images is being routinely conducted anyway for planetary science purposes, and this program could readily be expanded and outsourced at little extra cost to accommodate SETI goals, after the fashion of the SETI@home and Galaxy Zoo projects.

Motor neurone responses during a postural reflex in solitarious and gregarious desert locusts.

PubMed

Blackburn, Laura M; Ott, Swidbert R; Matheson, Tom; Burrows, Malcolm; Rogers, Stephen M

2010-08-01

Desert locusts show extreme phenotypic plasticity and can change reversibly between two phases that differ radically in morphology, physiology and behaviour. Solitarious locusts are cryptic in appearance and behaviour, walking slowly with the body held close to the ground. Gregarious locusts are conspicuous in appearance and much more active, walking rapidly with the body held well above the ground. During walking, the excursion of the femoro-tibial (F-T) joint of the hind leg is smaller in solitarious locusts, and the joint is kept more flexed throughout an entire step. Under open loop conditions, the slow extensor tibiae (SETi) motor neurone of solitarious locusts shows strong tonic activity that increases at more extended F-T angles. SETi of gregarious locusts by contrast showed little tonic activity. Simulated flexion of the F-T joint elicits resistance reflexes in SETi in both phases, but regardless of the initial and final position of the leg, the spiking rate of SETi during these reflexes was twice as great in solitarious compared to gregarious locusts. This increased sensory-motor gain in the neuronal networks controlling postural reflexes in solitarious locusts may be linked to the occurrence of pronounced behavioural catalepsy in this phase similar to other cryptic insects such as stick insects. Copyright (c) 2010 Elsevier Ltd. All rights reserved.

A cloaking device for transiting planets

NASA Astrophysics Data System (ADS)

Kipping, David M.; Teachey, Alex

2016-06-01

The transit method is presently the most successful planet discovery and characterization tool at our disposal. Other advanced civilizations would surely be aware of this technique and appreciate that their home planet's existence and habitability is essentially broadcast to all stars lying along their ecliptic plane. We suggest that advanced civilizations could cloak their presence, or deliberately broadcast it, through controlled laser emission. Such emission could distort the apparent shape of their transit light curves with relatively little energy, due to the collimated beam and relatively infrequent nature of transits. We estimate that humanity could cloak the Earth from Kepler-like broad-band surveys using an optical monochromatic laser array emitting a peak power of ˜30 MW for ˜10 hours per year. A chromatic cloak, effective at all wavelengths, is more challenging requiring a large array of tunable lasers with a total power of ˜250 MW. Alternatively, a civilization could cloak only the atmospheric signatures associated with biological activity on their world, such as oxygen, which is achievable with a peak laser power of just ˜160 kW per transit. Finally, we suggest that the time of transit for optical Search for Extraterrestrial Intelligence (SETI) is analogous to the water-hole in radio SETI, providing a clear window in which observers may expect to communicate. Accordingly, we propose that a civilization may deliberately broadcast their technological capabilities by distorting their transit to an artificial shape, which serves as both a SETI beacon and a medium for data transmission. Such signatures could be readily searched in the archival data of transit surveys.

Inspiring the next generation of scientists with their observations of quasars, black holes, Jupiter, and SETI with the Goldstone Apple Valley Radio Telescope, GAVRT

NASA Astrophysics Data System (ADS)

Jauncey, D. L.; Levin, S.; Teitelbaum, L.; Hofstadter, M.; Arballo, J.; McConnell, S.; Dorcey, R.; Cole, K.; Kreuser-Jenkins, N.; Leflang, J.; Kruzins, E.; Ricardo, L.; Horiuchi, S.; Nagle, G.; Miro, C. G.

2017-04-01

This paper describes a radio astronomy programfor schools, the Goldstone-AppleValley Radio Telescope,GAVRT. The GAVRT program is designed to bring the inspiration and enthusiasm to a younger generation of teachers and children who learn about science by doing real science, just as Iosif Shklovsky brought to an older generation.

Broadening and Simplifying the First SETI Protocol

NASA Astrophysics Data System (ADS)

Michaud, M. A. G.

The Declaration of Principles Concerning Activities Following the Detection of Extraterrestrial Intelligence, known informally as the First SETI Protocol, is the primary existing international guidance on this subject. During the fifteen years since the document was issued, several people have suggested revisions or additional protocols. This article proposes a broadened and simplified text that would apply to the detection of alien technology in our solar system as well as to electromagnetic signals from more remote sources.

Radio astronomy aspects of the NASA SETI Sky Survey

NASA Technical Reports Server (NTRS)

Klein, Michael J.

1986-01-01

The application of SETI data to radio astronomy is studied. The number of continuum radio sources in the 1-10 GHz region to be counted and cataloged is predicted. The radio luminosity functions for steep and flat spectrum sources at 2, 8, and 22 GHz are derived using the model of Peacock and Gull (1981). The relation between source number and flux density is analyzed and the sensitivity of the system is evaluated.

Past and Future of Astronomy and SETI Cast in Maths

NASA Astrophysics Data System (ADS)

Maccone, C.

Assume that the history of Astronomy and SETI is the leading proof of the evolution of human knowledge on Earth over the last 3000 years. Then, human knowledge has increased a lot, although not at a uniform pace. A mathematical description of how much human knowledge has increased, however, is difficult to achieve. In this paper, we cast a mathematical model of the evolution of human knowledge over the last three thousand years that seems to reflect reasonably well both what is known from the past and might be extrapolated into the future. Our model is based on two seminal books by Sagan and Finney and Jones. Our model is based on the use of two cubic curves, representing the evolution of Astronomy and of SETI, respectively. We conclude by extrapolating these curves into the future and reach the conclusion that the "Star Trek" age of humankind might possibly begin by the end of this century.

What ET will look like and why should we care

NASA Astrophysics Data System (ADS)

Shostak, Seth

2010-11-01

Our experiments to find extraterrestrial life are predicated on the assumption that it is most likely to be found on so-called "habitable worlds." These are planets and moons where surface liquid water exists, and atmospheres of light gases are found. Our searches presume that life on other worlds has a biochemistry at least somewhat similar to our own. While these postulates might be our best guide for finding biology, they could be misleading us in the search for extraterrestrial intelligence (SETI). Timescale arguments suggest that shortly after a sentient species invents the technology for communication, it develops synthetic intelligence. Consequently, SETI's targeted searches of star systems that might have habitable planets in the conventional sense may be chasing a very short-lived prey. In this paper, we discuss what the implications of post-biological intelligence might have in directing our SETI experiments.

Power Beaming Leakage Radiation as A SETI Observable

NASA Technical Reports Server (NTRS)

Benford, James N.; Benford, Dominic J.

2016-01-01

The most observable leakage radiation from an advanced civilization may well be from the use of power beam-ing to transfer energy and accelerate spacecraft. Applications suggested for power beaming involve launching spacecraft to orbit, raising satellites to a higher orbit, and interplanetary concepts involving space-to-space transfers of cargo or passengers. We also quantify beam-driven launch to the outer solar system, interstellar precursors and ultimately starships. We estimate the principal observable parameters of power beaming leak-age. Extraterrestrial civilizations would know their power beams could be observed, and so could put a message on the power beam and broadcast it for our receipt at little additional energy or cost. By observing leakage from power beams we may find a message embedded on the beam. Recent observations of the anomalous star KIC8462852 by the Allen Telescope Array (ATA) set some limits on extraterrestrial power beaming in that system.We show that most power beaming applications commensurate with those suggested for our solar system would be detectable if using the frequency range monitored by the ATA, and so the lack of detection is a meaningful,if modest, constraint on extraterrestrial power beaming in that system. Until more extensive observations are made, the limited observation time and frequency coverage are not sufficiently broad in frequency and duration to produce firm conclusions. Such beams would be visible over large interstellar distances. This implies a new approach to the SETI search: Instead of focusing on narrowband beacon transmissions generated by another civilization, look for more powerful beams with much wider bandwidth. This requires a new approach for their discovery by telescopes on Earth. Further studies of power beaming applications should be done, which could broaden the parameter space of observable features we have discussed here.

Power Beaming Leakage Radiation as a SETI Observable

NASA Astrophysics Data System (ADS)

Benford, James N.; Benford, Dominic J.

2016-07-01

The most observable leakage radiation from an advanced civilization may well be from the use of power beaming to transfer energy and accelerate spacecraft. Applications suggested for power beaming involve launching spacecraft to orbit, raising satellites to a higher orbit, and interplanetary concepts involving space-to-space transfers of cargo or passengers. We also quantify beam-driven launch to the outer solar system, interstellar precursors, and ultimately starships. We estimate the principal observable parameters of power beaming leakage. Extraterrestrial civilizations would know their power beams could be observed, and so could put a message on the power beam and broadcast it for our receipt at little additional energy or cost. By observing leakage from power beams we may find a message embedded on the beam. Recent observations of the anomalous star KIC 8462852 by the Allen Telescope Array (ATA) set some limits on extraterrestrial power beaming in that system. We show that most power beaming applications commensurate with those suggested for our solar system would be detectable if using the frequency range monitored by the ATA, and so the lack of detection is a meaningful, if modest, constraint on extraterrestrial power beaming in that system. Until more extensive observations are made, the limited observation time and frequency coverage are not sufficiently broad in frequency and duration to produce firm conclusions. Such beams would be visible over large interstellar distances. This implies a new approach to the SETI search: instead of focusing on narrowband beacon transmissions generated by another civilization, look for more powerful beams with much wider bandwidth. This requires a new approach for their discovery by telescopes on Earth. Further studies of power beaming applications should be performed, potentially broadening the parameter space of the observable features that we have discussed here.

Twinkle, Twinkle, Little Laser by Ben Bova

NASA Astrophysics Data System (ADS)

Bova, Ben

2000-03-01

Radio astronomers have had no success in the search for extraterrestrial intelligence (SETI). Astronomers are now studying the heavens for signals that intelligent beings might send using lasers. Laser lights have the advantage of directionality, monochromaticity, and coherence. This research, called "optical SETI," looks for optical or infrared pulses with detectors that can pick up a broad spectrum of frequencies. By confining the search to stars similar to the Sun, scientists hope to find evidence of life other than ours.

Cultural Evolution and SETI

NASA Astrophysics Data System (ADS)

Dick, S. J.

2009-12-01

The Drake Equation for the number of radio communicative technological civilizations in the Galaxy encompasses three components of cosmic evolution: astronomical, biological and cultural. Of these three, cultural evolution totally dominates in terms of the rapidity of its effects. Yet, SETI scientists do not take cultural evolution into account, perhaps for understandable reasons, since cultural evolution is not well-understood even on Earth and is unpredictable in its outcome. But the one certainty for technical civilizations billions, millions, or even thousands of years older than ours is that they will have undergone cultural evolution. Cultural evolution potentially takes place in many directions, but this paper argues that its central driving force is the maintenance, improvement and perpetuation of knowledge and intelligence, and that to the extent intelligence can be improved, it will be improved. Applying this principle to life in the universe, extraterrestrials will have sought the best way to improve their intelligence. One possibility is that they may have long ago advanced beyond flesh-and-blood to artificial intelligence, constituting a postbiological universe. Although this subject has been broached, it has not been given the attention it is due from its foundation in cultural evolution. Nor has the idea of a postbiological universe been carried to its logical conclusion, including a careful analysis of the implications for SETI. SETI scientists, social scientists, and experts in AI should consider the strengths and weaknesses of this new paradigm.

Space missions for SETI.

PubMed

Drake, F

1999-01-01

Radio Telescopes for SETI searches are less demanding than general purpose astronomical radio telescopes. This provides an opportunity to exploit economical approaches in designing SETI systems. Radio Telescopes in low Earth orbit offer no discernible advantages to SETI; indeed, they probably would perform more poorly than a telescope in any other location. Telescopes in geosynchronous orbits would be sufficiently far from Earth to mitigate greatly the deleterious effect of human radio transmissions. Telescopes on the far side of the moon would be superb both from a radio interference standpoint, and from a civil engineering standpoint. Single-reflector telescopes as large as 50 kilometers in diameter could be constructed with conventional materials. However, their costs appear prohibitive. The asteroid belt and the outer solar system are unpromising places to place a large radio telescope. Perhaps the ultimate radio telescope would utilize the sun as a gravitational lens, focusing radiation on free-flying 10-meter class or possibly larger radio telescopes located at distances of the order of 1000 A.U. from the sun. Such a combination has an energy collecting area at 10 centimeters wavelength equivalent to that of a radio telescope about 11 kilometers in diameter, or of the order of 3000 Arecibo radio telescopes. Such a system could detect transmitters with EIRP of the order of a gigawatt at a distance of the order of the distance to the galactic center.

CO2 and SO2 IR Line Lists for Venus/Mars and Exo-Planet Atmosphere Studies

NASA Astrophysics Data System (ADS)

Huang, X.; Schwenke, D.; Sergey, T. A.; Lee, T. J.

2012-12-01

Atmospheric studies of both solar system planets and extra-solar planets need accurate spectra data input and analysis from planetary missions and astronomical observations. Accurate Infra-Red (IR) line lists of critical species are necessary to determine the physical conditions and compositions of atmospheres. Here we demonstrate an example of how theoretical chemistry can help in this regard. By combining the state-of-the-art ab initio theory, quantum exact rovibrational CI approach, and selected reliable high resolution experimental data, we have successfully generated the most complete and reliable IR line lists for Carbon Dioxide and Sulfur Dioxide (and their isotopologues) with accuracies of 0.01-0.02 cm-1, or ~10 MHz for microwave spectra. Agreement for observed intensities is around 90%. Our approach not only automatically fills in all the missing bands (especially those weaker, difficult bands) below the highest experiment energies, but also safely extrapolates beyond those with still reliable predictions. The reliability and accuracy of our IR line lists have been verified by the most recent experiments. The CO2 line list actually extends to 30,000 cm-1 and J>180. It works for early planets with temperature as high as 1000-2000K. The SO2 line list covers 0 - 14000 cm-1 and J>100. These line lists are expected to facilitate the atmospheric analysis and modeling of both planets (and moons) within our solar system and beyond to extra-solar planets. 32SO2 IR spectra comparison. (top) Ames-296K line list vs. recent experiment; (bottom) Ames-296K fills in the gaps of HITRAN2008 data. 12C16O2 IR Simulation at different temperatures using the latest Ames-296K IR linelist. (Unpublished work by R.S. Freedman, SETI/NASA Ames SST)

SETI in the light of cosmic convergent evolution

NASA Astrophysics Data System (ADS)

Flores Martinez, Claudio L.

2014-11-01

Theodosius Dobzhansky, one of the founding fathers of the modern evolutionary synthesis, once famously stated that ;nothing makes sense in biology except in the light of evolution;. Here it will be argued that nothing in astrobiology makes sense except in the light of ;Cosmic Convergent Evolution; (CCE). This view of life contends that natural selection is a universal force of nature that leads to the emergence of similarly adapted life forms in analogous planetary biospheres. Although SETI historically preceded the rise of astrobiology that we have witnessed in the recent decade, one of its main tenets from the beginning was the convergence of life on a cosmic scale toward intelligent behavior and subsequent communication via technological means. The question of cultural convergence in terms of symbolic exchange, language and scientific capabilities between advanced interstellar civilizations has been the subject of ongoing debate. However, at the core of the search for extraterrestrial intelligence lies in essence a biological problem since even post-biological extraterrestrial intelligences must have had an origin based on self-replicating biopolymers. Thus, SETI assumes a propensity of the Universe towards biogenesis in accordance with CCE, a new evolutionary concept which posits the multiple emergence of life across the Cosmos. Consequently, we have to wonder about the biophilic properties the Universe apparently exhibits, as well as to try to find an encompassing theory that is able to explain this ;fine-tuning; in naturalistic terms. The aims of this paper are as follows: 1) to emphasize the importance of convergent evolution in astrobiology and ongoing SETI research; 2) to introduce novel and biology-centered cosmological ideas such as the ;Selfish Biocosm Hypothesis; and the ;Evo Devo Universe; as valuable arguments in theorizing about the origin and nature of extraterrestrial intelligence and 3) to synthesize these findings within an emerging post-biological paradigm on which future SETI efforts may be founded.

L factor: hope and fear in the search for extraterrestrial intelligence

NASA Astrophysics Data System (ADS)

Rubin, Charles T.

2001-08-01

The L factor in the Drake equation is widely understood to account for most of the variance in estimates of the number of extraterrestrial intelligences that might be contacted by the search for extraterrestrial intelligence (SETI). It is also among the hardest to quantify. An examination of discussions of the L factor in the popular and technical SETI literature suggests that attempts to estimate L involve a variety of potentially conflicting assumptions about civilizational lifespan that reflect hopes and fears about the human future.

Fluorescence imaging technology (FI) for high-throughput screening of selenide-modified nano-TiO2 catalysts.

PubMed

Wang, Liping; Lee, Jianchao; Zhang, Meijuan; Duan, Qiannan; Zhang, Jiarui; Qi, Hailang

2016-02-18

A high-throughput screening (HTS) method based on fluorescence imaging (FI) was implemented to evaluate the catalytic performance of selenide-modified nano-TiO2. Chemical ink-jet printing (IJP) technology was reformed to fabricate a catalyst library comprising 1405 (Ni(a)Cu(b)Cd(c)Ce(d)In(e)Y(f))Se(x)/TiO2 (M6Se/Ti) composite photocatalysts. Nineteen M6Se/Tis were screened out from the 1405 candidates efficiently.

Evolution of Life and SETI (Evo-SETI)

NASA Astrophysics Data System (ADS)

Maccone, Claudio

When SETI scientists will be able to discover a signal or just some signs of an Extra-Terrestrial (ET) Civilization, those ETs should turn out to be technologically advanced at least as much as Humans, if not more, or much more so. Comparing the technological level of two different Civilizations is then a key issue in SETI. But at the moment we only know about the development of life on Earth over the last 3.5 billion years. We thus need to mathematically model the evolution of life on Earth (RNA to Humans) and then apply our results to other extra-solar planets to find out “where they stand” along their evolution of life. In a series of recent papers and in a book (refs. [1] through [4]) this author introduced a new statistical model embracing SETI, Darwinian Evolution and Human History into a unified statistical picture and concisely called Evo-SETI (Evolution & SETI). The relevant mathematical instruments are: 1) The statistical generalization of the Drake equation yielding the number N of communicating ET civilizations in the Galaxy. Assuming that each input variable in the Drake equation was a random variable, rather than just a pure number, N was shown to follow the lognormal probability distribution having as mean value the sum of the input mean values, and as variance the sum of the input variances (ref. [1]). 2) Geometric Brownian Motion (GBM), the stochastic process representing Evolution as the stochastic increase of the number of Species living on Earth over the last 3.5 billion years. This GBM is well-known in the mathematics of finances (Black-Sholes models). Its main features are that its probability density function (pdf) is a lognormal pdf, and its mean value is either an increasing, or, more rarely (as in the Mass Extinctions of the past) a decreasing exponential of the time. 3) The probability distributions known as b-lognormals, i.e. lognormals starting at a certain positive instant b>0 rather than at the origin. These b-lognormals were then forced by us to have their peak value located on the exponential mean-value curve of the GBM (this is the so-called “Peak-Locus Theorem”). In the framework of Darwinian Evolution, the resulting mathematical construction was shown to identify with Cladistics (refs. [2], [3], [4]). 4) The (Shannon) Entropy of such b-lognormals is then seen to represent the “degree of progress” reached by each living organism or by each big set of living organisms, like historic human civilizations. Having understood this fact, Human History may then be cast into the language of b-lognormals that are more and more organized in time (i.e. having smaller and smaller entropy, or smaller and smaller “chaos”), and have their peaks located on the increasing GBM exponential. This exponential is thus the “trend of progress” in Human History. 5) But our most striking new result is about the well-known “Molecular Clock of Evolution”, namely the “constant rate of Evolution at the molecular level” as shown by Kimura’s Neutral Theory of Molecular Evolution. We showed that that the Molecular Clock identifies with Entropy in our Evo-SETI model because they both grew linearly in time since the origin of life. 6) Furthermore, we applid our Evo-SETI model to lognormal stochastic processes other then the GBMs. For instance, we showed that the Markov-Korotayev (2007-2008, refs. [5], [6]) model for Darwinian Evolution identifies with an Evo-SETI model for which the mean value of the lognormal stochastic process is a cubic (third degree polynomial) function of the time. In conclusion: we have provided a vast mathematical model capable of embracing Molecular Evolution, SETI and Entropy into a simple set of statistical equations based upon b-lognormals pdfs and lognormal stochastic processes Keywords: Molecular Clock, Darwinian evolution, statistical Drake equation, lognormal probability densities, geometric Brownian motion, entropy. REFERENCES [1] Maccone, C. (2008), “The Statistical Drake Equation”, paper #IAC-08-A4.1.4 presented on October 1st, 2008, at the 59th International Astronautical Congress (IAC) held in Glasgow, Scotland, UK, September 29th thru October 3rd, 2008, later published in Acta Astronautica, Vol. 67 (2010), pages 1366-1383. [2] Maccone, C. (2011, b), “A Mathematical Model for Evolution and SETI”, Origins of Life and Evolutionary Biospheres (OLEB), Vol. 41, pages 609-619, available online December 3rd, 2011. [3] Maccone, C. (2012), “Mathematical SETI”, a 724-pages book published by Praxis-Springer in the fall of 2012. ISBN, ISBN-10: 3642274366 | ISBN-13: 978-3642274367 | Edition: 2012 [4] Maccone, C., (2013), “SETI, Evolution and Human History merged into a Mathematical Model”, International Journal of Astrobiology, Vol. 12, issue 3 (2013), pages 218-245. Available online since April 23, 2013. [5] Markov A., Korotayev A., “Phanerozoic marine biodiversity follows a hyperbolic trend”, Paleoworld, Volume 16, Issue 4, December 2007, Pages 311-318. [6] Markov A., Korotayev A., “Hyperbolic growth of marine and continental biodiversity through the Phanerozoic and community evolution”, Journal of General Biology. Volume 69, 2008, N. 3, pp. 175-194.

Energy of Extra-Terrestrial Civilizations according to Evo-SETI Theory

NASA Astrophysics Data System (ADS)

Maccone, Claudio

2018-03-01

Consider two great scientists of the past: Kepler (1571-1630) and Newton (1642-1727). Kepler discovered his three laws of planetary motion by observing Mars: he knew experimentally that his three laws were correct, but he didn't even suspect that all three mathematical laws could be derived as purely mathematical consequences by a "superior" mathematical law. The latter was the Law of Gravitation that Newton gave the world together with his supreme mathematical discovery of the Calculus, necessary for that mathematical derivation. We think we did the same for the "molecular clock", the experimental law of genetics discovered in 1962 by Émile Zuckerkandl (1922-2013) and Linus Pauling (1901-1994) and derived by us as a purely mathematical consequence of our mathematical Evo-SETI Theory. Let us now summarize how this mathematical derivation was achieved. Darwinian evolution over the last 3.5 billion years was an increase in the number of living species from one (RNA ?) to the current (say) 50 million. This increasing trend in time looks like being exponential, but one may not assume an exact exponential curve since many species went extinct in the past, especially in the five, big mass extinctions. Thus, the simple exponential curve must be replaced by a stochastic process having an exponential mean value. Borrowing from financial mathematics (the "Black-Sholes models"), this "exponential" stochastic process is called Geometric Brownian Motion (GBM). Its probability density function (pdf) is a lognormal (and not a Gaussian) (Proof: see Ref. [3], Chapter 30, and Ref. [4], and, more in general, refs. [2] and [5]). Lognormal also is the pdf of the statistical number of communicating ExtraTerrestrial (ET) civilizations in the Galaxy at a certain fixed time, like a snapshot: this result was obtained in 2008 by this author as his solution to the Statistical Drake Equation of SETI (Proof: see Ref. [1]). Thus, the GBM of Darwinian evolution may also be regarded as the extension in time of the Statistical Drake equation (Proof: see ref. [4]). But the key step ahead made by this author in his Evo-SETI (Evolution and SETI) mathematical theory was to realize that life also is just a b-lognormal in time: every living organism (a cell, a human, a civilization, even an ET civilization) is born at a certain time b ("birth"), grows up to a peak p (with an ascending inflexion point in between, a for adolescence), then declines from p to s (senility, i.e. descending inflexion point) and finally declines linearly and dies at a final instant d (death). In other words, the infinite tail of the b-lognormal was cut away and replaced by just a straight line between s and d, leading to simple mathematical formulae ("History Formulae") allowing one to find this "finite b-lognormal" when the three instants b, s, and d are assigned. Next our crucial Peak-Locus Theorem comes. It means that the GBM exponential may be regarded as the geometric locus of all the peaks of a one-parameter (i.e. the peak time p) family of b-lognormals. Since b-lognormals are pdf-s, the area under each of them always equals 1 (normalization condition) and so, going from left to right on the time axis, the b-lognormals become more and more "peaky", and so they last less and less in time. This is precisely what happened in Human History: civilizations that lasted a millennium each (like Ancient Greece and Rome) lasted just a few centuries in later times (like the Italian Renaissance and Portuguese, Spanish, French, British and USA Empires) but they were more and more advanced in the "level of civilization". This "level of civilization" is what physicists call entropy. Also, in refs. [3,4], this author proved that, for all GBMs, the (Shannon) Entropy of the b-lognormals in his Peak-Locus Theorem grows linearly in time. The Molecular Clock (refs. [6] through [11]), well known to geneticists since 1962, shows that the DNA base-substitutions occur linearly in time since they are neutral with respect to Darwinian selection. This is Kimura's neutral theory of molecular evolution. The conclusion is that the Molecular Clock and the linear increase of EvoEntropy in time are just the same thing! In other words, we derived the Molecular Clock mathematically as a part of our Evo-SETI Theory. In addition, our EvoEntropy, i.e. the Shannon Entropy of the b-lognormal (with the minus sign reversed and starting at zero at the time of the origin of Life on Earth) is just the new Evo-SETI Scale to measure the evolution of life on Exoplanets (measured in bits). That was the situation prior to the present paper, firstly presented at the SETI II Session of the Adelaide IAC in October 2017. In fact, just as classical thermodynamics entails both energy and entropy, so our Evo-SETI Theory needs entailing the energy used by a living Species or Civilization along its whole lifetime in addition to its entropy (i.e. Molecular Clock). In other words still, while the Molecular Clock is a measure of the advancement in evolution, the energy required to get that advancement is another topic not faced by this author prior to 2017. However, in the present paper we were able to add the consideration of energy in addition to entropy by replacing the b-lognormal probability densities previously used by a new curve, finite in the time, that we call "logpar". This logpar is made up by an ascending b-lognormal in the time between the birth and the peak of the living organism, followed by a descending parabola in the time between its peak and death. The logpar curve is not normalized to one: the area under the logpar curve may be any positive number since it represents the energy requested by the organism to live over its entire lifetime "birth-to-death". In other words still, we mathematically demonstrate in this paper that just three instants (birth b, peak p and death d) must be assigned in order to make the mathematical logpar curve perfectly described. The history of the Roman Civilization fits to this description in that we not only know when Rome was funded (753 B.C.) and reached its peak (117 A.D.) but also when it collapsed (in the West), i.e. 476 A.D. Its energy is then estimated in terms of money (Sestertii) and so we dare to say that our Evo-SETI Theory so extended adequately describes not only the Entropy but also the Energy of Rome. In conclusion, we think that our invention of the logpar power curve provides a new, formidable mathematical tool for our Evo-SETI mathematical description of Life, History and SETI.

Using the Very Large Array (VLA) and other radio telescopes to perform a parasitic Search for Extraterrestrial Intelligence (SETI)

NASA Technical Reports Server (NTRS)

Tarter, J.

1985-01-01

This paper describes several attempts to utilize various radio telescopes in a manner that we term "parasitic," that is in a manner that does not interrupt or seriously impact the standard astronomical observing programs in progress at the radio observatories. In the extreme case, only recorded astronomical data are accessed off-line, after the fact, without any burden on the observatory at all.

Using the Very Large Array (VLA) and other radio telescopes to perform a parasitic search for extraterrestrial intelligence (SETI)

NASA Technical Reports Server (NTRS)

Tarter, J. C.

1984-01-01

This paper describes several attempts to utilize various radio telescopes in a manner that is termed 'parasitic', that is in a manner that does not interrupt or seriously impact the standard astronomical observing programs in progress at the radio observatories. In the extreme case, only recorded astronomical data are accessed off-line, after the fact, without any burden on the observatory at all.

Using the Very Large Array (VLA) and other radio telescopes to perform a parasitic Search for Extraterrestrial Intelligence (SETI).

PubMed

Tarter, J

1985-01-01

This paper describes several attempts to utilize various radio telescopes in a manner that we term "parasitic," that is in a manner that does not interrupt or seriously impact the standard astronomical observing programs in progress at the radio observatories. In the extreme case, only recorded astronomical data are accessed off-line, after the fact, without any burden on the observatory at all.

The lure of local SETI: Fifty years of field experiments

NASA Astrophysics Data System (ADS)

Ailleris, Philippe

2011-01-01

With the commemoration in October 2007 of the Sputnik launch, space exploration celebrated its 50th anniversary. Despite impressive technological and scientific achievements the fascination for space has weakened during the last decades. One contributing factor has been the gradual disappearance of mankind's hope of discovering extraterrestrial life within its close neighbourhood. In striking contrast and since the middle of the 20th century, a non-negligible proportion of the population have already concluded that intelligent beings from other worlds do exist and visit Earth through space vehicles popularly called Unidentified Flying Objects (UFOs). In light of the continuous public interest for the UFO enigma symbolized by the recent widely diffused media announcements on the release of French and English governmental files; and considering the approach of broadening the strategies of the "Active SETI" approach and the existence of a rich multi-disciplinary UFO documentation of potential interest for SETI; this paper describes some past scientific attempts to demonstrate the physical reality of the phenomena and potentially the presence on Earth of probes of extraterrestrial origin. Details of the different instrumented field studies deployed by scientists and organizations during the period 1950-1990 in the USA, Canada and Europe are provided. In conclusion it will be argued that while continuing the current radio/optical SETI searches, there is the necessity to maintain sustaining attention to the topic of anomalous aerospace phenomena and to develop new rigorous research approaches.

Sampling the Radio Transient Universe: Studies of Pulsars and the Search for Extraterrestrial Intelligence

NASA Astrophysics Data System (ADS)

Chennamangalam, Jayanth

The transient radio universe is a relatively unexplored area of astronomy, offering a variety of phenomena, from solar and Jovian bursts, to flare stars, pulsars, and bursts of Galactic and potentially even cosmological origin. Among these, perhaps the most widely studied radio transients, pulsars are fast-spinning neutron stars that emit radio beams from their magnetic poles. In spite of over 40 years of research on pulsars, we have more questions than answers on these exotic compact objects, chief among them the nature of their emission mechanism. Nevertheless, the wealth of phenomena exhibited by pulsars make them one of the most useful astrophysical tools. With their high densities, pulsars are probes of the nature of ultra-dense matter. Characterized by their high timing stability, pulsars can be used to verify the predictions of general relativity, discover planets around them, study bodies in the solar system, and even serve as an interplanetary (and possibly some day, interstellar) navigation aid. Pulsars are also used to study the nature of the interstellar medium, much like a flashlight illuminating airborne dust in a dark room. Studies of pulsars in the Galactic center can help answer questions about the massive black hole in the region and the star formation history in its vicinity. Millisecond pulsars in globular clusters are long-lived tracers of their progenitors, low-mass X-ray binaries, and can be used to study the dynamical history of those clusters. Another source of interest in radio transient astronomy is the hitherto undetected engineered signal from extraterrestrial intelligence. The Search for Extraterrestrial Intelligence (SETI) is an ongoing attempt at discovering the presence of technological life elsewhere in the Galaxy. In this work, I present my forays into two aspects of the study of the radio transient universe---pulsars and SETI. Firstly, I describe my work on the luminosity function and population size of pulsars in the globular clusters Terzan 5, 47 Tucanae, and M 28. Applying Bayesian statistics to our data set consisting of the number of detected pulsars, their flux densities, and the amount of diffuse radio emission from the direction of these clusters, we show that the number of potentially observable pulsars in Terzan 5 should be within a 95 per cent credible interval of 147+112-65 For 47 Tucanae and M 28, our results are 83+54-35 and 100+91-52 , spectively. We also constrain the luminosity function parameters for the pulsars in these clusters. The Galactic center pulsar population has been an interesting target for various studies, especially given that only one pulsar has been detected in the region, when we expect hundreds of pulsars to be present. In this work, we use the scattering measurements from recent observations of PSR J1745--2900, the Galactic center pulsar, and show that the size of the potentially observable pulsar population has a conservative upper limit of ~200. We show that the observational results so far are consistent with this number and make predictions for future radio pulsar surveys of the region. The Versatile GBT Astronomical Spectrometer (VEGAS) is a heterogeneous instrument used mainly for pulsar studies with the Green Bank Telescope. I describe our work on the GPU spectrometer that we developed as part of VEGAS. The GPU code supports a dual-polarization bandwidth of up to 600 MHz. In the field of SETI, I discuss two works. SERENDIP VI is a heterogeneous SETI spectrometer to be installed both at the Green Bank Telescope and at the Arecibo Observatory. In this work, we describe the design of the GPU spectrometer that forms part of SERENDIP VI. In the second work, we speculate on a novel search strategy for SETI, based on the idea that technological civilizations lacking the advancement required to build high-powered beacons may choose to build a modulator situated around a nearby pulsar, depending on whether it is energetically favorable. We discuss observational signatures to search for, using a model of artificially-nulled pulsars.

Synchronized SETI-The Case for "Opposition"

NASA Astrophysics Data System (ADS)

Corbet, Robin H. D.

2003-06-01

If the signals being sought in search for extraterrestrial intelligence (SETI) programs exist but are brief (for example, they are produced intermittently to conserve energy), then it is essential to know when these signals will arrive at the Earth. Different types of transmitter/receiver synchronization schemes are possible, which vary in the relative amount of effort required by the transmitter and the receiver. The case is made for a scheme that is extremely simple for the receiver: Make observations of a target when it is at maximum angular distance from the Sun (i.e., "opposition"). This strategy requires that the transmitter has accurate knowledge of the distance and proper motion of the Sun and the orbit of the Earth. It is anticipated that within the next 10-20 years it will be possible to detect directly nearby extrasolar planets of approximately terrestrial mass. Since extraterrestrial transmitters are expected to have significantly more advanced technology, it is not unreasonable to expect that they would be able to detect the presence of the Earth and measure its orbit at even greater distances. This strategy is simple to implement, and opposition is also typically the time when observations are easiest to make. Limited opposition surveys contained in a number of all-sky surveys have already been performed. However, full-sky opposition surveys are best suited to detectors with very large fields of view.

Synchronized SETI-the case for "opposition".

PubMed

Corbet, Robin H D

2003-01-01

If the signals being sought in search for extraterrestrial intelligence (SETI) programs exist but are brief (for example, they are produced intermittently to conserve energy), then it is essential to know when these signals will arrive at the Earth. Different types of transmitter/receiver synchronization schemes are possible, which vary in the relative amount of effort required by the transmitter and the receiver. The case is made for a scheme that is extremely simple for the receiver: Make observations of a target when it is at maximum angular distance from the Sun (i.e., "opposition"). This strategy requires that the transmitter has accurate knowledge of the distance and proper motion of the Sun and the orbit of the Earth. It is anticipated that within the next 10-20 years it will be possible to detect directly nearby extrasolar planets of approximately terrestrial mass. Since extraterrestrial transmitters are expected to have significantly more advanced technology, it is not unreasonable to expect that they would be able to detect the presence of the Earth and measure its orbit at even greater distances. This strategy is simple to implement, and opposition is also typically the time when observations are easiest to make. Limited opposition surveys contained in a number of all-sky surveys have already been performed. However, full-sky opposition surveys are best suited to detectors with very large fields of view.

#FoundThem-21st Century pre-search and post-detection seti protocols for social and digital media

NASA Astrophysics Data System (ADS)

Forgan, Duncan; Scholz, Alexander

2016-09-01

The transmission of news stories in global culture has changed fundamentally in the last three decades. The general public are alerted to breaking stories on increasingly rapid timescales, and the discussion/distortion of facts by writers, bloggers, commenters and Internet users can also be extremely fast. The narrative of a news item no longer belongs to a small cadre of conventional media outlets, but is instead synthesised to some level by the public as they select where and how they consume news. The IAA Search for Extraterrestrial Intelligence (SETI) post-detection protocols, initially drafted in 1989 and updated in 2010, were written to guide SETI scientists in the event of detecting evidence of extraterrestrial intelligence, but do not give guidance as to how scientists should prepare to navigate this media maelstrom. The protocols assume communication channels between scientists and the public still resemble those of 1989, which were specifically one-way with a narrative controlled by a select few media outlets. Modern SETI researchers must consider this modern paradigm for consumption of news by the public, using social media and other non-traditional outlets, when planning and executing searches for extraterrestrial intelligence. We propose additions to the post detection protocols as they pertain to the use of the Internet and social media, as well as pre-search protocols. It is our belief that such protocols are necessary if there is to be a well-informed, sane global conversation amongst the world's citizens following the discovery of intelligent life beyond the Earth.

Searching for Cost-Optimized Interstellar Beacons

NASA Astrophysics Data System (ADS)

Benford, Gregory; Benford, James; Benford, Dominic

2010-06-01

What would SETI beacon transmitters be like if built by civilizations that had a variety of motives but cared about cost? In a companion paper, we presented how, for fixed power density in the far field, a cost-optimum interstellar beacon system could be built. Here, we consider how we should search for a beacon if it were produced by a civilization similar to ours. High-power transmitters could be built for a wide variety of motives other than the need for two-way communication; this would include beacons built to be seen over thousands of light-years. Extraterrestrial beacon builders would likely have to contend with economic pressures just as their terrestrial counterparts do. Cost, spectral lines near 1 GHz, and interstellar scintillation favor radiating frequencies substantially above the classic "water hole." Therefore, the transmission strategy for a distant, cost-conscious beacon would be a rapid scan of the galactic plane with the intent to cover the angular space. Such pulses would be infrequent events for the receiver. Such beacons built by distant, advanced, wealthy societies would have very different characteristics from what SETI researchers seek. Future searches should pay special attention to areas along the galactic disk where SETI searches have seen coherent signals that have not recurred on the limited listening time intervals we have used. We will need to wait for recurring events that may arriarrive in intermittent bursts. Several new SETI search strategies have emerged from these ideas. We propose a new test for beacons that is based on the Life Plane hypotheses.

Searching for Cost-Optimized Interstellar Beacons

NASA Technical Reports Server (NTRS)

Benford, Gregory; Benford, James; Benford, Dominic

2010-01-01

What would SETI beacon transmitters be like if built by civilizations that had a variety of motives but cared about cost? In a companion paper, we presented how, for fixed power density in the far field, a cost-optimum interstellar beacon system could be built. Here, we consider how we should search for a beacon if it were produced by a civilization similar to ours. High-power transmitters could be built for a wide variety of motives other than the need for two-way communication, this would include beacons built to be seen over thousands of light-years. Extraterrestrial beacon builders would likely have to contend with economic pressures just as their terrestrial counterparts do. Cost, spectral lines near 1GHz, and interstellar scintillation favor radiating frequencies substantially above the classic "water hole." Therefore, the transmission strategy for a distant, cost-conscious beacon would be a rapid scan of the galactic plane with the intent to cover the angular space. Such pulses would be infrequent events for the receiver. Such beacons built by distant, advanced, wealthy societies would have very different characteristics from what SETI researchers seek. Future searches should pay special attention to areas along the galactic disk where SETI searches have seen coherent signals that have not recurred on the limited listening time intervals we have used. We will need to wait for recurring events that may arrive in intermittent bursts. Several new SETI search strategies have emerged from these ideas. We propose a new test for beacons that is based on the Life Plane hypotheses.

Searching for cost-optimized interstellar beacons.

PubMed

Benford, Gregory; Benford, James; Benford, Dominic

2010-06-01

What would SETI beacon transmitters be like if built by civilizations that had a variety of motives but cared about cost? In a companion paper, we presented how, for fixed power density in the far field, a cost-optimum interstellar beacon system could be built. Here, we consider how we should search for a beacon if it were produced by a civilization similar to ours. High-power transmitters could be built for a wide variety of motives other than the need for two-way communication; this would include beacons built to be seen over thousands of light-years. Extraterrestrial beacon builders would likely have to contend with economic pressures just as their terrestrial counterparts do. Cost, spectral lines near 1 GHz, and interstellar scintillation favor radiating frequencies substantially above the classic "water hole." Therefore, the transmission strategy for a distant, cost-conscious beacon would be a rapid scan of the galactic plane with the intent to cover the angular space. Such pulses would be infrequent events for the receiver. Such beacons built by distant, advanced, wealthy societies would have very different characteristics from what SETI researchers seek. Future searches should pay special attention to areas along the galactic disk where SETI searches have seen coherent signals that have not recurred on the limited listening time intervals we have used. We will need to wait for recurring events that may arrive in intermittent bursts. Several new SETI search strategies have emerged from these ideas. We propose a new test for beacons that is based on the Life Plane hypotheses.

The Scientific Search for Extraterrestrials

NASA Astrophysics Data System (ADS)

Shostack, S.

2001-05-01

The premise of intelligent life elsewhere in the cosmos is an old one, but has recently gained new impetus from discoveries that suggest that planets are common and biologically friendly habitats could be plentiful. Since there is some chance that a large number of sentient societies could inhabit the galaxy, a small group of scientists have undertaken the research activity known as SETI, the Search for Extraterrestrial Intelligence. SETI's methods are well founded in both astronomy and engineering: it is an attempt to find technically sophisticated civilizations in situ by looking for narrow-band radio signals or short pulses of laser light from other star systems. The rapid increase in SETI capability gives some reason to expect that a signal detection might occur early in the 21st century. If so, it would demonstrate that the natural processes that have produced intelligence on this planet have spawned functionally similar intelligence elsewhere. This would be further evidence that not only physics and chemistry are universal, but biology and the evolution of intelligence are also cosmic, rather than merely earthly phenomena.

New SETI prospects opened up by current information networking

NASA Astrophysics Data System (ADS)

Piotelat, Elisabeth; Cerceau, Florence Raulin

2013-07-01

This paper discusses ideas that impact the f c factor as defined by Frank Drake in 1961, i.e. the fraction of planets with intelligent creatures capable of interstellar communication. This factor remains one of the most speculative terms of the equation. We suggest that the ability of sharing information is an important parameter to take into account in evaluating the tendency of a civilization to make contact (or share data) with other civilizations. Thus, we give special consideration to the fraction of planets with intelligent creatures capable of producing and sharing large amount of data. First, we determine the level of our own civilization in the framework of Sagan's energy- and information-based classification, by taking into account the recent improvements in computing and networking technologies. Second, we distinguish two types of organization, hierarchical and heterarchical, with respect to information sharing. We illustrate this distinction in the case of SETI and we show that the probability to detect a civilization would be greater if it is heterarchical than if it is hierarchical and if we utilize heterarchical principles for SETI.

A near-infrared SETI experiment: commissioning, data analysis, and performance results

NASA Astrophysics Data System (ADS)

Maire, Jérôme; Wright, Shelley A.; Dorval, Patrick; Drake, Frank D.; Duenas, Andres; Isaacson, Howard; Marcy, Geoffrey W.; Siemion, Andrew; Stone, Remington P. S.; Tallis, Melisa; Treffers, Richard R.; Werthimer, Dan

2016-08-01

Over the last two decades, Optical Search for Extra-Terrestrial Intelligence experiments have been conducted to search for either continuous or pulsed visible-light laser beacons that could be used for interstellar communication or energy transmission. Near-infrared offers a compelling window for signal transmission since there is a decrease in interstellar extinction and Galactic background compared to optical wavelengths. An innovative Near-InfraRed and Optical SETI (NIROSETI) instrument has been designed and constructed to take advantage of a new generation of fast (> 1 Ghz) low-noise near-infrared avalanche photodiodes to search for nanosecond pulsed near-infrared (850 - 1650 nm) pulses. The instrument was successfully installed and commissioned at the Nickel (1m) telescope at Lick Observatory in March 2015. We will describe the overall design of the instrument with a focus on methods developed for data acquisition and reduction for near-infrared SETI. Time and height analyses of the pulses produced by the detectors are performed to search for periodicity and coincidences in the signals. We will further discuss our NIROSETI survey plans.

A near-Infrared SETI Experiment: Alignment and Astrometric precision

NASA Astrophysics Data System (ADS)

Duenas, Andres; Maire, Jerome; Wright, Shelley; Drake, Frank D.; Marcy, Geoffrey W.; Siemion, Andrew; Stone, Remington P. S.; Tallis, Melisa; Treffers, Richard R.; Werthimer, Dan

2016-06-01

Beginning in March 2015, a Near-InfraRed Optical SETI (NIROSETI) instrument aiming to search for fast nanosecond laser pulses, has been commissioned on the Nickel 1m-telescope at Lick Observatory. The NIROSETI instrument makes use of an optical guide camera, SONY ICX694 CCD from PointGrey, to align our selected sources into two 200µm near-infrared Avalanche Photo Diodes (APD) with a field-of-view of 2.5"x2.5" each. These APD detectors operate at very fast bandwidths and are able to detect pulse widths extending down into the nanosecond range. Aligning sources onto these relatively small detectors requires characterizing the guide camera plate scale, static optical distortion solution, and relative orientation with respect to the APD detectors. We determined the guide camera plate scale as 55.9+- 2.7 milli-arcseconds/pixel and magnitude limit of 18.15mag (+1.07/-0.58) in V-band. We will present the full distortion solution of the guide camera, orientation, and our alignment method between the camera and the two APDs, and will discuss target selection within the NIROSETI observational campaign, including coordination with Breakthrough Listen.

New Assumptions to Guide SETI Research

NASA Technical Reports Server (NTRS)

Colombano, S. P.

2018-01-01

The recent Kepler discoveries of Earth-like planets offer the opportunity to focus our attention on detecting signs of life and technology in specific planetary systems, but I feel we need to become more flexible in our assumptions. The reason is that, while it is still reasonable and conservative to assume that life is most likely to have originated in conditions similar to ours, the vast time differences in potential evolutions render the likelihood of "matching" technologies very slim. In light of these challenges I propose a more "aggressive"� approach to future SETI exploration in directions that until now have received little consideration.

A critical review of the state of foreign space technology

NASA Technical Reports Server (NTRS)

Grey, J.; Gerard, M.

1978-01-01

Scientific and technical capabilities of foreign nations, i.e., USSR, Japan, West Germany, UK, France, and other ESA nations, are reviewed. Attention is given to areas in which these nations are concentrating their efforts, as well as to areas in which achievements have already been realized. Among them: space industry and processing (including nonterrestrial mining), communications satellite technology, life support systems and space colonies, earth observation, space-borne astronomy and unmanned planetary probes, materials and propulsion, and exobiology (CETI/SETI).

The 2012 Seti River flood disaster and alpine cryospheric hazards facing Pokhara, Nepal

NASA Astrophysics Data System (ADS)

Kargel, Jeffrey; Leonard, Gregory; Paudel, Lalu; Regmi, Dhananjay; Bajracharya, Samjwal; Fort, Monique; Joshi, Sharad; Poudel, Khagendra; Thapa, Bhabana; Watanabe, Teiji

2014-05-01

We have identified the likeliest cause of the Seti River disaster of May 5, 2012, in which a flash flood killed or left missing 72 people. A cascade of deadly physical Earth processes combined with imprudent habitation on the lowest flood terraces and floodplain. The process cascade started with rockfalls into the Seti River gorge (observed via repeat ASTER imaging). The last rockfall-one to several weeks prior to the disaster-affected a knickpoint in the Seti River gorge and impounded glacial meltwater and spring snowmelt. The trigger was a large rock/ice avalanche originating from cornice ice on Annapurna IV, where part of the mass was channeled into the impoundment reservoir. That violent ground-surge event, plus possibly an air blast caused by a violent gravity flow of airborne debris-then burst the rockfall dam. This was not a glacier lake outburst flood. Glaciers were involved in the disaster by supplying meltwater, which was impounded by the rockfall dam, by triggering the disaster with collapse of cornice ice, and by contributing ice to the landslide and outburst flood. Debuttressing of moraine debris and ancient glacial lake sediment by retreat and thinning of glaciers also may have played a role-this is the only possible indirect link of the disaster to climate change. The rockfall and avalanche mass movements occurred independently of climate change. The narrow and easily blocked Seti River gorge was a key factor in the 2012 disaster, and it remains a unique component of this physiographic setting. A similar flood in this area may happen by a different cascade of Earth surface processes. An enormous mass of ancient unconsolidated glaciolacustrine and moraine sediment-many cubic kilometers-was discovered and is vulnerable to production of debris flows and hyperconcentrated slurry flows. Some aggravating processes occurring in the Sabche Cirque are related to climate change. Glaciers in that area are melting, and small lakes are forming. Although the lakes were not implicated in the 2012 disaster, the possibility exists for a small glacial lake outburst flood to trigger a larger mass movement. Such a debris flow could reach Pokhara directly. More likely, a debris flow in the Sabche Cirque could form another temporary and potentially dangerous impoundment dam in the gorge. Furthermore, the type of rockfall blockage that produced 2012's natural impoundment reservoir is likely to happen repeatedly. Hence, there is a high capacity of the Earth system in this area to produce comparable or even bigger flash floods or mass flows. The likelihood of a further disaster is magnified by imprudent habitation of the river channel and lower floodplain. Of all the changes to the Pokhara Valley, human encroachment on the flood plain is the factor most related to increasing vulnerability, but it is also the one factor that could be remedied by a complete ban on construction on lower terraces, if that is politically feasible. Warning systems could help, but fairly relocating people in jeopardy would be more effective. Supported by NASA/USAID SERVIR Applied Sciences and USAID Climbers' Science.

Evolution and mass extinctions as lognormal stochastic processes

NASA Astrophysics Data System (ADS)

Maccone, Claudio

2014-10-01

In a series of recent papers and in a book, this author put forward a mathematical model capable of embracing the search for extra-terrestrial intelligence (SETI), Darwinian Evolution and Human History into a single, unified statistical picture, concisely called Evo-SETI. The relevant mathematical tools are: (1) Geometric Brownian motion (GBM), the stochastic process representing evolution as the stochastic increase of the number of species living on Earth over the last 3.5 billion years. This GBM is well known in the mathematics of finances (Black-Sholes models). Its main features are that its probability density function (pdf) is a lognormal pdf, and its mean value is either an increasing or, more rarely, decreasing exponential function of the time. (2) The probability distributions known as b-lognormals, i.e. lognormals starting at a certain positive instant b>0 rather than at the origin. These b-lognormals were then forced by us to have their peak value located on the exponential mean-value curve of the GBM (Peak-Locus theorem). In the framework of Darwinian Evolution, the resulting mathematical construction was shown to be what evolutionary biologists call Cladistics. (3) The (Shannon) entropy of such b-lognormals is then seen to represent the `degree of progress' reached by each living organism or by each big set of living organisms, like historic human civilizations. Having understood this fact, human history may then be cast into the language of b-lognormals that are more and more organized in time (i.e. having smaller and smaller entropy, or smaller and smaller `chaos'), and have their peaks on the increasing GBM exponential. This exponential is thus the `trend of progress' in human history. (4) All these results also match with SETI in that the statistical Drake equation (generalization of the ordinary Drake equation to encompass statistics) leads just to the lognormal distribution as the probability distribution for the number of extra-terrestrial civilizations existing in the Galaxy (as a consequence of the central limit theorem of statistics). (5) But the most striking new result is that the well-known `Molecular Clock of Evolution', namely the `constant rate of Evolution at the molecular level' as shown by Kimura's Neutral Theory of Molecular Evolution, identifies with growth rate of the entropy of our Evo-SETI model, because they both grew linearly in time since the origin of life. (6) Furthermore, we apply our Evo-SETI model to lognormal stochastic processes other than GBMs. For instance, we provide two models for the mass extinctions that occurred in the past: (a) one based on GBMs and (b) the other based on a parabolic mean value capable of covering both the extinction and the subsequent recovery of life forms. (7) Finally, we show that the Markov & Korotayev (2007, 2008) model for Darwinian Evolution identifies with an Evo-SETI model for which the mean value of the underlying lognormal stochastic process is a cubic function of the time. In conclusion: we have provided a new mathematical model capable of embracing molecular evolution, SETI and entropy into a simple set of statistical equations based upon b-lognormals and lognormal stochastic processes with arbitrary mean, of which the GBMs are the particular case of exponential growth.

Cultural aspects of SETI

NASA Technical Reports Server (NTRS)

Billingham, John

1991-01-01

The paper presents a broad range of issues that raise important questions about the search for exterrestrial life forms or intelligence. The history of the concept of plurality of inhabited worlds is reviewed, and disciplinary areas are cited that are considered crucial for SETI. Such issues involve analogs of the discovery of ETI, immediate responses to such detections, and the significance of journalistic and media response. The responses of religion is also considered, and it is suggested that humankind respond to the discovery of ETI with a single voice and message. The issues discussed demonstrate the need for explicit protocols that would be followed after any discovery of the types discussed.

Exoplanets and SETI

NASA Astrophysics Data System (ADS)

Wright, Jason T.

The discovery of exoplanets has both focused and expanded the search for extraterrestrial intelligence. The consideration of Earth as an exoplanet, the knowledge of the orbital parameters of individual exoplanets, and our new understanding of the prevalence of exoplanets throughout the galaxy have all altered the search strategies of communication SETI efforts, by inspiring new "Schelling points" (i.e. optimal search strategies for beacons). Future efforts to characterize individual planets photometrically and spectroscopically, with imaging and via transit, will also allow for searches for a variety of technosignatures on their surfaces, in their atmospheres, and in orbit around them. In the near-term, searches for new planetary systems might even turn up free-floating megastructures.

A language based on analogy to communicate cultural concepts in SETI

NASA Astrophysics Data System (ADS)

Musso, Paolo

2011-02-01

The present paper is a synthesis of three presentation given by myself at the Toulouse IAC 2001 ( Analogy as a tool to communicate abstract concepts in SETI), the Bremen IAC 2003 ( From maths to culture: towards an effective message), and the Vancouver IAC 2004 ( Philosophical and religious implications of extraterrestrial intelligent life). Its aim is to find a way to make our cultural concepts understandable to hypothetical extraterrestrials (ETs) in a SETI communication. First of all, I expose the reasons why I think that analogy could be a good tool for this purpose. Then, I try to show that this is possible only in the context of an integrated language, using both abstract symbols and pictures, also sketching two practical examples about some basic concepts of our moral and religious tradition. Further studies are required to determine whether this method could be extended to the higher-level abstract concepts in the other fields of our culture. Finally, I discuss the possible role of mathematics, logic and natural science in the construction of an analogy-based language for interstellar messages with a cultural content and a possible way of managing this matter from a social point of view.

Astrobiology in culture: the search for extraterrestrial life as "science".

PubMed

Billings, Linda

2012-10-01

This analysis examines the social construction of authority, credibility, and legitimacy for exobiology/astrobiology and, in comparison, the search for extraterrestrial intelligence (SETI), considering English-language conceptions of these endeavors in scientific culture and popular culture primarily in the United States. The questions that define astrobiology as a scientific endeavor are multidisciplinary in nature, and this endeavor is broadly appealing to public audiences as well as to the scientific community. Thus, it is useful to examine astrobiology in culture-in scientific culture, official culture, and popular culture. A researcher may explore science in culture, science as culture, by analyzing its rhetoric, the primary means that people use to construct their social realities-their cultural environment, as it were. This analysis follows this path, considering scientific and public interest in astrobiology and SETI and focusing on scientific and official constructions of the two endeavors. This analysis will also consider whether and how scientific and public conceptions of astrobiology and SETI, which are related but at the same time separate endeavors, converge or diverge and whether and how these convergences or divergences affect the scientific authority, credibility, and legitimacy of these endeavors.

Starry Messages - Searching for Signatures of Interstellar Archaeology

NASA Astrophysics Data System (ADS)

Carrigan, R. A., Jr.

Searching for signatures of cosmic-scale archaeological artefacts such as Dyson spheres or Kardashev civilizations is an interesting alternative to conventional SETI. Uncovering such an artifact does not require the intentional transmission of a signal on the part of the originating civilization. This type of search is called interstellar archaeology or sometimes cosmic archaeology . The detection of intelligence elsewhere in the Universe with interstellar archaeology or SETI would have broad implications for science. For example, the constraints of the anthropic principle would have to be loosened if a different type of intelligence was discovered elsewhere. A variety of interstellar archaeology signatures are discussed including non-natural planetary atmospheric constituents, stellar doping with isotopes of nuclear wastes, Dyson spheres, as well as signatures of stellar and galactic-scale engineering. The concept of a Fermi bubble due to interstellar migration is introduced in the discussion of galactic signatures. These potential interstellar archaeological signatures are classified using the Kardashev scale. A modified Drake equation is used to evaluate the relative challenges of finding various sources. With few exceptions interstellar archaeological signatures are clouded and beyond current technological capabilities. However SETI for so-called cultural transmissions and planetary atmosphere signatures are within reach.

Broad horizons SETI, SF and education

NASA Astrophysics Data System (ADS)

Griffiths, Martin

2004-04-01

Science fiction (SF) is often perceived as a ‘fringe’ form of entertainment that excites the socially challenged. This misperception detracts from the critical, scientific and interpretive nature of the genre which can be directed into science teaching at school and university levels as an innovative way of exploring the cultural background, politics, leitmotif and themes of society, science and their operation. One example is the ‘alien’ theme in SF; it is perceptually one of the driving factors in the search for extraterrestrial intelligence (SETI). Such a topic can become an introduction to current technology, the motives and politics of science and the sociological implications inherent in a confrontation with the ideal of man's uniqueness in the cosmos. When applied to the SETI, SF engenders a constructive convergence in studies such as biological determinism, the evolution of life, communication, interstellar travel and methods of contact, thus enriching the consideration of possible life in the cosmos. Adopting elements of SF in lifelong learning therefore enables informed, imaginative reflection and debate that educates, trains and instructs, broadening the potential of students and their future roles by invoking an analysis of vital public, scientific and humanistic fields.

Models@Home: distributed computing in bioinformatics using a screensaver based approach.

PubMed

Krieger, Elmar; Vriend, Gert

2002-02-01

Due to the steadily growing computational demands in bioinformatics and related scientific disciplines, one is forced to make optimal use of the available resources. A straightforward solution is to build a network of idle computers and let each of them work on a small piece of a scientific challenge, as done by Seti@Home (http://setiathome.berkeley.edu), the world's largest distributed computing project. We developed a generally applicable distributed computing solution that uses a screensaver system similar to Seti@Home. The software exploits the coarse-grained nature of typical bioinformatics projects. Three major considerations for the design were: (1) often, many different programs are needed, while the time is lacking to parallelize them. Models@Home can run any program in parallel without modifications to the source code; (2) in contrast to the Seti project, bioinformatics applications are normally more sensitive to lost jobs. Models@Home therefore includes stringent control over job scheduling; (3) to allow use in heterogeneous environments, Linux and Windows based workstations can be combined with dedicated PCs to build a homogeneous cluster. We present three practical applications of Models@Home, running the modeling programs WHAT IF and YASARA on 30 PCs: force field parameterization, molecular dynamics docking, and database maintenance.

Starry messages: Searching for signatures of interstellar archaeology

DOE Office of Scientific and Technical Information (OSTI.GOV)

Carrigan, Richard A., Jr.; /Fermilab

2009-12-01

Searching for signatures of cosmic-scale archaeological artifacts such as Dyson spheres or Kardashev civilizations is an interesting alternative to conventional SETI. Uncovering such an artifact does not require the intentional transmission of a signal on the part of the original civilization. This type of search is called interstellar archaeology or sometimes cosmic archaeology. The detection of intelligence elsewhere in the Universe with interstellar archaeology or SETI would have broad implications for science. For example, the constraints of the anthropic principle would have to be loosened if a different type of intelligence was discovered elsewhere. A variety of interstellar archaeology signaturesmore » are discussed including non-natural planetary atmospheric constituents, stellar doping with isotopes of nuclear wastes, Dyson spheres, as well as signatures of stellar and galactic-scale engineering. The concept of a Fermi bubble due to interstellar migration is introduced in the discussion of galactic signatures. These potential interstellar archaeological signatures are classified using the Kardashev scale. A modified Drake equation is used to evaluate the relative challenges of finding various sources. With few exceptions interstellar archaeological signatures are clouded and beyond current technological capabilities. However SETI for so-called cultural transmissions and planetary atmosphere signatures are within reach.« less

A near-infrared SETI experiment: A multi-time resolution data analysis

NASA Astrophysics Data System (ADS)

Tallis, Melisa; Maire, Jerome; Wright, Shelley; Drake, Frank D.; Duenas, Andres; Marcy, Geoffrey W.; Stone, Remington P. S.; Treffers, Richard R.; Werthimer, Dan; NIROSETI

2016-06-01

We present new post-processing routines which are used to detect very fast optical and near-infrared pulsed signals using the latest NIROSETI (Near-Infrared Optical Search for Extraterrestrial Intelligence) instrument. NIROSETI was commissioned in 2015 at Lick Observatory and searches for near-infrared (0.95 to 1.65μ) nanosecond pulsed laser signals transmitted by distant civilizations. Traditional optical SETI searches rely on analysis of coincidences that occur between multiple detectors at a fixed time resolution. We present a multi-time resolution data analysis that extends our search from the 1ns to 1ms range. This new feature greatly improves the versatility of the instrument and its search parameters for near-infrared SETI. We aim to use these algorithms to assist us in our search for signals that have varying duty cycles and pulse widths. We tested the fidelity and robustness of our algorithms using both synthetic embedded pulsed signals, as well as data from a near-infrared pulsed laser installed on the instrument. Applications of NIROSETI are widespread in time domain astrophysics, especially for high time resolution transients, and astronomical objects that emit short-duration high-energy pulses such as pulsars.

The Tomb of SETI i (KV17) in the Florence Egyptian Museum. Integrated Non-Invasive Methods for Documentation, Material History and Diagnostics

NASA Astrophysics Data System (ADS)

Coppola, M.; Bracci, S.; Cantisani, E.; Magrini, D.

2017-05-01

The tomb of Seti I (KV17) is a magnificent example of New Kingdom funerary architecture, among the longest tombs in the Valley of the Kings. As part of a collaboration between the Egyptian Museum in Florence, the University of Florence and CNR, a survey project was launched, with non-invasive methods, on the fragments from the Seti I tomb, in Florence, coming from a gate jamb connecting the chamber F to the corridor G, taken by the franco-tuscan expedition in 1829. The primary goal is to achieve the best level of documentation, knowledge of the material history and conservation assessment. Preliminary results allowed to focus some steps of the history of this fragment, from its realization to the present. The digital documentation created an excellent support for the mapping and management of the collected information. Even if still on a preliminary phase, this study shows how the combination of imaging and spectroscopic techniques allowed the characterization of many materials and the mapping of their distribution on the surface. Several original pigments have been identified as well as many anomalies due to subsequent interventions.

Astrobiology Research Experience for Undergraduates: An Interdisciplinary REU Program at the SETI Institute

NASA Astrophysics Data System (ADS)

Phillips, C. B.; Devore, E. K.

2009-12-01

The SETI Institute hosts a summer Astrobiology Research Experience for Undergraduates program for highly motivated students interested in astrobiology research. Students work with scientists at the SETI Institute and at the nearby NASA Ames Research Center on projects spanning the field of astrobiology from microbiology to planetary geology to astronomy and astrophysics. Each student is mentored by a scientist for his/her summer research project. As astrobiology is interdisciplinary, the first week includes a seminar series to provide a broad foundation in the field as the students begin their research projects. The 10-week program includes a week-long field trip to the SETI Institute’s Allen Telescope Array, located at the Hat Creek Radio Astronomy Observatory in Northern California, as well as a field experience at hydrothermal systems at nearby Lassen Volcanic National Park. Students also participate in local field trips to places like the California Academy of Sciences and other nearby locations of scientific interest, and attend seminars, lectures, and discussions on astrobiology. Students are also invited to attend events at nearby NASA Ames Research Center, which offers the opportunity to interact with other undergraduate and graduate students participating in NASA summer programs. At the end of the program, students write up and present their research projects, and mentors recommend some projects for submission to a national scientific conference, which the selected students will be funded to attend. The Astrobiology REU program emphasizes three main areas, which are listed in the table along with typical project themes. Each year, specific student research projects are described on the website, and students are asked to select the three that most interest them as a part of their applications. Applications are due in early February. Typically, 10 students apply for each available position. Students have been selected from colleges and universities national-wide, including community colleges. The Astrobiology REU program has served 4 classes of students, and is funded through summer of 2011. A total of 61 students have participated (12 in 2006, 17 in 2007, 17 in 2008, and 15 in 2009); all have successfully completed their internships. Of these students, 59% were women, and 21% were minorities. To date 18 students have gone on to graduate studies, in Master’s or PhD programs at schools including Harvard, UC Berkeley, UC Santa Cruz, Stanford, Univ. of Nebraska, and many others, in fields including astronomy, optical science, space life sciences, geology, physics, mechanical engineering, and molecular and cellular biology. The SETI Institute is a non-profit private scientific research institution located in California’s Silicon Valley. The Astrobiology REU program is supported by National Science Foundation Grant AST-0852095 with additional funding from NASA’s Astrobiology Institute, the SETI Institute and private donors.Main research areas and typical project themes

Enhancement of anodic current attributed to oxygen evolution on α-Fe2O3 electrode by microwave oscillating electric field

PubMed Central

Kishimoto, Fuminao; Matsuhisa, Masayuki; Kawamura, Shinichiro; Fujii, Satoshi; Tsubaki, Shuntaro; Maitani, Masato M.; Suzuki, Eiichi; Wada, Yuji

2016-01-01

Various microwave effects on chemical reactions have been observed, reported and compared to those carried out under conventional heating. These effects are classified into thermal effects, which arise from the temperature rise caused by microwaves, and non-thermal effects, which are attributed to interactions between substances and the oscillating electromagnetic fields of microwaves. However, there have been no direct or intrinsic demonstrations of the non-thermal effects based on physical insights. Here we demonstrate the microwave enhancement of oxidation current of water to generate dioxygen with using an α-Fe2O3 electrode induced by pulsed microwave irradiation under constantly applied potential. The rectangular waves of current density under pulsed microwave irradiation were observed, in other words the oxidation current of water was increased instantaneously at the moment of the introduction of microwaves, and stayed stably at the plateau under continuous microwave irradiation. The microwave enhancement was observed only for the α-Fe2O3 electrode with the specific surface electronic structure evaluated by electrochemical impedance spectroscopy. This discovery provides a firm evidence of the microwave special non-thermal effect on the electron transfer reactions caused by interaction of oscillating microwaves and irradiated samples. PMID:27739529

RFI in the 0.5 to 10.8 GHz Band at the Allen Telescope Array

NASA Astrophysics Data System (ADS)

Backus, Peter R.; Kilsdonk, T. N.; Allen Telescope Array Team

2007-05-01

Thanks to funding from the Paul G. Allen Foundation (and other philanthropic supporters) for the technology development and first phase of construction, the first 42 elements of the Allen Telescope Array (ATA-42) are being commissioned for rapid surveys of the astrophysical and technological sky. Because of the innovative design of this array that will eventually include 350 elements, traditional radio astronomy and SETI are enabled simultaneously 24x7. The array has been designed to provide an optimal snapshot image of a very large field of view and simultaneously, 16 (dual polarization) phased beams within the field of view to be analyzed by a suite of backend processors. Four independent 100 MHz bands may be tuned anywhere within the instantaneous receiver bandwidth from 0.5 to 11.2 GHz. One key to the success of rapid surveys for astrophysical or technological signals is a quiet background. This poster presents the results of initial surveys with 6.1 meter dishes at high-spectral-resolution of the background spectrum from 0.5 to 10.8 GHz at the Hat Creek Radio Observatory, where the ATA is being constructed, and compares it with the background spectrum from 1.2-3 GHz at other observatories where SETI observations have been conducted within the past 11 years.

New Evo-SETI results about civilizations and molecular clock

NASA Astrophysics Data System (ADS)

Maccone, Claudio

2017-01-01

In two recent papers (Maccone 2013, 2014) as well as in the book (Maccone 2012), this author described the Evolution of life on Earth over the last 3.5 billion years as a lognormal stochastic process in the increasing number of living Species. In (Maccone 2012, 2013), the process used was `Geometric Brownian Motion' (GBM), largely used in Financial Mathematics (Black-Sholes models). The GBM mean value, also called `the trend', always is an exponential in time and this fact corresponds to the so-called `Malthusian growth' typical of population genetics. In (Maccone 2014), the author made an important generalization of his theory by extending it to lognormal stochastic processes having an arbitrary trend m L (t), rather than just a simple exponential trend as the GBM have. The author named `Evo-SETI' (Evolution and SETI) his theory inasmuch as it may be used not only to describe the full evolution of life on Earth from RNA to modern human societies, but also the possible evolution of life on exoplanets, thus leading to SETI, the current Search for ExtraTerrestrial Intelligence. In the Evo-SETI Theory, the life of a living being (let it be a cell or an animal or a human or a Civilization of humans or even an ET Civilization) is represented by a b-lognormal, i.e. a lognormal probability density function starting at a precise instant b (`birth') then increasing up to a peak-time p, then decreasing to a senility-time s (the descending inflexion point) and then continuing as a straight line down to the death-time d (`finite b-lognormal'). (1) Having so said, the present paper describes the further mathematical advances made by this author in 2014-2015, and is divided in two halves: Part One, devoted to new mathematical results about the History of Civilizations as b-lognormals, and (2) Part Two, about the applications of the Evo-SETI Theory to the Molecular Clock, well known to evolutionary geneticists since 50 years: the idea is that our EvoEntropy grows linearly in time just as the molecular clock. (a) Summarizing the new results contained in this paper: In Part One, we start from the History Formulae already given in (Maccone 2012, 2013) and improve them by showing that it is possible to determine the b-lognormal not only by assigning its birth, senility and death, but rather by assigning birth, peak and death (BPD Theorem: no assigned senility). This is precisely what usually happens in History, when the life of a VIP is summarized by giving birth time, death time, and the date of the peak of activity in between them, from which the senility may then be calculated (approximately only, not exactly). One might even conceive a b-scalene (triangle) probability density just centred on these three points (b, p, d) and we derive the relevant equations. As for the uniform distribution between birth and death only, that is clearly the minimal description of someone's life, we compare it with both the b-lognormal and the b-scalene by comparing the Shannon Entropy of each, which is the measure of how much information each of them conveys. Finally we prove that the Central Limit Theorem (CLT) of Statistics becomes a new `E-Pluribus-Unum' Theorem of the Evo-SETI Theory, giving formulae by which it is possible to find the b-lognormal of the History of a Civilization C if the lives of its Citizens C i are known, even if only in the form of birth and death for the vast majority of the Citizens. (b) In Part Two, we firstly prove the crucial Peak-Locus Theorem for any given trend m L (t) and not just for the GBM exponential. Then we show that the resulting Evo-Entropy grows exactly linearly in time if the trend is the exponential GMB trend. (c) In addition, three Appendixes (online) with all the relevant mathematical proofs are attached to this paper. They are written in the Maxima language, and Maxima is a symbolic manipulator that may be downloaded for free from the web. In conclusion, this paper further increases the huge mathematical spectrum of applications of the Evo-SETI Theory to prepare Humans for the first Contact with an Extra-Terrestrial Civilization.

2014 Summer Series - Jill Tarter - Searching for ET: An Investment In Our Long Future

NASA Image and Video Library

2014-07-31

SETI marked it's semi-centennial as a scientific exploration in 2010. Now that exoplanets have been discovered in such abundance and diversity, and Earth 2.0 is a reasonable expectation, it seems more relevant than ever to ask the 'Are we alone?' question. What should we be doing to improve our capability to detect intelligent life beyond Earth? There are lots of technical questions about how to move forward, but the most difficult question of all may be how do we integrate and support this vast, and potentially long-term endeavor into a world of short-term thinking? How do we justify continued investment in SETI?

On the design of a postprocessor for a search for extraterrestrial intelligence /SETI/ system

NASA Technical Reports Server (NTRS)

Healy, T. J.; Seeger, C. L.; Stull, M. A.

1979-01-01

The design of an on-line postprocessor for a search for extraterrestrial intelligence (SETI) system is described. Signal processing tasks of the postprocessor include: (1) analysis of power level, phase coherence, and state of polarization of single-channel signals in a search for significant signals; (2) grouping or aggregation of adjacent channel data, time averaging of data; and (3) the detection of drifting and modulated signals. Control functions include multichannel spectrum analyzer frequency and clock control, system calibration and selfdiagnostic, control of data flow to and from short-term and long-term (archival) memories, and operation of detection subsystems, such as a visual display and a tunable receiver.

Pre-launch simulation experiment of microwave-ionosphere nonlinear interaction rocket experiment in the space plasma chamber

NASA Astrophysics Data System (ADS)

Kaya, N.; Tsutsui, M.; Matsumoto, H.; Kimura, I.

1980-09-01

A pre-flight test experiment of a microwave-ionosphere nonlinear interaction rocket experiment (MINIX) has been carried out in a space plasma simulation chamber. Though the first rocket experiment ended up in failure because of a high voltage trouble, interesting results are observed in the pre-flight experiment. A significant microwave heating of plasma up to 300% temperature increase is observed. Strong excitations of plasma waves by the transmitted microwaves in the VLF and HF range are observed as well. These microwave effects may have to be taken into account in solar power satellite projects in the future.

Estimating effective roughness parameters of the L-MEB model for soil moisture retrieval using passive microwave observations from SMAPVEX12

USDA-ARS?s Scientific Manuscript database

Although there have been efforts to improve existing soil moisture retrieval algorithms, the ability to estimate soil moisture from passive microwave observations is still hampered by problems in accurately modeling the observed microwave signal. This paper focuses on the estimation of effective sur...

GCOM-W AMSR2 soil moisture product validation using core validation sites

USDA-ARS?s Scientific Manuscript database

The Advanced Microwave Scanning Radiometer 2 (AMSR2) is part of the Global Change Observation Mission-Water (GCOM-W). AMSR2 has filled the gap in passive microwave observations left by the loss of the Advanced Microwave Scanning Radiometer–Earth Observing System (AMSR-E) after almost 10 years of obs...

Satellite microwave observations of soil moisture variations. [by the microwave radiometer on the Nimbus 5 satellite

NASA Technical Reports Server (NTRS)

Schmugge, T. J.; Rango, A.; Neff, R.

1975-01-01

The electrically scanning microwave radiometer (ESMR) on the Nimbus 5 satellite was used to observe microwave emissions from vegetated and soil surfaces over an Illinois-Indiana study area, the Mississippi Valley, and the Great Salt Lake Desert in Utah. Analysis of microwave brightness temperatures (T sub B) and antecedent rainfall over these areas provided a way to monitor variations of near-surface soil moisture. Because vegetation absorbs microwave emission from the soil at the 1.55 cm wavelength of ESMR, relative soil moisture measurements can only be obtained over bare or sparsely vegetated soil. In general T sub B increased during rainfree periods as evaporation of water and drying of the surface soil occurs, and drops in T sub B are experienced after significant rainfall events wet the soil. Microwave observations from space are limited to coarse resolutions (10-25 km), but it may be possible in regions with sparse vegetation cover to estimate soil moisture conditions on a watershed or agricultural district basis, particularly since daily observations can be obtained.

Leg kinematics and muscle activity during treadmill running in the cockroach, Blaberus discoidalis: I. Slow running.

PubMed

Watson, J T; Ritzmann, R E

1998-01-01

We have combined high-speed video motion analysis of leg movements with electromyogram (EMG) recordings from leg muscles in cockroaches running on a treadmill. The mesothoracic (T2) and metathoracic (T3) legs have different kinematics. While in each leg the coxa-femur (CF) joint moves in unison with the femurtibia (FT) joint, the relative joint excursions differ between T2 and T3 legs. In T3 legs, the two joints move through approximately the same excursion. In T2 legs, the FT joint moves through a narrower range of angles than the CF joint. In spite of these differences in motion, no differences between the T2 and T3 legs were seen in timing or qualitative patterns of depressor coxa and extensor tibia activity. The average firing frequencies of slow depressor coxa (Ds) and slow extensor tibia (SETi) motor neurons are directly proportional to the average angular velocity of their joints during stance. The average Ds and SETi firing frequency appears to be modulated on a cycle-by-cycle basis to control running speed and orientation. In contrast, while the frequency variations within Ds and SETi bursts were consistent across cycles, the variations within each burst did not parallel variations in the velocity of the relevant joints.

Neuromuscular plasticity in the locust after permanent removal of an excitatory motoneuron of the extensor tibiae muscle.

PubMed

Büschges, A; Djokaj, S; Bässler, D; Bässler, U; Rathmayer, W

2000-01-01

The capacity of the larval insect nervous system to compensate for the permanent loss of one of the two excitatory motoneurons innervating a leg muscle was investigated in the locust (Locusta migratoria). In the fourth instar, the fast extensor tibiae (FETi) motoneuron in the mesothoracic ganglion was permanently removed by photoinactivation with a helium-cadmium laser. Subsequently, the animals were allowed to develop into adulthood. When experimental animals were tested as adults after final ecdysis, fast-contracting fibers in the most proximal region of the corresponding extensor muscle, which are normally predominantly innervated by FETi only, uniformly responded to activity of the slow extensor tibiae (SETi) neuron. In adult operated animals, single pulses to SETi elicited large junctional responses in the fibers which resulted in twitch contractions of these fibers similar to the responses to FETi activity in control animals. The total number of muscle fibers, their properties as histochemically determined contractional types (fast and slow), and their distribution were not affected by photoinactivation of FETi. Possible mechanisms enabling the larval neuromuscular system to compensate for the loss of FETi through functionally similar innervation by a different motoneuron, i.e. SETi, are discussed. Copyright 2000 John Wiley & Sons, Inc.

The Breakthrough Listen Initiative and the Future of the Search for Intelligent Life

NASA Astrophysics Data System (ADS)

Enriquez, J. Emilio; Siemion, Andrew; Croft, Steve; Hellbourg, Greg; Lebofsky, Matt; MacMahon, David; Price, Danny; DeBoer, David; Werthimer, Dan

2017-05-01

Unprecedented recent results in the fields of exoplanets and astrobiology have dramatically increased the interest in the potential existence of intelligent life elsewhere in the galaxy. Additionally, the capabilities of modern Searches for Extraterrestrial Intelligence (SETI) have increased tremendously. Much of this improvement is due to the ongoing development of wide bandwidth radio instruments and the Moore's Law increase in computing power over the previous decades. Together, these instrumentation improvements allow for narrow band signal searches of billions of frequency channels at once.The Breakthrough Listen Initiative (BL) was launched on July 20, 2015 at the Royal Society in London, UK with the goal to conduct the most comprehensive and sensitive search for advanced life in humanity's history. Here we detail important milestones achieved during the first year and a half of the program. We describe the key BL SETI surveys and briefly describe current facilities, including the Green Bank Telescope, the Automated Planet Finder and the Parkes Observatory. We also mention the ongoing and potential collaborations focused on complementary sciences, these include pulse searches of pulsars and FRBs, as well as astrophysically powered radio emission from stars targeted by our program.We conclude with a brief view towards future SETI searches with upcoming next-generation radio facilities such as SKA and ngVLA.

Area Coverage of Expanding E.T. Signals in the Galaxy: SETI and Drake’s N

NASA Astrophysics Data System (ADS)

Grimaldi, Claudio; Marcy, Geoffrey W.; Tellis, Nathaniel K.; Drake, Frank

2018-05-01

The Milky Way Galaxy contains an unknown number, N, of civilizations that emit electromagnetic radiation (of unknown wavelengths) over a finite lifetime, L. Here we are assuming that the radiation is not produced indefinitely, but within L as a result of some unknown limiting event. When a civilization stops emitting, the radiation continues traveling outward at the speed of light, c, but is confined within a shell wall having constant thickness, cL. We develop a simple model of the Galaxy that includes both the birthrate and detectable lifetime of civilizations to compute the possibility of a SETI detection at the Earth. Two cases emerge for radiation shells that are (1) thinner than or (2) thicker than the size of the Galaxy, corresponding to detectable lifetimes, L, less than or greater than the light-travel time, ∼100,000 years, across the Milky Way, respectively. For case (1), each shell wall has a thickness smaller than the size of the Galaxy and intersects the Galactic plane in a donut shape (annulus) that fills only a fraction of the Galaxy’s volume, inhibiting SETI detection. But the ensemble of such shell walls may still fill our Galaxy, and indeed may overlap locally, given a sufficiently high birthrate of detectable civilizations. In the second case, each radiation shell is thicker than the size of our Galaxy. Yet, the ensemble of walls may or may not yield a SETI detection depending on the civilization birthrate. We compare the number of different electromagnetic transmissions arriving at Earth to Drake’s N, the number of currently emitting civilizations, showing that they are equal to each other for both cases (1) and (2). However, for L < 100,000 years, the transmissions arriving at Earth may come from distant civilizations long extinct, while civilizations still alive are sending signals yet to arrive.

An examination of astrophysical habitats for targeted SETI

NASA Technical Reports Server (NTRS)

Doyle, Laurance R.; Mckay, Christopher P.; Reynolds, Ray T.; Whitmire, Daniel P.; Matese, John J.

1991-01-01

Planetary atmospheric radiative transfer models have recently given valuable insights into the definition of the solar system's ecoshell. In addition, however, results have indicated that constraints on solar evolution also need to be addressed, with even minor solar variations, (mass loss, for example), having important consequences from an exobiological standpoint. Following the definition of the solar system's ecoshell evolution, the ecoshells around different stellar spectral types can then be modeled. In this study the astrophysical constraints on the definition of ecoshells and possible exobiological habitats includes: (1) the investigation of the evolution of the solar system's ecoshell under different initial solar/stellar model conditions as indicated by both solar abundance considerations as well as planetary evidence; (2) an outline of considerations necessary to define the ecoshells around the most abundant spectral-type stars, the K and M stars looking at the effects on exobiological habitats of planetary rotational tidal locking effects, and stellar flare/chromospheric-activity cycles, among other effects; (3) a preliminary examination of the factors defining the expected ecoshells around binary stars determining the of regular stellar eclipses, and the expected shortening of the semi-major axis. These results can then be applied to the targeted microwave search for extraterrestrial intelligent signals by constraining the ecoshell space in the solar neighborhood.

Examining Dense Data Usage near the Regions with Severe Storms in All-Sky Microwave Radiance Data Assimilation and Impacts on GEOS Hurricane Analyses

NASA Technical Reports Server (NTRS)

Kim, Min-Jeong; Jin, Jianjun; McCarty, Will; El Akkraoui, Amal; Todling, Ricardo; Gelaro, Ron

2018-01-01

Many numerical weather prediction (NWP) centers assimilate radiances affected by clouds and precipitation from microwave sensors, with the expectation that these data can provide critical constraints on meteorological parameters in dynamically sensitive regions to make significant impacts on forecast accuracy for precipitation. The Global Modeling and Assimilation Office (GMAO) at NASA Goddard Space Flight Center assimilates all-sky microwave radiance data from various microwave sensors such as all-sky GPM Microwave Imager (GMI) radiance in the Goddard Earth Observing System (GEOS) atmospheric data assimilation system (ADAS), which includes the GEOS atmospheric model, the Gridpoint Statistical Interpolation (GSI) atmospheric analysis system, and the Goddard Aerosol Assimilation System (GAAS). So far, most of NWP centers apply same large data thinning distances, that are used in clear-sky radiance data to avoid correlated observation errors, to all-sky microwave radiance data. For example, NASA GMAO is applying 145 km thinning distances for most of satellite radiance data including microwave radiance data in which all-sky approach is implemented. Even with these coarse observation data usage in all-sky assimilation approach, noticeable positive impacts from all-sky microwave data on hurricane track forecasts were identified in GEOS-5 system. The motivation of this study is based on the dynamic thinning distance method developed in our all-sky framework to use of denser data in cloudy and precipitating regions due to relatively small spatial correlations of observation errors. To investigate the benefits of all-sky microwave radiance on hurricane forecasts, several hurricane cases selected between 2016-2017 are examined. The dynamic thinning distance method is utilized in our all-sky approach to understand the sources and mechanisms to explain the benefits of all-sky microwave radiance data from various microwave radiance sensors like Advanced Microwave Sounder Unit (AMSU-A), Microwave Humidity Sounder (MHS), and GMI on GEOS-5 analyses and forecasts of various hurricanes.

The Breakthrough Listen Search for Intelligent Life: L-Band Data Recovery and Analysis

NASA Astrophysics Data System (ADS)

Lifset, Noah

2018-01-01

Breakthrough Listen is a next generation SETI project conducted under the leadership of UC Berkeley. In January 2016, it began collecting data with the Green Bank Telescope in West Virginia. It started a targeted campaign of stars within 50 pc with the L-band receiver (1.1-1.9 GHz). Enriquez et al. (2017) analyzed two thirds of this data comprising an homogeneous sample. The remaining one third of the L-band data taken since then is incomplete in some way, and thus required a different analysis. This project identified all possible issues with this data, and classified it based on its ability to be analyzed. Seven issues were found, and six are able to be accounted for with adapted analysis techniques. The data set consisted of observations of 366 stars within 50 pc, with 297 able to be analyzed and 69 needing to be re-observed. The Breakthrough Listen observation strategy uses 6 five minute observations per target star alternating between ON-target and OFF-target in the form ABACAD, which allows for easier radio-frequency interference identification. The analysis techniques, called turboSETI, search for a narrowband signal with a drifting doppler shift. For this data, a maximum drift rate of 4 Hz/s was chosen, which corresponds to an ET emitter on a planet three times the size of earth rotating three times as fast. An SNR threshold for signal detection of 15 was chosen, which allows for detection of signals with an EIRP (Equivalent Isotropic Radiated Power) of 9.72 x109 W for an emitter at a distance of 10 Ly. A total of 10 candidates signals were found, which were all determined to be either a satellite or another type of RFI. We can infer an upper limit of ~ 5 x108 stars in the milky way transmitting continuously towards earth in the L-band with a EIRP of 1012 W or greater.

Alien Mindscapes—A Perspective on the Search for Extraterrestrial Intelligence

NASA Astrophysics Data System (ADS)

Cabrol, Nathalie A.

2016-09-01

Advances in planetary and space sciences, astrobiology, and life and cognitive sciences, combined with developments in communication theory, bioneural computing, machine learning, and big data analysis, create new opportunities to explore the probabilistic nature of alien life. Brought together in a multidisciplinary approach, they have the potential to support an integrated and expanded Search for Extraterrestrial Intelligence (SETI1), a search that includes looking for life as we do not know it. This approach will augment the odds of detecting a signal by broadening our understanding of the evolutionary and systemic components in the search for extraterrestrial intelligence (ETI), provide more targets for radio and optical SETI, and identify new ways of decoding and coding messages using universal markers.

The Search for Extra-Terrestrial Intelligence

NASA Astrophysics Data System (ADS)

Tarter, J.

1998-12-01

Aliens abound on the movie screens, but in reality we are still trying to find out if we share our universe with other sentient creatures. Intelligence is very difficult to define, and impossible to directly detect over interstellar distances. Therefore, SETI, the search for extraterrestrial intelligence, is actually an attempt to detect evidence of another distant technology. If we find such evidence, we will infer the existence of intelligent technologists. For the past 36 years, the SETI community has had a very pragmatic definition of intelligence - the ability to build radio telescopes! Radio signals are not the only possible way to detect a technology across the vast distances that separate the stars, but given our own current technological state, it remains the best way.

Are transmissions to space dangerous?

NASA Astrophysics Data System (ADS)

Shostak, Seth

2013-01-01

We consider the suggestion that, as a matter of caution, the deliberate broadcast of signals to the cosmos should be proscribed. We explore the likely capabilities of extraterrestrial societies that might conceivably pose a threat to our species and show that this suggestion is without merit because even if followed, it would fail to keep our existence secret. In addition, trying to limit signalling activities would be a burden on our descendants, crippling their own activities for the indefinite future. A corollary to these considerations affects the search for extraterrestrial intelligence (SETI): namely, it seems inarguable that technologically advanced beings will assume that other societies are capable of detecting their leakage. Consequently, the premise that SETI should expect to find deliberate beacons from other worlds may be mistaken.

Extraterrestrial Life

NASA Technical Reports Server (NTRS)

Klein, M. J.

1993-01-01

Extraterrestrial Intelligence is intelligent life that developed somewhere other than the earth. Such life has not yet been discovered. However, scientific research, including astronomy, biology, planetary science and studies of fossils here on earth have led many scientists to conclude that such life may exist on planets orbiting at least some of the hundreds of billions of stars in our Milky Way Galaxy. Today, some researchers are trying to find evidence for extraterrestrial intelligence. This effort is often called SETI, which stands for Search for Extraterrestrial Intelligence. SETI researchers decided that looking for evidence of their technology might be the best way to discover other intelligent life in the Galaxy. They decided to use large radio telescopes to search the sky over a wide range of radio frequencies...

Remote measurement of microwave distribution based on optical detection

DOE Office of Scientific and Technical Information (OSTI.GOV)

Ji, Zhong; Ding, Wenzheng; Yang, Sihua

2016-01-04

In this letter, we present the development of a remote microwave measurement system. This method employs an arc discharge lamp that serves as an energy converter from microwave to visible light, which can propagate without transmission medium. Observed with a charge coupled device, quantitative microwave power distribution can be achieved when the operators and electronic instruments are in a distance from the high power region in order to reduce the potential risk. We perform the experiments using pulsed microwaves, and the results show that the system response is dependent on the microwave intensity over a certain range. Most importantly, themore » microwave distribution can be monitored in real time by optical observation of the response of a one-dimensional lamp array. The characteristics of low cost, a wide detection bandwidth, remote measurement, and room temperature operation make the system a preferred detector for microwave applications.« less

Studies on antibacterial activity of ZnO nanoparticles by ROS induced lipid peroxidation.

PubMed

Dutta, R K; Nenavathu, Bhavani P; Gangishetty, Mahesh K; Reddy, A V R

2012-06-01

Recent studies indicated the role of ROS toward antibacterial activity. In our study we report ROS mediated membrane lipid oxidation of Escherichia coli treated with ZnO nanoparticles (NPs) as supported by detection and spectrophotometric measurement of malondialdehyde (MDA) by TBARS (thiobarbituric acid-reactive species) assay. The antibacterial effects of ZnO NPs were studied by measuring the growth curve of E. coli, which showed concentration dependent bacteriostatic and bacteriocidal effects of ZnO NPs. The antibacterial effects were characterized by scanning electron microscopy (SEM) and transmission electron microscopy (TEM). Further, antibacterial effect of ZnO NPs was found to decrease by introducing histidine to the culture medium treated with ZnO NPs. The ROS scavenging action of histidine was confirmed by treating histidine to the batch of Escherichia coli+ZnO NPs at the end of the lag phase of the growth curve (Set-I) and during inoculation (Set-II). A moderate bacteriostatic effect (lag in the E. coli growth) was observed in Set-II batch while Set-I showed no bacteriostatic effect. From these evidences we confirmed that the antibacterial effect of bare as well as TG capped ZnO NPs were due to membrane lipid peroxidation caused by the ROS generated during ZnO NPs interaction in culture medium. Copyright © 2012 Elsevier B.V. All rights reserved.

Breakthrough Listen on MWA Pilot Study

NASA Astrophysics Data System (ADS)

Croft, S.; Siemion, A.; Kaplan, D. L.; Tremblay, S.

2016-07-01

We propose a pilot study, using the Voltage Capture System, for Breakthrough Listen on the MWA. Breakthrough Listen (BL) is a major new project that aims to dramatically improve the coverage of parameter space in the search for intelligent life beyond Earth. BL has already deployed hardware and software to the Green Bank Telescope, and will bring a similar program with the Parkes Telescope online in the second half of 2016. The low frequency sky is however currently very poorly explored. The superb capabilities of the MWA (large field of view, low frequency of operation, and location in a very radio quiet site) provide a unique opportunity for a pilot study to obtain voltage data for a SETI (Search For Extraterrestrial Intelligence) study of the Galactic Plane. We propose commensal observations, piggybacking on the proposed pulsar search of Tremblay et al. Using existing VCS software, combined with the pipeline developed for Breakthrough Listen at GBT and Parkes, we will perform a blind search for candidate signals from extraterrestrial intelligence. Although the chances of a detection are not large, particularly for a pilot study such as that proposed here, the Breakthrough Listen team plan to perform extensive testing and analysis on the data obtained which should be useful for other users of the MWA VCS. We will make the secondary SETI data products and associated documentation available as a resource to the community via the Breakthrough Listen online archive.

Searching for `ET': Some Open Questions

NASA Astrophysics Data System (ADS)

Kracher, A.

2013-09-01

The assumptions underlying the “search for extraterrestrial intelligence” are examined, including the role of meteoritics, planetology and exoplanetology. Interdisciplinary strategies for SETI and their problems are evaluated.

The longevity of habitable planets and the development of intelligent life

NASA Astrophysics Data System (ADS)

Simpson, Fergus

2017-07-01

Why did the emergence of our species require a timescale similar to the entire habitable period of our planet? Our late appearance has previously been interpreted by Carter (2008) as evidence that observers typically require a very long development time, implying that intelligent life is a rare occurrence. Here we present an alternative explanation, which simply asserts that many planets possess brief periods of habitability. We also propose that the rate-limiting step for the formation of observers is the enlargement of species from an initially microbial state. In this scenario, the development of intelligent life is a slow but almost inevitable process, greatly enhancing the prospects of future search for extra-terrestrial intelligence (SETI) experiments such as the Breakthrough Listen project.

Evo-SETI: A Mathematical Tool for Cladistics, Evolution, and SETI.

PubMed

Maccone, Claudio

2017-04-06

The discovery of new exoplanets makes us wonder where each new exoplanet stands along its way to develop life as we know it on Earth. Our Evo-SETI Theory is a mathematical way to face this problem. We describe cladistics and evolution by virtue of a few statistical equations based on lognormal probability density functions (pdf) in the time . We call b -lognormal a lognormal pdf starting at instant b (birth). Then, the lifetime of any living being becomes a suitable b -lognormal in the time . Next, our "Peak-Locus Theorem" translates cladistics : each species created by evolution is a b -lognormal whose peak lies on the exponentially growing number of living species. This exponential is the mean value of a stochastic process called "Geometric Brownian Motion" (GBM). Past mass extinctions were all-lows of this GBM. In addition, the Shannon Entropy (with a reversed sign) of each b -lognormal is the measure of how evolved that species is, and we call it EvoEntropy. The "molecular clock" is re-interpreted as the EvoEntropy straight line in the time whenever the mean value is exactly the GBM exponential. We were also able to extend the Peak-Locus Theorem to any mean value other than the exponential. For example, we derive in this paper for the first time the EvoEntropy corresponding to the Markov-Korotayev (2007) "cubic" evolution: a curve of logarithmic increase.

Study on disinfestation of pulses using microwave technique.

PubMed

Singh, Ranjeet; Singh, K K; Kotwaliwale, N

2012-08-01

Mortality of the pulse beetle (Callosobruchus chinensis L.) exposed, continuously, to microwave radiation (2450 MHz) was evaluated as a function of exposure time and percent power level, at adult stages. The microwave exposure time to attain 100% insect mortality at 100 %, 80%, 60%, 40%, and 20% power levels for Chickpea, Pigeon Pea and Green Gram was optimized. Effect of optimized microwave exposure time on viability, germination, cooking and milling characteristics of Chickpea, Pigeon Pea and Green Gram was also evaluated. Adult stage study was characterized by a distinct dose-exposure curve. The mortality curve was following third degree polynomial equation. The seed viability and germination of Chickpea, Pigeon Pea and Green Gram was affected by microwave exposure time and power level. It was observed that as the power level is decreasing the germination and viability of all the pulses are increasing. The effect on cooking and milling characteristics are not affected by microwave exposure time and power level. The insects in the mobile state were observed to move towards the surface from inside the nutrient medium during microwave exposure. They also curled up and in some cases aggregation was observed.

Continuity of Climate Data Records derived from Microwave Observations

NASA Astrophysics Data System (ADS)

Mears, C. A.; Wentz, F. J.; Brewer, M.; Meissner, T.; Ricciardulli, L.

2017-12-01

Remote Sensing Systems (www.remss.com) has been producing and distributing microwave climate data products from microwave imagers (SSMI, TMI, AMSR, WindSat, GMI, Aquarius, SMAP) over the global oceans since the launch of the first SSMI in 1987. Interest in these data products has been significant as researchers around the world have downloaded the approximate equivalent of 1 million satellite years of processed data. Users, including NASA, NOAA, US National Laboratories, US Navy, UK Met, ECMWF, JAXA, JMA, CMC, the Australian Bureau of Meteorology, as well as many hundreds of other agencies and universities routinely access these microwave data products. The quality of these data records has increased as more observations have become available and inter-calibration techniques have improved. The impending end of missions for WindSat, AMSR-2, and the remaining SSMIs will have significant impact on the quality and continuity of long term microwave climate data records. In addition to the problem of reduced numbers of observations, there is a real danger of losing overlapping observations. Simultaneous operation of satellites, especially when the observations are at similar local crossing times, provides a significant benefit in the effort to inter-calibrate satellites to yield accurate and stable long-term records. The end of WindSat and AMSR-2 will leave us without microwave SSTs in cold water, as there will be no microwave imagers with C-band channels. Microwave SSTs have a crucial advantage over IR SSTs, which is not able to measure SST in clouds or if aerosols are present. The gap in ocean wind vectors will be somewhat mitigated as the European ASCAT C-band scatterometer mission on MetOp is continuing. Nonetheless, the anticipated cease of several microwave satellite radiometers retrieving ocean winds in the coming years will lead to a significant gap in temporal coverage. Atmospheric water vapor, cloud liquid water, and rain rate are all important climate variables whose long-term records will inevitably degrade as the microwave imagery constellation fades.

High temperature superconducting thin film microwave circuits: Fabrication, characterization, and applications

NASA Technical Reports Server (NTRS)

Bhasin, K. B.; Warner, J. D.; Romanofsky, R. R.; Heinen, V. O.; Chorey, C. M.

1990-01-01

Epitaxial YBa2Cu3O7 films were grown on several microwave substrates. Surface resistance and penetration depth measurements were performed to determine the quality of these films. Here the properties of these films on key microwave substrates are described. The fabrication and characterization of a microwave ring resonator circuit to determine transmission line losses are presented. Lower losses than those observed in gold resonator circuits were observed at temperatures lower than critical transition temperature. Based on these results, potential applications of microwave superconducting circuits such as filters, resonators, oscillators, phase shifters, and antenna elements in space communication systems are identified.

High temperature superconducting thin film microwave circuits - Fabrication, characterization, and applications

NASA Technical Reports Server (NTRS)

Bhasin, K. B.; Warner, J. D.; Romanofsky, R. R.; Heinen, V. O.; Chorey, C. M.

1990-01-01

Epitaxial YBa2Cu3O7 films were grown on several microwave substrates. Surface resistance and penetration depth measurements were performed to determine the quality of these films. Here, the properties of these films on key microwave substrates are described. The fabrication and characterization of a microwave ring resonator circuit to determine transmission line losses are presented. Lower losses than those observed in gold resonator circuits were observed at temperatures lower than critical transition temperature. Based on these results, potential applications of microwave superconducting circuits such as filters, resonators, oscillators, phase shifters, and antenna elements in space communication systems are identified.

We are alone in our Galaxy

NASA Astrophysics Data System (ADS)

Tipler, F. J.

1982-10-01

An assessment is presented of the probability of the existence of intelligent extraterrestrial life in view of biological evolutionary constraints, in order to furnish some perspective for the hopes and claims of search of extraterrestrial intelligence (SETI) enthusiasts. Attention is given to a hypothetical extraterrestrial civilization's exploration/colonization of interstellar space by means of von Neumann machine-like, endlessly self-replicating space probes which would eventually reach the planetary systems of all stars in the Galaxy. These probes would be able to replicate the biology of their creator species, upon reaching a hospitable planet. It is suggested that the fundamental technological feasibility of such schemes, and their geometrically progressive comprehension of the Galaxy, would make actual colonization of the earth by extraterrestrials so probable as to destroy the hopes of SETI backers for occasional contact.

Time and space integrating acousto-optic folded spectrum processing for SETI

NASA Technical Reports Server (NTRS)

Wagner, K.; Psaltis, D.

1986-01-01

Time and space integrating folded spectrum techniques utilizing acousto-optic devices (AOD) as 1-D input transducers are investigated for a potential application as wideband, high resolution, large processing gain spectrum analyzers in the search for extra-terrestrial intelligence (SETI) program. The space integrating Fourier transform performed by a lens channels the coarse spectral components diffracted from an AOD onto an array of time integrating narrowband fine resolution spectrum analyzers. The pulsing action of a laser diode samples the interferometrically detected output, aliasing the fine resolution components to baseband, as required for the subsequent charge coupled devices (CCD) processing. The raster scan mechanism incorporated into the readout of the CCD detector array is used to unfold the 2-D transform, reproducing the desired high resolution Fourier transform of the input signal.

Media reaction to a SETI success.

PubMed

Shostak, G S

1997-01-01

Consideration of the reaction to a SETI detection by the media, and the effect this will have on the public, is more than mere sociological speculation. An accurate forecast of the media's interest can lead to actions that will help ensure that correct and comprehensible information reaches the public. This is most critical in the first few weeks following a discovery. While a widely accepted protocol for dealing with a detection exists in the "Declaration of Principles Following the Detection of Extraterrestrial Intelligence," it gives scant consideration to the fact that the actual situation will be chaotic and not subject to easy control. The 1996 story about the possible discovery of martian microfossils has provided a useful precedent for what will happen if astronomers uncover the existence of alien intelligence.

Method and apparatus utilizing ionizing and microwave radiation for saturation determination of water, oil and a gas in a core sample

DOEpatents

Maerefat, Nicida L.; Parmeswar, Ravi; Brinkmeyer, Alan D.; Honarpour, Mehdi

1994-01-01

A system for determining the relative permeabilities of gas, water and oil in a core sample has a microwave emitter/detector subsystem and an X-ray emitter/detector subsystem. A core holder positions the core sample between microwave absorbers which prevent diffracted microwaves from reaching a microwave detector where they would reduce the signal-to-noise ratio of the microwave measurements. The microwave emitter/detector subsystem and the X-ray emitter/detector subsystem each have linear calibration characteristics, allowing one subsystem to be calibrated with respect to the other subsystem. The dynamic range of microwave measurements is extended through the use of adjustable attenuators. This also facilitates the use of core samples with wide diameters. The stratification characteristics of the fluids may be observed with a windowed cell separator at the outlet of the core sample. The condensation of heavy hydrocarbon gas and the dynamic characteristics of the fluids are observed with a sight glass at the outlet of the core sample.

Spatial variability of summer Florida precipitation and its impact on microwave radiometer rainfall-measurement systems

NASA Technical Reports Server (NTRS)

Turner, B. J.; Austin, G. L.

1993-01-01

Three-dimensional radar data for three summer Florida storms are used as input to a microwave radiative transfer model. The model simulates microwave brightness observations by a 19-GHz, nadir-pointing, satellite-borne microwave radiometer. The statistical distribution of rainfall rates for the storms studied, and therefore the optimal conversion between microwave brightness temperatures and rainfall rates, was found to be highly sensitive to the spatial resolution at which observations were made. The optimum relation between the two quantities was less sensitive to the details of the vertical profile of precipitation. Rainfall retrievals were made for a range of microwave sensor footprint sizes. From these simulations, spatial sampling-error estimates were made for microwave radiometers over a range of field-of-view sizes. The necessity of matching the spatial resolution of ground truth to radiometer footprint size is emphasized. A strategy for the combined use of raingages, ground-based radar, microwave, and visible-infrared (VIS-IR) satellite sensors is discussed.

Inactivation of Clostridium difficile spores by microwave irradiation.

PubMed

Ojha, Suvash Chandra; Chankhamhaengdecha, Surang; Singhakaew, Sombat; Ounjai, Puey; Janvilisri, Tavan

2016-04-01

Spores are a potent agent for Clostridium difficile transmission. Therefore, factors inhibiting spores have been of continued interest. In the present study, we investigated the influence of microwave irradiation in addition to conductive heating for C. difficile spore inactivation in aqueous suspension. The spores of 15 C. difficile isolates from different host origins were exposed to conductive heating and microwave irradiation. The complete inhibition of spore viability at 10(7) CFU/ml was encountered following microwave treatment at 800 W for 60 s, but was not observed in the conductive-heated spores at the same time-temperature exposure. The distinct patterns of ultrastructural alterations following microwave and conductive heat treatment were observed and the degree of damages by microwave was in the exposure time-dependent manner. Microwave would therefore be a simple and time-efficient tool to inactivate C. difficile spores, thus reducing the risk of C. difficile transmission. Copyright © 2015 Elsevier Ltd. All rights reserved.

Microwave radiative transfer studies of precipitation

NASA Technical Reports Server (NTRS)

Bringi, V. N.; Vivekanandan, J.; Turk, F. Joseph

1993-01-01

Since the deployment of the DMSP SSM/I microwave imagers in 1987, increased utilization of passive microwave radiometry throughout the 10 - 100 GHz spectrum has occurred for measurement of atmospheric constituents and terrestrial surfaces. Our efforts have focused on observations and analysis of the microwave radiative transfer behavior of precipitating clouds. We have focused particular attention on combining both aircraft and SSM/I radiometer imagery with ground-based multiparameter radar observations. As part of this and the past NASA contract, we have developed a multi-stream, polarized radiative transfer model which incorporates scattering. The model has the capability to be initialized with cloud model output or multiparameter radar products. This model provides the necessary 'link' between the passive microwave radiometer and active microwave radar observations. This unique arrangement has allowed the brightness temperatures (TB) to be compared against quantities such as rainfall, liquid/ice water paths, and the vertical structure of the cloud. Quantification of the amounts of ice and water in precipitating clouds is required for understanding of the global energy balance.

Synergistic estimation of surface parameters from jointly using optical and microwave observations in EOLDAS

NASA Astrophysics Data System (ADS)

Timmermans, Joris; Gomez-Dans, Jose; Lewis, Philip; Loew, Alexander; Schlenz, Florian

2017-04-01

The large amount of remote sensing data nowadays available provides a huge potential for monitoring crop development, drought conditions and water efficiency. This potential however not been realized yet because algorithms for land surface parameter retrieval mostly use data from only a single sensor. Consequently products that combine different low-level observations from different sensors are hard to find. The lack of synergistic retrieval is caused because it is easier to focus on single sensor types/footprints and temporal observation times, than to find a way to compensate for differences. Different sensor types (microwave/optical) require different radiative transfer (RT) models and also require consistency between the models to have any impact on the retrieval of soil moisture by a microwave instrument. Varying spatial footprints require first proper collocation of the data before one can scale between different resolutions. Considering these problems, merging optical and microwave observations have not been performed yet. The goal of this research was to investigate the potential of integrating optical and microwave RT models within the Earth Observation Land Data Assimilation System (EOLDAS) synergistically to derive biophysical parameters. This system uses a Bayesian data assimilation approach together with observation operators such as the PROSAIL model to estimate land surface parameters. For the purpose of enabling the system to integrate passive microwave radiation (from an ELBARRA II passive microwave radiometer), the Community Microwave Emission Model (CMEM) RT-model, was integrated within the EOLDAS system. In order to quantify the potential, a variety of land surface parameters was chosen to be retrieved from the system, in particular variables that a) impact only optical RT (such as leaf water content and leaf dry matter), b) only impact the microwave RT (such as soil moisture and soil temperature), and c) Leaf Area Index (LAI) that impacts both optical and microwave RT. The results show a high potential when both optical and microwave are used independently. Using only RapidEye only with SAIL RT model, LAI was estimated with R=0.68 with p=0.09, although estimating leaf water content and dry matter showed lower correlations |R|<0.4. The results for retrieving soil temperature and leaf area index retrievals using only (passive microwave) Elbarra-II observations were good with respectively R=[0.85, 0.79], P=[0.0, 0.0], when focusing on dry-spells (of at least 9 days) only the results respectively [R=0.73, and P=0.0], and R=0.89 and R=0.77 for respectively the trend and anomalies. Synergistically using optical and microwave shows also a good potential. This scenario shows that absolute errors improved (with RMSE=1.22 and S=0.89), but with degrading correlations (R=0.59 and P=0.04); the sparse optical observations only improved part of the temporal domain. However in general the synergistic retrieval showed good potential; microwave data provides better information concerning the overall trend of the retrieved LAI due to the regular acquisitions, while optical data provides better information concerning the absolute values of the LAI.

High-spectral resolution solar microwave observations

NASA Technical Reports Server (NTRS)

Hurford, G. J.

1986-01-01

The application of high-spectral resolution microwave observations to the study of solar activity is discussed with particular emphasis on the frequency dependence of microwave emission from solar active regions. A shell model of gyroresonance emission from active regions is described which suggest that high-spectral resolution, spatially-resolved observations can provide quantitative information about the magnetic field distribution at the base of the corona. Corresponding observations of a single sunspot with the Owens Valley frequency-agile interferometer at 56 frequencies between 1.2 and 14 Ghs are presented. The overall form of the observed size and brightness temperature spectra was consistent with expectations based on the shell model, although there were differences of potential physical significance. The merits and weaknesses of microwave spectroscopy as a technique for measuring magnetic fields in the solar corona are briefly discussed.

Microwave and hard X-ray observations of a solar flare with a time resolution of better than 100 MS

NASA Technical Reports Server (NTRS)

Kaufmann, P.; Strauss, F. M.; Costa, J. E. R.; Dennis, B. R.; Kiplinger, A.; Frost, K. J.; Orwig, L. E.

1982-01-01

Simultaneous microwave and X-ray observations are presented for a solar flare detected on 1980 May 8 starting at 1937 UT. The X-ray observations were made with the Hard X-Ray Burst Spectrometer on the Solar Maximum Mission and covered the energy range from 28-490 keV with a time resolution of 10 ms. The microwave observations were made with the 5 and 45 foot antennas at the Itapetinga Radio Observatory at frequencies of 7 and 22 GHz, with time resolutions of 100 ms and 1 ms respectively. Detailed correlation analysis of the different time profiles of the event show that the major impulsive in the X-ray flux preceded the corresponding microwave peaks at 22 GHz by about 240ms. For this particular burst the 22 GHz peaks preceded the 7 GHz by about 1.5s. Observed delays of the microwave peaks are too large for a simple electron beam model but they can be reconciled with the speeds of shock waves in a thermal model.

Microwave and hard X-ray observations of a solar flare with a time resolution better than 100 ms

NASA Technical Reports Server (NTRS)

Kaufmann, P.; Costa, J. E. R.; Dennis, B. R.; Frost, K. J.; Orwig, L. E.; Kiplinger, A.; Strauss, F. M.

1983-01-01

Simultaneous microwave and X-ray observations are presented for a solar flare detected on 1980 May 8 starting at 1937 UT. The X-ray observations were made with the Hard X-ray Burst Spectrometer on the Solar Maximum Mission and covered the energy range from 28-490 keV with a time resolution of 10 ms. The microwave observations were made with the 5 and 45 foot antennas at the Itapetinga Radio Obervatory at frequencies of 7 and 22 GHz, with time resolutions of 100 ms and 1 ms respectively. Detailed correlation analysis of the different time profiles of the event show that the major impulsive in the X-ray flux preceded the corresponding microwave peaks at 22 GHz by about 240 ms. For this particular burst the 22 GHz peaks preceded the 7 GHz by about 1.5s. Observed delays of the microwave peaks are too large for a simple electron beam model but they can be reconciled with the speeds of shock waves in a thermal model. Previously announced in STAR as N82-30215

Constraining Microwave Emission from Extensive Air Showers via the MIDAS Experiment

NASA Astrophysics Data System (ADS)

Richardson, Matthew; Privitera, Paolo

2017-01-01

Ultra high energy cosmic rays (UHECRs) are accelerated by the most energetic processes in the universe. Upon entering Earth’s atmosphere they produce particle showers known as extensive air showers (EASs). Observatories like the Pierre Auger Observatory sample the particles and light produced by the EASs through large particle detector arrays or nitrogen fluorescence detectors to ascertain the fundamental properties of UHECRs. The large sample of high quality data provided by the Pierre Auger Observatory can be attributed to the hybrid technique which utilizes the two aforementioned techniques simultaneously; however, the limitation of only being able to observe nitrogen fluorescence from EASs on clear moonless nights yields a limited 10% duty cycle for the hybrid technique. One proposal for providing high quality data at increased statistics is the observation of isotropic microwave emission from EASs, as such emission would be observed with a 100% duty cycle. Measurements of microwave emission from laboratory air plasmas conducted by Gorham et al. (2008) produced promising results indicating that the microwave emission should be observable using inexpensive detectors. The Microwave Detection of Air Showers (MIDAS) experiment was built at the University of Chicago to characterize the isotropic microwave emission from EASs and has collected 359 days of observational data at the location of the Pierre Auger experiment. We have performed a time coincidence analysis between this data and data from Pierre Auger and we report a null result. This result places stringent limits on microwave emission from EASs and demonstrates that the laboratory measurements of Gorham et al. (2008) are not applicable to EASs, thus diminishing the feasibility of using isotropic microwave emission to detect EASs.

Effect on the grain size of single-mode microwave sintered NiCuZn ferrite and zinc titanate dielectric resonator ceramics.

PubMed

Sirugudu, Roopas Kiran; Vemuri, Rama Krishna Murthy; Venkatachalam, Subramanian; Gopalakrishnan, Anisha; Budaraju, Srinivasa Murty

2011-01-01

Microwave sintering of materials significantly depends on dielectric, magnetic and conductive Losses. Samples with high dielectric and magnetic loss such as ferrites could be sintered easily. But low dielectric loss material such as dielectric resonators (paraelectrics) finds difficulty in generation of heat during microwave interaction. Microwave sintering of materials of these two classes helps in understanding the variation in dielectric and magnetic characteristics with respect to the change in grain size. High-energy ball milled Ni0.6Cu0.2Zn0.2Fe1.98O4-delta and ZnTiO3 are sintered in conventional and microwave methods and characterized for respective dielectric and magnetic characteristics. The grain size variation with higher copper content is also observed with conventional and microwave sintering. The grain size in microwave sintered Ni0.6Cu0.2Zn0.2Fe1.98O4-delta is found to be much small and uniform in comparison with conventional sintered sample. However, the grain size of microwave sintered sample is almost equal to that of conventional sintered sample of Ni0.3Cu0.5Zn0.2Fe1.98O4-delta. In contrast to these high dielectric and magnetic loss ferrites, the paraelectric materials are observed to sinter in presence of microwaves. Although microwave sintered zinc titanate sample showed finer and uniform grains with respect to conventional samples, the dielectric characteristics of microwave sintered sample are found to be less than that of conventional sample. Low dielectric constant is attributed to the low density. Smaller grain size is found to be responsible for low quality factor and the presence of small percentage of TiO2 is observed to achieve the temperature stable resonant frequency.

Source analysis of spaceborne microwave radiometer interference over land

NASA Astrophysics Data System (ADS)

Guan, Li; Zhang, Sibo

2016-03-01

Satellite microwave thermal emissions mixed with signals from active sensors are referred to as radiofrequency interference (RFI). Based on Advanced Microwave Scanning Radiometer-Earth Observing System (AMSR-E) observations from June 1 to 16, 2011, RFI over Europe was identified and analyzed using the modified principal component analysis algorithm in this paper. The X band AMSR-E measurements in England and Italy are mostly affected by the stable, persistent, active microwave transmitters on the surface, while the RFI source of other European countries is the interference of the reflected geostationary TV satellite downlink signals to the measurements of spaceborne microwave radiometers. The locations and intensities of the RFI induced by the geostationary TV and communication satellites changed with time within the observed period. The observations of spaceborne microwave radiometers in ascending portions of orbits are usually interfered with over European land, while no RFI was detected in descending passes. The RFI locations and intensities from the reflection of downlink radiation are highly dependent upon the relative geometry between the geostationary satellite and the measuring passive sensor. Only these fields of view of a spaceborne instrument whose scan azimuths are close to the azimuth relative to the geostationary satellite are likely to be affected by RFI.

A New Catalogue of Fine Structures Superimposed on Solar Microwave Bursts

NASA Astrophysics Data System (ADS)

Fu, Qi-Jun; Yan, Yi-Hua; Liu, Yu-Ying; Wang, Min; Wang, Shu-Juan

2004-04-01

The 2.6--3.8 GHz, 4.5--7.5 GHz, 5.2--7.6 GHz and 0.7--1.5 GHz component spectrometers of Solar Broadband Radio Spectrometer (SBRS) started routine observations, respectively, in late August 1996, August 1999, August 1999, and June 2000. They just managed to catch the coming 23rd solar active maximum. Consequently, a large amount of microwave burst data with high temporal and high spectral resolutionand high sensitivity were obtained. A variety of fine structures (FS) superimposed on microwave bursts have been found. Some of them are known, such as microwave type III bursts, microwave spike emission, but these were observed with more detail; some are new. Reported for the first time here are microwave type U bursts with similar spectral morphology to those in decimetric and metric wavelengths, and with outstanding characteristics such as very short durations (tens to hundreds ms), narrow bandwidths, higher frequency drift rates and higher degrees of polarization. Type N and type M bursts were also observed. Detailed zebra pattern and fiber bursts at the high frequency were found. Drifting pulsation structure (DPS) phenomena closely associated with CME are considered to manifest the initial phase of the CME, and quasi-periodic pulsation with periods of tens ms have been recorded. Microwave ``patches", unlike those reported previously, were observed with very short durations (about 300 ms), very high flux densities (up to 1000 sfu), very high polarization (about 100% RCP), extremely narrow bandwidths (about 5%), and very high spectral indexes. These cannot be interpreted with the gyrosynchrotron process. A superfine structure in the form of microwave FS (ZPS, type U), consisting of microwave millisecond spike emission (MMS), was also found.

Data Assimilation and verification based on GEO microwave observations

NASA Astrophysics Data System (ADS)

He, J.

2017-12-01

THE frequency band from 50 to 56 GHz has been used to retrieve atmospheric temperature profiles through radiometric measurements at and near absorption maxima. Sensors working around 50-56 GHz are now only available on low earth orbit (LEO), and are still lacked in the geostationary earth orbit (GEO) application. Compared with LEO sounding, sensors working in GEO orbit can continuously monitor the full earth disk and perform. The Geostationary Interferometric Microwave Sounder (GIMS) is a synthetic aperture microwave sounder working in time-sharing sampling mode with a rotating circular antenna array. Real-time forecasting for short-term meteorological phenomena such as tropical cyclones, which is one of the most important natural disasters that cause severe damage in coastal areas around the world. Furthermore, since information available in microwave band is different from that available in visible/ infrared frequency, microwave sensor in GEO orbit can complement the existing sensors in GEO orbit that work in visible/infrared frequency to determine vertical temperature distribution and thus help investigate inner structure of tropical cyclone. As we know, a lot of improvement of WRFDA has been realized, such as radar data and LEO microwave data. It has the ability of providing initial conditions for the WRF model and assessing observing system. However, one major constraint of WRFDA is the ability of assimilating GEO microwave observations into the assimilation model and verify how the GIMS sensor effect the output data of model, especially for synthetic aperture microwave sounder. So, for my group, we focus on surface pressure and precipitation in hurricane and typhoon areas based on WRF and WRFDA model, and also, combine polar-orbit observations and geostationary microwave simulations to improve the tracking accuracy.

Satellite microwave observations of the Utah Great Salt Lake Desert

NASA Technical Reports Server (NTRS)

Ulaby, F. T.; Dellwig, L. F.; Schmugge, T.

1975-01-01

Microwave data acquired over the Great Salt Lake Desert area by sensors aboard Skylab and Nimbus 5 indicate that the microwave emission and backscatter were strongly influenced by contributions from subsurface layers of sediment saturated with brine. This phenomenon was observed by Skylab's S-194 radiometer operating at 1.4 GHz, S-193 RADSCAT (Radiometer-Scatterometer) operating at 13.9 GHz, and the Nimbus 5 ESMR (Electrically Scanning Microwave Radiometer) operating at 19.35 GHz. The availability of ESMR data over an 18-month period allowed an investigation of temporal variations.

Comparative study of microwave radiation-induced magnetoresistive oscillations induced by circularly- and linearly- polarized photo-excitation

PubMed Central

Ye, Tianyu; Liu, Han-Chun; Wang, Zhuo; Wegscheider, W.; Mani, Ramesh G.

2015-01-01

A comparative study of the radiation-induced magnetoresistance oscillations in the high mobility GaAs/AlGaAs heterostructure two dimensional electron system (2DES) under linearly- and circularly- polarized microwave excitation indicates a profound difference in the response observed upon rotating the microwave launcher for the two cases, although circularly polarized microwave radiation induced magnetoresistance oscillations observed at low magnetic fields are similar to the oscillations observed with linearly polarized radiation. For the linearly polarized radiation, the magnetoresistive response is a strong sinusoidal function of the launcher rotation (or linear polarization) angle, θ. For circularly polarized radiation, the oscillatory magnetoresistive response is hardly sensitive to θ. PMID:26450679

Comparative study of microwave radiation-induced magnetoresistive oscillations induced by circularly- and linearly- polarized photo-excitation.

PubMed

Ye, Tianyu; Liu, Han-Chun; Wang, Zhuo; Wegscheider, W; Mani, Ramesh G

2015-10-09

A comparative study of the radiation-induced magnetoresistance oscillations in the high mobility GaAs/AlGaAs heterostructure two dimensional electron system (2DES) under linearly- and circularly- polarized microwave excitation indicates a profound difference in the response observed upon rotating the microwave launcher for the two cases, although circularly polarized microwave radiation induced magnetoresistance oscillations observed at low magnetic fields are similar to the oscillations observed with linearly polarized radiation. For the linearly polarized radiation, the magnetoresistive response is a strong sinusoidal function of the launcher rotation (or linear polarization) angle, θ. For circularly polarized radiation, the oscillatory magnetoresistive response is hardly sensitive to θ.

Coordinated ultraviolet and radio observations of selected nearby stars

NASA Technical Reports Server (NTRS)

Lang, Kenneth R.

1987-01-01

All of the US2 shifts assigned were successfully completed with simultaneous International Ultraviolet Explorer (IUE) and the Very Large Array (VLA) observations of the proposed target stars. The target stars included dwarf M flare stars and RS CVn stars. The combined ultraviolet (IUE) and microwave (VLA) observations have provided important new insights to the radiation mechanisms at these two widely-separated regions of the electromagnetic spectrum. The VLA results included the discovery of narrow-band microwave radiation and rapid time variations in the microwave radiation of dwarf M flare stars. The results indicate that conventional radiation mechanisms cannot explain the microwave emission from these stars. In general, ultraviolet variations and bursts occur when no similar variations are detected at microwave wavelengths and vice versa. Although these is some overlap, the variations in these two spectral regions are usually uncorrelated, suggesting that there is little interaction between the activity centers at the two associated atmospheric levels.

Full-time response of starch subjected to microwave heating.

PubMed

Fan, Daming; Wang, Liyun; Zhang, Nana; Xiong, Lei; Huang, Luelue; Zhao, Jianxin; Wang, Mingfu; Zhang, Hao

2017-06-21

The effect of non-ionizing microwave radiation on starch is due to a gelatinization temperature range that changes starch structure and properties. However, the changes in starch upon microwave heating are observable throughout the heating process. We compared the effects on starch heating by microwaves to the effects by rapid and regular conventional heating. Our results show that microwave heating promotes the rapid rearrangement of starch molecules at low temperatures; starch showed a stable dielectric response and a high dielectric constant. Microwave heating changed the Cole-Cole curve and the polarization of starch suspension at low temperatures. A marked transition at 2.45 GHz resulted in a double-polarization phenomenon. At temperatures below gelatinization, microwave-induced dielectric rearrangement and changes in the polarization characteristics of starch suspensions reduced the absorption properties; at temperatures above gelatinization, these characteristics became consistent with conventional heating. Throughout the heating process, microwaves change the electrical response and polarization characteristics of the starch at low temperatures, but on the macro level, there is no enhancement of the material's microwave absorption properties. In contrast, with the warming process, the starch exhibited a "blocking effect", and the absorption properties of the starch quickly returned to the level observed in conductive heating after gelatinization.

Comparative microstructure study of oil palm fruit bunch fibre, mesocarp and kernels after microwave pre-treatment

NASA Astrophysics Data System (ADS)

Chang, Jessie S. L.; Chan, Y. S.; Law, M. C.; Leo, C. P.

2017-07-01

The implementation of microwave technology in palm oil processing offers numerous advantages; besides elimination of polluted palm oil mill effluent, it also reduces energy consumption, processing time and space. However, microwave exposure could damage a material’s microstructure which affected the quality of fruit that can be related to its physical structure including the texture and appearance. In this work, empty fruit bunches, mesocarp and kernel was microwave dried and their respective microstructures were examined. The microwave pretreatments were conducted at 100W and 200W and the microstructure investigation of both treated and untreated samples were evaluated using scanning electron microscope. The micrographs demonstrated that microwave does not significantly influence kernel and mesocarp but noticeable change was found on the empty fruit bunches where the sizes of the granular starch were reduced and a small portion of the silica bodies were disrupted. From the experimental data, the microwave irradiation was shown to be efficiently applied on empty fruit bunches followed by mesocarp and kernel as significant weight loss and size reduction was observed after the microwave treatments. The current work showed that microwave treatment did not change the physical surfaces of samples but sample shrinkage is observed.

Method and apparatus utilizing ionizing and microwave radiation for saturation determination of water, oil and a gas in a core sample

DOEpatents

Maerefat, N.L.; Parmeswar, R.; Brinkmeyer, A.D.; Honarpour, M.

1994-08-23

A system is described for determining the relative permeabilities of gas, water and oil in a core sample has a microwave emitter/detector subsystem and an X-ray emitter/detector subsystem. A core holder positions the core sample between microwave absorbers which prevent diffracted microwaves from reaching a microwave detector where they would reduce the signal-to-noise ratio of the microwave measurements. The microwave emitter/detector subsystem and the X-ray emitter/detector subsystem each have linear calibration characteristics, allowing one subsystem to be calibrated with respect to the other subsystem. The dynamic range of microwave measurements is extended through the use of adjustable attenuators. This also facilitates the use of core samples with wide diameters. The stratification characteristics of the fluids may be observed with a windowed cell separator at the outlet of the core sample. The condensation of heavy hydrocarbon gas and the dynamic characteristics of the fluids are observed with a sight glass at the outlet of the core sample. 11 figs.

A SETI Course at University of Western Sydney Macarthur.

ERIC Educational Resources Information Center

Bhathal, Ragbir

1999-01-01

Describes a course based on the scientific approach to the search for extraterrestrial intelligence. Explores the biological and technological aspects of the search and the social implications of possible contact. (Author/CCM)

Is interstellar archeology possible?

NASA Astrophysics Data System (ADS)

Carrigan, Richard A.

2012-09-01

Searching for signatures of cosmic-scale archeological artifacts such as Dyson spheres is an interesting alternative to conventional radio SETI. Uncovering such an artifact does not require the intentional transmission of a signal on the part of the original civilization. This type of search is called interstellar archeology or sometimes cosmic archeology. A variety of interstellar archeology signatures is discussed including non-natural planetary atmospheric constituents, stellar doping, Dyson spheres, as well as signatures of stellar, and galactic-scale engineering. The concept of a Fermi bubble due to interstellar migration is reviewed in the discussion of galactic signatures. These potential interstellar archeological signatures are classified using the Kardashev scale. A modified Drake equation is introduced. With few exceptions interstellar archeological signatures are clouded and beyond current technological capabilities. However SETI for so-called cultural transmissions and planetary atmosphere signatures are within reach.

Shouting in the Jungle - The SETI Transmission Debate

NASA Astrophysics Data System (ADS)

Schuch, H. P.; Almar, I.

The prudence of transmitting deliberate messages from Earth into interstellar space remains controversial. Reasoned risk- benefit analysis is needed, to inform policy recommendations by such bodies as the International Academy of Astronautics SETI Permanent Study Group. As a first step, at the 2005 International Astronautical Congress in Fukuoka, we discussed the San Marino Scale, a new analytical tool for assessing transmission risk. That Scale was updated, and a revised version presented at the 2006 IAC in Valencia. We are now in a position to recommend specific improvements to the scale we proposed for quantifying terrestrial transmissions. Our intent is to make this tool better reflect the detectability and potential impact of recent and proposed messages beamed from Earth. We believe the changes proposed herein strengthen the San Marino Scale as an analytical tool, and bring us closer to its eventual adoption.

Alien Mindscapes—A Perspective on the Search for Extraterrestrial Intelligence

PubMed Central

2016-01-01

Abstract Advances in planetary and space sciences, astrobiology, and life and cognitive sciences, combined with developments in communication theory, bioneural computing, machine learning, and big data analysis, create new opportunities to explore the probabilistic nature of alien life. Brought together in a multidisciplinary approach, they have the potential to support an integrated and expanded Search for Extraterrestrial Intelligence (SETI1), a search that includes looking for life as we do not know it. This approach will augment the odds of detecting a signal by broadening our understanding of the evolutionary and systemic components in the search for extraterrestrial intelligence (ETI), provide more targets for radio and optical SETI, and identify new ways of decoding and coding messages using universal markers. Key Words: SETI—Astrobiology—Coevolution of Earth and life—Planetary habitability and biosignatures. Astrobiology 16, 661–676. PMID:27383691

Evo-SETI: A Mathematical Tool for Cladistics, Evolution, and SETI

PubMed Central

Maccone, Claudio

2017-01-01

The discovery of new exoplanets makes us wonder where each new exoplanet stands along its way to develop life as we know it on Earth. Our Evo-SETI Theory is a mathematical way to face this problem. We describe cladistics and evolution by virtue of a few statistical equations based on lognormal probability density functions (pdf) in the time. We call b-lognormal a lognormal pdf starting at instant b (birth). Then, the lifetime of any living being becomes a suitable b-lognormal in the time. Next, our “Peak-Locus Theorem” translates cladistics: each species created by evolution is a b-lognormal whose peak lies on the exponentially growing number of living species. This exponential is the mean value of a stochastic process called “Geometric Brownian Motion” (GBM). Past mass extinctions were all-lows of this GBM. In addition, the Shannon Entropy (with a reversed sign) of each b-lognormal is the measure of how evolved that species is, and we call it EvoEntropy. The “molecular clock” is re-interpreted as the EvoEntropy straight line in the time whenever the mean value is exactly the GBM exponential. We were also able to extend the Peak-Locus Theorem to any mean value other than the exponential. For example, we derive in this paper for the first time the EvoEntropy corresponding to the Markov-Korotayev (2007) “cubic” evolution: a curve of logarithmic increase. PMID:28383497

A scheme for a high-power, low-cost transmitter for deep space applications

NASA Astrophysics Data System (ADS)

Scheffer, L. K.

2005-10-01

Applications such as planetary radars and spacecraft communications require transmitters with extremely high effective isotropic radiated power. Until now, this has been done by combining a high-power microwave source with a large reflective antenna. However, this arrangement has a number of disadvantages. It is costly, since the steerable reflector alone is quite expensive, and for spacecraft communications, the need to transmit hurts the receive performance. For planetary radars, the utilization is very low since the antenna must be shared with other applications such as radio astronomy or spacecraft communications. This paper describes a potential new way of building such transmitters with lower cost, greater versatility, higher reliability, and potentially higher power. The basic idea is a phased array with a very large number of low-power elements, built with mass production techniques that have been optimized for consumer markets. The antennas are built en mass on printed circuit boards and are driven by chips, built with consumer complementary metal-oxide-semiconductor technology, that adjust the phase of each element. Assembly and maintenance should be comparatively inexpensive since the boards need only be attached to large, flat, unmoving, ground-level infrastructure. Applications to planetary radar and spacecraft communications are examined. Although we would be unlikely to use such a facility in this way, an implication for Search for Extraterrestrial Intelligence (SETI) is that high-power beacons are easier to build than had been thought.

Novel Optical SETI Observations of Three Exoplanets

NASA Astrophysics Data System (ADS)

Welsh, Barry; Vallerga, John; Kotze, Marissa; Wheatley, Jonathan

2018-01-01

We report on observations of three nearby stars (Trappist-1, GJ 422 and Wolf 1061) that possess exoplanets located in their respective habitable zones to search for optical signals generated by an advanced alien civilization. Using the photon data collected with the Berkeley Visible Image Tube attached to the 10m Southern African Large Telescope, we searched for very high amplitude events in the pulse height distributions that statistically could only be produced by non-astrophysical means such as an optical laser used for communications purposes.Assuming that a purported ET civilization has access to an orbiting 10m mirror and an optical laser to send signals over the three sight-lines to Earth, we derive upper limits to the output power of their l lasers which might be used for inter-stellar communication.

Advances in Assimilation of Satellite-Based Passive Microwave Observations for Soil-Moisture Estimation

NASA Technical Reports Server (NTRS)

De Lannoy, Gabrielle J. M.; Pauwels, Valentijn; Reichle, Rolf H.; Draper, Clara; Koster, Randy; Liu, Qing

2012-01-01

Satellite-based microwave measurements have long shown potential to provide global information about soil moisture. The European Space Agency (ESA) Soil Moisture and Ocean Salinity (SMOS, [1]) mission as well as the future National Aeronautics and Space Administration (NASA) Soil Moisture Active and Passive (SMAP, [2]) mission measure passive microwave emission at L-band frequencies, at a relatively coarse (40 km) spatial resolution. In addition, SMAP will measure active microwave signals at a higher spatial resolution (3 km). These new L-band missions have a greater sensing depth (of -5cm) compared with past and present C- and X-band microwave sensors. ESA currently also disseminates retrievals of SMOS surface soil moisture that are derived from SMOS brightness temperature observations and ancillary data. In this research, we address two major challenges with the assimilation of recent/future satellite-based microwave measurements: (i) assimilation of soil moisture retrievals versus brightness temperatures for surface and root-zone soil moisture estimation and (ii) scale-mismatches between satellite observations, models and in situ validation data.

Ultrafast high-power microwave window breakdown: nonlinear and postpulse effects.

PubMed

Chang, C; Verboncoeur, J; Guo, M N; Zhu, M; Song, W; Li, S; Chen, C H; Bai, X C; Xie, J L

2014-12-01

The time- and space-dependent optical emissions of nanosecond high-power microwave discharges near a dielectric-air interface have been observed by nanosecond-response four-framing intensified-charged-coupled device cameras. The experimental observations indicate that plasma developed more intensely at the dielectric-air interface than at the free-space region with a higher electric-field amplitude. A thin layer of intense light emission above the dielectric was observed after the microwave pulse. The mechanisms of the breakdown phenomena are analyzed by a three-dimensional electromagnetic-field modeling and a two-dimensional electromagnetic particle-in-cell simulation, revealing the formation of a space-charge microwave sheath near the dielectric surface, accelerated by the normal components of the microwave field, significantly enhancing the local-field amplitude and hence ionization near the dielectric surface. The nonlinear positive feedback of ionization, higher electron mobility, and ultraviolet-driven photoemission due to the elevated electron temperature are crucial for achieving the ultrafast discharge. Following the high-power microwave pulse, the sheath sustains a glow discharge until the sheath collapses.

The catalytic oxidation of malachite green by the microwave-Fenton processes.

PubMed

Zheng, Huaili; Zhang, Huiqin; Sun, Xiaonan; Zhang, Peng; Tshukudu, Tiroyaone; Zhu, Guocheng

2010-01-01

Catalytic oxidation of malachite green using the microwave-Fenton process was investigated. 0% of malachite green de-colorization using the microwave process and 23.5% of malachite green de-colorization using the Fenton process were observed within 5 minutes. In contrast 95.4% of malachite green de-colorization using the microwave-Fenton was observed in 5 minutes. During the microwave-Fenton process, the optimum operating conditions for malachite green de-colorization were found to be 3.40 of initial pH, 0.08 mmol/L of Fe2+ concentration and 12.5 mmol/L of H2O2 concentration. Confirmatory tests were carried out under the optimum conditions and the COD removal rate of 82.0% and the de-colorization rate of 99.0% were observed in 5 minutes. The apparent kinetics equation of -dC/dt=0.0337 [malachite green]0.9860[Fe2+)]0.8234[H2O2]0.1663 for malachite green de-colorization was calculated, which implied that malachite green was the dominant factor in determining the removal efficiency of malachite green based on microwave-Fenton process.

Microwave Radiative Transfer: Theory and Applications

NASA Astrophysics Data System (ADS)

Wilheit, T. T.

2006-12-01

The same physical laws govern visible, infrared and microwave radiative transfer. However, frequency dependence of the Planck function and of the properties of geophysically important materials create apparent differences. The applicability of the Rayleigh-Jeans to most of the microwave spectrum is a convenience, and makes it easier to illustrate some physical principles, but is of very little fundamental importance. Line widths of gaseous constituents are determined by collision frequencies and are of the order of 1 GHz throughout the troposphere in the visible, infrared and microwave portions of the spectrum. However, it is easy to make a radiometer that has a bandwidth small compared to this width in the microwave portion of the spectrum and significantly more difficult in the infrared and visible. As a result, computations in the microwave are monochromatic (or very close to it). In the microwave portion of the spectrum there is no need for elaborate band models. Clouds are a fundamental difference because the opacity of most clouds is very high in the visible and infrared and fairly small in the microwave. This quantitative difference necessitates qualitative differences in approach. Probably, the most counter-intuitive differences between the microwave regions and shorter wavelengths result from the preponderance of highly reflective surfaces in the microwave. The oceans reflect on the order of 50% but the details depend strongly on frequency, polarization and view angle. The large glaciers of Greenland and Antarctica are also highly reflective but less dependant on view angle and polarization. This high reflectivity means that introducing an absorber into the atmosphere at a temperature colder than the surface temperature will, nevertheless increase the observed radiance. This has fundamental importance for the retrieval of constituents from the atmosphere. Even over land surfaces, the observed radiance in microwave window channels depends more on the reflectivity than on the temperature. Thus, microwave observations can yield information on the surface composition (soil moisture, vegetation cover).

First validation of satellite microwave liquid water path with ship-based observations in marine low clouds

NASA Astrophysics Data System (ADS)

Painemal, D.; Cadeddu, M. P.; Greenwald, T. J.; Minnis, P.

2015-12-01

We present the first validation study of satellite microwave liquid water path, from four operational sensors, against in-situ observations from a ship-borne three-channel microwave radiometer collected over the northeast Pacific during May-August of 2013, along a ship transect length of 40˚ (33.7˚N, 118.2˚W - 21.3˚N, 157.8˚W). The satellite sensors analyzed here are: The Tropical Rainfall Measuring Mission (TRMM) Microwave Imager (TMI), Special Sensor Microwave Imager/Sounder (SSMIS) on the Defense Meteorological Satellite Program F16 and F17 satellites, and The Advanced Microwave Scanning Radiometer (AMSR-2) on board the Global Change Observation Mission - Water (GCOM-W1). Satellite retrievals show an overall correlation with hourly-averaged in-situ observations of 0.86 and a positive bias of 10.0 gm2, which decreases to 1.0 gm2 and a correlation that increases to 0.91 when selecting overcast scenes. The satellite bias for broken scenes remains below 22.2 gm2, although the removal of clear-sky in-situ samples yields an unbiased relationship. Satellites produce a diurnal cycle with amplitudes (35-47 gm2) consistent with ship-based observations. Longitudinal biases remain below 17.4 gm2, and they are negligible in overcast scenes and when clear-sky samples are removed from the in-situ hourly average. Our study indicates that satellite microwave retrievals are a reliable dataset for climate studies in marine warm low clouds. The implications for satellite visible/infrared retrievals will be also discussed.

Comparative study of microwave radiation-induced magnetoresistive oscillations induced by circularly- and linearly- polarized photo-excitation

DOE Office of Scientific and Technical Information (OSTI.GOV)

Ye, Tianyu; Liu, Han -Chun; Wang, Zhuo

A comparative study of the radiation-induced magnetoresistance oscillations in the high mobility GaAs/AlGaAs heterostructure two dimensional electron system (2DES) under linearly- and circularly- polarized microwave excitation indicates a profound difference in the response observed upon rotating the microwave launcher for the two cases, although circularly polarized microwave radiation induced magnetoresistance oscillations observed at low magnetic fields are similar to the oscillations observed with linearly polarized radiation. For the linearly polarized radiation, the magnetoresistive response is a strong sinusoidal function of the launcher rotation (or linear polarization) angle, θ. As a result, for circularly polarized radiation, the oscillatory magnetoresistive response ismore » hardly sensitive to θ.« less

Comparative study of microwave radiation-induced magnetoresistive oscillations induced by circularly- and linearly- polarized photo-excitation

DOE PAGES

Ye, Tianyu; Liu, Han -Chun; Wang, Zhuo; ...

2015-10-09

A comparative study of the radiation-induced magnetoresistance oscillations in the high mobility GaAs/AlGaAs heterostructure two dimensional electron system (2DES) under linearly- and circularly- polarized microwave excitation indicates a profound difference in the response observed upon rotating the microwave launcher for the two cases, although circularly polarized microwave radiation induced magnetoresistance oscillations observed at low magnetic fields are similar to the oscillations observed with linearly polarized radiation. For the linearly polarized radiation, the magnetoresistive response is a strong sinusoidal function of the launcher rotation (or linear polarization) angle, θ. As a result, for circularly polarized radiation, the oscillatory magnetoresistive response ismore » hardly sensitive to θ.« less

Kilometric shock-associated events and microwave bursts

NASA Technical Reports Server (NTRS)

Kundu, M. R.; Macdowall, R. J.; Stone, R. G.

1990-01-01

The peak times of impulsive microwaves bursts are compared with those of shock-associated (SA) kilometric radio events. The first peaks in these two frequency regimes are usually well-correlated in time, but the last peaks of the SA events observed at 1 MHz occur an average of 20 min after the last impulsive microwave peaks. In some cases, the SA events overlap in time with the post-burst increases of microwave bursts; sometimes there is general correspondence in their intensity time profiles. These observations suggest that the earlier components of the SA events are usually caused by electrons accelerated in or near the microwave source region. The possibility that the later components of some SA events could be associated with nonthermal electrons responsible for microwave post-burst increases, although they have traditionally been attributed to electrons accelerated at type II burst producing shocks in the upper corona is discussed.

SETI@home

Science.gov Websites

experiment, based at UC Berkeley, that uses Internet-connected computers in the Search for Extraterrestrial several hours to be sure. If that didn't solve the problem, it probably means the index the server uses to

An Orbital "Virtual Radar" from TRMM Passive Microwave and Lightning Observations

NASA Technical Reports Server (NTRS)

Boccippio, Dennis J.

2004-01-01

The retrieval of vertical structure from joint passive microwave and lightning observations is demonstrated. Three years of data from the TRMM (Tropical Rainfall Measuring Mission) are used as a training dataset for regression and classification neural networks; the TMI (TRMM Microwave Imager) and LIS (Lightning Imaging Sensor) provide the inputs, the PR (Precipitation Radar) provides the training targets. Both vertical reflectivity profile categorization (into 9 convective, 7 stratiform, 2 mixed and 6 anvil types) and geophysical parameters (surface rainfall, vertically integrated liquid (VIL), ice water content (IWC) and echo tops) are retrieved. Retrievals are successful over both land and ocean surfaces. The benefit of using lightning observations as inputs to these retrievals is quantitatively demonstrated; lightning essentially provides an additional convective/stratiform discriminator, and is most important for isolation of midlevel (tops in the mixed phase region) convective profile types (this is because high frequency passive microwave observations already provide good convective/stratiform discrimination for deep convective profiles). This is highly relevant as midlevel convective profiles account for an extremely large fraction of tropical rainfall, and yet are most difficult to discriminate from comparable-depth stratiform profile types using passive microwave observations alone.

Observed effects of soil organic matter content on the microwave emissivity of soils

NASA Technical Reports Server (NTRS)

O'Neill, P. E.; Jackson, T. J.

1990-01-01

In order to determine the significance of organic matter content on the microwave emissivity of soils when estimating soil moisture, field experiments were conducted in which 1.4 GHz microwave emissivity data were collected over test plots of sandy loam soil with different organic matter levels (1.8, 4.0, and 6.1 percent) for a range of soil moisture values. Analyses of the observed data show only minor variation in microwave emissivity due to a change in organic matter content at a given moisture level for soils with similar texture and structure. Predictions of microwave emissivity made using a dielectric model for aggregated soils exhibit the same trends and type of response as the measured data when appropriate values for the input parameters were utilized.

Observed effects of soil organic matter content on the microwave intensity of soils

NASA Technical Reports Server (NTRS)

Jackson, T. J.; Oneill, P. E.

1988-01-01

In order to determine the significance of organic matter content on the microwave emissivity of soils when estimating soil moisture, field experiments were conducted in which 1.4 GHz microwave emissivity data were collected over test plots of sandy loam soil with different organic matter levels (1.8, 4.0, and 6.1 percent) for a range of soil moisture values. Analyses of the observed data show only minor variation in microwave emissivity due to a change in organic matter content at a given moisture level for soils with similar texture and structure. Predictions of microwave emissivity made using a dielectric model for aggregated soils exhibit the same trends and type of response as the measured data when appropriate values for the input parameters were utilized.

Longevity of microwave-treated (2. 45 GHz continuous wave) honey bees in observation hives

DOE Office of Scientific and Technical Information (OSTI.GOV)

Gary, N.E.; Westerdahl, B.B.

1981-12-15

Adult honey bees were exposed for 30 min to 2.45 GHz of continuous wave microwave radiation at power densities ranging from 3 to 50 mW/cm/sup 2/. After exposure, bees were returned to glass-walled observation hives, and their longevity was compared with that of control bees. No significant differences were found between microwave- and sham-treated bees at any of the power densities tested.

HMMR (High-Resolution Multifrequency Microwave Radiometer) Earth observing system, volume 2e. Instrument panel report

NASA Technical Reports Server (NTRS)

1987-01-01

Recommendations and background are provided for a passive microwave remote sensing system of the future designed to meet the observational needs of Earth scientist in the next decade. This system, called the High Resolution Multifrequency Microwave Radiometer (HMMR), is to be part of a complement of instruments in polar orbit. Working together, these instruments will form an Earth Observing System (EOS) to provide the information needed to better understand the fundamental, global scale processes which govern the Earth's environment. Measurements are identified in detail which passive observations in the microwave portion of the spectrum could contribute to an Earth Observing System in polar orbit. Requirements are established, e.g., spatial and temporal resolution, for these measurements so that, when combined with the other instruments in the Earth Observing System, they would yield a data set suitable for understanding the fundamental processes governing the Earth's environment. Existing and/or planned sensor systems are assessed in the light of these requirements, and additional sensor hardware needed to meet these observational requirements are defined.

Quasi-periodic pulsations in solar hard X-ray and microwave flares

NASA Technical Reports Server (NTRS)

Kosugi, Takeo; Kiplinger, Alan L.

1986-01-01

For more than a decade, various studies have pointed out that hard X-ray and microwave time profiles of some solar flares show quasi-periodic fluctuations or pulsations. Nevertheless, it was not until recently that a flare displaying large amplitude quasi-periodic pulsations in X-rays and microwaves was observed with good spectral coverage and with a sufficient time resolution. The event occurred on June 7, 1980, at approximately 0312 UT, and exhibits seven intense pulses with a quasi-periodicity of approximately 8 seconds in microwaves, hard X-rays, and gamma-ray lines. On May 12, 1983, at approximately 0253 UT, another good example of this type of flare was observed both in hard X-rays and in microwaves. Temporal and spectral characteristics of this flare are compared with the event of June 7, 1980. In order to further explore these observational results and theoretical scenarios, a study of nine additional quasi-periodic events were incorporated with the results from the two flares described. Analysis of these events are briefly summarized.

Analysis and evaluation of WRF microphysical schemes for deep moist convection over south-eastern South America (SESA) using microwave satellite observations and radiative transfer simulations

NASA Astrophysics Data System (ADS)

Sol Galligani, Victoria; Wang, Die; Alvarez Imaz, Milagros; Salio, Paola; Prigent, Catherine

2017-10-01

In the present study, three meteorological events of extreme deep moist convection, characteristic of south-eastern South America, are considered to conduct a systematic evaluation of the microphysical parameterizations available in the Weather Research and Forecasting (WRF) model by undertaking a direct comparison between satellite-based simulated and observed microwave radiances. A research radiative transfer model, the Atmospheric Radiative Transfer Simulator (ARTS), is coupled with the WRF model under three different microphysical parameterizations (WSM6, WDM6 and Thompson schemes). Microwave radiometry has shown a promising ability in the characterization of frozen hydrometeors. At high microwave frequencies, however, frozen hydrometeors significantly scatter radiation, and the relationship between radiation and hydrometeor populations becomes very complex. The main difficulty in microwave remote sensing of frozen hydrometeor characterization is correctly characterizing this scattering signal due to the complex and variable nature of the size, composition and shape of frozen hydrometeors. The present study further aims at improving the understanding of frozen hydrometeor optical properties characteristic of deep moist convection events in south-eastern South America. In the present study, bulk optical properties are computed by integrating the single-scattering properties of the Liu(2008) discrete dipole approximation (DDA) single-scattering database across the particle size distributions parameterized by the different WRF schemes in a consistent manner, introducing the equal mass approach. The equal mass approach consists of describing the optical properties of the WRF snow and graupel hydrometeors with the optical properties of habits in the DDA database whose dimensions might be different (Dmax') but whose mass is conserved. The performance of the radiative transfer simulations is evaluated by comparing the simulations with the available coincident microwave observations up to 190 GHz (with observations from Tropical Rainfall Measuring Mission's (TRMM) Microwave Imager (TMI), Microwave Humidity Sounder (MHS) and Special Sensor Microwave Imager/Sounder (SSMI/S)) using the χ2 test. Good agreement is obtained with all observations provided special care is taken to represent the scattering properties of the snow and graupel species.

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, E. C. (Editor)

1988-01-01

The Office of Space Operation (OSO) tasks addressed include: Deep Space Network (DSN) advanced systems and systems implementation. The Office of Space Science and Applications (OSSA) tasks discussed include SETI data controllers and simulated performance for narrowband signal detection.

Unpacking the great transmission debate

NASA Astrophysics Data System (ADS)

Denning, Kathryn

2010-12-01

The debate about the wisdom of sending interstellar transmissions is well-known to those involved in SETI, and frustrating for many. Its tendency towards intractability is a result of multiple factors, including: different models of the scientist's role as citizen and/or leader; disparate ideas about society's readiness to cope with frontier science; variable political substrates, particularly ideas concerning individual freedom and state control; competing ideologies of globalization; and the perceived relative risks and benefits of contact. (Variations in the latter, i.e. assessments of the risks and benefits of contact, derive partly from different thinking styles, including tolerance for risk, and partly from inferences based upon episodes of biological and cultural contact on Earth.) Unpacking the debate into its components may be of use to those debating policy about SETI transmissions, or at the very least, help keep in focus what, precisely, the perennial arguments are really about.

Space biology research development

NASA Technical Reports Server (NTRS)

Bonting, Sjoerd L.

1993-01-01

The purpose of the Search for Extraterrestrial Intelligence (SETI) Institute is to conduct and promote research related activities regarding the search for extraterrestrial life, particularly intelligent life. Such research encompasses the broad discipline of 'Life in the Universe', including all scientific and technological aspects of astronomy and the planetary sciences, chemical evolution, the origin of life, biological evolution, and cultural evolution. The primary purpose was to provide funding for the Principal Investigator to collaborate with the personnel of the SETI Institute and the NASA-Ames Research center in order to plan and develop space biology research on and in connection with Space Station Freedom; to promote cooperation with the international partners in the space station; to conduct a study on the use of biosensors in space biology research and life support system operation; and to promote space biology research through the initiation of an annual publication 'Advances in Space Biology and Medicine'.

SETI: A good introductory physics topic

NASA Astrophysics Data System (ADS)

Hobson, Art

1997-04-01

If America is to achieve the science literacy that is essential to industrialized democracy, all students must study such topics as scientific methodology, pseudoscience, ozone depletion, and global warming. My large-enrollment liberal-arts physics course covers the great principles of physics along with several such philosophical and societal topics. It is easy to include the interdisciplinary context of physics in courses for non-scientists, because these courses are flexible, conceptual, and taught to students whose interests span a broad range. Students find these topics relevant and fascinating, leading to large enrollments by non-scientists even in courses labeled ''physics.'' I will discuss my approach to teaching the search for extra-terrestrial intelligence (SETI), a topic with lots of good physics and with connections to scientific methodology and pseudoscience. A textbook for this kind of course has been published, Physics: Concepts and Connections (Prentice-Hall, 1995).

The SETI episode in the 1967 discovery of pulsars

NASA Astrophysics Data System (ADS)

Penny, Alan John

2013-09-01

In the winter of 1967 Cambridge radio astronomers discovered a new type of radio source of such an artificial seeming nature that for a few weeks some members of the group had to seriously consider whether they had discovered an extraterrestrial intelligence. Although their investigations lead them to a natural explanation (they had discovered pulsars), they had discussed the implications if it was indeed an artificial source: how to verify such a conclusion and how to announce it, and whether such a discovery might be dangerous. In this they presaged many of the components of the SETI Detection Protocols and the proposed Reply Protocols which have been used to guide the responses of groups dealing with the detection of an extraterrestrial intelligence. These Protocols were only established some twenty five years later in the 1990s and 2000s. Using contemporary and near-contemporary documentation and later recollections, this paper discusses in detail what happened that winter.

Life in the Universe: Foundation for exciting multidisciplinary science activities for middle and elementary school classes

NASA Technical Reports Server (NTRS)

Milne, D.; O'Sullivan, K.

1994-01-01

Young students find extra-terrestrial life one of the most intriguing of all topics. A project funded by the National Science Foundation and NASA, and administered by the SETI Institute, is underway to devise science lessons for grades 3-9 that draw upon this fascination. The lessons are designed by teachers and persons with long experience at curriculum design, tested in classrooms, revised and retested. Six guides, each containing some 6-10 science lessons, will be finished by summer, 1994.The theme Life in the Universe lends itself naturally to integrated treatment of facts and concepts from many scientific disciplines. The lessons for two completed guides span the origin of planet systems, evolution of complex life, chemical makeup of life, astronomy, spectroscopy, continental drift, mathematics and SETI (Search for Extra-Terrestrial Intelligence). All lessons are hands-on, interesting, and successful.

Life in the universe: foundation for exciting multidisciplinary science activities for middle and elementary school classes.

PubMed

Milne, D; O'Sullivan, K

1994-01-01

Young students find extra-terrestrial life one of the most intriguing of all topics. A project funded by the National Science Foundation and NASA, and administered by the SETI Institute, is underway to devise science lessons for grades 3-9 that draw upon this fascination. The lessons are designed by teachers and persons with long experience at curriculum design, tested in classrooms, revised and retested. Six guides, each containing some 6-10 science lessons, will be finished by summer, 1994. The theme Life in the Universe lends itself naturally to integrated treatment of facts and concepts from many scientific disciplines. The lessons for two completed guides span the origin of planet systems, evolution of complex life, chemical makeup of life, astronomy, spectroscopy, continental drift, mathematics and SETI (Search for Extra-Terrestrial Intelligence). All lessons are hands-on, interesting, and successful.

The Impact of the Temporal Distribution of Communicating Civilizations on Their Detectability.

PubMed

Balbi, Amedeo

2018-01-01

We used a statistical model to investigate the detectability (defined by the requirement that causal contact has been initiated with us) of communicating civilizations within a volume of the Universe surrounding our location. If the civilizations are located in our galaxy, the detectability requirement imposes a strict constraint on their epoch of appearance and their communicating life span. This, in turn, implies that our ability to gather empirical evidence of the fraction of civilizations within range of detection strongly depends on the specific features of their temporal distribution. Our approach illuminates aspects of the problem that can escape the standard treatment based on the Drake equation. Therefore, it might provide the appropriate framework for future studies dealing with the evolutionary aspects of the search for extraterrestrial intelligence (SETI). Key Words: Astrobiology-Extraterrestrial life-SETI-Complex life-Life detection-Intelligence. Astrobiology 18, 54-58.

A numerical testbed for hypotheses of extraterrestrial life and intelligence

NASA Astrophysics Data System (ADS)

Forgan, D. H.

2009-04-01

The search for extraterrestrial intelligence (SETI) has been heavily influenced by solutions to the Drake Equation, which returns an integer value for the number of communicating civilizations resident in the Milky Way, and by the Fermi Paradox, glibly stated as: ‘If they are there, where are they?’. Both rely on using average values of key parameters, such as the mean signal lifetime of a communicating civilization. A more accurate answer must take into account the distribution of stellar, planetary and biological attributes in the galaxy, as well as the stochastic nature of evolution itself. This paper outlines a method of Monte Carlo realization that does this, and hence allows an estimation of the distribution of key parameters in SETI, as well as allowing a quantification of their errors (and the level of ignorance therein). Furthermore, it provides a means for competing theories of life and intelligence to be compared quantitatively.

Ten years of the international review meetings on Communication with Extraterrestrial Intelligence /CETI/

NASA Technical Reports Server (NTRS)

Pesek, R.; Billingham, J.

1981-01-01

The development of ideas on CETI within the international community over the past five years is reviewed, and the outlook for future CETI activities is discussed. The growth of review sessions on CETI held annually by the International Academy of Astronautics (IAA) is considered, with particular attention given to the issue of radio frequency allocation for the search for extraterrestrial intelligence. CETI activities outside the IAA are then examined, including the Viking search for life on Mars, Project Orion for the detection of extrasolar planetary systems, SETI programs undertaken in the U.S. and Soviet Union, and the development of multispectral spectrum analyzers and signal processors. The expected future development of CETI strategies, techniques and instrumentation as well as popular and scientific interest in SETI are discussed, and it is noted that the IAA sessions remain the only regular international forum for the exchange of data on all aspects of CETI.

Passive microwave structure of severe tornadic storms on 16 November 1987

NASA Technical Reports Server (NTRS)

Heymsfield, Gerald M.; Fulton, Richard

1994-01-01

Passive microwave observations using the Special Sensor Microwave/Imager (SSM/I) are presented for severe tornadic storms in the lower midwestern United States on 16 November 1987. These measurements are compared with Geostationary Operational Environmental Satellite infrared (IR) measurements for the same case. The IR observations had a classic 'V' cold feature commonly associated with severe Midwest thunderstorms. The minimum microwave brightness temperatures at 86 GHz, which primarily respond to ice scattering by larger ice particles, were located in the convective region and the warm interior of the anvil top, between the arms of the IR V feature. The interior warm region was the only portion of the entire anvil region that had high 86-GHz polarization difference temperatures. Microphysical implications of these multispectral observations are discussed. The observations suggest that there are large variations of ice microphysical characteristics spatially and vertically in the anvil region. These observations are discussed in the context of previous dynamical and microphysical hypotheses on the IR V feature.

Interpretation of temporal features in an unusual X-ray and microwave bursts

NASA Technical Reports Server (NTRS)

Mackinnon, A. L.; Costa, J. E. R.; Kaufmann, P.; Dennis, B. R.

1986-01-01

Observations are briefly discussed of an event in which microwave and hard X-ray emissions were not correlated in the accepted way. Two impulsive peaks of roughly equal intensity were observed at three different microwave frequencies. The hard X-ray peaks accompanying these, however, differ in intensity by almost two orders of magnitude. Various possible interpretations of this burst are discussed, in the context of familiar models of these emissions. The most likely explanation is that the electron spectrum in the first burst has a break at about 350 keV. General implications for interpretation of X-rays and microwaves are discussed.

An optical model for the microwave properties of sea ice

NASA Technical Reports Server (NTRS)

Gloersen, P.; Larabee, J. K.

1981-01-01

The complex refractive index of sea ice is modeled and used to predict the microwave signatures of various sea ice types. Results are shown to correspond well with the observed values of the complex index inferred from dielectic constant and dielectric loss measurements performed in the field, and with observed microwave signatures of sea ice. The success of this modeling procedure vis a vis modeling of the dielectric properties of sea ice constituents used earlier by several others is explained. Multiple layer radiative transfer calculations are used to predict the microwave properties of first-year sea ice with and without snow, and multiyear sea ice.

Recommended Rest Frequencies for Observed Interstellar Molecular Microwave Transitions - 2002 Revision

National Institute of Standards and Technology Data Gateway

SRD 116 NIST Recommended Rest Frequencies for Observed Interstellar Molecular Microwave Transitions - 2002 Revision (Web, free access)   Critically evaluated transition frequencies for the molecular transitions detected in interstellar and circumstellar clouds are presented.

Statistical Analysis of the Correlation between Microwave Emission Anomalies and Seismic Activity Based on AMSR-E Satellite Data

NASA Astrophysics Data System (ADS)

qin, kai; Wu, Lixin; De Santis, Angelo; Zhang, Bin

2016-04-01

Pre-seismic thermal IR anomalies and ionosphere disturbances have been widely reported by using the Earth observation system (EOS). To investigate the possible physical mechanisms, a series of detecting experiments on rock loaded to fracturing were conducted. Some experiments studies have demonstrated that microwave radiation energy will increase under the loaded rock in specific frequency and the feature of radiation property can reflect the deformation process of rock fracture. This experimental result indicates the possibility that microwaves are emitted before earthquakes. Such microwaves signals are recently found to be detectable before some earthquake cases from the brightness temperature data obtained by the microwave-radiometer Advanced Microwave-Scanning Radiometer for the EOS (AMSR-E) aboard the satellite Aqua. This suggested that AMSR-E with vertical- and horizontal-polarization capability for six frequency bands (6.925, 10.65, 18.7, 23.8, 36.5, and 89.0 GHz) would be feasible to detect an earthquake which is associated with rock crash or plate slip. However, the statistical analysis of the correlation between satellite-observed microwave emission anomalies and seismic activity are firstly required. Here, we focus on the Kamchatka peninsula to carry out a statistical study, considering its high seismicity activity and the dense orbits covering of AMSR-E in high latitudes. 8-years (2003-2010) AMSR-E microwave brightness temperature data were used to reveal the spatio-temporal association between microwave emission anomalies and 17 earthquake events (M>5). Firstly, obvious spatial difference of microwave brightness temperatures between the seismic zone at the eastern side and the non-seismic zone the western side within the Kamchatka peninsula are found. Secondly, using both vertical- and horizontal-polarization to extract the temporal association, it is found that abnormal changes of microwave brightness temperatures appear generally 2 months before the M>6 earthquakes. Since the microwave emissions observed by AMSR-E are affected by various factors (e.g., emission of the earth's surface and emission, absorption and scattering of the atmosphere), further study together with the surface temperature, soil moisture and atmospheric water vapor will remove the weather and climate influences.

The game of active search for extra-terrestrial intelligence: breaking the `Great Silence'

NASA Astrophysics Data System (ADS)

de Vladar, Harold P.

2013-01-01

The search for extra-terrestrial intelligence (SETI) has been performed principally as a one-way survey, listening of radio frequencies across the Milky Way and other galaxies. However, scientists have engaged in an active messaging only rarely. This suggests the simple rationale that if other civilizations exist and take a similar approach to ours, namely listening but not broadcasting, the result is a silent universe. A simple game theoretical model, the prisoner's dilemma, explains this situation: each player (civilization) can passively search (defect), or actively search and broadcast (cooperate). In order to maximize the payoff (or, equivalently, minimize the risks) the best strategy is not to broadcast. In fact, the active search has been opposed on the basis that it might be dangerous to expose ourselves. However, most of these ideas have not been based on objective arguments, and ignore accounting of the possible gains and losses. Thus, the question stands: should we perform an active search? I develop a game-theoretical framework where civilizations can be of different types, and explicitly apply it to a situation where societies are either interested in establishing a two-way communication or belligerent and in urge to exploit ours. The framework gives a quantitative solution (a mixed-strategy), which is how frequent we should perform the active SETI. This frequency is roughly proportional to the inverse of the risk, and can be extremely small. However, given the immense amount of stars being scanned, it supports active SETI. The model is compared with simulations, and the possible actions are evaluated through the San Marino scale, measuring the risks of messaging.

Earth Observing System (EOS)/Advanced Microwave Sounding Unit-A (AMSU-A): Calibration management plan

NASA Technical Reports Server (NTRS)

1994-01-01

This is the Calibration Management Plan for the Earth Observing System/Advanced Microwave Sounding Unit-A (AMSU-A). The plan defines calibration requirements, calibration equipment, and calibration methods for the AMSU-A, a 15 channel passive microwave radiometer that will be used for measuring global atmospheric temperature profiles from the EOS polar orbiting observatory. The AMSU-A system will also provide data to verify and augment that of the Atmospheric Infrared Sounder.

Microwave enhanced electroanalysis of formulations: processes in micellar media at glassy carbon and at platinum electrodes.

PubMed

Ghanem, Mohamed A; Compton, Richard G; Coles, Barry A; Canals, Antonio; Marken, Frank

2005-10-01

The direct electroanalysis of complex formulations containing alpha-tocopherol (vitamin E) is possible in micellar solution and employing microwave-enhanced voltammetry. In the presence of microwave radiation substantial heating and current enhancement effects have been observed at 330 microm diameter glassy carbon electrodes placed into a micellar aqueous solution and both hydrophilic and highly hydrophobic redox systems are detected. For the water soluble Fe(CN)(6)(3-/4-) redox system in micellar aqueous solutions of 0.1 M NaCl and 0.1 M sodium dodecylsulfate (SDS) at low to intermediate microwave power, thermal effects and convection effects are observed. At higher microwave power, thermal cavitation is induced and dominates the mass transport at the electrode surface. For the micelle-soluble redox systems tert-butylferrocene and 2,5-di-tert-butyl-1,4-benzoquinone, strong and concentration dependent current responses are observed only in the presence of microwave radiation. For the oxidation of micelle-soluble alpha-tocopherol current responses at glassy carbon electrodes are affected by adsorption and desorption processes whereas at platinum electrodes, analytical limiting currents are obtained over a wide range of alpha-tocopherol concentrations. However, for the determination of alpha-tocopherol in a commercial formulation interference from proteins is observed at platinum electrodes and direct measurements are possible only over a limited concentration range and at glassy carbon electrodes.

Spatial and Temporal Variations of Surface Characteristics on the Greenland Ice Sheet as Derived from Passive Microwave Observations

NASA Technical Reports Server (NTRS)

Anderson, Mark; Rowe, Clinton; Kuivinen, Karl; Mote, Thomas

1996-01-01

The primary goals of this research were to identify and begin to comprehend the spatial and temporal variations in surface characteristics of the Greenland ice sheet using passive microwave observations, physically-based models of the snowpack and field observations of snowpack and firn properties.

Passive microwave remote sensing of soil moisture - Results from HAPEX, FIFE and MONSOON 90

NASA Technical Reports Server (NTRS)

Schmugge, T.; Jackson, T. J.; Kustas, W. P.; Wang, J. R.

1992-01-01

HAPEX (Hydrologic Atmospheric Pilot Experiment), FIFE (First ISLSCP Field Experiment) and MONSOON 90 which used an imaging microwave radiometer operating at a frequency of 1.42 GHz are reported. For FIFE and MONSOON 90, a wide range of moisture conditions were present and it was possible to observe the drydown of the soil following heavy rain and to map its spatial variation. The quantitative agreement of microwave observations and ground measurements was very good. In HAPEX there were no significant rains and conditions were generally rather dry, however, moisture variations due to irrigation were observed.

Passive microwave remote sensing of soil moisture: Results from HAPEX, FIFE, and MONSOON 90

NASA Technical Reports Server (NTRS)

Schmugge, Thomas; Jackson, T. J.; Wang, J. R.

1991-01-01

HAPEX (Hydrologic Atmospheric Pilot Experiment), FIFE (First ISLSCP Field Experiment) and MONSOON 90 which used an imaging microwave radiometer operating at a frequency of 1.42 GHz are reported. For FIFE and MONSOON 90, a wide range of moisture conditions were present and it was possible to observe the drydown of the soil following heavy rain and to map its spatial variation. The quantitive agreement of microwave observations and ground measurements was very good. In HAPEX there were no significant rains and conditions were generally rather dry, however, moisture variations due to irrigation were observed.

Microwave Pasteurization of Cooked Pasta: Effect of Process Parameters on Texture and Quality for Heat-and-Eat and Ready-to-Eat Meals.

PubMed

Joyner Melito, Helen S; Jones, Kari E; Rasco, Barbara A

2016-06-01

Pasta presents a challenge to microwave processing due to its unique cooking requirements. The objective of this study was to determine the effects of microwave processing on pasta physicochemical and mechanical properties. Fettuccine pasta was parboiled for selected times, then pasteurized using a Microwave Assisted Pasteurization System and stored under refrigeration for 1 wk. Samples were analyzed using microscopy, mechanical testing, and chemical analyses after storage. While no significant differences were observed for free amylose among fresh samples, samples parboiled for ≤6 min had significantly higher free amylose, suggesting reduced starch retrogradation. Increased heat treatment increased degree of protein polymerization, observed in microstructures as increased gluten strand thickness and network density. Firmness and extensibility increased with increased parboil time; however, extension data indicated an overall weakening of microwave-treated pasta regardless of total cooking time. Overall, microwave pasteurization was shown to be a viable cooking method for pasta. © 2016 Institute of Food Technologists®

Toward all weather, long record, and real-time land surface temperature retrievals from microwave satellite observations

NASA Astrophysics Data System (ADS)

Jimenez, Carlos; Prigent, Catherine; Aires, Filipe; Ermida, Sofia

2017-04-01

The land surface temperature can be estimated from satellite passive microwave observations, with limited contamination from the clouds as compared to the infrared satellite retrievals. With ˜60% cloud cover in average over the globe, there is a need for "all weather," long record, and real-time estimates of land surface temperature (Ts) from microwaves. A simple yet accurate methodology is developed to derive the land surface temperature from microwave conical scanner observations, with the help of pre-calculated land surface microwave emissivities. The method is applied to the Special Sensor Microwave/Imagers (SSM/I) and the Earth observation satellite (EOS) Advanced Microwave Scanning Radiometer (AMSR-E) observations?, regardless of the cloud cover. The SSM/I results are compared to infrared estimates from International Satellite Cloud Climatology Project (ISCCP) and from Advanced Along Track Scanning Radiometer (AATSR), under clear-sky conditions. Limited biases are observed (˜0.5 K for both comparisons) with a root-mean-square difference (RMSD) of ˜5 K, to be compared to the RMSE of ˜3.5 K between ISCCP et AATSR. AMSR-E results are compared with the Moderate Resolution Imaging Spectroradiometer (MODIS) clear-sky estimates. As both instruments are on board the same satellite, this reduces the uncertainty associated to the observations match-up, resulting in a lower RMSD of ˜ 4K. The microwave Ts is compared to in situ Ts time series from a collection of ground stations over a large range of environments. For 22 stations available in the 2003-2004 period, SSM/I Ts agrees very well for stations in vegetated environments (down to RMSD of ˜2.5 K for several stations), but the retrieval methodology encounters difficulties under cold conditions due to the large variability of snow and ice surface emissivities. For 10 stations in the year 2010, AMSR-E presents an all-station mean RMSD of ˜4.0 K with respect tom the ground Ts. Over the same stations, MODIS agrees better (RMSD of 2.4 K), ?but AMSR-E provides a larger number of Ts estimates by being able to measure under cloudy conditions, with an approximated ratio of 3 to 1 over the analysed stations. At many stations the RMSD of the AMSR-E clear and cloudy-sky are comparable, highlighting the ability of the microwave inversions to provide Ts under most atmospheric and surface conditions.

Estimating terrestrial snow depth with the Topex-Poseidon altimeter and radiometer

USGS Publications Warehouse

Papa, F.; Legresy, B.; Mognard, N.M.; Josberger, E.G.; Remy, F.

2002-01-01

Active and passive microwave measurements obtained by the dual-frequency Topex-Poseidon radar altimeter from the Northern Great Plains of the United States are used to develop a snow pack radar backscatter model. The model results are compared with daily time series of surface snow observations made by the U.S. National Weather Service. The model results show that Ku-band provides more accurate snow depth determinations than does C-band. Comparing the snow depth determinations derived from the Topex-Poseidon nadir-looking passive microwave radiometers with the oblique-looking Satellite Sensor Microwave Imager (SSM/I) passive microwave observations and surface observations shows that both instruments accurately portray the temporal characteristics of the snow depth time series. While both retrievals consistently underestimate the actual snow depths, the Topex-Poseidon results are more accurate.

Passive Microwave Remote Sensing of Soil Moisture

NASA Technical Reports Server (NTRS)

Njoku, Eni G.; Entekhabi, Dara

1996-01-01

Microwave remote sensing provides a unique capability for direct observation of soil moisture. Remote measurements from space afford the possibility of obtaining frequent, global sampling of soil moisture over a large fraction of the Earth's land surface. Microwave measurements have the benefit of being largely unaffected by cloud cover and variable surface solar illumination, but accurate soil moisture estimates are limited to regions that have either bare soil or low to moderate amounts of vegetation cover. A particular advantage of passive microwave sensors is that in the absence of significant vegetation cover soil moisture is the dominant effect on the received signal. The spatial resolutions of passive Microwave soil moisture sensors currently considered for space operation are in the range 10-20 km. The most useful frequency range for soil moisture sensing is 1-5 GHz. System design considerations include optimum choice of frequencies, polarizations, and scanning configurations, based on trade-offs between requirements for high vegetation penetration capability, freedom from electromagnetic interference, manageable antenna size and complexity, and the requirement that a sufficient number of information channels be available to correct for perturbing geophysical effects. This paper outlines the basic principles of the passive microwave technique for soil moisture sensing, and reviews briefly the status of current retrieval methods. Particularly promising are methods for optimally assimilating passive microwave data into hydrologic models. Further studies are needed to investigate the effects on microwave observations of within-footprint spatial heterogeneity of vegetation cover and subsurface soil characteristics, and to assess the limitations imposed by heterogeneity on the retrievability of large-scale soil moisture information from remote observations.

Passive Polarimetric Microwave Signatures Observed Over Antarctica

USDA-ARS?s Scientific Manuscript database

WindSat satellite-based fully polarimetric passive microwave observations, expressed in the form of the Stokes vector, were analyzed over the Antarctic ice sheet. The vertically and horizontally polarized brightness temperatures (first two Stokes components) from WindSat are shown to be consistent w...

Comparative Kinetic Study and Microwaves Non-Thermal Effects on the Formation of Poly(amic acid) 4,4′-(Hexafluoroisopropylidene)diphthalic Anhydride (6FDA) and 4,4′-(Hexafluoroisopropylidene)bis(p-phenyleneoxy)dianiline (BAPHF). Reaction Activated by Microwave, Ultrasound and Conventional Heating

PubMed Central

Tellez, Hugo Mendoza; Alquisira, Joaquín Palacios; Alonso, Carlos Rius; Cortés, José Guadalupe López; Toledano, Cecilio Alvarez

2011-01-01

Green chemistry is the design of chemical processes that reduce or eliminate negative environmental impacts. The use and production of chemicals involve the reduction of waste products, non-toxic components, and improved efficiency. Green chemistry applies innovative scientific solutions in the use of new reagents, catalysts and non-classical modes of activation such as ultrasounds or microwaves. Kinetic behavior and non-thermal effect of poly(amic acid) synthesized from (6FDA) dianhydride and (BAPHF) diamine in a low microwave absorbing p-dioxane solvent at low temperature of 30, 50, 70 °C were studied, under conventional heating (CH), microwave (MW) and ultrasound irradiation (US). Results show that the polycondensation rate decreases (MW > US > CH) and that the increased rates observed with US and MW are due to decreased activation energies of the Arrhenius equation. Rate constant for a chemical process activated by conventional heating declines proportionally as the induction time increases, however, this behavior is not observed under microwave and ultrasound activation. We can say that in addition to the thermal microwave effect, a non-thermal microwave effect is present in the system. PMID:22072913

Comparative kinetic study and microwaves non-thermal effects on the formation of poly(amic acid) 4,4'-(hexafluoroisopropylidene)diphthalic anhydride (6FDA) and 4,4'-(hexafluoroisopropylidene)bis(p-phenyleneoxy)dianiline (BAPHF). Reaction activated by microwave, ultrasound and conventional heating.

PubMed

Tellez, Hugo Mendoza; Alquisira, Joaquín Palacios; Alonso, Carlos Rius; Cortés, José Guadalupe López; Toledano, Cecilio Alvarez

2011-01-01

Green chemistry is the design of chemical processes that reduce or eliminate negative environmental impacts. The use and production of chemicals involve the reduction of waste products, non-toxic components, and improved efficiency. Green chemistry applies innovative scientific solutions in the use of new reagents, catalysts and non-classical modes of activation such as ultrasounds or microwaves. Kinetic behavior and non-thermal effect of poly(amic acid) synthesized from (6FDA) dianhydride and (BAPHF) diamine in a low microwave absorbing p-dioxane solvent at low temperature of 30, 50, 70 °C were studied, under conventional heating (CH), microwave (MW) and ultrasound irradiation (US). Results show that the polycondensation rate decreases (MW > US > CH) and that the increased rates observed with US and MW are due to decreased activation energies of the Arrhenius equation. Rate constant for a chemical process activated by conventional heating declines proportionally as the induction time increases, however, this behavior is not observed under microwave and ultrasound activation. We can say that in addition to the thermal microwave effect, a non-thermal microwave effect is present in the system.

Arctic and Antarctic Sea Ice, 1978-1987: Satellite Passive-Microwave Observations and Analysis

NASA Technical Reports Server (NTRS)

Gloersen, Per; Campbell, William J.; Cavalieri, Donald J.; Comiso, Josefino C.; Parkinson, Claire L.; Zwally, H. Jay

1992-01-01

This book contains a description and analysis of the spatial and temporal variations in the Arctic and Antarctic sea ice covers from October 26, 1978 through August 20, 1987. It is based on data collected by the Scanning Multichannel Microwave Radiometer (SMMR) onboard the NASA Nimbus 7 satellite. The 8.8-year period, together with the 4 years of the Nimbus 5 Electrically Scanning Microwave Radiometer (ESMR) observations presented in two earlier volumes, comprises a sea ice record spanning almost 15 years.

Observation of valley-selective microwave transport in photonic crystals

NASA Astrophysics Data System (ADS)

Ye, Liping; Yang, Yuting; Hong Hang, Zhi; Qiu, Chunyin; Liu, Zhengyou

2017-12-01

Recently, the discrete valley degree of freedom has attracted extensive attention in condensed matter physics. Here, we present an experimental observation of the intriguing valley transport for microwaves in photonic crystals, including the bulk valley transport and the valley-projected edge modes along the interface separating different photonic insulating phases. For both cases, valley-selective excitations are realized by a point-like chiral source located at proper locations inside the samples. Our results are promising for exploring unprecedented routes to manipulate microwaves.

Angular phase shift in polarization-angle dependence of microwave-induced magnetoresistance oscillations

NASA Astrophysics Data System (ADS)

Liu, Han-Chun; Samaraweera, Rasanga L.; Mani, R. G.; Reichl, C.; Wegscheider, W.

2016-12-01

We examine the microwave frequency (f ) variation of the angular phase shift, θ0, observed in the polarization-angle dependence of microwave-induced magnetoresistance oscillations in a high-mobility GaAs/AlGaAs two-dimensional electron system. By fitting the diagonal resistance Rx x versus θ plots to an empirical cosine square law, we extract θ0 and trace its quasicontinuous variation with f . The results suggest that the overall average of θ0 extracted from Hall bar device sections with length-to-width ratios of L /W =1 and 2 is the same. We compare the observations with expectations arising from the "ponderomotive force" theory for microwave radiation-induced transport phenomena.

Microwave oxidation treatment of sewage sludge.

PubMed

Lo, Kwang V; Srinivasan, Asha; Liao, Ping H; Bailey, Sam

2015-01-01

Microwave-oxidation treatment of sewage sludge using various oxidants was studied. Two treatment schemes with a combination of hydrogen peroxide and ozone were examined: hydrogen peroxide and ozone were introduced into the sludge simultaneously, followed by microwave heating. The other involved the ozonation first, and then the resulting solution was subjected to microwave and hydrogen peroxide treatment. The set with ozonation followed by hydrogen peroxide plus microwave heating yielded higher soluble materials than those of the set with hydrogen peroxide plus ozone first and then microwave treatment. No settling was observed for all treatments in the batch operation, except ozone/microwave plus hydrogen peroxide set at 120°C. The pilot-scale continuous-flow 915 MHz microwave study has demonstrated that microwave-oxidation process is feasible for real-time industrial application. It would help in providing key data for the design of a full-scale system for treating sewage sludge and the formulation of operational protocols.

Hello Out There.

ERIC Educational Resources Information Center

Giberson, Karl; Brown, Laura

1997-01-01

Presents an activity that begins with a discussion that leads into the rationale behind the techniques used in the Search for Extraterrestrial Intelligence (SETI) program. Students decode a message intended for extraterrestrials and consider a number of topics related to the possible existence of extraterrestrials. (DDR)

The Telecommunications and Data Acquisition Report

NASA Technical Reports Server (NTRS)

Posner, E. C. (Editor)

1985-01-01

Developments in programs managed by the Jet Propulsion Laboratory's Office of Telecommunications and Data acquisition are discussed. Space communications, radio antennas, the Deep Space Network, antenna design, Project SETI, seismology, coding, very large scale integration, downlinking, and demodulation are among the topics covered.

Inventing Life-Forms: The Creation of an Extraterrestrial Species.

ERIC Educational Resources Information Center

Science Activities, 1996

1996-01-01

Presents activities in which students play the role of cadets performing missions for the fictitious SETI (Search for Extraterrestrial Intelligence) Academy. Guides students toward an understanding of evolutionary forces and how they are affected by the physical environment. (JRH)

Observation of microwave absorption and emission from incoherent electron tunneling through a normal-metal-insulator-superconductor junction.

PubMed

Masuda, Shumpei; Tan, Kuan Y; Partanen, Matti; Lake, Russell E; Govenius, Joonas; Silveri, Matti; Grabert, Hermann; Möttönen, Mikko

2018-03-02

We experimentally study nanoscale normal-metal-insulator-superconductor junctions coupled to a superconducting microwave resonator. We observe that bias-voltage-controllable single-electron tunneling through the junctions gives rise to a direct conversion between the electrostatic energy and that of microwave photons. The measured power spectral density of the microwave radiation emitted by the resonator exceeds at high bias voltages that of an equivalent single-mode radiation source at 2.5 K although the phonon and electron reservoirs are at subkelvin temperatures. Measurements of the generated power quantitatively agree with a theoretical model in a wide range of bias voltages. Thus, we have developed a microwave source which is compatible with low-temperature electronics and offers convenient in-situ electrical control of the incoherent photon emission rate with a predetermined frequency, without relying on intrinsic voltage fluctuations of heated normal-metal components or suffering from unwanted losses in room temperature cables. Importantly, our observation of negative generated power at relatively low bias voltages provides a novel type of verification of the working principles of the recently discovered quantum-circuit refrigerator.

Invited Pesek lecture: Exploration rather than speculation-assembling the puzzle of potential life beyond Earth

NASA Astrophysics Data System (ADS)

Dominik, Martin

2012-12-01

Speculations about the existence of life beyond Earth are probably as old as mankind itself, but still there is no evidence - neither for its presence nor for its absence. Moreover, we neither know the necessary nor the sufficient conditions for life to emerge, sustain or evolve. The Drake equation famously quantifies our ignorance by writing the number of detectable civilizations as product of factors that get increasingly uncertain the further one goes to the right. As a result, the predictive power is poor, and it ultimately depends on the most uncertain factor. However, if we were able to derive a reasonable estimate, we would not need SETI experiments to tell us whether we are alone or not. What has changed substantially over human history is our ability to explore the Universe. Most significantly, radio transmission technology gives us the opportunity to communicate over interstellar distances, and we are now able to not only determine the population statistics of planets within the Milky Way, but even in principle to find biosignatures in their atmospheres. By finding life beyond Earth, we will learn how frequently it emerges. By finding signals from intelligent extra-terrestrial civilizations, we will get unprecedented insight into our biological, technological, and societal evolution. The Drake equation is not such a useful means for assessing the chances of success of SETI, but instead it provides the framework for using observational data in advancing towards understanding the origins of our existence and our role in the cosmos, and maybe to get a glimpse of our future.

Earth Observing System (EOS)/Advanced Microwave Sounding Unit-A (AMSU-A): Instrument logic diagrams

NASA Technical Reports Server (NTRS)

1994-01-01

This report contains all of the block diagrams and internal logic diagrams for the Earth Observation System Advanced Microwave Sounding Unit-A (AMSU-A). These diagrams show the signal inputs, outputs, and internal signal flow for the AMSU-A.

Studies of the Antarctic Sea Ice Edges and Ice Extents from Satellite and Ship Observations

NASA Technical Reports Server (NTRS)

Worby, Anthony P.; Comiso, Josefino C.

2003-01-01

Passive-microwave derived ice edge locations in Antarctica are assessed against other satellite data as well as in situ observations of ice edge location made between 1989 and 2000. The passive microwave data generally agree with satellite and ship data but the ice concentration at the observed ice edge varies greatly with averages of 14% for the TEAM algorithm and 19% for the Bootstrap algorithm. The comparisons of passive microwave with the field data show that in the ice growth season (March - October) the agreement is extremely good, with r(sup 2) values of 0.9967 and 0.9797 for the Bootstrap and TEAM algorithms respectively. In the melt season however (November - February) the passive microwave ice edge is typically 1-2 degrees south of the observations due to the low concentration and saturated nature of the ice. Sensitivity studies show that these results can have significant impact on trend and mass balance studies of the sea ice cover in the Southern Ocean.

In vitro starch digestibility and predicted glycemic index of microwaved and conventionally baked pound cake.

PubMed

Sánchez-Pardo, María Elena; Ortiz-Moreno, Alicia; Mora-Escobedo, Rosalva; Necoechea-Mondragón, Hugo

2007-09-01

The present study compares the effect of baking process (microwave vs conventional oven) on starch bioavailability in fresh pound cake crumbs and in crumbs from pound cake stored for 8 days. Proximal chemical analysis, resistant starch (RS), retrograded starch (RS3) and starch hydrolysis index (HI) were evaluated. The empirical formula suggested by Granfeldt was used to determine the predicted glycemic index (pGI). Pound cake, one of Mexico's major bread products, was selected for analysis because the quality defects often associated with microwave baking might be reduced with the use of high-fat, high-moisture, batted dough. Differences in product moisture, RS and RS3 were observed in fresh microwave-baked and conventionally baked pound cake. RS3 increased significantly in conventionally baked products stored for 8 days at room temperature, whereas no significantly changes in RS3 were observed in the microwaved product. HI values for freshly baked and stored microwaved product were 59 and 62%, respectively (P > 0.05), whereas the HI value for the conventionally baked product decreased significantly after 8 days of storage. A pound cake with the desired HI and GI characteristics might be obtained by adjusting the microwave baking process.

Estimation of global snow cover using passive microwave data

NASA Astrophysics Data System (ADS)

Chang, Alfred T. C.; Kelly, Richard E.; Foster, James L.; Hall, Dorothy K.

2003-04-01

This paper describes an approach to estimate global snow cover using satellite passive microwave data. Snow cover is detected using the high frequency scattering signal from natural microwave radiation, which is observed by passive microwave instruments. Developed for the retrieval of global snow depth and snow water equivalent using Advanced Microwave Scanning Radiometer EOS (AMSR-E), the algorithm uses passive microwave radiation along with a microwave emission model and a snow grain growth model to estimate snow depth. The microwave emission model is based on the Dense Media Radiative Transfer (DMRT) model that uses the quasi-crystalline approach and sticky particle theory to predict the brightness temperature from a single layered snowpack. The grain growth model is a generic single layer model based on an empirical approach to predict snow grain size evolution with time. Gridding to the 25 km EASE-grid projection, a daily record of Special Sensor Microwave Imager (SSM/I) snow depth estimates was generated for December 2000 to March 2001. The estimates are tested using ground measurements from two continental-scale river catchments (Nelson River and the Ob River in Russia). This regional-scale testing of the algorithm shows that for passive microwave estimates, the average daily snow depth retrieval standard error between estimated and measured snow depths ranges from 0 cm to 40 cm of point observations. Bias characteristics are different for each basin. A fraction of the error is related to uncertainties about the grain growth initialization states and uncertainties about grain size changes through the winter season that directly affect the parameterization of the snow depth estimation in the DMRT model. Also, the algorithm does not include a correction for forest cover and this effect is clearly observed in the retrieval. Finally, error is also related to scale differences between in situ ground measurements and area-integrated satellite estimates. With AMSR-E data, improvements to snow depth and water equivalent estimates are expected since AMSR-E will have twice the spatial resolution of the SSM/I and will be able to characterize better the subnivean snow environment from an expanded range of microwave frequencies.

Characterization of errors in a coupled snow hydrology-microwave emission model

USGS Publications Warehouse

Andreadis, K.M.; Liang, D.; Tsang, L.; Lettenmaier, D.P.; Josberger, E.G.

2008-01-01

Traditional approaches to the direct estimation of snow properties from passive microwave remote sensing have been plagued by limitations such as the tendency of estimates to saturate for moderately deep snowpacks and the effects of mixed land cover within remotely sensed pixels. An alternative approach is to assimilate satellite microwave emission observations directly, which requires embedding an accurate microwave emissions model into a hydrologic prediction scheme, as well as quantitative information of model and observation errors. In this study a coupled snow hydrology [Variable Infiltration Capacity (VIC)] and microwave emission [Dense Media Radiative Transfer (DMRT)] model are evaluated using multiscale brightness temperature (TB) measurements from the Cold Land Processes Experiment (CLPX). The ability of VIC to reproduce snowpack properties is shown with the use of snow pit measurements, while TB model predictions are evaluated through comparison with Ground-Based Microwave Radiometer (GBMR), air-craft [Polarimetric Scanning Radiometer (PSR)], and satellite [Advanced Microwave Scanning Radiometer for the Earth Observing System (AMSR-E)] TB measurements. Limitations of the model at the point scale were not as evident when comparing areal estimates. The coupled model was able to reproduce the TB spatial patterns observed by PSR in two of three sites. However, this was mostly due to the presence of relatively dense forest cover. An interesting result occurs when examining the spatial scaling behavior of the higher-resolution errors; the satellite-scale error is well approximated by the mode of the (spatial) histogram of errors at the smaller scale. In addition, TB prediction errors were almost invariant when aggregated to the satellite scale, while forest-cover fractions greater than 30% had a significant effect on TB predictions. ?? 2008 American Meteorological Society.

Multivariate Statistical Inference of Lightning Occurrence, and Using Lightning Observations

NASA Technical Reports Server (NTRS)

Boccippio, Dennis

2004-01-01

Two classes of multivariate statistical inference using TRMM Lightning Imaging Sensor, Precipitation Radar, and Microwave Imager observation are studied, using nonlinear classification neural networks as inferential tools. The very large and globally representative data sample provided by TRMM allows both training and validation (without overfitting) of neural networks with many degrees of freedom. In the first study, the flashing / or flashing condition of storm complexes is diagnosed using radar, passive microwave and/or environmental observations as neural network inputs. The diagnostic skill of these simple lightning/no-lightning classifiers can be quite high, over land (above 80% Probability of Detection; below 20% False Alarm Rate). In the second, passive microwave and lightning observations are used to diagnose radar reflectivity vertical structure. A priori diagnosis of hydrometeor vertical structure is highly important for improved rainfall retrieval from either orbital radars (e.g., the future Global Precipitation Mission "mothership") or radiometers (e.g., operational SSM/I and future Global Precipitation Mission passive microwave constellation platforms), we explore the incremental benefit to such diagnosis provided by lightning observations.

Estimating Soil Moisture from Satellite Microwave Observations

NASA Technical Reports Server (NTRS)

Owe, M.; VandeGriend, A. A.; deJeu, R.; deVries, J.; Seyhan, E.

1998-01-01

Cooperative research in microwave remote sensing between the Hydrological Sciences Branch of the NASA Goddard Space Flight Center and the Earth Sciences Faculty of the Vrije Universiteit Amsterdam began with the Botswana Water and Energy Balance Experiment and has continued through a series of highly successful International Research Programs. The collaboration between these two research institutions has resulted in significant scientific achievements, most notably in the area of satellite-based microwave remote sensing of soil moisture. The Botswana Program was the first joint research initiative between these two institutions, and provided a unique data base which included historical data sets of Scanning Multifrequency Microwave Radiometer (SN4NM) data, climate information, and extensive soil moisture measurements over several large experimental sites in southeast Botswana. These data were the basis for the development of new approaches in physically-based inverse modelling of soil moisture from satellite microwave observations. Among the results from this study were quantitative estimates of vegetation transmission properties at microwave frequencies. A single polarization modelling approach which used horizontally polarized microwave observations combined with monthly composites of Normalized Difference Vegetation Index was developed, and yielded good results. After more precise field experimentation with a ground-based radiometer system, a dual-polarization approach was subsequently developed. This new approach realized significant improvements in soil moisture estimation by satellite. Results from the Botswana study were subsequently applied to a desertification monitoring study for the country of Spain within the framework of the European Community science research programs EFEDA and RESMEDES. A dual frequency approach with only microwave data was used for this application. The Microwave Polarization Difference Index (MPDI) was calculated from 37 GHz data and used to derive the one-way canopy transmissivity. Using a simple radiative transfer model, this information was combined with horizontally polarized 6.6 GHz SMMR observations to derive a 9-year time series of soil moisture for all of Spain at a one quarter degree spatial scale. Both day and night SMMR observations were used independently, in order to check the consistency of the results. A first order Fourier Transform was performed on the mean monthly soil moisture values to identify major characteristics of time series such as trend, amplitude, and phase shift.

Synergistic use of multispectral satellite data for monitoring land surface change

NASA Technical Reports Server (NTRS)

Choudhury, Bhaskar J.

1991-01-01

Observations by the Advanced Very High Resolution Radiometer (AVHRR) onboard the NOAA satellites were used to compute visible and near infrared reflectances and surface temperature, while passive microwave observations at 37 GHz frequency by the Scanning Multichannel Microwave Radiometer (SMMR) and Special Sensor Microwave Imager (SSM/I) on board, respectively, the Nimbus-7 and DMSP-F8 satellites were used to compute polarization difference. These observations were analyzed along transects from rainforest to desert over northern Africa for the period 1979-1987, which included an unprecedented drought during 1984 over the Sahel zone. Model simulations were made to understand the interrelationship among multispectral data.

Microwave properties of Ni-based ferromagnetic inverse opals

NASA Astrophysics Data System (ADS)

Kostylev, M.; Stashkevich, A. A.; Roussigné, Y.; Grigoryeva, N. A.; Mistonov, A. A.; Menzel, D.; Sapoletova, N. A.; Napolskii, K. S.; Eliseev, A. A.; Lukashin, A. V.; Grigoriev, S. V.; Samarin, S. N.

2012-11-01

Investigations of microwave properties of Ni-based inverse ferromagnetic opal-like film with the [111] axis of the fcc structure along the normal direction to the film have been carried out in the 2-18 GHz frequency band. We observed multiple spin wave resonances for the magnetic field applied perpendicular to the film, i.e., along the [111] axis of this artificial crystal. For the field applied in the film plane, a broad band of microwave absorption is observed, which does not contain a fine structure. The field ranges of the responses observed are quite different for these two magnetization directions. This suggests a collective magnetic ground state or shape anisotropy and collective microwave dynamics for this foam-like material. This result is in agreement with SQUID measurements of hysteresis loops for the material. Two different models for this collective behavior are suggested that satisfactorily explain the major experimental results.

Microwave signatures of ice hydrometeors from ground-based observations above Summit, Greenland

DOE PAGES

Pettersen, Claire; Bennartz, Ralf; Kulie, Mark S.; ...

2016-04-15

Multi-instrument, ground-based measurements provide unique and comprehensive data sets of the atmosphere for a specific location over long periods of time and resulting data compliment past and existing global satellite observations. Our paper explores the effect of ice hydrometeors on ground-based, high-frequency passive microwave measurements and attempts to isolate an ice signature for summer seasons at Summit, Greenland, from 2010 to 2013. Furthermore, data from a combination of passive microwave, cloud radar, radiosonde, and ceilometer were examined to isolate the ice signature at microwave wavelengths. By limiting the study to a cloud liquid water path of 40 g m -2more » or less, the cloud radar can identify cases where the precipitation was dominated by ice. These cases were examined using liquid water and gas microwave absorption models, and brightness temperatures were calculated for the high-frequency microwave channels: 90, 150, and 225GHz. By comparing the measured brightness temperatures from the microwave radiometers and the calculated brightness temperature using only gas and liquid contributions, any residual brightness temperature difference is due to emission and scattering of microwave radiation from the ice hydrometeors in the column. The ice signature in the 90, 150, and 225 GHz channels for the Summit Station summer months was isolated. Then, this measured ice signature was compared to an equivalent brightness temperature difference calculated with a radiative transfer model including microwave single-scattering properties for several ice habits. Furthermore, initial model results compare well against the 4 years of summer season isolated ice signature in the high-frequency microwave channels.« less

AMSR2 soil moisture product validation

USDA-ARS?s Scientific Manuscript database

The Advanced Microwave Scanning Radiometer 2 (AMSR2) is part of the Global Change Observation Mission-Water (GCOM-W) mission. AMSR2 fills the void left by the loss of the Advanced Microwave Scanning Radiometer–Earth Observing System (AMSR-E) after almost 10 years. Both missions provide brightness te...

Assimilation of Precipitation Measurement Missions Microwave Radiance Observations With GEOS-5

NASA Technical Reports Server (NTRS)

Jin, Jianjun; Kim, Min-Jeong; McCarty, Will; Akella, Santha; Gu, Wei

2015-01-01

The Global Precipitation Mission (GPM) Core Observatory satellite was launched in February, 2014. The GPM Microwave Imager (GMI) is a conically scanning radiometer measuring 13 channels ranging from 10 to 183 GHz and sampling between 65 S 65 N. This instrument is a successor to the Tropical Rainfall Measurement Mission (TRMM) Microwave Imager (TMI), which has observed 9 channels at frequencies ranging 10 to 85 GHz between 40 S 40 N since 1997. This presentation outlines the base procedures developed to assimilate GMI and TMI radiances in clear-sky conditions, including quality control methods, thinning decisions, and the estimation of, observation errors. This presentation also shows the impact of these observations when they are incorporated into the GEOS-5 atmospheric data assimilation system.

Microwave remote sensing of sea ice in the AIDJEX Main Experiment. [Arctic Ice Dynamics Joint Experiment

NASA Technical Reports Server (NTRS)

Campbell, W. J.; Wayenberg, J.; Ramseyer, J. B.; Ramseier, R. O.; Vant, M. R.; Weaver, R.; Redmond, A.; Arsenault, L.; Gloersen, P.; Zwally, H. J.

1978-01-01

A microwave remote sensing program of sea ice in the Beaufort Sea was conducted during the Arctic Ice Dynamics Joint Experiment (AIDJEX). Several types of both passive and active sensors were used to perform surface and aircraft measurements during all seasons of the year. In situ observations were made of physical properties (salinity, temperature, density, surface roughness), dielectric properties, and passive microwave measurements were made of first-year, multiyear, and first-year/multiyear mixtures. Airborne passive microwave measurements were performed with the electronically scanning microwave radiometer while airborne active microwave measurements were performed by synthetic aperture radar, X- and L-band radar, and a scatterometer.

The interaction of intense, ultra-short microwave beams with the plasma generated by gas ionization

NASA Astrophysics Data System (ADS)

Shafir, G.; Cao, Y.; Bliokh, Y.; Leopold, J. G.; Levko, D.; Rostov, V.; Gad, R.; Fisher, A.; Bernshtam, V.; Krasik, Ya. E.

2018-03-01

Results of the non-linear interaction of an extremely short (0.6 ns) high power (˜500 MW) X-band focused microwave beam with the plasma generated by gas ionization are presented. Within certain gas pressure ranges, specific to the gas type, the plasma density is considerably lower around the microwave beam axis than at its periphery, thus forming guiding channel through which the beam self-focuses. Outside these pressure ranges, either diffuse or streamer-like plasma is observed. We also observe high energy electrons (˜15 keV), accelerated by the very high-power microwaves. A simplified analytical model of this complicated dynamical system and particle-in-cell numerical simulations confirm the experimental results.

An intercomparison of remotely sensed soil moisture products at various spatial scales over the Iberian penisula

USDA-ARS?s Scientific Manuscript database

Soil moisture (SM) can be retrieved from active microwave (AM)-, passive microwave (PM)- and thermal infrared (TIR)-observations, each having their unique spatial- and temporal-coverage. A limitation of TIR-based SM retrievals is its dependency on cloud-free conditions, while microwave retrievals ar...

Microwave emission measurements of sea surface roughness, soil moisture, and sea ice structure

NASA Technical Reports Server (NTRS)

Gloersen, P.; Wilheit, T. T.; Schmugge, T. J.

1972-01-01

In order to demonstrate the feasibility of the microwave radiometers to be carried aboard the Nimbus 5 and 6 satellites and proposed for one of the earth observatory satellites, remote measurements of microwave radiation at wavelengths ranging from 0.8 to 21 cm have been made of a variety of the earth's surfaces from the NASA CV-990 A/C. Brightness temperatures of sea water surfaces of varying roughness, of terrain with varying soil moisture, and of sea ice of varying structure were observed. In each case, around truth information was available for correlation with the microwave brightness temperature. The utility of passive microwave radiometry in determining ocean surface wind speeds, at least for values higher than 7 meters/second has been demonstrated. In addition, it was shown that radiometric signatures can be used to determine soil moisture in unvegetated terrain to within five percentage points by weight. Finally, it was demonstrated that first year thick, multi-year, and first year thin sea ice can be distinguished by observing their differing microwave emissivities at various wavelengths.

Observing Lava Flows with Spaceborne Microwave Radiometry

NASA Astrophysics Data System (ADS)

Lorenz, R. D.

2017-12-01

The interpretation of infrared observations of lava flows is well-established, both on Earth and Io, to establish flow areas and temperatures, and thereby constrain eruption rates. However, the detection of such radiation from space requires lava temperatures that are high enough to be incandescent, and a relatively clear atmosphere. The former condition is met only for a short period after eruption as the top millimeters of lava cool quickly. The latter condition may fail due to ash or water clouds on Earth, or the persistent thick clouds on Venus. Microwave radiometry, which in principle probes to depths of centimeters to decimeters, offers the prospect of detecting older flows. It furthermore is minimally sensitive to cloud.The challenge, however, is that spaceborne microwave instruments have relatively large footprints (sometimes 100km) such that the emission from relatively small flows is heavily diluted and therefore difficult to detect. Here we describe models of microwave remote sensing of recent volcanics on Earth, Venus and Titan, and present some preliminary observational studies of terrestrial volcanoes with the SMAP (Soil Moisture Active Passive) radiometer. This spacecraft has a large antenna to yield a relatively narrow observation footprint, and a long wavelength to penetrate into volcanic rock, and thus offers the best prospects yet for volcano surveillance in microwave radiometry.

Estimating the Thickness of Sea Ice Snow Cover in the Weddell Sea from Passive Microwave Brightness Temperatures

NASA Technical Reports Server (NTRS)

Arrigo, K. R.; vanDijken, G. L.; Comiso, J. C.

1996-01-01

Passive microwave satellite observations have frequently been used to observe changes in sea ice cover and concentration. Comiso et al. showed that there may also be a direct relationship between the thickness of snow cover (h(sub s)) on ice and microwave emissivity at 90 GHz. Because the in situ experiment of experiment of Comiso et al. was limited to a single station, the relationship is re-examined in this paper in a more general context and using more extensive in situ microwave observations and measurements of h from the Weddell Sea 1986 and 1989 winter cruises. Good relationships were found to exist between h(sub s) sand the emissivity at 90 GHz - 10 GHz and the emissivity at 90 GHz - 18.7 GHz when the standard deviation of h(sub s) was less than 50% of the mean and when h(sub s) was less than 0.25 m. The reliance of these relationships on h(sub s) is most likely caused by the limited penetration through the snow of radiation at 90 GHz. When the algorithm was applied to the Special Sensor Microwave/Imager (SSM/I) satellite data from the Weddell Sea, the resulting mean h(sub s) agreed within 5% of the mean calculated from greater than 1400 in situ observations.

A passive and active microwave-vector radiative transfer (PAM-VRT) model

NASA Astrophysics Data System (ADS)

Yang, Jun; Min, Qilong

2015-11-01

A passive and active microwave vector radiative transfer (PAM-VRT) package has been developed. This fast and accurate forward microwave model, with flexible and versatile input and output components, self-consistently and realistically simulates measurements/radiation of passive and active microwave sensors. The core PAM-VRT, microwave radiative transfer model, consists of five modules: gas absorption (two line-by-line databases and four fast models); hydrometeor property of water droplets and ice (spherical and nonspherical) particles; surface emissivity (from Community Radiative Transfer Model (CRTM)); vector radiative transfer of successive order of scattering (VSOS); and passive and active microwave simulation. The PAM-VRT package has been validated against other existing models, demonstrating good accuracy. The PAM-VRT not only can be used to simulate or assimilate measurements of existing microwave sensors, but also can be used to simulate observation results at some new microwave sensors.

Hybrid microwave/conventionally heated calorimeter

NASA Astrophysics Data System (ADS)

Binner, Jon G. P.; Price, Duncan M.; Reading, Mike; Vaidhyanathan, Bala

2005-06-01

The design and construction of a calorimeter in which the specimen may be heated by microwave radiation and/or hot air is described. The apparatus was used to examine the effect of microwave radiation on the melting of benzil (89°C) and the solid-state phase transition of silver iodide (147°C). Reproducibility of transition temperature determinations were within ±1°C. No changes were observed for benzil but silver iodide exhibited an apparent reduction in transition temperature to around 120°C in the presence of microwaves, which increased with the level of microwave irradiation.

How do people feel about contact with ETIs?

NASA Astrophysics Data System (ADS)

Sabadell, Miguel A.; Salamero, Fernando J.

1996-06-01

'Astronomers find ET civilization.' In the opinion of many, this newspaper headline could reflect what would be the most exciting, challenging and profound discovery not only of the century but of human history. The idea of a plurality of inhabited worlds in the universe is as old as our civilization. It was a religious heresy in pre-Renaissance times; Giordano Bruno was burned at the stake in 1600 because of this belief. A slow but steady increase in the number of papers on the possible existence of other beings distinct from us has been appearing since then. The rapid progress in science and technology, our although poor understanding of the mechanisms of the cosmic evolution, the consolidation of the Darwinian hypothesis and, most importantly, the tenacious work of SETI pioneers have made possibly that the scientific community took seriously the possibility of life in other places of the universe and to search for it. There are different SETI projects running in the world. The unequivocal detection of an ETI signal is the goal. This could take many forms, all of them unpredictable. Some authors notice that the unambiguous confirmation that the signal is of extraterrestrial intelligence origin would be a hard work (Boyce 1990, Tarter 1991). But of most significance is the impact on our society of such a contact. How should we react? With fear and panic because advanced ETIs would quickly destroy the human spirit? Waiting a golden age? Imagine an extraterrestrial spaceship landing somewhere in our planet. What should we do? In both cases, will human behavior be influenced by the incontestable knowledge of the existence of ETIs? As John Billingham point out 'there has been little activity on those cultural aspects of SETI other than science and engineering.'

Searching for extraterrestrial civilizations.

PubMed

Kuiper, T B; Morris, M

1977-05-06

We have argued that planning for a search for extraterrestrial intelligence should involve a minimum number of assumptions. In view of the feasibility (at our present level of understanding) of using nuclear fusion to effect interstellar travel at a speed of 0.1c, it appears unwarranted (at this time) to assume that it would not occur for at least some technologically advanced civilizations. One cannot even conclude that humans would not attempt this within the next few centuries. On the contrary, the most likely future situation, given the maintenance of technological growth and the absence of extraterrestrial interference, is that our civilization will explore and colonize our galactic neighborhood. A comparison of the time scales of galactic evolution and interstellar travel leads to the conclusion that the galaxy is either essentially empty with respect to technological civilizations or extensively colonized. In the former instance, a SETI would be unproductive. In the latter, a SETI could be fruitful if a signal has been deliberately directed at the earth or at an alien outpost, probe, or communication relay station in our solar system. In the former case, an existing antenna would probably be sufficient to detect the signal. In the latter case, success would depend on the way in which the communications were coded. Failure to detect a signal could permit any of the following conclusions: (i) the galaxy is devoid of technological civilizations, advanced beyond our own, (ii) such civilizations exist, but cannot (for some reason which is presently beyond our ken) engage in interstellar colonization, or (iii) such civilizations are not attempting overt contact with terrestrial civilizations and their intercommunications, if present, are not coded in a simple way. To plan at this time for a high-cost, large-array SETI based on the last two possibilities appears to be rather premature.

Heavy thunderstorms observed over land by the Nimbus 7 scanning multichannel microwave radiometer

NASA Technical Reports Server (NTRS)

Spencer, R. W.; Olson, W. S.; Martin, D. W.; Weinman, J. A.; Santek, D. A.; Wu, R.

1983-01-01

Brightness temperatures obtained through examination of microwave data from the Nimbus 7 satellite are noted to be much lower than those expected on the strength of radiation emanating from rain-producing clouds. Very cold brightness temperature cases all coincided with heavy thunderstorm rainfall, with the cold temperatures being attributable to scattering by a layer of ice hydrometeors in the upper parts of the storms. It is accordingly suggested that brightness temperatures observed by satellite microwave radiometers can sometimes distinguish heavy rain over land.

The cosmic microwave background radiation

NASA Technical Reports Server (NTRS)

Silk, Joseph

1992-01-01

A review the implications of the spectrum and anisotropy of the cosmic microwave background for cosmology. Thermalization and processes generating spectral distortions are discussed. Anisotropy predictions are described and compared with observational constraints. If the evidence for large-scale power in the galaxy distribution in excess of that predicted by the cold dark matter model is vindicated, and the observed structure originated via gravitational instabilities of primordial density fluctuations, the predicted amplitude of microwave background anisotropies on angular scales of a degree and larger must be at least several parts in 10 exp 6.

Snowmelt and Surface Freeze/Thaw Timings over Alaska derived from Passive Microwave Observations using a Wavelet Classifier

NASA Astrophysics Data System (ADS)

Steiner, N.; McDonald, K. C.; Dinardo, S. J.; Miller, C. E.

2015-12-01

Arctic permafrost soils contain a vast amount of organic carbon that will be released into the atmosphere as carbon dioxide or methane when thawed. Surface to air greenhouse gas fluxes are largely dependent on such surface controls as the frozen/thawed state of the snow and soil. Satellite remote sensing is an important means to create continuous mapping of surface properties. Advances in the ability to determine soil and snow freeze/thaw timings from microwave frequency observations improves upon our ability to predict the response of carbon gas emission to warming through synthesis with in-situ observation, such as the 2012-2015 Carbon in Arctic Reservoir Vulnerability Experiment (CARVE). Surface freeze/thaw or snowmelt timings are often derived using a constant or spatially/temporally variable threshold applied to time-series observations. Alternately, time-series singularity classifiers aim to detect discontinuous changes, or "edges", in time-series data similar to those that occur from the large contrast in dielectric constant during the freezing or thaw of soil or snow. We use multi-scale analysis of continuous wavelet transform spectral gradient brightness temperatures from various channel combinations of passive microwave radiometers, Advanced Microwave Scanning Radiometer (AMSR-E, AMSR2) and Special Sensor Microwave Imager (SSM/I F17) gridded at a 10 km posting with resolution proportional to the observational footprint. Channel combinations presented here aim to illustrate and differentiate timings of "edges" from transitions in surface water related to various landscape components (e.g. snow-melt, soil-thaw). To support an understanding of the physical basis of observed "edges" we compare satellite measurements with simple radiative transfer microwave-emission modeling of the snow, soil and vegetation using in-situ observations from the SNOw TELemetry (SNOTEL) automated weather stations. Results of freeze/thaw and snow-melt timings and trends are reported for Alaska and the North-West Canadian Arctic for the period 2002 to 2015.

Detection of Rain-on-Snow (ROS) Events Using the Advanced Microwave Scanning Radiometer-Earth Observing System (AMSR-E) and Weather Station Observations

NASA Astrophysics Data System (ADS)

Ryan, E. M.; Brucker, L.; Forman, B. A.

2015-12-01

During the winter months, the occurrence of rain-on-snow (ROS) events can impact snow stratigraphy via generation of large scale ice crusts, e.g., on or within the snowpack. The formation of such layers significantly alters the electromagnetic response of the snowpack, which can be witnessed using space-based microwave radiometers. In addition, ROS layers can hinder the ability of wildlife to burrow in the snow for vegetation, which limits their foraging capability. A prime example occurred on 23 October 2003 in Banks Island, Canada, where an ROS event is believed to have caused the deaths of over 20,000 musk oxen. Through the use of passive microwave remote sensing, ROS events can be detected by utilizing observed brightness temperatures (Tb) from AMSR-E. Tb observed at different microwave frequencies and polarizations depends on snow properties. A wet snowpack formed from an ROS event yields a larger Tb than a typical dry snowpack would. This phenomenon makes observed Tb useful when detecting ROS events. With the use of data retrieved from AMSR-E, in conjunction with observations from ground-based weather station networks, a database of estimated ROS events over the past twelve years was generated. Using this database, changes in measured Tb following the ROS events was also observed. This study adds to the growing knowledge of ROS events and has the potential to help inform passive microwave snow water equivalent (SWE) retrievals or snow cover properties in polar regions.

A search for narrow band signals with SERENDIP II: a progress report

NASA Technical Reports Server (NTRS)

Werthimer, D.; Brady, R.; Berezin, A.; Bowyer, S.

1988-01-01

Commensal programs for the Search for Extraterrestrial Intelligence (SETI), carried out concurrently with conventional radio astronomical observing programs, can be an attractive and cost-effective means of exploring the large multidimensional search space intrinsic to this effort. Our automated commensal system, SERENDIP II, is a high resolution 131,072 channel spectrometer. It searches for 0.49 Hz signals in sequential 64,700 Hz bands of the IF signal from a radio telescope being used for an astronomical observation. Upon detection of a narrow band signal with power above a preset threshold, the frequency, power, time, and telescope direction are recorded for later study. The system has been tested at the Hat Creek Radio Astronomy Observatory 85 ft telescope and the NASA-JPL Deep Space Station (DSS 14) 64 m telescope. It is currently collecting data at the National Radio Astronomy Observatory 300 ft telescope.

A search for narrow band signals with SERENDIP II: a progress report.

PubMed

Werthimer, D; Brady, R; Berezin, A; Bowyer, S

1988-01-01

Commensal programs for the Search for Extraterrestrial Intelligence (SETI), carried out concurrently with conventional radio astronomical observing programs, can be an attractive and cost-effective means of exploring the large multidimensional search space intrinsic to this effort. Our automated commensal system, SERENDIP II, is a high resolution 131,072 channel spectrometer. It searches for 0.49 Hz signals in sequential 64,700 Hz bands of the IF signal from a radio telescope being used for an astronomical observation. Upon detection of a narrow band signal with power above a preset threshold, the frequency, power, time, and telescope direction are recorded for later study. The system has been tested at the Hat Creek Radio Astronomy Observatory 85 ft telescope and the NASA-JPL Deep Space Station (DSS 14) 64 m telescope. It is currently collecting data at the National Radio Astronomy Observatory 300 ft telescope.

SETV: an Extension of SETI?

NASA Astrophysics Data System (ADS)

Teodorani, M.

2003-02-01

In the ambit of the SETI Project, a new branch named SETV (Search for Extraterrestrial Visitation) was born very recently due to the international effort of some engineers, astronomers and other researchers, and it is now in a development phase with several monitoring projects. SETV is aimed at investigating, by using well-tested means of physical and technological sciences, the possible evidence of extraterrestrial visitations inside our solar system. On the basis of statistical calculations of galactic migration, and of models coming from standard stellar evolution, Dyson theory and advanced possibilities invoked by theoretical physics, the historical excursus which turned the SETA hypothesis (Search for Extraterrestrial Artifacts), developed in the 80', into the present SETV definition, is presented in detail. The possibility that extraterrestrial intelligences are present inside our solar system with inhabited and/or robotic probes is discussed, including the possibility that our planet is one of their targets. A proposal concerning instrumented multi-wavelength surveys and identification of such exogenous probes is presented.

A critical examination of factors that might encourage secrecy

NASA Astrophysics Data System (ADS)

Tough, Allen

If a signal is detected someday from extraterrestrial intelligence, several factors might encourage complete and immediate secrecy. As a result, all data might be restricted to the receiving facility or nation instead of being shared promptly with SETI scientists around the world. Seven factors seem particularly like to encourage secrecy: (1) the belief that people may panic; (2) the fear of a negative impact on religion, science, and culture; (3) embarrassment; (4) the individual and national competitive urge; (5) avoiding a harmful premature reply; (6) a national trade or military advantage; and (7) the fear of a Trojan Horse. Three steps might alleviate the particularly difficult factors (numbers 4, 5, 6): an international treaty for immediate sharing of possible signals with SETI scientists in several other countries; implementation and frequent use of an actual network of scientists for such sharing; and further study of the possible need for partial restriction of data about the location and channel of a suspected signal.

Microphysical and Radiative Characteristics of Convective Clouds during COHMEX.

NASA Astrophysics Data System (ADS)

Fulton, Richard; Heymsfield, Gerald M.

1991-01-01

The use of passive remote microwave radiance measurements above cloud tops for rainrate estimation is complicated by the complex nature of cloud microphysics. The knowledge of the microphysical structure of clouds, specifically the hydrometeor types, shapes, sizes, and their vertical distribution, is important because radiative emission and scattering effects are dependent upon the hydrometeor distribution. This paper has two purposes: first, to document the structure and evolution of two strong thunderstorms in Alabama using radar multiparameter data; and second, to relate the inferred microphysics to the resulting upwelling microwave radiance observed concurrently by high altitude aircraft. These measurements were collected during the COHMEX field program in the summer of 1986. The radar analysis includes a description of the parameters reflectivity Z, differential reflectivity ZDR, linear depolarization ratio LDR, and hail signal HS for two thunderstorm cases on 11 July 1986. The simultaneous aircraft data includes passive microwave brightness temperature (TB) measurements at four frequencies ranging from 18 to 183 GHz as well as visible and infrared data.The remote radar observations reveal the existence of large ice particles within the storms which is likely to have caused the observed low microwave brightness temperatures. By relating the evolution of the radar measureables to the microwave TB's it has been found that knowledge of the storm microphysics and its evolution is important to adequately understand the microwave TB's.

Impairment of long-term potentiation induction is essential for the disruption of spatial memory after microwave exposure.

PubMed

Wang, Hui; Peng, Ruiyun; Zhou, Hongmei; Wang, Shuiming; Gao, Yabing; Wang, Lifeng; Yong, Zheng; Zuo, Hongyan; Zhao, Li; Dong, Ji; Xu, Xinping; Su, Zhentao

2013-12-01

To assess the impact of microwave exposure on learning and memory and to explore the underlying mechanisms. 100 Wistar rats were exposed to a 2.856 GHz pulsed microwave field at average power densities of 0 mW/cm(2), 5 mW/cm(2), 10 mW/cm(2) and 50 mW/cm(2) for 6 min. The spatial memory was assessed by the Morris Water Maze (MWM) task. An in vivo study was conducted soon after microwave exposure to evaluate the changes of population spike (PS) amplitudes of long-term potentiation (LTP) in the medial perforant path (MPP)-dentate gyrus (DG) pathway. The structure of the hippocampus was observed by the light microscopy and the transmission electron microscopy (TEM) at 7 d after microwave exposure. Our results showed that the rats exposed in 10 mW/cm(2) and 50 mW/cm(2) microwave displayed significant deficits in spatial learning and memory at 6 h, 1 d and 3 d after exposure. Decreased PS amplitudes were also found after 10 mW/cm(2) and 50 mW/cm(2) microwave exposure. In addition, varying degrees of degeneration of hippocampal neurons, decreased synaptic vesicles and blurred synaptic clefts were observed in the rats exposed in 10 mW/cm(2) and 50 mW/cm(2) microwave. Compared with the sham group, the rats exposed in 5 mW/cm(2) microwave showed no difference in the above experiments. This study suggested that impairment of LTP induction and the damages of hippocampal structure, especially changes of synapses, might contribute to cognitive impairment after microwave exposure.

Rheological and sensory behaviors of parboiled pasta cooked using a microwave pasteurization process.

PubMed

Joyner, Helen S; Jones, Kari E; Rasco, Barbara A

2017-10-01

Pasta hydration and cooking requirements make in-package microwave pasteurization of pasta a processing challenge. The objective of this study was to assess instrumental and sensory attributes of microwave-treated pasta in comparison to conventionally cooked pasta. Fettuccine pasta was parboiled for 0, 3, 6, 9, or 12 min, pasteurized by microwaves at 915 MHz, then stored under refrigeration for 1 week. Pastas were evaluated by a trained sensory panel and with rheometry. Total pasta heat treatment affected both rheological and sensory behaviors; these differences were attributed to ultrastructure differences. Significant nonlinear behavior and dominant fluid-like behavior was observed in all pastas at strains >1%. Sensory results suggested microwave pasteurization may intensify the attributes associated with the aging of pasta such as retrogradation. A clear trend between magnitude of heat treatment and attribute intensity was not observed for all sensory attributes tested. The microwave pasta with the longest parboil time showed rheological behavior most similar to conventionally cooked pasta. Principal component analysis revealed that no microwave-treated pasta was similar to the control pasta. However, pasta parboiled for 9 min before microwave treatment had the greatest number of similar sensory attributes, followed by pasta parboiled for 6 or 12 min. Further study is needed to determine overall consumer acceptance of microwave-treated pasta and whether the differences in sensory and rheological behavior would impact consumer liking. The results of this study may be applied to optimize microwave pasteurization processes for cooked pasta and similar products, such as rice. The measurement and analysis procedures can be used to evaluate processing effects on a variety of different foods to determine overall palatability. © 2017 Wiley Periodicals, Inc.

Microwave radiometric aircraft observations of the Fabry-Perot interference fringes of an ice-water system

NASA Technical Reports Server (NTRS)

Harrington, R. F.; Swift, C. T.; Fedors, J. C.

1980-01-01

Airborne stepped-frequency microwave radiometer (SFMR) observations of the Fabry-Perot interference fringes of ice-water systems are discussed. The microwave emissivity at normal incidence of a smooth layered dielectric medium over a semi-infinite dielectric medium is examined for the case of ice over water as a function of ice thickness and attenuation coefficient, and the presence of quarter-wavelength oscillations in emissivity as the ice thickness and frequency are varied is pointed out. Experimental observations of pronounced quarter-wavelength oscillations in radiometric brightness temperature due to the Fabry-Perot interference fringes over smooth sea ice and lake ice varying in roughness as the radiometer frequencies were scanned are then presented.

Anomalous Kondo transport in a single-electron transistor driven by microwave field

NASA Astrophysics Data System (ADS)

Cao, Zhan; Chen, Cheng; Chen, Fu-Zhou; Luo, Hong-Gang

2014-03-01

The Kondo transport in a single-electron transistor continues to provide unexpected physics due to the interplay between magnetic field and microwave applied, as shown in a recent experiment(B. Hemingway et al., arXiv:1304.0037). For a given microwave frequency, the Kondo differential conductance shows an anomalous magnetic field dependence, and a very sharp peak is observed for certain field applied. Additionally, the microwave frequency is found to be larger of about one order than the corresponding Zeeman energy. These two features are not understood in the current theory. Here we propose a phenomenological mechanism to explain these observations. When both magnetic field and microwave are applied in the SET, if the frequency matches the (renormalized) Zeeman energy, it is assumed that the microwave is able to induce spin-ip in the single-electron transistor, which leads to two consequences. One is the dot level shifts down and the other is the renormalization of the Zeeman energy. This picture can not only explain qualitatively the main findings in the experiment but also further stimulate the related experimental study of the Kondo transport. Additional microwave modulation may provide a novel way to explore the functional of the SET in nanotechnology and quantum information processing.

Consideration on the Mechanism of Microwave Emission Due to Rock Fracture

NASA Astrophysics Data System (ADS)

Takano, Tadashi; Sugita, Seiji; Yoshida, Shingo; Maeda, Takashi

2010-05-01

Microwave emission due to rock fracture was found at 300 MHz, 2 GHz, and 22 GHz, and its power was calibrated in laboratory for the first time in the world. The observed waveform is impulsive, and contains correspondent frequency component inside the envelope at each frequency band. At such high frequencies, the electro-magnetic signal power can be calibrated as a radiating wave with high accuracy. Accordingly, it was verified that a substantial power is emitted. The microwave emission phenomena were also observed on occasions of hypervelocity impact, and esteemed as phenomena generally associated with material destruction. Earthquakes and volcanic activities are association with rock fractures so that the microwave is expected to be emitted. Actually, the e emission was confirmed by the data analysis of the brightness temperature obtained by a remote sensing satellite, which flew over great earthquakes of Wuenchan and Sumatra, and great volcanic eruptions of Reventador and Chanten. It is important to show the microwave emission during rock fracture in natural phenomena. Therefore, the field test to detect the microwave due to the collapse of a crater cliff was planned and persecuted at the volcano of Miyake-jima about 100 km south of Tokyo. Volcanic activity may be more convenient than an earthquake because of the known location and time. As a result, they observed the microwave emission which was strongly correlated with the cliff collapses. Despite of the above-mentioned phenomenological fruits, the reason of the microwave emission is not fixed yet. We have investigated the mechanism of the emission in consideration of the obtained data in rock fracture experiments so far and the study results on material destruction by hypervelocity impact. This paper presents the proposal of the hypothesis and resultant discussions. The microwave sensors may be useful to monitor natural hazards such as an earthquake or a volcanic eruption, because the microwave due to rock fracture can penetrate the ionosphere and can be received by a satellite in orbit. However, the relation between a rock fracture and quakes has not been clarified at all, and is left to the future research. Please fill in your abstract text.

Outline of the survey on the development of earth observation satellites

NASA Technical Reports Server (NTRS)

1977-01-01

An independent earth observation system with land and sea satellites to be developed by Japan is described. Visible and infrared radiometers, microwave radiometers, microwave scattermeters, synthetic aperture radar, and laser sensors are among the instrumentation discussed. Triaxial attitude control, basic technology common to sea and land observation satellites as well as land data analytical technology developed for U.S. LANDSAT data are reviewed.

Visualizing ex vivo radiofrequency and microwave ablation zones using electrode vibration elastography

PubMed Central

DeWall, Ryan J.; Varghese, Tomy; Brace, Chris L.

2012-01-01

Purpose: Electrode vibration elastography is a new shear wave imaging technique that can be used to visualize thermal ablation zones. Prior work has shown the ability of electrode vibration elastography to delineate radiofrequency ablations; however, there has been no previous study of delineation of microwave ablations or radiological–pathological correlations using multiple observers. Methods: Radiofrequency and microwave ablations were formed in ex vivo bovine liver tissue. Their visualization was compared on shear wave velocity and maximum displacement images. Ablation dimensions were compared to gross pathology. Elastographic imaging and gross pathology overlap and interobserver variability were quantified using similarity measures. Results: Elastographic imaging correlated with gross pathology. Correlation of area estimates was better in radiofrequency than in microwave ablations, with Pearson coefficients of 0.79 and 0.54 on shear wave velocity images and 0.90 and 0.70 on maximum displacement images for radiofrequency and microwave ablations, respectively. The absolute relative difference in area between elastographic imaging and gross pathology was 18.9% and 22.9% on shear wave velocity images and 16.0% and 23.1% on maximum displacement images for radiofrequency and microwave ablations, respectively. Conclusions: Statistically significant radiological–pathological correlation was observed in this study, but correlation coefficients were lower than other modulus imaging techniques, most notably in microwave ablations. Observers provided similar delineations for most thermal ablations. These results suggest that electrode vibration elastography is capable of imaging thermal ablations, but refinement of the technique may be necessary before it can be used to monitor thermal ablation procedures clinically. PMID:23127063

Real Time Monitoring of Flooding from Microwave Satellite Observations

NASA Technical Reports Server (NTRS)

Galantowicz, John F.; Frey, Herb (Technical Monitor)

2002-01-01

We have developed a new method for making high-resolution flood extent maps (e.g., at the 30-100 m scale of digital elevation models) in real-time from low-resolution (20-70 km) passive microwave observations. The method builds a "flood-potential" database from elevations and historic flood imagery and uses it to create a flood-extent map consistent with the observed open water fraction. Microwave radiometric measurements are useful for flood monitoring because they sense surface water in clear-or-cloudy conditions and can provide more timely data (e.g., compared to radars) from relatively wide swath widths and an increasing number of available platforms (DMSP, ADEOS-II, Terra, NPOESS, GPM). The chief disadvantages for flood mapping are the radiometers' low resolution and the need for local calibration of the relationship between radiances and open-water fraction. We present our method for transforming microwave sensor-scale open water fraction estimates into high-resolution flood extent maps and describe 30-day flood map sequences generated during a retrospective study of the 1993 Great Midwest Flood. We discuss the method's potential improvement through as yet unimplemented algorithm enhancements and expected advancements in microwave radiometry (e.g., improved resolution and atmospheric correction).

The Search for Cosmic Company: SETI on ngVLA

NASA Astrophysics Data System (ADS)

Croft, Steve; Siemion, Andrew; Hellbourg, Greg

2018-01-01

"Are we alone?" is one of the most profound human questions. The unprecedented capabilities of next generation radio telescopes, including ngVLA, will allow us to probe hitherto unexplored regions of parameter space, placing meaningful limits on the prevalence of technological civilizations in the Universe, or perhaps making one of the most significant discoveries in the history of science.Through both targeted and commensal observations, ngVLA data will be searched for signatures of technology (including narrow-band, Doppler-drifting, and more complex signals) that can be localized to particular positions on the sky. ngVLA provides critical capabilities in the 10 – 100 GHz range, a region of the spectrum used by many human technologies, to survey the sky at sensitivities unmatched by other facilities.

Using Microwaves to Heat Lunar Soil

NASA Technical Reports Server (NTRS)

Ethridge, Edwin C.

2011-01-01

This slide presentation reviews the use of microwaves to heat lunar soil in order to obtain water. There appears to be large amounts of water in the lunar poles, in Martian areas in lower latitudes and some of the Moons of Jupiter. The presence of water in the south lunar polar region was demonstrated by the Lunar CRater Observation and Sensing Satellite (LCROSS) mission. Microwaves can be used to extract water from lunar soil without excavation. Using microwaves on a lunar soil simulant at least 95% of the water from the regolith permafrost simulant was extracted (2 minutes). The process is modeled using COMSOL Multiphysics Finite Element analysis microwave physics module and demonstrated usingan experiment of an microwave apparatus on a rover.

ASPECTS OF ARCTIC SEA ICE OBSERVABLE BY SEQUENTIAL PASSIVE MICROWAVE OBSERVATIONS FROM THE NIMBUS-5 SATELLITE.

USGS Publications Warehouse

Campbell, William J.; Gloersen, Per; Zwally, H. Jay; ,

1984-01-01

Observations made from 1972 to 1976 with the Electrically Scanning Microwave Radiometer on board the Nimbus-5 satellite provide sequential synoptic information of the Arctic sea ice cover. This four-year data set was used to construct a fairly continuous series of three-day average 19-GHz passive microwave images which has become a valuable source of polar information, yielding many anticipated and unanticipated discoveries of the sea ice canopy observed in its entirety through the clouds and during the polar night. Short-term, seasonal, and annual variations of key sea ice parameters, such as ice edge position, ice types, mixtures of ice types, ice concentrations, and snow melt on the ice, are presented for various parts of the Arctic.

Magnetic carbon nanostructures: microwave energy-assisted pyrolysis vs. conventional pyrolysis.

PubMed

Zhu, Jiahua; Pallavkar, Sameer; Chen, Minjiao; Yerra, Narendranath; Luo, Zhiping; Colorado, Henry A; Lin, Hongfei; Haldolaarachchige, Neel; Khasanov, Airat; Ho, Thomas C; Young, David P; Wei, Suying; Guo, Zhanhu

2013-01-11

Magnetic carbon nanostructures from microwave assisted- and conventional-pyrolysis processes are compared. Unlike graphitized carbon shells from conventional heating, different carbon shell morphologies including nanotubes, nanoflakes and amorphous carbon were observed. Crystalline iron and cementite were observed in the magnetic core, different from a single cementite phase from the conventional process.

Assimilation of active and passive microwave observations for improved estimates of soil moisture and crop growth

USDA-ARS?s Scientific Manuscript database

An Ensemble Kalman Filter-based data assimilation framework that links a crop growth model with active and passive (AP) microwave models was developed to improve estimates of soil moisture (SM) and vegetation biomass over a growing season of soybean. Complementarities in AP observations were incorpo...

Microwave radiation (2.45 GHz)-induced oxidative stress: Whole-body exposure effect on histopathology of Wistar rats.

PubMed

Chauhan, Parul; Verma, H N; Sisodia, Rashmi; Kesari, Kavindra Kumar

2017-01-01

Man-made microwave and radiofrequency (RF) radiation technologies have been steadily increasing with the growing demand of electronic appliances such as microwave oven and cell phones. These appliances affect biological systems by increasing free radicals, thus leading to oxidative damage. The aim of this study was to explore the effect of 2.45 GHz microwave radiation on histology and the level of lipid peroxide (LPO) in Wistar rats. Sixty-day-old male Wistar rats with 180 ± 10 g body weight were used for this study. Animals were divided into two groups: sham exposed (control) and microwave exposed. These animals were exposed for 2 h a day for 35 d to 2.45 GHz microwave radiation (power density, 0.2 mW/cm 2 ). The whole-body specific absorption rate (SAR) was estimated to be 0.14 W/kg. After completion of the exposure period, rats were sacrificed, and brain, liver, kidney, testis and spleen were stored/preserved for determination of LPO and histological parameters. Significantly high level of LPO was observed in the liver (p < 0.001), brain (p < 0.004) and spleen (p < 0.006) in samples from rats exposed to microwave radiation. Also histological changes were observed in the brain, liver, testis, kidney and spleen after whole-body microwave exposure, compared to the control group. Based on the results obtained in this study, we conclude that exposure to microwave radiation 2 h a day for 35 d can potentially cause histopathology and oxidative changes in Wistar rats. These results indicate possible implications of such exposure on human health.

New Technique for Retrieving Liquid Water Path over Land using Satellite Microwave Observations

DOE Office of Scientific and Technical Information (OSTI.GOV)

Deeter, M.N.; Vivekanandan, J.

2005-03-18

We present a new methodology for retrieving liquid water path over land using satellite microwave observations. As input, the technique exploits the Advanced Microwave Scanning Radiometer for earth observing plan (EOS) (AMSR-E) polarization-difference signals at 37 and 89 GHz. Regression analysis performed on model simulations indicates that over variable atmospheric and surface conditions the polarization-difference signals can be simply parameterized in terms of the surface emissivity polarization difference ({Delta}{var_epsilon}), surface temperature, liquid water path (LWP), and precipitable water vapor (PWV). The resulting polarization-difference parameterization (PDP) enables fast and direct (noniterative) retrievals of LWP with minimal requirements for ancillary data. Single-more » and dual-channel retrieval methods are described and demonstrated. Data gridding is used to reduce the effects of instrumental noise. The methodology is demonstrated using AMSR-E observations over the Atmospheric Radiation Measurement (ARM) Southern Great Plains (SGP) site during a six day period in November and December, 2003. Single- and dual-channel retrieval results mostly agree with ground-based microwave retrievals of LWP to within approximately 0.04 mm.« less

Introduction and analysis of several FY3C-MWHTS cloud/rain screening methods

NASA Astrophysics Data System (ADS)

Li, Xiaoqing

2017-04-01

Data assimilation of satellite microwave sounders are very important for numerical weather prediction. Fengyun-3C (FY-3C),launched in September, 2013, has two such sounders: MWTS (MicroWave Temperature Sounder) and MWHTS (MicroWave Humidity and Temperature Sounder). These data should be quality-controlled before assimilation and cloud/rain detection is one of the crucial steps. This paper introduced different cloud/rain detection methods based on MWHTS, VIRR (Visible and InfraRed Radiometer) and MWRI (Microwave Radiation Imager) observations. We designed 6 cloud/rain detection combinations and then analyzed the application effect of these schemes. The difference between observations and model simulations for FY-3C MWHTS channels were calculated as a parameter for analysis. Both RTTOV and CRTM were used to fast simulate radiances of MWHTS channels.

Temperature peaking at beginning of breakdown in 2.45 GHz pulsed off-resonance electron cyclotron resonance ion source hydrogen plasma

NASA Astrophysics Data System (ADS)

Cortázar, O. D.; Megía-Macías, A.; Vizcaíno-de-Julián, A.

2012-10-01

An experimental study of temperature and density evolution during breakdown in off-resonance ECR hydrogen plasma is presented. Under square 2.45 GHz microwave excitation pulses with a frequency of 50 Hz and relative high microwave power, unexpected transient temperature peaks that reach 18 eV during 20 μs are reported at very beginning of plasma breakdown. Decays of such peaks reach final stable temperatures of 5 eV at flat top microwave excitation pulse. Evidence of interplay between incoming power and duty cycle giving different kind of plasma parameters evolutions engaged to microwave coupling times is observed. Under relative high power conditions where short microwave coupling times are recorded, high temperature peaks are measured. However, for lower incoming powers and longer coupling times, temperature evolves gradually to a higher final temperature without peaking. On the other hand, the early instant where temperature peaks are observed also suggest a possible connection with preglow processes during breakdown in ECRIS plasmas.

Microwave-Assisted Superheating and/or Microwave-Specific Superboiling (Nucleation-Limited Boiling) of Liquids Occurs under Certain Conditions but is Mitigated by Stirring.

PubMed

Ferrari, Anthony; Hunt, Jacob; Stiegman, Albert; Dudley, Gregory B

2015-12-04

Temporary superheating and sustained nucleation-limited "superboiling" of unstirred liquids above the normal atmospheric boiling point have been documented during microwave heating. These phenomena are reliably observed under prescribed conditions, although the duration (of superheating) and magnitude (of superheating and superboiling) vary according to system parameters such as volume of the liquid and the size and shape of the vessel. Both phenomena are mitigated by rapid stirring with an appropriate stir bar and/or with the addition of boiling chips, which provide nucleation sites to support the phase-change from liquid to gas. With proper experimental design and especially proper stirring, the measured temperature of typical organic reaction mixtures heated at reflux will be close to the normal boiling point temperature of the solvent, whether heated using microwave radiation or conventional convective heat transfer. These observations are important to take into consideration when comparing reaction rates under conventional and microwave heating.

Response of the microwave-induced cyclotron harmonic resistance spike to an in-plane magnetic field

NASA Astrophysics Data System (ADS)

Dai, Yanhua; Stone, Kristjan; Knez, Ivan; Zhang, Chi; Du, R. R.; Yang, Changli; Pfeiffer, L. N.; West, K. W.

2011-12-01

Microwave-induced resistance oscillations (MIROs) have been commonly observed in high-mobility GaAs/AlGaAs two-dimensional electron systems (2DESs) under microwave irradiation. In ultraclean GaAs/AlGaAs quantum wells, we have recently observed a very large resistance spike at the second harmonic of cyclotron resonance. In order to elucidate its origin, we have studied the response of microwave photoresistances in a two-axis magnetic field configuration, where the perpendicular (Bz) and the in-plane (Bx) components can be independently applied to the sample. The experiments reveal a distinctive response of the spike to the Bx compared with that of the MIROs. While the major MIRO peaks show an increasing phase shift toward a quarter period in increasing Bx, the spike position shows an essentially zero shift. This finding lends additional support for the notion that the spike is a unique effect in the microwave-driven 2DES.

The Cosmic Microwave Background Anisotropy

NASA Astrophysics Data System (ADS)

Bennett, C. L.

1994-12-01

The properties of the cosmic microwave background radiation provide unique constraints on the history and evolution of the universe. The first detection of anisotropy of the microwave radiation was reported by the COBE Team in 1992, based on the first year of flight data. The latest analyses of the first two years of COBE data are reviewed in this talk, including the amplitude of the microwave anisotropy as a function of angular scale and the statistical nature of the fluctuations. The two-year results are generally consistent with the earlier first year results, but the additional data allow for a better determination of the key cosmological parameters. In this talk the COBE results are compared with other observational anisotropy results and directions for future cosmic microwave anisotropy observations will be discussed. The National Aeronautics and Space Administration/Goddard Space Flight Center (NASA/GSFC) is responsible for the design, development, and operation of the Cosmic Background Explorer (COBE). Scientific guidance is provided by the COBE Science Working Group.

Assimilation of Passive and Active Microwave Soil Moisture Retrievals

NASA Technical Reports Server (NTRS)

Draper, C. S.; Reichle, R. H.; DeLannoy, G. J. M.; Liu, Q.

2012-01-01

Root-zone soil moisture is an important control over the partition of land surface energy and moisture, and the assimilation of remotely sensed near-surface soil moisture has been shown to improve model profile soil moisture [1]. To date, efforts to assimilate remotely sensed near-surface soil moisture at large scales have focused on soil moisture derived from the passive microwave Advanced Microwave Scanning Radiometer (AMSR-E) and the active Advanced Scatterometer (ASCAT; together with its predecessor on the European Remote Sensing satellites (ERS. The assimilation of passive and active microwave soil moisture observations has not yet been directly compared, and so this study compares the impact of assimilating ASCAT and AMSR-E soil moisture data, both separately and together. Since the soil moisture retrieval skill from active and passive microwave data is thought to differ according to surface characteristics [2], the impact of each assimilation on the model soil moisture skill is assessed according to land cover type, by comparison to in situ soil moisture observations.

Land Surface Microwave Emissivity Dynamics: Observations, Analysis and Modeling

NASA Technical Reports Server (NTRS)

Tian, Yudong; Peters-Lidard, Christa D.; Harrison, Kenneth W.; Kumar, Sujay; Ringerud, Sarah

2014-01-01

Land surface microwave emissivity affects remote sensing of both the atmosphere and the land surface. The dynamical behavior of microwave emissivity over a very diverse sample of land surface types is studied. With seven years of satellite measurements from AMSR-E, we identified various dynamical regimes of the land surface emission. In addition, we used two radiative transfer models (RTMs), the Community Radiative Transfer Model (CRTM) and the Community Microwave Emission Modeling Platform (CMEM), to simulate land surface emissivity dynamics. With both CRTM and CMEM coupled to NASA's Land Information System, global-scale land surface microwave emissivities were simulated for five years, and evaluated against AMSR-E observations. It is found that both models have successes and failures over various types of land surfaces. Among them, the desert shows the most consistent underestimates (by approx. 70-80%), due to limitations of the physical models used, and requires a revision in both systems. Other snow-free surface types exhibit various degrees of success and it is expected that parameter tuning can improve their performances.

A novel algorithm for monitoring reservoirs under all-weather conditions at a high temporal resolution through passive microwave remote sensing

NASA Astrophysics Data System (ADS)

Zhang, Shuai; Gao, Huilin

2016-08-01

Flood mitigation in developing countries has been hindered by a lack of near real-time reservoir storage information at high temporal resolution. By leveraging satellite passive microwave observations over a reservoir and its vicinity, we present a globally applicable new algorithm to estimate reservoir storage under all-weather conditions at a 4 day time step. A weighted horizontal ratio (WHR) based on the brightness temperatures at 36.5 GHz is introduced, with its coefficients calibrated against an area training data set over each reservoir. Using a predetermined area-elevation (A-H) relationship, these coefficients are then applied to the microwave data to calculate the storage. Validation results over four reservoirs in South Asia indicate that the microwave-based storage estimations (after noise reduction) perform well (with coefficients of determination ranging from 0.41 to 0.74). This is the first time that passive microwave observations are fused with other satellite data for quantifying the storage of individual reservoirs.

The ASMEx snow slab experiment: snow microwave radiative transfer (SMRT) model evaluation

NASA Astrophysics Data System (ADS)

Sandells, Melody; Löwe, Henning; Picard, Ghislain; Dumont, Marie; Essery, Richard; Floury, Nicolas; Kontu, Anna; Lemmetyinen, Juha; Maslanka, William; Mätzler, Christian; Morin, Samuel; Wiesmann, Andreas

2017-04-01

A major uncertainty in snow microwave modelling to date has been the treatment of the snow microstructure. Although observations of microstructural parameters such as the optical grain diameter, specific surface area and correlation length have improved drastically over the last few years, scale factors have been used to derive the parameters needed in microwave emission models from these observations. Previous work has shown that a major difference between electromagnetic models of scattering coefficients is due to the specific snow microstructure models used. The snow microwave radiative transfer model (SMRT) is a new model developed to advance understanding of the role of microstructure and isolate different assumptions in existing microwave models that collectively hinder interpretation of model intercomparison studies. SMRT is implemented in Python and is modular, thus allows switching between different representations in its various components. Here, the role of microstructure is examined with the Improved Born Approximation electromagnetic model. The model is evaluated against scattering and absorption coefficients derived from radiometer measurements of snow slabs taken as part of the Arctic Snow Microstructure Experiment (ASMEx), which took place in Sodankylä, Finland over two seasons. Microtomography observations of slab samples were used to determine parameters for five microstructure models: spherical, exponential, sticky hard sphere, Teubner-Strey and Gaussian random field. SMRT brightness temperature simulations are also compared with radiometric observations of the snow slabs over a reflector plate and an absorber substrate. Agreement between simulations and observations is generally good except for slabs that are highly anisotropic.

Current status of the global change observation mission - water SHIZUKU (GCOM-W) and the advanced microwave scanning radiometer 2 (AMSR2) (Conference Presentation)

NASA Astrophysics Data System (ADS)

Maeda, Takashi; Kachi, Misako; Kasahara, Marehito

2016-10-01

Japan Aerospace Exploration Agency (JAXA) launched the Global Change Observation Mission - Water (GCOM-W) or "SHIZUKU" in 18 May 2012 (JST) from JAXA's Tanegashima Space Center. The GCOM-W satellite joins to NASA's A-train orbit since June 2012, and its observation is ongoing. The GCOM-W satellite carries the Advanced Microwave Scanning Radiometer 2 (AMSR2). The AMSR2 is a multi-frequency, total-power microwave radiometer system with dual polarization channels for all frequency bands, and successor microwave radiometer to the Advanced Microwave Scanning Radiometer for EOS (AMSR-E) loaded on the NASA's Aqua satellite. The AMSR-E kept observation in the slower rotation speed (2 rotations per minute) for cross-calibration with AMSR2 since December 2012, its operation ended in December 2015. The AMSR2 is designed almost similarly as the AMSR-E. The AMSR2 has a conical scanning system with large-size offset parabolic antenna, a feed horn cluster to realize multi-frequency observation, and an external calibration system with two temperature standards. However, some important improvements are made. For example, the main reflector size of the AMSR2 is expanded to 2.0 m to observe the Earth's surface in higher spatial resolution, and 7.3-GHz channel is newly added to detect radio frequency interferences at 6.9 GHz. In this paper, we present a recent topic for the AMSR2 (i.e., RFI detection performances) and the current operation status of the AMSR2.

Effect of different alcohols, gelatinizing times, calcination and microwave on characteristics of TiO2 nanoparticles synthesized by sol-gel method

NASA Astrophysics Data System (ADS)

Bahar, Mahmoud; Mozaffari, Masoud; Esmaeili, Sahar

2017-03-01

In this work, nanoparticles of titanium dioxide (TiO2) were synthesized by means of TiCl4 as precursor. Effects of alcohol type, calcination, gelatinizing time and microwave exposure on the particle size, morphology, crystallinity and particle phase are studied using XRD patterns and SEM images. Results showed that alcohols such as ethanol increased the particle size; calcination increased the particle size and improved the crystallinity of particles. Microwave exposure of particles resulted in smaller particles; adding water increased the impact of microwave. Effect of microwave exposure in rutile phase formation is also observed during this study.

The AMSR2 Satellite-based Microwave Snow Algorithm (SMSA) to estimate regional to global snow depth and snow water equivalent

NASA Astrophysics Data System (ADS)

Kelly, R. E. J.; Saberi, N.; Li, Q.

2017-12-01

With moderate to high spatial resolution (<1 km) regional to global snow water equivalent (SWE) observation approaches yet to be fully scoped and developed, the long-term satellite passive microwave record remains an important tool for cryosphere-climate diagnostics. A new satellite microwave remote sensing approach is described for estimating snow depth (SD) and snow water equivalent (SWE). The algorithm, called the Satellite-based Microwave Snow Algorithm (SMSA), uses Advanced Microwave Scanning Radiometer - 2 (AMSR2) observations aboard the Global Change Observation Mission - Water mission launched by the Japan Aerospace Exploration Agency in 2012. The approach is unique since it leverages observed brightness temperatures (Tb) with static ancillary data to parameterize a physically-based retrieval without requiring parameter constraints from in situ snow depth observations or historical snow depth climatology. After screening snow from non-snow surface targets (water bodies [including freeze/thaw state], rainfall, high altitude plateau regions [e.g. Tibetan plateau]), moderate and shallow snow depths are estimated by minimizing the difference between Dense Media Radiative Transfer model estimates (Tsang et al., 2000; Picard et al., 2011) and AMSR2 Tb observations to retrieve SWE and SD. Parameterization of the model combines a parsimonious snow grain size and density approach originally developed by Kelly et al. (2003). Evaluation of the SMSA performance is achieved using in situ snow depth data from a variety of standard and experiment data sources. Results presented from winter seasons 2012-13 to 2016-17 illustrate the improved performance of the new approach in comparison with the baseline AMSR2 algorithm estimates and approach the performance of the model assimilation-based approach of GlobSnow. Given the variation in estimation power of SWE by different land surface/climate models and selected satellite-derived passive microwave approaches, SMSA provides SWE estimates that are independent of real or near real-time in situ and model data.

Low intensity microwave radiation induced oxidative stress, inflammatory response and DNA damage in rat brain.

PubMed

Megha, Kanu; Deshmukh, Pravin Suryakantrao; Banerjee, Basu Dev; Tripathi, Ashok Kumar; Ahmed, Rafat; Abegaonkar, Mahesh Pandurang

2015-12-01

Over the past decade people have been constantly exposed to microwave radiation mainly from wireless communication devices used in day to day life. Therefore, the concerns over potential adverse effects of microwave radiation on human health are increasing. Until now no study has been proposed to investigate the underlying causes of genotoxic effects induced by low intensity microwave exposure. Thus, the present study was undertaken to determine the influence of low intensity microwave radiation on oxidative stress, inflammatory response and DNA damage in rat brain. The study was carried out on 24 male Fischer 344 rats, randomly divided into four groups (n=6 in each group): group I consisted of sham exposed (control) rats, group II-IV consisted of rats exposed to microwave radiation at frequencies 900, 1800 and 2450 MHz, specific absorption rates (SARs) 0.59, 0.58 and 0.66 mW/kg, respectively in gigahertz transverse electromagnetic (GTEM) cell for 60 days (2h/day, 5 days/week). Rats were sacrificed and decapitated to isolate hippocampus at the end of the exposure duration. Low intensity microwave exposure resulted in a frequency dependent significant increase in oxidative stress markers viz. malondialdehyde (MDA), protein carbonyl (PCO) and catalase (CAT) in microwave exposed groups in comparison to sham exposed group (p<0.05). Whereas, levels of reduced glutathione (GSH) and superoxide dismutase (SOD) were found significantly decreased in microwave exposed groups (p<0.05). A significant increase in levels of pro-inflammatory cytokines (IL-2, IL-6, TNF-α, and IFN-γ) was observed in microwave exposed animal (p<0.05). Furthermore, significant DNA damage was also observed in microwave exposed groups as compared to their corresponding values in sham exposed group (p<0.05). In conclusion, the present study suggests that low intensity microwave radiation induces oxidative stress, inflammatory response and DNA damage in brain by exerting a frequency dependent effect. The study also indicates that increased oxidative stress and inflammatory response might be the factors involved in DNA damage following low intensity microwave exposure. Copyright © 2015 Elsevier Inc. All rights reserved.

ARC-2007-ACD07-0065-028

NASA Image and Video Library

2007-04-12

Ames Video group during interviewing Dave Lathem, Harvard Smithsonian Center for Astrophysics, Cambridge, MR at the SETI Institute during a NASA Ames Kepler Mission conference. Dave Maurantonio, Ed Schilling, Bill Moede, and Eric Land, Ames/Planners Video crew (Kepler a search for habitable planets was selected for Discovery Program)

Search for extraterrestrial intelligence (SETI)

DOE Office of Scientific and Technical Information (OSTI.GOV)

Morrison, P.; Billingham, J.; Wolfe, J.

1977-01-01

Findings are presented of a series of workshops on the existence of extraterrestrial intelligent life and ways in which extraterrestrial intelligence might be detected. The coverage includes the cosmic and cultural evolutions, search strategies, detection of other planetary systems, alternate methods of communication, and radio frequency interference. 17 references. (JFP)

Experiential Education on the Edge: SETI Activities for the College Classroom

ERIC Educational Resources Information Center

Crider, Anthony; Weston, Anthony

2012-01-01

In a sophomore-level, interdisciplinary honors class, we introduced students to the Search for Extraterrestrial Intelligence through assigned readings, student presentations, classroom discussions, and multiple experiential activities. In this paper, we present four of these novel experiential activities. In the first, students suddenly find…

Orthodontic instrument sterilization with microwave irradiation.

PubMed

Yezdani, Arif; Mahalakshmi, Krishnan; Padmavathy, Kesavaram

2015-04-01

This study was designed to evaluate the efficiency of microwave sterilization of orthodontic instruments and molar bands immersed in plain distilled water with and without oral rinse, and to ascertain the minimum time of exposure required to sterilize. The orthodontic instruments (hinged and nonhinged), molar bands and mouth mirrorsused in the patient 's mouth were selected for the study. The instruments were divided into two groups - Group I with oral rinse-set A (0.01% chlorhexidine gluconate) and set B (0.025% betadine) and Group II (included sets C and D without oral rinse). The instruments of set A, B and C were microwaved at 2,450 MHz, 800 W for 5 min, whereas, set D was microwaved for 10 min at the same above mentioned specifications. The efficacy of sterilization was assessed by stab inoculation of the instruments onto trypticase soya agar plates. The plates were checked for bacterial growth following incubation at 37 °C for 24 h. For sterility control,Geobacillus stearothermophilus (MTCC 1518) was included. No growth was observed in the plates that were inoculated with the microwaved orthodontic instruments of sets A, B and D, whereas scanty bacterial growth was observed in the plates inoculatedwith the microwaved set C instruments. Effective sterilization was achieved when the orthodontic instruments and molar bands were immersed in distilled water without oral rinse and microwaved for 10 min as also for those that were immersed in distilled water with oral rinse and microwaved for 5 min.