Sample records for squash artifacts yield

  1. Gourd and squash artifacts yield starch grains of feasting foods from preceramic Peru

    PubMed Central

    Duncan, Neil A.; Pearsall, Deborah M.; Benfer, Robert A.

    2009-01-01

    In a study of residues from gourd and squash artifacts, we recovered starch grains from manioc (Manihot esculenta), potato (Solanum sp.), chili pepper (Capsicum spp.), arrowroot (Maranta arundinacea), and algarrobo (Prosopis sp.) from feasting contexts at the Buena Vista site, a central Peruvian preceramic site dating to ≈2200 calendar years B.C. This study has implications for the study of plant food use wherever gourds or squashes are preserved, documents the earliest evidence for the consumption of algarrobo and arrowroot in Peru, and provides insights into foods consumed at feasts. PMID:19633184

  2. Rapid immunocytochemistry based on alternating current electric field using squash smear preparation of central nervous system tumors.

    PubMed

    Moriya, Jun; Tanino, Mishie Ann; Takenami, Tomoko; Endoh, Tomoko; Urushido, Masana; Kato, Yasutaka; Wang, Lei; Kimura, Taichi; Tsuda, Masumi; Nishihara, Hiroshi; Tanaka, Shinya

    2016-01-01

    The role of intraoperative pathological diagnosis for central nervous system (CNS) tumors is crucial for neurosurgery when determining the surgical procedure. Especially, treatment of carmustine (BCNU) wafers requires a conclusive diagnosis of high-grade glioma proven by intraoperative diagnosis. Recently, we demonstrated the usefulness of rapid immunohistochemistry (R-IHC) that facilitates antigen-antibody reaction under alternative current (AC) electric field in the intraoperative diagnosis of CNS tumors; however, a higher proportion of water and lipid in the brain parenchyma sometimes leads to freezing artifacts, resulting in poor quality of frozen sections. On the other hand, squash smear preparation of CNS tumors for cytology does not affect the frozen artifacts, and the importance of smear preparation is now being re-recognized as being better than that of the tissue sections. In this study, we established the rapid immunocytochemistry (R-ICC) protocol for squash smears of CNS tumors using AC electric field that takes only 22 min, and demonstrated its usefulness for semi-quantitative Ki-67/MIB-1 labeling index and CD 20 by R-ICC for intraoperative diagnosis. R-ICC by AC electric field may become a substantial tool for compensating R-IHC and will be applied for broad antibodies in the future.

  3. Potential organic herbicides for squash production: Pelargonic acid herbicides AXXE® and Scythe®

    USDA-ARS?s Scientific Manuscript database

    Organic squash (Cucurbita pepo L.) producers need appropriate herbicides that can effectively provide season-long weed control. Although corn gluten meal has shown promise as an early-season pre-emergent organic herbicide in squash production, any uncontrolled weeds can inflict serious yield reducti...

  4. Root foraging elicits niche complementarity-dependent yield advantage in the ancient ‘three sisters’ (maize/bean/squash) polyculture

    PubMed Central

    Zhang, Chaochun; Postma, Johannes A.; York, Larry M.; Lynch, Jonathan P.

    2014-01-01

    Background and Aims Since ancient times in the Americas, maize, bean and squash have been grown together in a polyculture known as the ‘three sisters’. This polyculture and its maize/bean variant have greater yield than component monocultures on a land-equivalent basis. This study shows that below-ground niche complementarity may contribute to this yield advantage. Methods Monocultures and polycultures of maize, bean and squash were grown in two seasons in field plots differing in nitrogen (N) and phosphorus (P) availability. Root growth patterns of individual crops and entire polycultures were determined using a modified DNA-based technique to discriminate roots of different species. Key Results The maize/bean/squash and maize/bean polycultures had greater yield and biomass production on a land-equivalent basis than the monocultures. Increased biomass production was largely caused by a complementarity effect rather than a selection effect. The differences in root crown architecture and vertical root distribution among the components of the ‘three sisters’ suggest that these species have different, possibly complementary, nutrient foraging strategies. Maize foraged relatively shallower, common bean explored the vertical soil profile more equally, while the root placement of squash depended on P availability. The density of lateral root branching was significantly greater for all species in the polycultures than in the monocultures. Conclusions It is concluded that species differences in root foraging strategies increase total soil exploration, with consequent positive effects on the growth and yield of these ancient polycultures. PMID:25274551

  5. The Impact of Location and Growing Medium on Harvest Yield and Flavor of Basil and Squash Microgreens

    NASA Astrophysics Data System (ADS)

    Leal, J.; Ventura, C. J.

    2016-12-01

    The purpose of this experiment is to discover the most efficient, feasible way to produce a high yield of flavorful microgreens within the best growing medium and building location at the Stanford Educational Farm. In recent years, microgreens, young, small edible greens utilized as flavor garnishes for fine dining, have evolved into an immensely profitable market that will continue to expand and prosper. To capitalize on such opportunities, the primary metrics focused upon are harvest yield and flavor of basil and squash microgreens, as they develop in different concentrations of quick root and compost while located in either a greenhouse or lath house. It was hypothesized that if basil and squash microgreens were grown in a mixture of 50% compost and 50% quick root in the greenhouse, then they would produce the greatest harvest yield and maximum amount of flavor. The general experimental protocol includes monitoring the growth of the microgreens, then harvesting directly after the first true leaves begin to emerge. Upon harvest, each set of microgreens are separated into different clear glass jars to place on a small scale for weighing to determine the yield and tasting the leaves to analyze the flavor content. The highest yield of basil (63 grams) developed in a tray of 100% quick root in the lath house, while the greatest yield of squash (51 grams) succeeded in 100% quick root in the greenhouse. Overall however, the basil grew fastest in the greenhouse but tasted stronger in the lath house. Additionally, because the harvest yield and flavor results were so poor in all other locations and growing mediums for squash during the first trial, it cannot be considered a viable microgreen. In the future, more trials should be conducted for greater numbers of trays of microgreens to collect more data. The nutritional value of microgreens should also be explored further to obtain a holistic approach to the value of these plants from seed to harvest to consumption.

  6. Root-knot nematode management in double-cropped plasticulture vegetables.

    PubMed

    Desaeger, J A; Csinos, A S

    2006-03-01

    Combination treatments of chisel-injected fumigants (methyl bromide, 1,3-D, metam sodium, and chloropicrin) on a first crop, followed by drip-applied fumigants (metam sodium and 1,3-D +/- chloropicrin) on a second crop, with and without oxamyl drip applications were evaluated for control of Meloidogyne incognita in three different tests (2002 to 2004) in Tifton, GA. First crops were eggplant or tomato, and second crops were cantaloupe, squash, or jalapeno pepper. Double-cropped vegetables suffered much greater root-knot nematode (RKN) pressure than first crops, and almost-total yield loss occurred when second crops received no nematicide treatment. On a first crop of eggplant, all fumigants provided good nematode control and average yield increases of 10% to 15 %. On second crops, higher application rates and fumigant combinations (metam sodium and 1,3-D +/- chloropicrin) improved RKN control and increased yields on average by 20% to 35 % compared to the nonfumigated control. Oxamyl increased yields of the first crop in 2003 on average by 10% to 15% but had no effect in 2004 when RKN failed to establish itself. On double-cropped squash in 2003, oxamyl following fumigation provided significant additional reduction in nematode infection and increased squash yields on average by 30% to 75%.

  7. Root-Knot Nematode Management in Double-Cropped Plasticulture Vegetables

    PubMed Central

    Desaeger, J. A.; Csinos, A. S.

    2006-01-01

    Combination treatments of chisel-injected fumigants (methyl bromide, 1,3-D, metam sodium, and chloropicrin) on a first crop, followed by drip-applied fumigants (metam sodium and 1,3-D ± chloropicrin) on a second crop, with and without oxamyl drip applications were evaluated for control of Meloidogyne incognita in three different tests (2002 to 2004) in Tifton, GA. First crops were eggplant or tomato, and second crops were cantaloupe, squash, or jalapeno pepper. Double-cropped vegetables suffered much greater root-knot nematode (RKN) pressure than first crops, and almost-total yield loss occurred when second crops received no nematicide treatment. On a first crop of eggplant, all fumigants provided good nematode control and average yield increases of 10% to 15 %. On second crops, higher application rates and fumigant combinations (metam sodium and 1,3-D ± chloropicrin) improved RKN control and increased yields on average by 20% to 35 % compared to the nonfumigated control. Oxamyl increased yields of the first crop in 2003 on average by 10% to 15% but had no effect in 2004 when RKN failed to establish itself. On double-cropped squash in 2003, oxamyl following fumigation provided significant additional reduction in nematode infection and increased squash yields on average by 30% to 75%. PMID:19259431

  8. Discovery of a new genotype of Squash mosaic virus through deep sequencing of small RNAs and development of a qRT-PCR for broad spectrum detection

    USDA-ARS?s Scientific Manuscript database

    Squash mosaic virus (SqMV), a seed-borne virus belonging to the genus Commovirus in the family Comoviridae, could cause a serious yield loss on cucurbit crops worldwide. SqMV has a bipartite single-stranded ribonucleic acid (RNA) genome (RNA-1 and RNA-2) encapsidated separately with two capsid prote...

  9. [Effects of soil moisture content and light intensity on the plant growth and leaf physiological characteristics of squash].

    PubMed

    Du, She-ni; Bai, Gang-shuan; Liang, Yin-li

    2011-04-01

    A pot experiment with artificial shading was conducted to study the effects of soil moisture content and light intensity on the plant growth and leaf physiological characteristics of squash variety "Jingyingyihao". Under all test soil moisture conditions, 30% shading promoted the growth of "Jingyingyihao", with the highest yield at 70% - 80% soil relative moisture contents. 70% shading inhibited plant growth severely, only flowering and not bearing fruits, no economic yield produced. In all treatments, there was a similar water consumption trend, i. e., both the daily and the total water consumption decreased with increasing shading and decreasing soil moisture content. Among all treatments, 30% shading and 70% - 80% soil relative moisture contents had the highest water use efficiency (2.36 kg mm(-1) hm(-2)) and water output rate (1.57 kg mm(-1) hm(-2)). The net photosynthetic rate, transpiration rate, stomatal conductance, and chlorophyll content of squash leaves decreased with increasing shading, whereas the intercellular CO2 concentration was in adverse. The leaf protective enzyme activity and proline content decreased with increasing shading, and the leaf MAD content decreased in the order of 70% shading, natural radiation, and 30% shading. Under the three light intensities, the change characteristics of squash leaf photosynthesis, protective enzyme activity, and proline and MAD contents differed with the increase of soil relative moisture content.

  10. Filter paper-assisted cell transfer (FaCT) technique: A novel cell-sampling technique for intraoperative diagnosis of central nervous system tumors.

    PubMed

    Kawamura, Jumpei; Kamoshida, Shingo; Shimakata, Takaaki; Hayashi, Yurie; Sakamaki, Kuniko; Denda, Tamami; Kawai, Kenji; Kuwao, Sadahito

    2017-04-01

    Intraoperative diagnosis of central nervous system (CNS) tumors provides critical guidance to surgeons in the determination of surgical resection margins and treatment. The techniques and preparations used for the intraoperative diagnosis of CNS tumors include frozen sectioning and cytologic methods (squash smear and touch imprint). Cytologic specimens, which do not have freezing artifacts, are important as an adjuvant tool to frozen sections. However, if the amount of submitted tissue samples is limited, then it is difficult to prepare both frozen sections and squash smears or touch imprint specimens from a single sample at the same time. Therefore, the objective of this study was to derive cells directly from filter paper on which tumor samples are placed. The authors established the filter paper-assisted cell transfer (FaCT) smear technique, in which tumor cells are transferred onto a glass slide directly from the filter paper sample spot after the biopsy is removed. Cell yields and diagnostic accuracy of the FaCT smears were assessed in 40 CNS tumors. FaCT smears had ample cell numbers and well preserved cell morphology sufficient for cytologic diagnosis, even if the submitted tissues were minimal. The overall diagnostic concordance rates between frozen sections and FaCT smears were 90% and 87.5%, respectively (no significant differences). When combining FaCT smears with frozen sections, the diagnostic concordance rate rose to 92.5%. The current results suggest that the FaCT smear technique is a simple and effective processing method that has significant value for intraoperative diagnosis of CNS tumors. Cancer Cytopathol 2017;125:277-282. © 2016 American Cancer Society. © 2017 American Cancer Society.

  11. Heavy metals in summer squash fruits grown in soil amended with municipal sewage sludge.

    PubMed

    Antonious, George F; Snyder, John C; Dennis, Sam O

    2010-02-01

    The increasing awareness of the value of vegetables and fruits in the human diet requires monitoring of heavy metals in food crops. The effects of amending soil with compost made from municipal sewage sludge (MSS) and MSS mixed with yard waste (MSS-YW) on Cd, Cr, Mo, Cu, Zn, Pb, and Ni concentrations in soil and the potential bioaccumulation of heavy metals in squash fruits at harvest were investigated. A field study was conducted in a silty-loam soil at Kentucky State University Research Farm. Eighteen plots of 22 x 3.7 m each were separated using metal borders and the soil in six plots was mixed with MSS at 15 t acre(-1), six plots were mixed with MSS-YW at 15 t acre(-1) (on dry weight basis), and six unamended plots (no-mulch) were used for comparison purposes. Plots were planted with summer squash and heavy metals were analyzed in soil and mature fruits at harvest. Analysis of heavy metals in squash fruits was conducted using inductively coupled plasma spectrometry. Zinc and Cu concentrations in soil mixed with MSS were extremely high compared to other metals. In squash fruits, concentrations of Zn were generally greater than Cu. Total squash marketable yield was greatest in MSS-YW and MSS treatments compared to no-mulch conventional soil. Concentrations of Cd and Pb in soil amended with MSS averaged 0.1 and 1.4 mg kg(-1), respectively. These levels were much lower than the limits in the U.S. guidelines for using MSS in land farming. Data revealed that maximum concentrations of Cd and Pb in squash fruits were 0.03 and 0.01 microg g(-1) dry fruit, respectively. Nickel concentration in squash fruits fluctuated among harvest dates reaching a maximum of 2.5 microg g(-1) dry fruit. However, these concentrations were far below their permissible limits in edible fruits.

  12. Assessment of Total Phenolic and Flavonoid Content, Antioxidant Properties, and Yield of Aeroponically and Conventionally Grown Leafy Vegetables and Fruit Crops: A Comparative Study

    PubMed Central

    Chandra, Suman; Khan, Shabana; Avula, Bharathi; Lata, Hemant; Yang, Min Hye; ElSohly, Mahmoud A.; Khan, Ikhlas A.

    2014-01-01

    A comparison of the product yield, total phenolics, total flavonoids, and antioxidant properties was done in different leafy vegetables/herbs (basil, chard, parsley, and red kale) and fruit crops (bell pepper, cherry tomatoes, cucumber, and squash) grown in aeroponic growing systems (AG) and in the field (FG). An average increase of about 19%, 8%, 65%, 21%, 53%, 35%, 7%, and 50% in the yield was recorded for basil, chard, red kale, parsley, bell pepper, cherry tomatoes, cucumber, and squash, respectively, when grown in aeroponic systems, compared to that grown in the soil. Antioxidant properties of AG and FG crops were evaluated using 2,2-diphenyl-1-picrylhydrazyl (DDPH) and cellular antioxidant (CAA) assays. In general, the study shows that the plants grown in the aeroponic system had a higher yield and comparable phenolics, flavonoids, and antioxidant properties as compared to those grown in the soil. PMID:24782905

  13. Validity and Reliability of an on-Court Fitness Test for Assessing and Monitoring Aerobic Fitness in Squash.

    PubMed

    James, Carl Alexander; Vallejo, Florencio Tenllado; Kantebeen, Melvin; Farra, Saro

    2018-02-14

    Current on-court assessments of aerobic fitness in squash are not designed to yield a wealth of physiological data. Moreover, tests may require complex computer equipment or involve simulated racket strokes, which are difficult to standardize at high intensities. This study investigated the validity and reliability of a squash-specific fitness test which can yield both a standalone performance score, as well as pertinent physiological markers such as V[Combining Dot Above]O2max, the lactate turnpoint and oxygen cost, in a sport-specific environment. Eight national squash players completed three tests in a counter-balanced order; an incremental laboratory treadmill test (LAB) and two on-court fitness tests (ST) that involved repeated shuttle runs at increasing speeds. V[Combining Dot Above]O2max during ST was agreeable with LAB (Typical error [TE]=3.3 mL.kg.min, r=0.79). The mean bias between LAB and ST was 2.5 mL.kg.min. There were no differences in maximum heart rate, post exercise blood lactate concentration or end of test RPE between LAB and ST (p>0.05). The ST was highly reliable, with 74 (10) laps completed in ST1 and 75 (12) laps in ST2 (mean bias=1 lap, TE=3 laps, r=0.97). Physiological markers were also reliable, including V[Combining Dot Above]O2max, (TE=1.5 mL.kg.min, r=0.95), the lap number at 4 mMol (TE=4 laps, r=0.77) and average VO2 across the first 4 stages (TE=0.94 mL.kg.min, r=0.95). We observed good agreement between LAB and ST for assessing V[Combining Dot Above]O2max and between both on-court trials for assessing test performance and selected physiological markers. Consequently, we recommend this test for monitoring training adaptations and prescribing individualized training in elite squash players.

  14. Effect of application timing and method on efficacy and phytotoxicity of 1,3-D, chloropicrin and metam-sodium combinations in squash plasticulture.

    PubMed

    Desaeger, Johan A; Seebold, Kenneth W; Csinos, Alex S

    2008-03-01

    Metam-sodium, 1,3-dichloropropene (1,3-D) and chloropicrin are widely used soil fumigants. Combined application of metam-sodium and 1,3-D + chloropicrin is intended to improve efficacy and broaden spectrum of control, but little is known about the effect on crop safety. This study aimed to evaluate the effects of application timing of fumigant combinations on soilborne pest and disease control (nematodes, soil fungi and weeds) and growth of squash. Two separate tests with chisel-injected and drip-applied fumigant combinations and plant-back times ranging from 1 to 4 weeks were conducted in Tifton, GA, USA, in spring and fall 2002. Fumigant combinations using 1,3-D, chloropicrin and metam-sodium were as effective as methyl bromide in controlling Meloidogyne incognita (Kofoid & White) Chitwood, Pythium irregulare Buis., Rhizoctonia solani Kühn and Cyperus esculentus L. Chisel-applied combinations were more effective in terms of root-knot nematode control than drip-applied combinations. Root-knot nematode reduced squash yields by up to 60%. Phytotoxicity problems and lower yields were observed during spring, especially following 1,3-D + chloropicrin and when plant-back periods were shorter. The main problem with fumigant alternatives to methyl bromide may not be reduced efficacy but, in particular for 1,3-D products, loss of flexibility in terms of longer plant-back periods. (c) 2008 Society of Chemical Industry.

  15. Effects of Tropical Rotation Crops on Meloidogyne arenaria Population Densities and Vegetable Yields in Microplots.

    PubMed

    McSorley, R; Dickson, D W; de Brito, J A; Hewlett, T E; Frederick, J J

    1994-06-01

    The effects of 12 summer crop rotation treatments on population densities of Meloidogyne arenaria race 1 and on yields of subsequent spring vegetable crops were determined in microplots. The crop sequence was: (i) rotation crops during summer 1991 ; (ii) cover crop of rye (Secale cereale) during winter 1991-92; (iii) squash (Cucurbita pepo) during spring 1992; (iv) rotation crops during summer 1992; (v) rye during winter 1992-93; (vi) eggplant (Solanum melongena) during spring 1993. The 12 rotation treatments were castor (Ricinus communis), cotton (Gossypium hirsutum), velvetbean (Mucuna deeringiana), crotalaria (Crotalaria spectabilis), fallow, hairy indigo (Indigofera hirsuta), American jointvetch (Aeschynomene americana), sorghum-sudangrass (Sorghum bicolor x S. sudanense), soybean (Glycine max), horsebean (Canavalia ensiformis), sesame (Sesamum indicum), and peanut (Arachis hypogaea). Compared to peanut, the first eight rotation treatments resulted in lower (P

  16. Tropical rotation crops influence nematode densities and vegetable yields.

    PubMed

    McSorley, R; Dickson, D W; de Brito, J A; Hochmuth, R C

    1994-09-01

    The effects of eight summer rotation crops on nematode densities and yields of subsequent spring vegetable crops were determined in field studies conducted in north Florida from 1991 to 1993. The crop sequence was as follows: (i) rotation crops during summer 1991; (ii) cover crop of rye (Secale cereale) during winter 1991-92; (iii) 'Lemondrop L' squash (Cucurbita pepo) during spring 1992; (iv) rotation crops during summer 1992; (v) rye during winter 1992-93; (vi) 'Classic' eggplant (Solanum melongena) during spring 1993. The eight summer crop rotation treatments were as follows: 'Hale' castor (Ricinus communis), velvetbean (Mucuna deeringiana), sesame (Sesamum indicum), American jointvetch (Aeschynomene americana), weed fallow, 'SX- 17' sorghum-sudangrass (Sorghum bicolor x S. sudanense), 'Kirby' soybean (Glycine max), and 'Clemson Spineless' okra (Hibiscus esculentus) as a control. Rotations with castor, velvetbean, American jointvetch, and sorghum-sudangrass were most effective in maintaining the lowest population densities of Meloidogyne spp. (a mixture of M. incognita race 1 and M. arenaria race 1), but Paratrichodorus minor built up in the sorghum-sudangrass rotation. Yield of squash was lower (P

  17. AXXE® (Pelargonic acid) and Racer® (Ammonium Nonanoate): Weed control comparisons

    USDA-ARS?s Scientific Manuscript database

    Although corn gluten meal has shown promise as an early-season pre-emergent organic herbicide in squash (Cucurbita pepo L.) production, any uncontrolled weeds can inflict serious yield reductions by the end of the growing season. Organic vegetable producers need additional organic herbicides that c...

  18. Without the Academic Part, It Wouldn't Be Squash": Youth Development in an Urban Squash Program

    ERIC Educational Resources Information Center

    Hemphill, Michael A.; Richards, K. Andrew R.

    2016-01-01

    Purpose: The purpose of this study was to examine youth development outcomes in an Urban Squash program. Methods: A mixed method approach to was employed to address three research questions: 1) to what extent did the Urban Squash program exhibit features of a quality OST program?; 2) what aspects of the Urban Squash program were most valued by…

  19. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Fleming, W.E.; Baker, F.E.; Koblitsky, L.

    Experiments were performed to determine what effects lead arsenate added to soils had on the germination, growth, and yield of garden vegetables. The vegetables used were asparagus, broccoli, brussels sprouts, cabbage, carrots, cauliflower, corn, popcorn, pepper, cucumber, eggplant, endive, kohlrabi, lettuce, okra, onion, parsley, parsnip, pea, pumpkin, radish, squash, tomato, turnip, watermelon, beets, muskmelon, spinach, lima beans, and string beans.

  20. Unprotected eyes in squash: not seeing the risk of injury.

    PubMed

    Eime, R; McCarty, C; Finch, C F; Owen, N

    2005-03-01

    The use of appropriate eyewear in squash can protect the eyes against injury. However, few adult squash players adequately protect their eyes against potential severe injuries. We describe the characteristics of non-users of protective eyewear and examine predictors of appropriate eyewear use. Self-report surveys of adult players were conducted in metropolitan Melbourne, Australia. Information on players' knowledge, behaviours and attitudes associated with protective eyewear use was collected, in addition to player demographic data. Appropriate eyewear was defined as Standards-approved polycarbonate lens eyewear. The majority 92.2% of players did not adequately protect their eyes while playing squash. Significant predictors of reported eyewear use were: previous eye injury: playing squash on average more than 2 hr per wk: having played for more than 20 y; and having more favourable attitudes towards eye safety in squash. The significant predictors of appropriate eyewear use were: being female; previous eye injury; playing squash on average more than 2 hr per week; and having more favourable attitudes towards eye safety in squash. Understanding the characteristics of both users and non-users of appropriate eye protection in squash is essential for informing future prevention strategies.

  1. Stability of squashed Kaluza-Klein black holes

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Kimura, Masashi; Ishihara, Hideki; Murata, Keiju

    2008-03-15

    The stability of squashed Kaluza-Klein black holes is studied. The squashed Kaluza-Klein black hole looks like a five-dimensional black hole in the vicinity of horizon and looks like a four-dimensional Minkowski spacetime with a circle at infinity. In this sense, squashed Kaluza-Klein black holes can be regarded as black holes in the Kaluza-Klein spacetimes. Using the symmetry of squashed Kaluza-Klein black holes, SU(2)xU(1){approx_equal}U(2), we obtain master equations for a part of the metric perturbations relevant to the stability. The analysis based on the master equations gives strong evidence for the stability of squashed Kaluza-Klein black holes. Hence, the squashed Kaluza-Kleinmore » black holes deserve to be taken seriously as realistic black holes in the Kaluza-Klein spacetime.« less

  2. Evolution of perturbations of squashed Kaluza-Klein black holes: Escape from instability

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Ishihara, Hideki; Kimura, Masashi; Konoplya, Roman A.

    2008-04-15

    The squashed Kaluza-Klien (KK) black holes differ from the Schwarzschild black holes with asymptotic flatness or the black strings even at energies for which the KK modes are not excited yet, so that squashed KK black holes open a window in higher dimensions. Another important feature is that the squashed KK black holes are apparently stable and, thereby, let us avoid the Gregory-Laflamme instability. In the present paper, the evolution of scalar and gravitational perturbations in time and frequency domains is considered for these squashed KK black holes. The scalar field perturbations are analyzed for general rotating squashed KK blackmore » holes. Gravitational perturbations for the so-called zero mode are shown to be decayed for nonrotating black holes, in concordance with the stability of the squashed KK black holes. The correlation of quasinormal frequencies with the size of extra dimension is discussed.« less

  3. 7 CFR 319.56-36 - Watermelon, squash, cucumber, and oriental melon from the Republic of Korea.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 7 Agriculture 5 2014-01-01 2014-01-01 false Watermelon, squash, cucumber, and oriental melon from... QUARANTINE NOTICES Fruits and Vegetables § 319.56-36 Watermelon, squash, cucumber, and oriental melon from the Republic of Korea. Watermelon (Citrullus lanatus), squash (Cucurbita maxima), cucumber (Cucumis...

  4. 7 CFR 319.56-36 - Watermelon, squash, cucumber, and oriental melon from the Republic of Korea.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 7 Agriculture 5 2012-01-01 2012-01-01 false Watermelon, squash, cucumber, and oriental melon from... QUARANTINE NOTICES Fruits and Vegetables § 319.56-36 Watermelon, squash, cucumber, and oriental melon from the Republic of Korea. Watermelon (Citrullus lanatus), squash (Cucurbita maxima), cucumber (Cucumis...

  5. 7 CFR 319.56-36 - Watermelon, squash, cucumber, and oriental melon from the Republic of Korea.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 7 Agriculture 5 2013-01-01 2013-01-01 false Watermelon, squash, cucumber, and oriental melon from... QUARANTINE NOTICES Fruits and Vegetables § 319.56-36 Watermelon, squash, cucumber, and oriental melon from the Republic of Korea. Watermelon (Citrullus lanatus), squash (Cucurbita maxima), cucumber (Cucumis...

  6. Host-mediated effects of semipersistently transmitted Squash vein yellowing virus on sweetpotato whitefly (Hemiptera: Aleyrodidae) behavior and fitness

    USDA-ARS?s Scientific Manuscript database

    Alighting, settling and oviposition behavioral assays were conducted on Squash vein yellowing virus- (SqVYV-) infected and mock-inoculated squash and watermelon plants. Developmental time of immature stages, adult longevity, and fecundity were measured on SqVYV-infected and mock-inoculated squash p...

  7. Hawking radiation from squashed Kaluza-Klein black holes: A window to extra dimensions

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Ishihara, Hideki; Soda, Jiro

    2007-09-15

    We explore the observability of extra dimensions through five-dimensional squashed Kaluza-Klein black holes residing in the Kaluza-Klein spacetime. With the expectation that the Hawking radiation reflects the five-dimensional nature of the squashed horizon, we study the Hawking radiation of a scalar field in the squashed black hole background. As a result, we show that the luminosity of Hawking radiation tells us the size of the extra dimension, namely, the squashed Kaluza-Klein black holes open a window to extra dimensions.

  8. Conductance Oscillations in Squashed Carbon Nanotubes

    NASA Technical Reports Server (NTRS)

    Mehrez, H.; Anantram, M. P.; Svizhenko, A.

    2003-01-01

    A combination of molecular dynamics and electrical conductance calculations are used to probe the electromechanical properties of squashed metallic carbon nanotubes. We find that the conductance and bandgap of armchair nanotubes show oscillations upon squashing. The physical origin of these oscillations is attributed to interaction of carbon atoms with a fourth neighbor. Squashing of armchair and zigzag nanotubes ultimately leads to metallic behavior.

  9. 75 FR 29309 - Notice of Decision to Issue Permits for the Importation of Fresh Male Summer Squash Flowers From...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-05-25

    ...] Notice of Decision to Issue Permits for the Importation of Fresh Male Summer Squash Flowers From Israel... into the continental United States of fresh male summer squash flowers from Israel. Based on the... importation of fresh male summer squash flowers from Israel. EFFECTIVE DATE: May 25, 2010. FOR FURTHER...

  10. 75 FR 6346 - Notice of Availability of a Pest Risk Analysis for the Importation of Fresh Male Summer Squash...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-02-09

    ...] Notice of Availability of a Pest Risk Analysis for the Importation of Fresh Male Summer Squash Flowers... evaluates the risks associated with the importation of fresh male summer squash flowers from Israel into the... summer squash flowers, Cucurbita pepo L. into the continental United States. Currently, fresh male summer...

  11. Comparative analysis of Cucurbita pepo metabolism throughout fruit development in acorn squash and oilseed pumpkin

    PubMed Central

    Wyatt, Lindsay E; Strickler, Susan R; Mueller, Lukas A; Mazourek, Michael

    2016-01-01

    Both the fruit mesocarp and the seeds of winter squash can be used for consumption, although the focus of breeding efforts varies by cultivar. Cultivars bred for fruit consumption are selected for fruit mesocarp quality traits such as carotenoid content, percent dry matter, and percent soluble solids, while these traits are essentially ignored in oilseed pumpkins. To compare fruit development in these two types of squash, we sequenced the fruit transcriptome of two cultivars bred for different purposes: an acorn squash, ‘Sweet REBA’, and an oilseed pumpkin, ‘Lady Godiva’. Putative metabolic pathways were developed for carotenoid, starch, and sucrose synthesis in winter squash fruit and squash homologs were identified for each of the structural genes in the pathways. Gene expression, especially of known rate-limiting and branch point genes, corresponded with metabolite accumulation both across development and between the two cultivars. Thus, developmental regulation of metabolite genes is an important factor in winter squash fruit quality. PMID:27688889

  12. Physiological profiles and sport specific fitness of Asian elite squash players.

    PubMed Central

    Chin, M K; Steininger, K; So, R C; Clark, C R; Wong, A S

    1995-01-01

    There is a scarcity of descriptive data on the physiological characteristics of elite Asian squash players. The purpose of this study was to evaluate the physiological profile and sports specific fitness of Hong Kong elite squash players. It was conducted before the selection of the Hong Kong national squash team for the 1992 Asian Squash Championship. Ten elite squash players were selected as subjects for the study. Maximum oxygen uptake was measured using a continuous treadmill running test. A sports specific field test was performed in a squash court. The following means (s.d.) were observed: height 172.6(4.3) cm; weight 67.7(6.9) kg; body fat 7.4(3.4)%; forced vital capacity (FVC) 5.13(0.26) litres; maximum oxygen uptake (VO2max) 61.7(3.4) ml.kg-1.min-1; anaerobic threshold (AT) 80.2(3.3)% of VO2max; alactic power index 15.5(1.8) W.kg-1; lactic work index 323.5(29.4) J.kg-1, peak isokinetic dominant knee extensor and flexor strengths 3.11(0.29) Nm.kg-1 and 1.87(0.18) Nm.kg-1. The results show that the Hong Kong squash players have relatively high cardiorespiratory sports specific fitness and muscle strength which may be one of the key factors that contributed to the success of the Hong Kong team in the Asian Championship. PMID:8800847

  13. Intraoperative Squash and Touch Preparation Cytology of Brain Lesions Stained with H+E and Diff-Quik™: A 20-Year Retrospective Analysis and Comparative Literature Review.

    PubMed

    Hamasaki, Makoto; Chang, Karen H F; Nabeshima, Kazuki; Tauchi-Nishi, Pamela S

    2018-01-01

    Squash preparation (SP) is a rapid technique for the intraoperative assessment of brain lesions. Only a few studies have employed touch preparation (TP) cytology and Diff-QuikTM (DQ) staining in conjunction with SP. Our study aimed to assess the diagnostic efficacy of SP of brain lesions at our institution, ascertain the additional effect of TP and DQ staining, examine factors affecting the sensitivity and specificity of our methods, and compare our findings with those of previous investigations. Our database was searched for all SP/TP of brain lesions examined from January 1996 to December 2016. During this 20-year study period, our search revealed 400 brain lesions diagnosed by SP/TP cytology. There were 338 (84.5%) neoplasms and 62 (15.5%) nonneoplastic lesions. The most common neoplasms were glioblastoma multiforme (24.6%), metastatic cancer (18.3%), meningioma (16.9%), astrocytoma (11.5%), lymphoma (8.3%), oligoastrocytoma (3.3%), and pituitary adenoma (3.3%). There was discordance between the SP/TP and histological diagnoses in 19/338 (5.6%) cases, i.e., 12 misclassifications of tumor subtype and 7 sampling errors. No false-positive cases were detected. Brain SP/TP stained with H+E/DQ demonstrated high sensitivity (97.9%), specificity (100%), and overall diagnostic accuracy (95.3%). The combined methods, in particular, aided in the diagnosis of brain tumors prone to smearing artifacts and certain metastatic malignancies. © 2017 S. Karger AG, Basel.

  14. Host-Mediated Effects of Semipersistently Transmitted Squash Vein Yellowing Virus on Sweetpotato Whitefly (Hemiptera: Aleyrodidae) Behavior and Fitness.

    PubMed

    Shrestha, Deepak; McAuslane, Heather J; Adkins, Scott T; Smith, Hugh A; Dufault, Nicholas; Colee, James; Webb, Susan E

    2017-08-01

    Plant viruses may indirectly affect insect vector behavior and fitness via a shared host plant. Here, we evaluated the host-mediated effects of Squash vein yellowing virus (SqVYV) on the behavior and fitness of its whitefly vector, Bemisia tabaci (Gennadius) Middle East-Asia Minor 1, formerly biotype B. Alighting, settling, and oviposition behavioral assays were conducted on infected and mock-inoculated squash (Cucurbita pepo L.) and watermelon [Citrullus lanatus (Thunb) Matsum and Nakai] plants. Developmental time of immature stages, adult longevity, and fecundity were measured on infected and mock-inoculated squash plants. For adult longevity and fecundity, whiteflies were reared on infected and mock-inoculated squash plants to determine the effects of nymphal rearing host on the adult stage. More whiteflies alighted and remained settled on infected squash than on mock-inoculated squash 0.25, 1, 8, and 24 h after release. No such initial preference was observed on watermelon plants, but by 8 h after release, more whiteflies were found on mock-inoculated watermelon plants than on infected plants. Whiteflies laid approximately six times more eggs on mock-inoculated watermelon than on infected watermelon; however, no differences were observed on squash. Development from egg to adult emergence was 3 d shorter on infected than mock-inoculated squash plants. Females lived 25% longer and had higher fecundity on infected squash plants than on mock-inoculated plants, regardless of infection status of the rearing host. The host-mediated effects of SqVYV infection on whitefly behavior differ on two cucurbit host plants, suggesting the potential for more rapid spread of the virus within watermelon fields. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  15. Pollination value of male bees: the specialist bee Peponapis pruinosa (Apidae) at summer squash (Cucurbita pepo).

    PubMed

    Cane, James H; Sampson, Blair J; Miller, Stephanie A

    2011-06-01

    Male bees can be abundant at flowers, particularly floral hosts of those bee species whose females are taxonomic pollen specialists (oligolecty). Contributions of male bees to host pollination are rarely studied directly despite their prevalence in a number of pollination guilds, including those of some crop plants. In this study, males of the oligolectic bee, Peponapis pruinosa Say, were shown to be effective pollinators of summer squash, Cucurbita pepo L. Seven sequential visits from male P. pruinosa maximized squash fruit set and growth. This number of male visits accumulated during the first hour of their foraging and mate searching at flowers soon after sunrise. Pollination efficacy of male P. pruinosa and their abundances at squash flowers were sufficient to account for most summer squash production at our study sites, and by extrapolation, to two-thirds of all 87 North American farms and market gardens growing squashes that were surveyed for pollinators by collaborators in the Squash Pollinators of the Americas Survey. We posit that the substantial pollination value of male Peponapis bees is a consequence of their species' oligolecty, their mate seeking strategy, and some extreme traits of Cucurbita flowers (massive rewards, flower size, phenology).

  16. Energy Requirements of Squash and Racquetball.

    ERIC Educational Resources Information Center

    Montpetit, Richard R.; And Others

    1987-01-01

    Oxygen consumption and heart rate were monitored in 32 male adults playing racquetball and squash. Results indicated that energy expenditure in racquetball was only slightly less than for squash, suggesting that either sport is appropriate for developing and maintaining fitness in healthy adults. (Author/CB)

  17. What do adult squash players think about protective eyewear?

    PubMed Central

    Finch, C.; Vear, P.

    1998-01-01

    OBJECTIVE: To determine the attitudes of adult squash players towards protective eyewear. METHODS: A survey of 197 competition and social squash players from seven squash centres in the outer eastern suburbs of Melbourne, Australia was conducted in September to October 1995. Information about participation in squash, previous injuries, use of protective eyewear, barriers towards eyewear use, and attitudes towards protective eyewear was obtained by a self report questionnaire. RESULTS: Squash is a popular sport in Australia. Of the players surveyed, 6% played in junior competitions, 67% in senior competitions, and 27% were social players. Most had been playing for more than ten years. Some 15% of players had previously suffered an eye injury, most commonly caused by a racquet. Less than 10% of players reported that they wore protective eyewear when they played squash, and 35% of these wore prescriptive lenses which they considered to be protective. The major reason for not wearing protective eyewear was the perception that it was unnecessary. Poor vision and a lack of comfort were also stated as reasons by a significant number of players. More than half (57%) of the respondents agreed that more players should wear protective eyewear, yet only 16% thought it should be compulsory for all players. There was considerable support for protective eyewear use by junior players, however. CONCLUSIONS: The rate of protective eyewear use is low among competition and social squash players in Melbourne. The major areas that need to be addressed are the ignorance of the need for protective eyewear among social and experienced players and the mistaken belief that prescription lenses provide adequate protection on a squash court. 


 PMID:9631225

  18. Bacterial elicitation of transcriptional response of female squash bug, Anasa tristis (De Geer)

    USDA-ARS?s Scientific Manuscript database

    The Squash bug, Anasa tristis (De Geer), is a major pest of squash, pumpkin, and other cucurbits throughout North America. A. tristis is a piercing/sucking feeder which causes extensive foliar wilting, fruit scarring, and in addition transmits plant pathogens. Current biological control agents ava...

  19. Predator-prey trophic relationships in response to organic management practices.

    PubMed

    Schmidt, Jason M; Barney, Sarah K; Williams, Mark A; Bessin, Ricardo T; Coolong, Timothy W; Harwood, James D

    2014-08-01

    A broad range of environmental conditions likely regulate predator-prey population dynamics and impact the structure of these communities. Central to understanding the interplay between predator and prey populations and their importance is characterizing the corresponding trophic interactions. Here, we use a well-documented molecular approach to examine the structure of the community of natural enemies preying upon the squash bug, Anasa tristis, a herbivorous cucurbit pest that severely hinders organic squash and pumpkin production in the United States. Primer pairs were designed to examine the effects of organic management practices on the strength of these trophic connections and link this metric to measures of the arthropod predator complex density and diversity within an experimental open-field context. Replicated plots of butternut squash were randomly assigned to three treatments and were sampled throughout a growing season. Row-cover treatments had significant negative effects on squash bug and predator communities. In total, 640 predators were tested for squash bug molecular gut-content, of which 11% were found to have preyed on squash bugs, but predation varied over the season between predator groups (coccinellids, geocorids, nabids, web-building spiders and hunting spiders). Through the linking of molecular gut-content analysis to changes in diversity and abundance, these data delineate the complexity of interaction pathways on a pest that limits the profitability of organic squash production. © 2014 John Wiley & Sons Ltd.

  20. 78 FR 25620 - Importation of Female Squash Flowers From Israel Into the Continental United States

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-05-02

    ... Flowers From Israel Into the Continental United States AGENCY: Animal and Plant Health Inspection Service... importation of fruits and vegetables to allow the importation of female squash flowers from Israel into the continental United States. As a condition of entry, female squash flowers from Israel would be subject to a...

  1. Complete genome sequence of a novel genotype of squash mosaic virus

    USDA-ARS?s Scientific Manuscript database

    Complete genome sequence of a novel genotype of Squash mosaic virus (SqMV) infecting squash plants in Spain was obtained using deep sequencing of small ribonucleic acids and assembly. The low nucleotide sequence identities, with 87-88% on RNA1 and 84-86% on RNA2 to known SqMV isolates, suggest a new...

  2. Predation and Parasitism Rates on Sentinel and Naturally Occurring Egg Masses of the Squash Bug (Hemiptera: Coreidae) in Maryland

    USDA-ARS?s Scientific Manuscript database

    Seasonal changes in egg predation and parasitism rates on sentinel and naturally occurring (wild) egg masses of the squash bug, Anasa tristis (DeGeer), were evaluated in squash fields in Maryland from June through September in 2013 and 2014. Rates of egg predation and parasitism were significantly ...

  3. A Recovery-Oriented Approach to Dependable Services: Repairing Past Errors with System-Wide Undo

    DTIC Science & Technology

    2003-12-01

    54 4.5.3 Handling propagating paradoxes: the squash interface . . . . . . . . . . . . . . . . . . . 54 4.6 Discussion...84 6.3.3 Compensating for paradoxes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 84 6.3.4 Squashing propagating...the service and comparing the behavior of the replicas to detect and squash misbehaving replicas. While on paper Byzantine fault tolerance may seem to

  4. Squashed Entanglement, k-Extendibility, Quantum Markov Chains, and Recovery Maps

    NASA Astrophysics Data System (ADS)

    Li, Ke; Winter, Andreas

    2018-02-01

    Squashed entanglement (Christandl and Winter in J. Math. Phys. 45(3):829-840, 2004) is a monogamous entanglement measure, which implies that highly extendible states have small value of the squashed entanglement. Here, invoking a recent inequality for the quantum conditional mutual information (Fawzi and Renner in Commun. Math. Phys. 340(2):575-611, 2015) greatly extended and simplified in various work since, we show the converse, that a small value of squashed entanglement implies that the state is close to a highly extendible state. As a corollary, we establish an alternative proof of the faithfulness of squashed entanglement (Brandão et al. Commun. Math. Phys. 306:805-830, 2011). We briefly discuss the previous and subsequent history of the Fawzi-Renner bound and related conjectures, and close by advertising a potentially far-reaching generalization to universal and functorial recovery maps for the monotonicity of the relative entropy.

  5. Impact of the egg parasitoid, gryon pennsylvanicum (Hymenoptera: Scelionidae), on sentinel and wild egg masses of the squash bug (Hemiptera: Coreidae) in Maryland

    USDA-ARS?s Scientific Manuscript database

    Seasonal changes in egg predation and parasitism rates on sentinel and naturally occurring (wild) egg masses of the squash bug, Anasa tristis (DeGeer), were evaluated in squash fields in Maryland from June through September in 2013 and 2014. Rates of egg predation and parasitism were significantly...

  6. Optimal 2D-SIM reconstruction by two filtering steps with Richardson-Lucy deconvolution.

    PubMed

    Perez, Victor; Chang, Bo-Jui; Stelzer, Ernst Hans Karl

    2016-11-16

    Structured illumination microscopy relies on reconstruction algorithms to yield super-resolution images. Artifacts can arise in the reconstruction and affect the image quality. Current reconstruction methods involve a parametrized apodization function and a Wiener filter. Empirically tuning the parameters in these functions can minimize artifacts, but such an approach is subjective and produces volatile results. We present a robust and objective method that yields optimal results by two straightforward filtering steps with Richardson-Lucy-based deconvolutions. We provide a resource to identify artifacts in 2D-SIM images by analyzing two main reasons for artifacts, out-of-focus background and a fluctuating reconstruction spectrum. We show how the filtering steps improve images of test specimens, microtubules, yeast and mammalian cells.

  7. Optimal 2D-SIM reconstruction by two filtering steps with Richardson-Lucy deconvolution

    NASA Astrophysics Data System (ADS)

    Perez, Victor; Chang, Bo-Jui; Stelzer, Ernst Hans Karl

    2016-11-01

    Structured illumination microscopy relies on reconstruction algorithms to yield super-resolution images. Artifacts can arise in the reconstruction and affect the image quality. Current reconstruction methods involve a parametrized apodization function and a Wiener filter. Empirically tuning the parameters in these functions can minimize artifacts, but such an approach is subjective and produces volatile results. We present a robust and objective method that yields optimal results by two straightforward filtering steps with Richardson-Lucy-based deconvolutions. We provide a resource to identify artifacts in 2D-SIM images by analyzing two main reasons for artifacts, out-of-focus background and a fluctuating reconstruction spectrum. We show how the filtering steps improve images of test specimens, microtubules, yeast and mammalian cells.

  8. Effect of Fusarium isolates and their filtrates on respiratory rate and chemical analysis of squash plants.

    PubMed

    El-Shenawy, Z; Mansour, M A; El-Behrawi, S

    1978-01-01

    The highly pathogenic isolate stimulated the emergence of the squash seedlings first, caused, however, the highest death rate of the seedlings finally. Fusarium isolates and their culture filtrates inhibited the respiratory rate of squash plants significantly. However, F. oxysporum isolates inhibited respiration more than F. solani isolates. Seasonal changes of respiration decline show that the respiratory rate decreased with plant growth in the case of infested soil and of plants injected with culture filtrates. However, spraying Fusarium culture filtrates on the foliage gave opposite results when the plants grew older. Fusarium solani isolates decreased nitrogen content of squash stems and leaves, while F. oxysporum isolates gave reverse results. Injecting Fusarium culture filtrate into the plant decreased nitrogen content of both stems and leaves, while spraying the foliage with the filtrates increased nitrogen content more than that of the control. Phosphorus content of the stems of squash plants, sown in infested soil, was less than in the control when the plants were treated with F. solani and higher when they were treated with F. oxysporum isolates. On the other hand, the phosphorus content of squash leaves was higher than in the control. In the case of injected plants, however, the phosphorus content in stems and leaves was equal to that of the control or less, and with sprayed plants it was higher than in the control. Infesting the soil with Fusarium isolates and spraying the foliage with their culture filtrates increased potassium content of squash stems and leaves, while injecting the filtrates into the plants decreased potassium content of both stems and leaves.

  9. Complex Chern-Simons from M5-branes on the squashed three-sphere

    NASA Astrophysics Data System (ADS)

    Córdova, Clay; Jafferis, Daniel L.

    2017-11-01

    We derive an equivalence between the (2,0) superconformal M5-brane field theory dimensionally reduced on a squashed three-sphere, and Chern-Simons theory with complex gauge group. In the reduction, the massless fermions obtain an action which is second order in derivatives and are reinterpreted as ghosts for gauge fixing the emergent non-compact gauge symmetry. A squashing parameter in the geometry controls the imaginary part of the complex Chern-Simons level.

  10. Are squash players protecting their eyes?

    PubMed

    Eime, R M; Finch, C F; Sherman, C A; Garnham, A P

    2002-09-01

    To determine factors associated with adult squash players' protective eyewear behaviours. A survey of 303 players (aged >or =18 years) was conducted at three squash venues in Melbourne, Australia over a three week period in June 2000 to obtain information about protective eyewear use. Of 303 participants the response rate was 98.1%; 66.1% were males, with a mean age of 40.5 years. The majority (68.4%) had played squash for 10 years or more. Although 18.8% of players reported using protective eyewear, only 8.9% reported wearing approved eyewear. Both age group (p<0.05) and years of squash experience (p<0.01) were significantly associated with any eyewear use. The two main influences were personal experience of eye injuries (50.0%) and knowledge of eye injury risk (33.9%). A commonly reported barrier was restriction of vision (34.2%). These findings demonstrate a low prevalence of voluntary use of appropriate protective eyewear. Future prevention strategies incorporating education campaigns should focus on increasing players' knowledge of risks. The barriers to use and misconceptions about which types of eyewear is most protective need to be addressed as a priority.

  11. Analysis of Tactical, Decisional and Executional Behaviour according to the Level of Expertise in Squash

    PubMed Central

    Catalán-Eslava, María; González-Víllora, Sixto; Pastor-Vicedo, Juan C.; Contreras-Jordán, Onofre R.

    2018-01-01

    Abstract The objective of this study was to analyse the differences in tactical principles, decision-making and execution of the return shot and drop shot of squash players at different levels of proficiency. The sample was composed of 80 players, divided into four levels of expertise (first national category, second national category, autonomous regional level and provincial level). The Squash Performance Evaluation Tool was used for recording the level of decision-making and execution. The results revealed that reading of the context of the game improved as the level of the player’s expertise of both the return shot and the drop shot increased. The correlation between correct decision-making and better quality execution for both the return shot and the drop shot in squash also improved with the player’s level of expertise. According to these results, improvements in situational tactical principles and the application of tactical principles, correct decision-making and high-quality execution are essential to develop the athletic performance level among squash players. PMID:29599875

  12. Engineering zucchini yellow mosaic potyvirus as a non-pathogenic vector for expression of heterologous proteins in cucurbits.

    PubMed

    Arazi, T; Slutsky, S G; Shiboleth, Y M; Wang, Y; Rubinstein, M; Barak, S; Yang, J; Gal-On, A

    2001-04-27

    Plant virus vectors provide an attractive biotechnological tool for the transient expression of foreign genes in whole plants. As yet there has been no use of recombinant viruses for the improvement of commercial crops. This is mainly because the viruses used to create vectors usually cause significant yield loss and can be transmitted in the field. A novel attenuated zucchini yellow mosaic potyvirus (AG) was used for the development of an environmentally safe non-pathogenic virus vector. The suitability of AG as an expression vector in plants was tested by analysis of two infectious viral constructs, each containing a distinct gene insertion site. Introduction of a foreign viral coat protein gene into AG genome between the P1 and HC-Pro genes, resulted in no expression in planta. In contrast, the same gene was stably expressed when inserted between NIb and CP genes, suggesting that this site is more suitable for a gene vector. Virus-mediated expression of reporter genes was observed in squash and cucumber leaves, stems, roots and edible fruit. Furthermore, AG stably expressed human interferon-alpha 2, an important human anti-viral drug, without affecting plant development and yield. Interferon biological activity was measured in cucumber and squash fruit. Together, these data corroborate a biotechnological utility of AG as a non-pathogenic vector for the expression of a foreign gene, as a benefit trait, in cucurbits and their edible fruit.

  13. Glucose Content and In Vitro Bioaccessibility in Sweet Potato and Winter Squash Varieties during Storage

    PubMed Central

    Zaccari, Fernanda; Cabrera, María Cristina; Saadoun, Ali

    2017-01-01

    Glucose content and in vitro bioaccessibility were determined in raw and cooked pulp of Arapey, Cuabé, and Beauregard sweet potato varieties, as well as Maravilla del Mercado and Atlas winter squash, after zero, two, four, and six months of storage (14 °C, 80% relative humidity (RH)). The total glucose content in 100 g of raw pulp was, for Arapey, 17.7 g; Beauregard, 13.2 g; Cuabé, 12.6 g; Atlas, 4.0 g; and in Maravilla del Mercado, 4.1 g. These contents were reduced by cooking process and storage time, 1.1 to 1.5 times, respectively, depending on the sweet potato variety. In winter squash varieties, the total glucose content was not modified by cooking, while the storage increased glucose content 2.8 times in the second month. After in vitro digestion, the glucose content released was 7.0 times higher in sweet potato (6.4 g) than in winter squash (0.91 g) varieties. Glucose released by in vitro digestion for sweet potato stored for six months did not change, but in winter squashes, stored Atlas released glucose content increased 1.6 times. In conclusion, in sweet potato and winter squash, the glucose content and the released glucose during digestive simulation depends on the variety and the storage time. These factors strongly affect the supply of glucose for human nutrition and should be taken into account for adjusting a diet according to consumer needs. PMID:28665302

  14. Glucose Content and In Vitro Bioaccessibility in Sweet Potato and Winter Squash Varieties during Storage.

    PubMed

    Zaccari, Fernanda; Cabrera, María Cristina; Saadoun, Ali

    2017-06-30

    Glucose content and in vitro bioaccessibility were determined in raw and cooked pulp of Arapey, Cuabé, and Beauregard sweet potato varieties, as well as Maravilla del Mercado and Atlas winter squash, after zero, two, four, and six months of storage (14 °C, 80% relative humidity (RH)). The total glucose content in 100 g of raw pulp was, for Arapey, 17.7 g; Beauregard, 13.2 g; Cuabé, 12.6 g; Atlas, 4.0 g; and in Maravilla del Mercado, 4.1 g. These contents were reduced by cooking process and storage time, 1.1 to 1.5 times, respectively, depending on the sweet potato variety. In winter squash varieties, the total glucose content was not modified by cooking, while the storage increased glucose content 2.8 times in the second month. After in vitro digestion, the glucose content released was 7.0 times higher in sweet potato (6.4 g) than in winter squash (0.91 g) varieties. Glucose released by in vitro digestion for sweet potato stored for six months did not change, but in winter squashes, stored Atlas released glucose content increased 1.6 times. In conclusion, in sweet potato and winter squash, the glucose content and the released glucose during digestive simulation depends on the variety and the storage time. These factors strongly affect the supply of glucose for human nutrition and should be taken into account for adjusting a diet according to consumer needs.

  15. Knowledge, beliefs and attitudes of squash venue operators relating to use of protective eyewear.

    PubMed

    Eime, Rochelle; Finch, Caroline; Owen, Neville; Gifford, Sandra; Vear, Paul

    2004-03-01

    Sports venues are in a position to potentially influence the safety practices of their patrons. This study examined the knowledge, beliefs and attitudes of venue operators that could influence the use of protective eyewear by squash players. A 50% random sample of all private and public squash venues affiliated with the Victorian Squash Federation in metropolitan Melbourne was selected. Face-to-face interviews were conducted with 15 squash venue operators during August 2001. Interviews were transcribed and content and thematic analyses were performed. The content of the interviews covered five topics: (1) overall injury risk perception, (2) eye injury occurrence, (3) knowledge, behaviors, attitudes and beliefs associated with protective eyewear, (4) compulsory protective eyewear and (5) availability of protective eyewear at venues. Venue operators were mainly concerned with the severe nature of eye injuries, rather than the relatively low incidence of these injuries. Some venue operators believed that players should wear any eyewear, rather than none at all, and believed that more players should use protective eyewear. Generally, they did not believe that players with higher levels of experience and expertise needed to wear protective eyewear when playing. Only six venues had at least one type of eyewear available for players to hire or borrow or to purchase. Operators expressed a desire to be informed about correct protective eyewear. Appropriate protective eyewear is not readily available at squash venues. Better-informed venue operators may be more likely to provide suitable protective eyewear.

  16. Biology of Anastrepha grandis (Diptera: Tephritidae) in Different Cucurbits.

    PubMed

    Bolzan, Anderson; Nava, Dori E; Garcia, Flávio R M; Valgas, Ricardo A; Smaniotto, Giovani

    2015-06-01

    Anastrepha grandis (Macquart) (Diptera: Tephritidae) is one of the main pests of cucurbits in Brazil. Losses occur due to the damage caused to the fruits and the embargo on exports, as A. grandis is considered a quarantine pest in countries that import Brazilian cucurbits. This study aimed to evaluate the development of A. grandis in hosts of the Cucurbitaceae family. The hosts used were stem squash (Cucurbita pepo L.), squash (Cucurbita moschata Duchesne), chayote [Sechium edule (Jacq.) Swartz], mini watermelon [Citrullus lanatus (Thunb.) Matsum & Nakai], Spanish melon (Cucumis melo L.), hybrid squash "Tetsukabuto" (C. moschata×Cucurbita maxima Duchesne), and salad cucumber (Cucumis sativus L.). We evaluated the viability and duration of egg-to-pupa period, pupal weight, sex ratio, and average number of pupae per fruit under controlled conditions of temperature, relative humidity, and photophase. The preoviposition and oviposition periods, fecundity, fertility, and longevity of females were determined for adults. Hosts of the genus Cucurbita provided a better development of A. grandis in comparison with other hosts, and presented a greater number of insects on fruit as well as higher infestation rate. Fecundity and longevity were also higher for females that developed in hosts of the genus Cucurbita, although values of these biological parameters varied between stem squash, squash, hybrid squash "Tetsukabuto." © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  17. Evaluation of different pulverisation methods for RNA extraction in squash fruit: lyophilisation, cryogenic mill and mortar grinding.

    PubMed

    Román, Belén; González-Verdejo, Clara I; Peña, Francisco; Nadal, Salvador; Gómez, Pedro

    2012-01-01

    Quality and integrity of RNA are critical for transcription studies in plant molecular biology. In squash fruit and other high water content crops, the grinding of tissue with mortar and pestle in liquid nitrogen fails to produce a homogeneous and fine powered sample desirable to ensure a good penetration of the extraction reagent. To develop an improved pulverisation method to facilitate the homogenisation process of squash fruit tissue prior to RNA extraction without reducing quality and yield of the extracted RNA. Three methods of pulverisation, each followed by the same extraction protocol, were compared. The first approach consisted of the lyophilisation of the sample in order to remove the excess of water before grinding, the second one used a cryogenic mill and the control one a mortar grinding of frozen tissue. The quality of the isolated RNA was tested by carrying out a quantitative real time downstream amplification. In the three situations considered, mean values for A(260) /A(280) indicated minimal interference by proteins and RNA quality indicator (RQI) values were considered appropriate for quantitative real-time polymerase chain reaction (qRT-PCR) amplification. Successful qRT-PCR amplifications were obtained with cDNA isolated with the three protocols. Both apparatus can improve and facilitate the grinding step in the RNA extraction process in zucchini, resulting in isolated RNA of high quality and integrity as revealed by qRT-PCR downstream application. This is apparently the first time that a cryogenic mill has been used to prepare fruit samples for RNA extraction, thereby improving the sampling strategy because the fine powder obtained represents a homogeneous mix of the organ tissue. Copyright © 2012 John Wiley & Sons, Ltd.

  18. Crop domestication facilitated rapid geographical expansion of a specialist pollinator, the squash bee Peponapis pruinosa

    PubMed Central

    Cane, James H.; Minckley, Robert L.; Danforth, Bryan N.

    2016-01-01

    Squash was first domesticated in Mexico and is now found throughout North America (NA) along with Peponapis pruinosa, a pollen specialist bee species of the squash genus Cucurbita. The origin and spread of squash cultivation is well-studied archaeologically and phylogenetically; however, no study has documented how cultivation of this or any other crop has influenced species in mutualistic interactions. We used molecular markers to reconstruct the demographic range expansion and colonization routes of P. pruinosa from its native range into temperate NA. Populations east of the Rocky Mountains expanded from the wild host plant's range in Mexico and were established by a series of founder events. Eastern North America was most likely colonized from squash bee populations in the present-day continental Midwest USA and not from routes that followed the Gulf and Atlantic coasts from Mexico. Populations of P. pruinosa west of the Rockies spread north from the warm deserts much more recently, showing two genetically differentiated populations with no admixture: one in California and the other one in eastern Great Basin. These bees have repeatedly endured severe bottlenecks as they colonized NA, following human spread of their Cucurbita pollen hosts during the Holocene. PMID:27335417

  19. Heart Rate Response and Lactic Acid Concentration in Squash Players.

    ERIC Educational Resources Information Center

    Beaudin, Paula; And Others

    1978-01-01

    It was concluded that playing squash is an activity that results in heart rate responses of sufficient intensity to elicit aerobic training effects without producing high lactic acid concentration in the blood. (MM)

  20. Composite Cucurbita pepo plants with transgenic roots as a tool to study root development

    PubMed Central

    Ilina, Elena L.; Logachov, Anton A.; Laplaze, Laurent; Demchenko, Nikolay P.; Pawlowski, Katharina; Demchenko, Kirill N.

    2012-01-01

    Background and Aims In most plant species, initiation of lateral root primordia occurs above the elongation zone. However, in cucurbits and some other species, lateral root primordia initiation and development takes place in the apical meristem of the parental root. Composite transgenic plants obtained by Agrobacterium rhizogenes-mediated transformation are known as a suitable model to study root development. The aim of the present study was to establish this transformation technique for squash. Methods The auxin-responsive promoter DR5 was cloned into the binary vectors pKGW-RR-MGW and pMDC162-GFP. Incorporation of 5-ethynyl-2′-deoxyuridine (EdU) was used to evaluate the presence of DNA-synthesizing cells in the hypocotyl of squash seedlings to find out whether they were suitable for infection. Two A. rhizogenes strains, R1000 and MSU440, were used. Roots containing the respective constructs were selected based on DsRED1 or green fluorescent protein (GFP) fluorescence, and DR5::Egfp-gusA or DR5::gusA insertion, respectively, was verified by PCR. Distribution of the response to auxin was visualized by GFP fluorescence or β-glucuronidase (GUS) activity staining and confirmed by immunolocalization of GFP and GUS proteins, respectively. Key Results Based on the distribution of EdU-labelled cells, it was determined that 6-day-old squash seedlings were suited for inoculation by A. rhizogenes since their root pericycle and the adjacent layers contain enough proliferating cells. Agrobacterium rhizogenes R1000 proved to be the most virulent strain on squash seedlings. Squash roots containing the respective constructs did not exhibit the hairy root phenotype and were morphologically and structurally similar to wild-type roots. Conclusions The auxin response pattern in the root apex of squash resembled that in arabidopsis roots. Composite squash plants obtained by A. rhizogenes-mediated transformation are a good tool for the investigation of root apical meristem development and root branching. PMID:22553131

  1. (Mechanisms of inhibition of viral replication in plants)

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Not Available

    1992-01-01

    Progress is described concerning genetic mapping CMV movement genes for CMV coat protein in squash and ToMV gene in tomato. These gene products appear to be involved in resistance to squash and tomato mosaic viruses respectively.

  2. Intact Plastids Are Required for Nitrate- and Light-Induced Accumulation of Nitrate Reductase Activity and mRNA in Squash Cotyledons 1

    PubMed Central

    Oelmüller, Rolf; Briggs, Winslow R.

    1990-01-01

    Induction of nitrate reductase activity and mRNA by nitrate and light is prevented if chloroplasts are destroyed by photooxidation in norflurazon-treated squash (Cucurbita maxima L.) cotyledons. The enzyme activity and mRNA can be induced if norflurazon-treated squash seedlings are kept in low-intensity red light, which minimizes photodamage to the plastids. It is concluded that induction of nitrate reductase activity and nitrate reductase mRNA requires intact plastids. If squash seedlings grown in low-intensity red light are transferred to photooxidative white light, nitrate reductase activity accumulates during the first 12 hours after the shift and declines thereafter. Thus photodamage to the plastids and the disappearance of nitrate reductase activity and mRNA are events separable in time, and disappearance of the enzyme activity is a consequence of the damage to the plastids. Images Figure 1 Figure 3 Figure 4 PMID:16667294

  3. Management of Root-knot Nematodes by Phenamiphos Applied through an Irrigation Simulator with Various Amounts of Water

    PubMed Central

    Johnson, A. W.; Young, J. R.; Wright, W. C.

    1986-01-01

    Phenamiphos (6.7 kg a.i./ha) was applied via an irrigation simulator to squash at planting (AP) and 2 weeks after planting (PP), and to corn AP and 1 week PP to manage root-knot nematodes (Meloidogyne incognita). The nematicide was applied with 0.25, 0.64, 1.27, and 1.91 cm surface water/ ha to a Lakeland sand in which the soil moisture was at or near field capacity. Based on efficacy and crop response, no additional benefits resulted when phenamiphos was applied in volumes of water greater than 0.25 crn/ha. The cost of applying each 0.25 cm of water over a hectare is approximately $1.08, or a 92% reduction in nematicide application cost over conventional methods ($13.50/ha). Low root-gall indices and high yields from squash and corn indicate more effective nematode management when phenamiphos was applied AP rather than PP. Results from this method of applying phenamiphos suggest that certain nematicides could be used as salvage alternatives when nematodes are detected in crops soon after planting. For multiple-pest management, nematicides, other compatible biocides, and fertilizers could be applied simultaneously with sprinkler irrigation. PMID:19294192

  4. Cell lines derived from the squash bug, Anasa tristis (Coreidae: Hemiptera).

    PubMed

    Goodman, Cynthia L; Ringbauer, Joseph A; Li, Yao-Fa; Lincoln, Tamra Reall; Stanley, David

    2017-05-01

    The squash bug, Anasa tristis, is a pest of cucurbits that exerts direct damage on crops and is a vector of plant pathogens. We established cell lines from this insect to serve as tools for basic biology, including virology and immunology, as well as applied studies, such as insecticide development programs. We initiated 15 cell cultures, using nine media or combinations of media. The media yielding the best results were a modification of Kimura's medium and a combination of two commercially available cell culture media (EX-CELL 420 and L15). We designated the two cell lines as BCIRL-AtE-CLG11 and BCIRL-AtE-CLG15. From the AtE-CLG15 line, we isolated two sub-lines, A and B. Of these, the most consistently replicating line was AtE-CLG15A. We determined the doubling time of this line (190 h) and its mean cell diameter (14.5 ± 0.7 μm). We characterized the AtE-CLG15A line using DAF-PCR. The BCIRL-AtE-CLG15A cell line is now available for researchers world-wide.

  5. [Mechanisms of inhibition of viral replication in plants]. Progress report

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Not Available

    1992-09-01

    Progress is described concerning genetic mapping CMV movement genes for CMV coat protein in squash and ToMV gene in tomato. These gene products appear to be involved in resistance to squash and tomato mosaic viruses respectively.

  6. Squash vein yellowing virus

    USDA-ARS?s Scientific Manuscript database

    Cucurbits are an important crop of temperate, subtropical and tropical regions of the world. Squash vein yellowing virus (SqVYV) is a major viral pathogen of cucurbits. This chapter provides an overview of the biology of SqVYV and the disease it causes....

  7. Grains and Starchy Vegetables

    MedlinePlus

    ... Pumpkin Acorn squash Butternut squash Green Peas Corn Beans, Legumes, Peas and Lentils Try to include beans into several meals per week. They are a ... and are loaded with fiber, vitamins and minerals. Beans such as black, kidney, and pinto Bean products ...

  8. Hawking radiation as tunneling from squashed Kaluza-Klein black hole

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Matsuno, Ken; Umetsu, Koichiro

    2011-03-15

    We discuss Hawking radiation from a five-dimensional squashed Kaluza-Klein black hole on the basis of the tunneling mechanism. A simple method, which was recently suggested by Umetsu, may be used to extend the original derivation by Parikh and Wilczek to various black holes. That is, we use the two-dimensional effective metric, which is obtained by the dimensional reduction near the horizon, as the background metric. Using the same method, we derive both the desired result of the Hawking temperature and the effect of the backreaction associated with the radiation in the squashed Kaluza-Klein black hole background.

  9. Crop domestication facilitated rapid geographical expansion of a specialist pollinator, the squash bee Peponapis pruinosa.

    PubMed

    López-Uribe, Margarita M; Cane, James H; Minckley, Robert L; Danforth, Bryan N

    2016-06-29

    Squash was first domesticated in Mexico and is now found throughout North America (NA) along with Peponapis pruinosa, a pollen specialist bee species of the squash genus Cucurbita The origin and spread of squash cultivation is well-studied archaeologically and phylogenetically; however, no study has documented how cultivation of this or any other crop has influenced species in mutualistic interactions. We used molecular markers to reconstruct the demographic range expansion and colonization routes of P. pruinosa from its native range into temperate NA. Populations east of the Rocky Mountains expanded from the wild host plant's range in Mexico and were established by a series of founder events. Eastern North America was most likely colonized from squash bee populations in the present-day continental Midwest USA and not from routes that followed the Gulf and Atlantic coasts from Mexico. Populations of P. pruinosa west of the Rockies spread north from the warm deserts much more recently, showing two genetically differentiated populations with no admixture: one in California and the other one in eastern Great Basin. These bees have repeatedly endured severe bottlenecks as they colonized NA, following human spread of their Cucurbita pollen hosts during the Holocene. © 2016 The Author(s).

  10. Combining ability of summer-squash lines with different degrees of parthenocarpy and PRSV-W resistance.

    PubMed

    Nogueira, Douglas Willian; Maluf, Wilson Roberto; Dos Reis Figueira, Antonia; Maciel, Gabriel Mascarenhas; Gomes, Luiz Antonio Augusto; Benavente, Cesar Augusto Ticona

    2011-10-01

    The aim was to assess heterosis in a set of 16 summer-squash hybrids, and evaluate the combining capacity of the respective parental lines, which differed as to the degree of parthenocarpy and resistance to PRSV-W (Papaya Ringspot Virus-Watermelon strain). The hybrids were obtained using a partial diallel cross design (4 × 4). The lines of parental group I were 1 = ABX-037G-77-03-05-01-01-bulk, 2 = ABX-037G-77-03-05-03-10-bulk, 3 = ABX-037G-77-03-05-01-04-bulk and 4 = ABX-037G-77-03-05-05-01-bulk, and of group II, 1' = ABX-037G-77-03-05-04-08-bulk, 2' = ABX-037G-77-03-05-02-11-bulk, 3' = Clarice and 4' = Caserta. The 16 hybrids and eight parental lines were evaluated for PRSV-W resistance, parthenocarpic expression and yield in randomized complete-block designs, with three replications. Parthenocarpy and the resistance to PRSV-W were rated by means of a scale from 1 to 5, where 1 = non-parthenocarpic or high resistance to PRSV-W, and 5 = parthenocarpic or high susceptibility to PRSV-W. Both additive and non-additive gene effects were important in the expression of parthenocarpy and resistance to PRSV-W. Whereas estimates of heterosis in parthenocarpy usually tended towards a higher degree, resistance to PRSV-W was towards higher susceptibility. At least one F(1) hybrid was identified with a satisfactory degree of parthenocarpy, resistance to PRSV-W and high fruit-yield.

  11. Combining ability of summer-squash lines with different degrees of parthenocarpy and PRSV-W resistance

    PubMed Central

    Nogueira, Douglas Willian; Maluf, Wilson Roberto; dos Reis Figueira, Antonia; Maciel, Gabriel Mascarenhas; Gomes, Luiz Antonio Augusto; Benavente, Cesar Augusto Ticona

    2011-01-01

    The aim was to assess heterosis in a set of 16 summer-squash hybrids, and evaluate the combining capacity of the respective parental lines, which differed as to the degree of parthenocarpy and resistance to PRSV-W (Papaya Ringspot Virus-Watermelon strain). The hybrids were obtained using a partial diallel cross design (4 × 4). The lines of parental group I were 1 = ABX-037G-77-03-05-01-01-bulk, 2 = ABX-037G-77-03-05-03-10-bulk, 3 = ABX-037G-77-03-05-01-04-bulk and 4 = ABX-037G-77-03-05-05-01-bulk, and of group II, 1′ = ABX-037G-77-03-05-04-08-bulk, 2′ = ABX-037G-77-03-05-02-11-bulk, 3′ = Clarice and 4′ = Caserta. The 16 hybrids and eight parental lines were evaluated for PRSV-W resistance, parthenocarpic expression and yield in randomized complete-block designs, with three replications. Parthenocarpy and the resistance to PRSV-W were rated by means of a scale from 1 to 5, where 1 = non-parthenocarpic or high resistance to PRSV-W, and 5 = parthenocarpic or high susceptibility to PRSV-W. Both additive and non-additive gene effects were important in the expression of parthenocarpy and resistance to PRSV-W. Whereas estimates of heterosis in parthenocarpy usually tended towards a higher degree, resistance to PRSV-W was towards higher susceptibility. At least one F1 hybrid was identified with a satisfactory degree of parthenocarpy, resistance to PRSV-W and high fruit-yield. PMID:22215966

  12. Handicapping in Squash

    ERIC Educational Resources Information Center

    Wagaman, John; Fletcher, Michael

    2018-01-01

    This article considers how a handicapping system should be devised for squash. It looks at the American scoring system, and whether it is possible to have a fair system of handicapping. We consider "fair" from a perspective of expected number of rallies won and probability of winning.

  13. Sphingolipid Long-Chain Base Synthesis in Plants (Characterization of Serine Palmitoyltransferase Activity in Squash Fruit Microsomes).

    PubMed

    Lynch, D. V.; Fairfield, S. R.

    1993-12-01

    The activity of serine palmitoyltransferase (palmitoyl-coenzyme A [CoA]:L-serine [Ser]-C-palmitoyltransferase [decarboxylating], EC 2.3.1.50), the enzyme catalyzing the first step in the synthesis of the long-chain base required for sphingolipid assembly, has been characterized in a plant system. Enzyme activity in a microsomal membrane fraction from summer squash fruit (Cucurbita pepo L. cv Early Prolific Straightneck) was assayed by monitoring the incorporation of L-[3H]Ser into the chloroform-soluble product, 3-ketosphinganine. Addition of NADPH to the assay system resulted in the conversion of 3-ketosphinganine to sphinganine. The apparent Km for Ser was approximately 1.8 mM. The enzyme exhibited a strong preference for palmitoyl-CoA, with optimal activity at a substrate concentration of 200 [mu]M. Pyridoxal 5[prime]-phosphate was required as a coenzyme. The pH optimum was 7.6, and the temperature optimum was 36 to 40[deg]C. Enzyme activity was greatest in the microsomal fraction obtained by differential centrifugation and was localized to the endoplasmic reticulum using marker enzymes. Two known mechanism-based inhibitors of the mammalian enzyme, L-cycloserine and [beta]-chloro-L-alanine, were effective inhibitors of enzyme activity in squash microsomes. Changes in enzyme activity with size (age) of squash fruit were observed. The results from this study suggest that the properties and catalytic mechanism of Ser palmitoyltransferase from squash are similar to those of the animal, fungal, and bacterial enzyme in most respects. The specific activity of the enzyme in squash microsomes ranged from 0.57 to 0.84 nmol min-1 mg-1 of protein, values 2- to 20-fold higher than those previously reported for preparations from animal tissues.

  14. Faithful Squashed Entanglement

    NASA Astrophysics Data System (ADS)

    Brandão, Fernando G. S. L.; Christandl, Matthias; Yard, Jon

    2011-09-01

    Squashed entanglement is a measure for the entanglement of bipartite quantum states. In this paper we present a lower bound for squashed entanglement in terms of a distance to the set of separable states. This implies that squashed entanglement is faithful, that is, it is strictly positive if and only if the state is entangled. We derive the lower bound on squashed entanglement from a lower bound on the quantum conditional mutual information which is used to define squashed entanglement. The quantum conditional mutual information corresponds to the amount by which strong subadditivity of von Neumann entropy fails to be saturated. Our result therefore sheds light on the structure of states that almost satisfy strong subadditivity with equality. The proof is based on two recent results from quantum information theory: the operational interpretation of the quantum mutual information as the optimal rate for state redistribution and the interpretation of the regularised relative entropy of entanglement as an error exponent in hypothesis testing. The distance to the set of separable states is measured in terms of the LOCC norm, an operationally motivated norm giving the optimal probability of distinguishing two bipartite quantum states, each shared by two parties, using any protocol formed by local quantum operations and classical communication (LOCC) between the parties. A similar result for the Frobenius or Euclidean norm follows as an immediate consequence. The result has two applications in complexity theory. The first application is a quasipolynomial-time algorithm solving the weak membership problem for the set of separable states in LOCC or Euclidean norm. The second application concerns quantum Merlin-Arthur games. Here we show that multiple provers are not more powerful than a single prover when the verifier is restricted to LOCC operations thereby providing a new characterisation of the complexity class QMA.

  15. 7 CFR 319.56-36 - Watermelon, squash, cucumber, and oriental melon from the Republic of Korea.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... QUARANTINE NOTICES Fruits and Vegetables § 319.56-36 Watermelon, squash, cucumber, and oriental melon from... McPhail traps (or a similar type with a protein bait that has been approved for the pests of concern) in...

  16. 7 CFR 319.56-36 - Watermelon, squash, cucumber, and oriental melon from the Republic of Korea.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... QUARANTINE NOTICES Fruits and Vegetables § 319.56-36 Watermelon, squash, cucumber, and oriental melon from... McPhail traps (or a similar type with a protein bait that has been approved for the pests of concern) in...

  17. Operational Audit Model for a Small Not-for-Profit Organization.

    DTIC Science & Technology

    1980-06-01

    is projected to lose only il0. Presently, they grow kiwi fruit, raspberries, olallieberries, asparagus, banana squash, acorn squash and zucchini...California 93940 0. LT Johnnie Johnson III 2 Procurement Division NTaval Supply Center Oakland, California 94617 7. Henry Flowers 2 Seventh Day

  18. The effects of transducer geometry on artifacts common to diagnostic bone imaging with conventional medical ultrasound.

    PubMed

    Mauldin, F William; Owen, Kevin; Tiouririne, Mohamed; Hossack, John A

    2012-06-01

    The portability, low cost, and non-ionizing radiation associated with medical ultrasound suggest that it has potential as a superior alternative to X-ray for bone imaging. However, when conventional ultrasound imaging systems are used for bone imaging, clinical acceptance is frequently limited by artifacts derived from reflections occurring away from the main axis of the acoustic beam. In this paper, the physical source of off-axis artifacts and the effect of transducer geometry on these artifacts are investigated in simulation and experimental studies. In agreement with diffraction theory, the sampled linear-array geometry possessed increased off-axis energy compared with single-element piston geometry, and therefore, exhibited greater levels of artifact signal. Simulation and experimental results demonstrated that the linear-array geometry exhibited increased artifact signal when the center frequency increased, when energy off-axis to the main acoustic beam (i.e., grating lobes) was perpendicularly incident upon off-axis surfaces, and when off-axis surfaces were specular rather than diffusive. The simulation model used to simulate specular reflections was validated experimentally and a correlation coefficient of 0.97 between experimental and simulated peak reflection contrast was observed. In ex vivo experiments, the piston geometry yielded 4 and 6.2 dB average contrast improvement compared with the linear array when imaging the spinous process and interlaminar space of an animal spine, respectively. This work indicates that off-axis reflections are a major source of ultrasound image artifacts, particularly in environments comprising specular reflecting (i.e., bone or bone-like) objects. Transducer geometries with reduced sensitivity to off-axis surface reflections, such as a piston transducer geometry, yield significant reductions in image artifact.

  19. A second gene for acyl-(acyl-carrier-protein): glycerol-3-phosphate acyltransferase in squash, Cucurbita moschata cv. Shirogikuza(*), codes for an oleate-selective isozyme: molecular cloning and protein purification studies.

    PubMed

    Nishida, I; Sugiura, M; Enju, A; Nakamura, M

    2000-12-01

    A new isogene for acyl-(acyl-carrier-protein):glycerol-3-phosphate acyltransferase (GPAT; EC 2.3.1.15) in squash has been cloned and the gene product was identified as oleate-selective GPAT. Using PCR primers that could hybridise with exons for a previously cloned squash GPAT, we obtained two PCR products of different size: one coded for a previously cloned squash GPAT corresponding to non-selective isoforms AT2 and AT3, and the other for a new isozyme, probably the oleate-selective isoform AT1. Full-length amino acid sequences of respective isozymes were deduced from the nucleotide sequences of genomic genes and cDNAs, which were cloned by a series of PCR-based methods. Thus, we designated the new gene CmATS1;1 and the other one CmATS1;2. Genome blot analysis revealed that the squash genome contained the two isogenes at non-allelic loci. AT1-active fractions were partially purified, and three polypeptide bands were identified as being AT1 polypeptides, which exhibited relative molecular masses of 39.5-40.5 kDa, pI values of 6.75-7.15, and oleate selectivity over palmitate. Partial amino-terminal sequences obtained from two of these bands verified that the new isogene codes for AT1 polypeptides.

  20. Potential organic herbicides for squash production: Pelargonic acid herbicides AXXE (registered trademark) and Scythe (registered trademark)

    USDA-ARS?s Scientific Manuscript database

    Organic squash (Cucurbita pepo L.) producers need appropriate herbicides that can effectively provide season- long weed control. Research was conducted in southeast Oklahoma (Atoka County, Lane, OK) to determine the impact of potential organic herbicides on weed control efficacy, crop injury, and y...

  1. First report of Squash vein yellowing virus in watermelon in Guatemala

    USDA-ARS?s Scientific Manuscript database

    In this study, we report the first detection of Squash vein yellowing virus (SqVYV)-induced watermelon vine decline in Central America. Symptoms including wilt and collapse of plants at harvest, and non-marketable fruits with internal rind necrosis were observed. This report provides an overview o...

  2. Weed control in yellow squash using sequential postdirected applications of pelargonic acid

    USDA-ARS?s Scientific Manuscript database

    Squash (Cucurbita pepo L.) producers would benefit from appropriate herbicides that can effectively provide season-long weed control. Research was conducted in southeast Oklahoma (Atoka County, Lane, OK) during 2010 and 2011 to determine the impact of a naturally derived herbicide on weed control ef...

  3. Construction of Experimental Polyvinyl Chloride (PVC) Roofing.

    DTIC Science & Technology

    1984-04-01

    in. War II vintage; squash and handball courts were (13-mm) fiberboard, to comply with Sarnafil re- added in 1966. The entire structure is of wood con...squash and handball courts had a gravel surface. pendently, avoiding difficulties of trying to handle Figure 23 shows the building arrangements. two

  4. 78 FR 45907 - United States Standards for Grades of Frozen Vegetables

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-07-30

    ... standards covered by these revisions are: frozen asparagus, frozen lima beans, frozen speckled butter beans..., lima beans, speckled butter beans, cooked squash, summer squash, etc., and not other vegetables. AMS... document. United States Standards for Grades of Frozen Lima Beans Update address for AMS. Change ``U.S...

  5. Crop domestication facilitated rapid geographic expansion of a specialist pollinator, the squash bee Peponapis pruinosa

    USDA-ARS?s Scientific Manuscript database

    Over the past 10,000 years, humans have facilitated rapid range expansions of animal, plants and microorganisms, often accompanying agriculture’s spread. Three squash species were early domesticates in the New World. Their spreading cultivation out of the Southwest across much of today’s USA has bee...

  6. Cell lines derived from the squash bug, anasa tristis (coreidae: hemiptera)

    USDA-ARS?s Scientific Manuscript database

    The squash bug, Anasa tristis, is a pest of cucurbits that exerts direct damage on crops and is a vector of plant pathogens. We established cell lines from this insect to serve as tools for basic biology, such as virology and immunology, as well as applied studies, such as insecticide development pr...

  7. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Shirokov, M. E.

    We analyse two possible definitions of the squashed entanglement in an infinite-dimensional bipartite system: direct translation of the finite-dimensional definition and its universal extension. It is shown that the both definitions produce the same lower semicontinuous entanglement measure possessing all basis properties of the squashed entanglement on the set of states having at least one finite marginal entropy. It is also shown that the second definition gives an adequate lower semicontinuous extension of this measure to all states of the infinite-dimensional bipartite system. A general condition relating continuity of the squashed entanglement to continuity of the quantum mutual information ismore » proved and its corollaries are considered. Continuity bound for the squashed entanglement under the energy constraint on one subsystem is obtained by using the tight continuity bound for quantum conditional mutual information (proved in the Appendix by using Winter’s technique). It is shown that the same continuity bound is valid for the entanglement of formation. As a result the asymptotic continuity of the both entanglement measures under the energy constraint on one subsystem is proved.« less

  8. Are squash players protecting their eyes?

    PubMed Central

    Eime, R; Finch, C; Sherman, C; Garnham, A

    2002-01-01

    Methods: A survey of 303 players (aged ≥18 years) was conducted at three squash venues in Melbourne, Australia over a three week period in June 2000 to obtain information about protective eyewear use. Results: Of 303 participants the response rate was 98.1%; 66.1% were males, with a mean age of 40.5 years. The majority (68.4%) had played squash for 10 years or more. Although 18.8% of players reported using protective eyewear, only 8.9% reported wearing approved eyewear. Both age group (p<0.05) and years of squash experience (p<0.01) were significantly associated with any eyewear use. The two main influences were personal experience of eye injuries (50.0%) and knowledge of eye injury risk (33.9%). A commonly reported barrier was restriction of vision (34.2%). Conclusion: These findings demonstrate a low prevalence of voluntary use of appropriate protective eyewear. Future prevention strategies incorporating education campaigns should focus on increasing players' knowledge of risks. The barriers to use and misconceptions about which types of eyewear is most protective need to be addressed as a priority. PMID:12226124

  9. Antioxidant activities of various fruits and vegetables produced in Taiwan.

    PubMed

    Huang, Hui-Yu; Chang, Chen-Kang; Tso, Tim K; Huang, Ju-Jen; Chang, Wei-Wei; Tsai, Ying-Chieh

    2004-08-01

    Fruits and vegetables have been known to contain a variety of antioxidant components. It has been suggested that antioxidants may protect biomolecules from oxidative damage and therefore be associated with reduced risks of cardiovascular disease and certain cancer. The antioxidant abilities of various parts of eight common fruits and vegetables produced in Taiwan were investigated, including tomato, guava, squash, tangerine, wax gourd, pineapple, chayote, and eggplant. Squash, wax gourd, tomato, and guava seeds showed the highest antioxidant activities in thiobarbituric acid assay. Wax guard and squash seeds showed the highest antioxidant activities in iodometric assay. At the level of 1 g fresh sample, low-density lipoprotein peroxidation was inhibited by at least 90% by tomato meat, guava meat, squash seed, wax gourd meat, core, and seed, and eggplant skin. The total phenolic content was significantly correlated with antioxidant activities measured by thiobarbituric acid (r=0.715, P<0.01) and iodometric (r=0.749, P<0.01) assays. The results of this study could be used for development of merchandise with potential health benefits from agricultural products.

  10. A comparison of heart rate responses in racquet games.

    PubMed Central

    Docherty, D.

    1982-01-01

    The present study investigated the heart rate response to playing tennis with special reference to the skill levels and ages of the participants. Data obtained in a similar manner during earlier studies of badminton and squash players were compared with that obtained during tennis. The number of rallies, mean rally time and actual playing time in 30 minutes of play was also compared for the different skill levels and sports. Results showed that playing tennis raised the players' heart rates to 68-70% of their predicted maximum heart rate (PMHR). Playing squash and badminton could raise heart rates to 80-85% of the players' PMHR which was significantly higher than the values obtained for tennis. The actual skill level of the participants within their chosen sport did not have a significant effect in predicting the physical demands of squash or tennis but was important in predicting the heart rate response of badminton players. The more skillful the badminton player the greater the cardiac response as a result of game play. Analysis of time spent in actual play revealed that tennis players were involved in play for only five of the thirty minutes of game play, compared to 15 and 10 min respectively for squash and badminton. Skill level within each sport was only a significant factor in predicting length of play for squash players in which the medium and highly skilled groups played significantly longer than those of a lower level of skill. Images p96-a PMID:7104564

  11. Fruit quality of seedless watermelon grafted onto squash rootstocks under different production systems.

    PubMed

    Liu, Qianru; Zhao, Xin; Brecht, Jeffrey K; Sims, Charles A; Sanchez, Tatiana; Dufault, Nicholas S

    2017-11-01

    The market demand for seedless watermelon has been continuously increasing because of consumer preference. Grafting is a useful tool to manage soilborne diseases in watermelon production, but the use of squash rootstocks may negatively affect watermelon fruit quality. Currently, most research has focused on seeded cultivars, while grafting effects on seedless watermelons remain largely unknown. This multi-season study was conducted to assess the effects of squash rootstocks, including both Cucurbita maxima × C. moschata and C. moschata cultivars, with intact or excised and regenerated roots, on fruit quality of seedless watermelon 'Melody' using both instrumental and sensory measurements under different production scenarios. The grafted watermelon plants were also challenged by field inoculation with Fusarium oxysporum f.sp. niveum. A combination of instrumental measurements and consumer sensory analyses suggested that fruit quality of the seedless watermelon 'Melody' was not impacted by the use of the squash rootstocks used in this study, which included soluble solids content, titratable acidity, pH and most fruit sensory properties. Watermelon flesh firmness was increased by grafting but the grafting effect on lycopene content was inconclusive. Root excision and regeneration did not influence the grafting effect, whereas the grafting effect on flesh firmness varied among the rootstocks under Fusarium inoculation. Overall, grafting with squash rootstocks did not reduce fruit quality attributes of 'Melody' but improved texture. Our results support incorporating grafting into integrated management programs for seedless watermelon production. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  12. Incidence and behavior of Salmonella and Escherichia coli on whole and sliced zucchini squash (Cucurbitapepo) fruit.

    PubMed

    Castro-Rosas, Javier; Santos López, Eva María; Gómez-Aldapa, Carlos Alberto; González Ramírez, Cesar Abelardo; Villagomez-Ibarra, José Roberto; Gordillo-Martínez, Alberto José; López, Angélica Villarruel; del Refugio Torres-Vitela, M

    2010-08-01

    The incidence of coliform bacteria (CB), thermotolerant coliforms (TC), Escherichia coli, and Salmonella was determined for zucchini squash fruit. In addition, the behavior of four serotypes of Salmonella and a cocktail of three E. coli strains on whole and sliced zucchini squash at 25+/-2 degrees C and 3 to 5 degrees C was tested. Squash fruit was collected in the markets of Pachuca city, Hidalgo State, Mexico. CB, TC, E. coli, and Salmonella were detected in 100, 70, 62, and 10% of the produce, respectively. The concentration ranged from 3.8 to 7.4 log CFU per sample for CB, and >3 to 1,100 most probable number per sample for TC and E. coli. On whole fruit stored at 25+/-2 degrees C or 3 to 5 degrees C, no growth was observed for any of the tested microorganisms or cocktails thereof. After 15 days at 25+/-2 degrees C, the tested Salmonella serotypes had decreased from an initial inoculum level of 7 log CFU to <1 log, and at 3 to 5 degrees C they decreased to approximately 2 log. Survival of E. coli was significantly greater than for the Salmonella strains at the same times and temperatures; after 15 days, at 25+/-2 degrees C E. coli cocktail strains had decreased to 3.4 log CFU per fruit and at 3 to 5 degrees C they decreased to 3.6 log CFU per fruit. Both the Salmonella serotypes and E. coli strains grew when inoculated onto sliced squash: after 24 h at 25+/-2 degrees C, both bacteria had grown to approximately 6.5 log CFU per slice. At 3 to 5 degrees C, the bacterial growth was inhibited. The squash may be an important factor contributing to the endemicity of Salmonella in Mexico.

  13. Manufacture and calibration of optical supersmooth roughness artifacts for intercomparisons

    NASA Astrophysics Data System (ADS)

    Ringel, Gabriele A.; Kratz, Frank; Schmitt, Dirk-Roger; Mangelsdorf, Juergen; Creuzet, Francois; Garratt, John D.

    1995-09-01

    Intercomparison roughness measurements have been carried out on supersmooth artifacts fabricated from BK7, fused silica, and Zerodur. The surface parameters were determined using the optical heterodyne profiler Z5500 (Zygo), a special prototype of the mechanical profiler Nanostep (Rank Taylor Hobson), and an Atomic Force Microscope (Park Scientific Instruments) with an improved acquisition technique. The intercomparison was performed after the range of collected spatial wavelengths for each instrument was adjusted using digital filtering techniques. It is demonstrated for different roughness ranges that the applied superpolishing techniques yield supersmooth artifacts which can be used for more intercomparisons. More than 100 samples were investigated. Criteria were developed to select artifacts from the sample stock.

  14. Tennis-Badminton-Squash Guide. June 1974-June 1976.

    ERIC Educational Resources Information Center

    Sherman, Patricia, Ed.; And Others

    This guide is a collection of essays by various authors on tennis, badminton, and squash. The document is divided into three sections, one for each sport. The topics covered include general teaching methods, methods to employ for teaching specific skills such as the lob or the backhand, the use of visual aids, conditioning drills, study questions,…

  15. Tennis-Badminton-Squash Guide with Official Rules. June 1972 - June 1974.

    ERIC Educational Resources Information Center

    Knight, Martha, Ed.; And Others

    Rules in tennis, badminton, and squash for girls and women from June 1972 - June 1974 are discussed. Standards in the sports are detailed along with the Division for Girls and Women's Sports (DGWS) statement of beliefs. Specific articles dealing with teaching techniques, officiating techniques, and rules for tennis and badminton are presented.…

  16. Influence of insecticides and reflective mulch on watermelon vine decline caused by squash vein yellowing virus (SqVYV)

    USDA-ARS?s Scientific Manuscript database

    Watermelon vine decline (WVD) caused by the whitefly-transmitted Squash vein yellowing virus (SqVYV) has been a major limiting factor in watermelon production in southwest and west-central Florida for the past several years. Symptoms of WVD typically manifest as sudden decline of vines a few weeks ...

  17. 76 FR 37055 - Notice of Request for Extension of Approval of an Information Collection; Importation of Baby...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-06-24

    ...] Notice of Request for Extension of Approval of an Information Collection; Importation of Baby Squash and Baby Courgettes From Zambia AGENCY: Animal and Plant Health Inspection Service, USDA. ACTION: Extension... importation of baby squash and baby courgettes from Zambia. DATES: We will consider all comments that we...

  18. Genetic relationships in Cucurbita pepo (pumpkin, squash, gourd) as viewed with high frequency oligonucleotide–targeting active gene (HFO–TAG) markers

    USDA-ARS?s Scientific Manuscript database

    Cucurbita pepo is a highly diverse, economically important member of the Cucurbitaceae. C. pepo encompasses hundreds of cultivars of pumpkins, squash, and gourds. Although C. pepo has been scrutinized with various types of DNA markers, the relationships among the cultivar-groups of C. pepo subsp. p...

  19. Native Bees Effectively Pollinate New World Cucurbita (C. pepo and C. maxima): An Internet Collaboration

    USDA-ARS?s Scientific Manuscript database

    Wild squash bees have all five traits ascribed to the most effective crop pollinators. They are abundant, competitive, efficient, faithful to a specific crop and fast. Shared pollinator surveys covering 2,700 ha of US squash and pumpkin (n = 50 farms) show strong parallels among Cucurbita’s bee gui...

  20. Development and evaluation of ELISA and qRT-PCR for identification of Squash vein yellowing virus in cucurbits

    USDA-ARS?s Scientific Manuscript database

    Enzyme linked-immunosorbent assay (ELISA) and quantitative reverse transcription-PCR (qRT-PCR) assays were developed for identification of Squash vein yellowing virus (SqVYV), the cause of viral watermelon vine decline. Both assays were capable of detecting SqVYV in a wide range of cucurbit hosts. ...

  1. Instrumental Techniques in Archeological Research

    DTIC Science & Technology

    1988-09-01

    and instruments borrowed from the fields of chemistry , physics, geology, metallurgy, and ceramic engineering yield quantitative data on archeological...artifacts. Early analyses relied primarily on wet chemistry techniques in which samples of artifacts were dissolved into liquid solutions, destroying...other organic and inorganic materials. Advantages and disadvantages are dis- cussed. Each technique is presented with attention to appropriate materials

  2. Identification and reduction of image artifacts in non-contrast-enhanced velocity-selective peripheral angiography at 3T.

    PubMed

    Shin, Taehoon; Qin, Qin; Park, Jang-Yeon; Crawford, Robert S; Rajagopalan, Sanjay

    2016-08-01

    To identify and reduce image artifacts in non-contrast-enhanced velocity-selective (VS) magnetization-prepared peripheral MR angiography (MRA) at 3T. To avoid signal loss in the arteries, double and quadruple refocused VS excitation pulse sequences were designed that were robust to a wide range of B0 and B1 offset. To suppress stripe artifact and background signal variation, we successively applied two VS preparations with excitation profiles shifted by half the period of the stripes. VS-MRA using single, double, and quadruple refocused VS preparations was tested in healthy subjects and a patient. In the regions of large B0 and B1 offsets, arterial signal loss was yielded by single refocused VS preparation, but was avoided with double or quadruple refocused preparations. Compared with single VS preparation, the two consecutive preparations with shifted excitation profiles substantially reduced the stripe artifact and background signal variation, as demonstrated by increased mean and decreased standard deviation of relative contrast-to-noise ratio. The proposed VS-MRA identified multilevel disease in the femoral arteries of the patient, as validated by digital subtraction angiography. Two multiple refocused VS magnetization preparations with shifted excitation profiles yield artifact-free peripheral angiograms at 3T. Magn Reson Med 76:466-477, 2016. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  3. A duplex real-time RT-PCR system with an internal control offers sensitive and reliable broad spectrum detection of Squash mosaic virus variants

    USDA-ARS?s Scientific Manuscript database

    Squash mosaic virus (SqMV) is a seed-borne virus, belonging to the genus Commovirus in the subfamily Comoviridae of family Secoviridae. SqMV has a bipartite single-stranded ribonucleic acid (RNA) genome (RNA1 and RNA2) encapsidated separately with two capsid proteins. Two serotypes (genotypes) of ...

  4. Ovipositional preferences of two squash bug species, Anasa tristis, and Anasa armigera (Heteroptera: Coreidae), for different cultivars and species of Cucurbitaceae

    USDA-ARS?s Scientific Manuscript database

    The ovipositional preferences of two squash bug species, Anasa tristis (DeGeer) and Anasa armigera Say, were evaluated in paired choice tests of different species and cultivars of plants in the family Cucurbitaceae. Females of A. tristis preferred to oviposit on the cultivar from which they were rea...

  5. First Complete Squash leaf curl China virus Genomic Segment DNA-A Sequence from East Timor

    PubMed Central

    Maina, Solomon; Edwards, Owain R.; de Almeida, Luis; Ximenes, Abel

    2017-01-01

    ABSTRACT We present here the first complete Squash leaf curl China virus (SLCCV) genomic segment DNA-A sequence from East Timor. It was isolated from a pumpkin plant. When compared with 15 complete SLCCV DNA-A genome sequences from other world regions, it most resembled the Malaysian isolate MC1 sequence. PMID:28619789

  6. Squashing the Millennium Bug: A Year 2000 Compliance Guide for Elementary/Secondary Schools and School Districts.

    ERIC Educational Resources Information Center

    Root, Mark; Carlson, Robert; Dexter, David; Karinch, Samantha; Kaplan, Heather

    This guide was developed to assist the nation's elementary and secondary schools and school districts address their Year 2000 (Y2K) problem. The guide is divided into three sections: Squashing the Millennium Bug Step-by-Step; Remediating Specific Types of Systems; and Appendix. The first chapter presents the following steps for tackling the Year…

  7. Three Sisters: Lessons of Traditional Story Honored in Assessment and Accreditation

    ERIC Educational Resources Information Center

    Chenault, Venida S.

    2008-01-01

    The three sisters story is shared across many tribes. It explains the practice of planting corn, beans, and squash together. The corn stalks provide support for the bean vines; the beans provide nitrogen for the corn; and the squash prevents weed growth between the mounds. Such stories explain not only the science of agricultural methods in tribal…

  8. Squash cytology findings of subependymomas: A report of three cases and differential diagnosis.

    PubMed

    Tokumitsu, Takako; Sato, Yuichiro; Fukushima, Tsuyoshi; Takeshima, Hideo; Sato, Shinya; Asada, Yujiro

    2018-03-01

    Subependymomas are slowly growing glial tumors, corresponding to WHO grade I. Few descriptions of the cytologic features of this neoplasm are available. This study describes the cytologic features of three subependymomas, as well as their differential diagnosis based on cytology. Three men, aged 52, 56, and 63 years, presented with headache. Magnetic resonance imaging revealed a nodular intraventricular mass in all three patients. Intraoperative squash cytology specimens from the three intraventricular tumors showed nodular clusters with microcystic changes. Nuclei were round to oval in shape, but showed no evidence of severe nuclear atypia or mitoses. Histological examination showed features of subependymoma. Squash cytology findings, including nodular clusters, mild cellular atypia, microcystic changes, and mucoid material, are useful in the rapid intraoperative diagnosis of subependymoma. © 2017 Wiley Periodicals, Inc.

  9. Improved Image Quality in Head and Neck CT Using a 3D Iterative Approach to Reduce Metal Artifact.

    PubMed

    Wuest, W; May, M S; Brand, M; Bayerl, N; Krauss, A; Uder, M; Lell, M

    2015-10-01

    Metal artifacts from dental fillings and other devices degrade image quality and may compromise the detection and evaluation of lesions in the oral cavity and oropharynx by CT. The aim of this study was to evaluate the effect of iterative metal artifact reduction on CT of the oral cavity and oropharynx. Data from 50 consecutive patients with metal artifacts from dental hardware were reconstructed with standard filtered back-projection, linear interpolation metal artifact reduction (LIMAR), and iterative metal artifact reduction. The image quality of sections that contained metal was analyzed for the severity of artifacts and diagnostic value. A total of 455 sections (mean ± standard deviation, 9.1 ± 4.1 sections per patient) contained metal and were evaluated with each reconstruction method. Sections without metal were not affected by the algorithms and demonstrated image quality identical to each other. Of these sections, 38% were considered nondiagnostic with filtered back-projection, 31% with LIMAR, and only 7% with iterative metal artifact reduction. Thirty-three percent of the sections had poor image quality with filtered back-projection, 46% with LIMAR, and 10% with iterative metal artifact reduction. Thirteen percent of the sections with filtered back-projection, 17% with LIMAR, and 22% with iterative metal artifact reduction were of moderate image quality, 16% of the sections with filtered back-projection, 5% with LIMAR, and 30% with iterative metal artifact reduction were of good image quality, and 1% of the sections with LIMAR and 31% with iterative metal artifact reduction were of excellent image quality. Iterative metal artifact reduction yields the highest image quality in comparison with filtered back-projection and linear interpolation metal artifact reduction in patients with metal hardware in the head and neck area. © 2015 by American Journal of Neuroradiology.

  10. 7 CFR 319.56-48 - Conditions governing the entry of baby squash and baby courgettes from Zambia.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... Fruits and Vegetables § 319.56-48 Conditions governing the entry of baby squash and baby courgettes from... fly traps with an approved protein bait must be placed inside the greenhouses at a density of four... fly traps with an approved protein bait must be placed inside a buffer area 500 meters wide around the...

  11. 7 CFR 319.56-48 - Conditions governing the entry of baby squash and baby courgettes from Zambia.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... Fruits and Vegetables § 319.56-48 Conditions governing the entry of baby squash and baby courgettes from... fly traps with an approved protein bait must be placed inside the greenhouses at a density of four... fly traps with an approved protein bait must be placed inside a buffer area 500 meters wide around the...

  12. Hawking radiation in a rotating Kaluza-Klein black hole with squashed horizons

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Chen Songbai; Wang Bin; Su Rukeng

    2008-01-15

    We explore the signature of the extra dimension in the Hawking radiation in a rotating Kaluza-Klein black hole with squashed horizons. Comparing with the spherical case, we find that the rotating parameter brings richer physics. We obtain the appropriate size of the extra dimension which can enhance the Hawking radiation and may open a window to detect the extra dimensions.

  13. Translocation of heavy metals from soils into floral organs and rewards of Cucurbita pepo: Implications for plant reproductive fitness.

    PubMed

    Xun, Erna; Zhang, Yanwen; Zhao, Jimin; Guo, Jixun

    2017-11-01

    Metals and metalloids in soil could be transferred into reproductive organs and floral rewards of hyperaccumulator plants and influence their reproductive success, yet little is known whether non-hyperaccumulator plants can translocate heavy metals from soil into their floral organs and rewards (i.e., nectar and pollen) and, if so, whether plant reproduction will be affected. In our studies, summer squash (Cucurbita pepo L. cv. Golden Apple) was exposed to heavy-metal treatments during bud stage to investigate the translocation of soil-supplemented zinc, copper, nickel and lead into its floral organs (pistil, anther and nectary) and rewards (nectar and pollen) as well as floral metal accumulation effects on its reproduction. The results showed that metals taken up by squash did translocate into its floral organs and rewards, although metal accumulation varied depending on different metal types and concentrations as well as floral organ/reward types. Mean foraging time of honey bees to each male and female flower of squash grown in metal-supplemented soils was shorter relative to that of plants grown in control soils, although the visitation rate of honeybees to both male and female flowers was not affected by metal treatments. Pollen viability, pollen removal and deposition as well as mean mass per seed produced by metal-treated squash that received pollen from plants grown in control soils decreased with elevated soil-supplemented metal concentrations. The fact that squash could translocate soil-supplemented heavy metals into floral organs and rewards indicated possible reproductive consequences caused either directly (i.e., decreasing pollen viability or seed mass) or indirectly (i.e., affecting pollinators' visitation behavior to flowers) to plant fitness. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. A new method for assessing squash tactics using 15 court areas for ball locations.

    PubMed

    Vučković, Goran; James, Nic; Hughes, Mike; Murray, Stafford; Milanović, Zoran; Perš, Janez; Sporiš, Goran

    2014-04-01

    Tactics in squash have typically been assessed using the frequency of different shot types played at different locations on the court either without reference to other relevant information or on the basis of the preceding shot. This paper presents a new squash specific method for categorizing court locations in which the ball was played, a novel techniques for assessing the reliability of this method and presents typical shots responses in these new areas controlled for preceding shot as well as the time between shots and the handedness of the players. Twelve games were viewed using the SAGIT/Squash software and 2907 shots viewed a second time from a video image taken from behind the court with an overall agreement of 88.90% for the court location data and 99.52% for shot type. 3192 shots from 9 matches from the 2003 World Team Championships were analyzed in SAGIT/Squash. In the court areas analyzed between 2 and 7 shot responses were predominant suggesting tactical patterns were evident. This was supported by differences evident between shot responses played from the two back corners where the backhand side was characterized by a predominance of straight drives whereas straight and crosscourt drives were played on the forehand side. These results tended to confirm that tactics i.e., consistent shot types, are played although these are only apparent when factors that determine shot selection are accounted for. This paper has controlled for some of these factors but others need to be considered e.g., if individual player profiles are to be ascertained. Copyright © 2014 Elsevier B.V. All rights reserved.

  15. Cross-sectional survey of indicator and pathogenic bacteria on vegetables sold from Asian vendors at farmers' markets in northern California.

    PubMed

    Pan, Fengguang; Li, Xunde; Carabez, Jennifer; Ragosta, Guy; Fernandez, Kristine L; Wang, Elaine; Thiptara, Anyarat; Antaki, Elizabeth; Atwill, Edward R

    2015-03-01

    A cross-sectional survey was conducted during summer 2013 to determine the occurrence of Escherichia coli, fecal coliforms (FCs), E. coli O157:H7, and Salmonella on raw vegetable commodities common to Asian cuisine from 21 vendors or farmers at six farmers' markets in northern California. Based on 242 samples from six commodities (basil, yardlong beans, bitter squash, okra, squash stems and leaves, cilantro), 100% of samples had detectable FCs and 20% had detectable E. coli. The mean concentrations were 0.67 log CFU/g and 1.26 log CFU per bundle for E. coli and 4.00 log CFU/g and 6.26 log CFU per bundle for FCs. Vegetables irrigated with ground versus surface water contained lower concentrations of FCs, but this difference was not observed for E. coli. Yardlong beans, bitter squash, and okra had lower levels of FCs compared with basil, cilantro, and squash stems and leaves. Sixteen (6.6%) samples had detectable levels of Salmonella serovars (Newport, Enteritidis, Agona, and Worthington), with the majority of positives found in cilantro and squash stems and leaves. There was a twofold higher probability of Salmonella contamination in samples from growers or vendors who stated that they used organic farming practices compared with samples from those using conventional farming practices. Lastly, the concentrations of FC and E. coli bacteria were significantly associated with Salmonella contamination: for each additional 100 CFU/g or bundle, the probability of Salmonella contamination increased by ∼15 and ∼30%, respectively. None of the samples had detectable E. coli O157:H7.

  16. Dual-detector X-ray fluorescence imaging of ancient artifacts with surface relief

    PubMed Central

    Smilgies, Detlef-M.; Powers, Judson A.; Bilderback, Donald H.; Thorne, Robert E.

    2012-01-01

    Interpretation of X-ray fluorescence images of archeological artifacts is complicated by the presence of surface relief and roughness. Using two symmetrically arranged fluorescence detectors in a back-reflection geometry, the proper X-ray fluorescence yield can be distinguished from intensity variations caused by surface topography. This technique has been applied to the study of Roman inscriptions on marble. PMID:22713888

  17. Integrating Archaeological Modeling in DoD Cultural Resource Compliance

    DTIC Science & Technology

    2012-10-01

    that Eglin-area populations shared behaviors and values with other regions. Evidence for maize horticulture appears for the first time during the...ceramic containers, the introduction of maize agriculture, the practice of pipe smoking, the existence of more substantial sedentary villages with storage...excavations undertaken during survey to locate buried artifacts and features. Phase 2 is the phase after initial survey when STPs that yielded artifacts

  18. Comparing phase-sensitive and phase-insensitive echolocation target images using a monaural audible sonar.

    PubMed

    Kuc, Roman

    2018-04-01

    This paper describes phase-sensitive and phase-insensitive processing of monaural echolocation waveforms to generate target maps. Composite waveforms containing both the emission and echoes are processed to estimate the target impulse response using an audible sonar. Phase-sensitive processing yields the composite signal envelope, while phase-insensitive processing that starts with the composite waveform power spectrum yields the envelope of the autocorrelation function. Analysis and experimental verification show that multiple echoes form an autocorrelation function that produces near-range phantom-reflector artifacts. These artifacts interfere with true target echoes when the first true echo occurs at a time that is less than the total duration of the target echoes. Initial comparison of phase-sensitive and phase-insensitive maps indicates that both display important target features, indicating that phase is not vital. A closer comparison illustrates the improved resolution of phase-sensitive processing, the near-range phantom-reflectors produced by phase-insensitive processing, and echo interference and multiple reflection artifacts that were independent of the processing.

  19. Reduction of metal artifacts in x-ray CT images using a convolutional neural network

    NASA Astrophysics Data System (ADS)

    Zhang, Yanbo; Chu, Ying; Yu, Hengyong

    2017-09-01

    Patients usually contain various metallic implants (e.g. dental fillings, prostheses), causing severe artifacts in the x-ray CT images. Although a large number of metal artifact reduction (MAR) methods have been proposed in the past four decades, MAR is still one of the major problems in clinical x-ray CT. In this work, we develop a convolutional neural network (CNN) based MAR framework, which combines the information from the original and corrected images to suppress artifacts. Before the MAR, we generate a group of data and train a CNN. First, we numerically simulate various metal artifacts cases and build a dataset, which includes metal-free images (used as references), metal-inserted images and various MAR methods corrected images. Then, ten thousands patches are extracted from the databased to train the metal artifact reduction CNN. In the MAR stage, the original image and two corrected images are stacked as a three-channel input image for CNN, and a CNN image is generated with less artifacts. The water equivalent regions in the CNN image are set to a uniform value to yield a CNN prior, whose forward projections are used to replace the metal affected projections, followed by the FBP reconstruction. Experimental results demonstrate the superior metal artifact reduction capability of the proposed method to its competitors.

  20. Automatic detection and classification of artifacts in single-channel EEG.

    PubMed

    Olund, Thomas; Duun-Henriksen, Jonas; Kjaer, Troels W; Sorensen, Helge B D

    2014-01-01

    Ambulatory EEG monitoring can provide medical doctors important diagnostic information, without hospitalizing the patient. These recordings are however more exposed to noise and artifacts compared to clinically recorded EEG. An automatic artifact detection and classification algorithm for single-channel EEG is proposed to help identifying these artifacts. Features are extracted from the EEG signal and wavelet subbands. Subsequently a selection algorithm is applied in order to identify the best discriminating features. A non-linear support vector machine is used to discriminate among different artifact classes using the selected features. Single-channel (Fp1-F7) EEG recordings are obtained from experiments with 12 healthy subjects performing artifact inducing movements. The dataset was used to construct and validate the model. Both subject-specific and generic implementation, are investigated. The detection algorithm yield an average sensitivity and specificity above 95% for both the subject-specific and generic models. The classification algorithm show a mean accuracy of 78 and 64% for the subject-specific and generic model, respectively. The classification model was additionally validated on a reference dataset with similar results.

  1. Dual energy CT: How well can pseudo-monochromatic imaging reduce metal artifacts?

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Kuchenbecker, Stefan, E-mail: stefan.kuchenbecker@dkfz.de; Faby, Sebastian; Sawall, Stefan

    2015-02-15

    Purpose: Dual Energy CT (DECT) provides so-called monoenergetic images based on a linear combination of the original polychromatic images. At certain patient-specific energy levels, corresponding to certain patient- and slice-dependent linear combination weights, e.g., E = 160 keV corresponds to α = 1.57, a significant reduction of metal artifacts may be observed. The authors aimed at analyzing the method for its artifact reduction capabilities to identify its limitations. The results are compared with raw data-based processing. Methods: Clinical DECT uses a simplified version of monochromatic imaging by linearly combining the low and the high kV images and by assigning an energymore » to that linear combination. Those pseudo-monochromatic images can be used by radiologists to obtain images with reduced metal artifacts. The authors analyzed the underlying physics and carried out a series expansion of the polychromatic attenuation equations. The resulting nonlinear terms are responsible for the artifacts, but they are not linearly related between the low and the high kV scan: A linear combination of both images cannot eliminate the nonlinearities, it can only reduce their impact. Scattered radiation yields additional noncanceling nonlinearities. This method is compared to raw data-based artifact correction methods. To quantify the artifact reduction potential of pseudo-monochromatic images, they simulated the FORBILD abdomen phantom with metal implants, and they assessed patient data sets of a clinical dual source CT system (100, 140 kV Sn) containing artifacts induced by a highly concentrated contrast agent bolus and by metal. In each case, they manually selected an optimal α and compared it to a raw data-based material decomposition in case of simulation, to raw data-based material decomposition of inconsistent rays in case of the patient data set containing contrast agent, and to the frequency split normalized metal artifact reduction in case of the metal implant. For each case, the contrast-to-noise ratio (CNR) was assessed. Results: In the simulation, the pseudo-monochromatic images yielded acceptable artifact reduction results. However, the CNR in the artifact-reduced images was more than 60% lower than in the original polychromatic images. In contrast, the raw data-based material decomposition did not significantly reduce the CNR in the virtual monochromatic images. Regarding the patient data with beam hardening artifacts and with metal artifacts from small implants the pseudo-monochromatic method was able to reduce the artifacts, again with the downside of a significant CNR reduction. More intense metal artifacts, e.g., as those caused by an artificial hip joint, could not be suppressed. Conclusions: Pseudo-monochromatic imaging is able to reduce beam hardening, scatter, and metal artifacts in some cases but it cannot remove them. In all cases, the CNR is significantly reduced, thereby rendering the method questionable, unless special post processing algorithms are implemented to restore the high CNR from the original images (e.g., by using a frequency split technique). Raw data-based dual energy decomposition methods should be preferred, in particular, because the CNR penalty is almost negligible.« less

  2. Correction of data truncation artifacts in differential phase contrast (DPC) tomosynthesis imaging

    NASA Astrophysics Data System (ADS)

    Garrett, John; Ge, Yongshuai; Li, Ke; Chen, Guang-Hong

    2015-10-01

    The use of grating based Talbot-Lau interferometry permits the acquisition of differential phase contrast (DPC) imaging with a conventional medical x-ray source and detector. However, due to the limited area of the gratings, limited area of the detector, or both, data truncation image artifacts are often observed in tomographic DPC acquisitions and reconstructions, such as tomosynthesis (limited-angle tomography). When data are truncated in the conventional x-ray absorption tomosynthesis imaging, a variety of methods have been developed to mitigate the truncation artifacts. However, the same strategies used to mitigate absorption truncation artifacts do not yield satisfactory reconstruction results in DPC tomosynthesis reconstruction. In this work, several new methods have been proposed to mitigate data truncation artifacts in a DPC tomosynthesis system. The proposed methods have been validated using experimental data of a mammography accreditation phantom, a bovine udder, as well as several human cadaver breast specimens using a bench-top DPC imaging system at our facility.

  3. Effect of Crotalaria juncea Amendment on Squash Infected with Meloidogyne incognita.

    PubMed

    Wang, K-H; McSorley, R; Gallaher, R N

    2004-09-01

    Two greenhouse experiments were conducted to examine the effect of Crotalaria juncea amendment on Meloidogyne incognita population levels and growth of yellow squash (Cucurbita pepo). In the first experiment, four soils with a long history of receiving yard waste compost (YWC+), no-yard-waste compost (YWC-), conventional tillage, or no-tillage treatments were used; in the second experiment, only one recently cultivated soil was used. Half of the amount of each soil received air-dried residues of C. juncea as amendment before planting squash, whereas the other half did not. Crotalaria juncea amendment increased squash shoot and root weights in all soils tested, except in YWC+ soil where the organic matter content was high without the amendment. The amendment suppressed the numbers of M. incognita if the inoculum level was low, and when the soil contained relatively abundant nematode-antagonistic fungi. Microwaved soil resulted in greater numbers of M. incognita and free-living nematodes than frozen or untreated soil, indicating nematode-antagonistic microorganisms played a role in nematode suppression. The effects of C. juncea amendment on nutrient cycling were complex. Amendment with C. juncea increased the abundance of free-living nematodes and Harposporium anguillulae, a fungus antagonistic to them in the second experiment but not in the first experiment. Soil histories, especially long-term yard waste compost treatments that increased soil organic matter, can affect the performance of C. juncea amendment.

  4. Effect of Crotalaria juncea Amendment on Squash Infected with Meloidogyne incognita

    PubMed Central

    Wang, K.-H.; McSorley, R.; Gallaher, R. N.

    2004-01-01

    Two greenhouse experiments were conducted to examine the effect of Crotalaria juncea amendment on Meloidogyne incognita population levels and growth of yellow squash (Cucurbita pepo). In the first experiment, four soils with a long history of receiving yard waste compost (YWC+), no-yard-waste compost (YWC-), conventional tillage, or no-tillage treatments were used; in the second experiment, only one recently cultivated soil was used. Half of the amount of each soil received air-dried residues of C. juncea as amendment before planting squash, whereas the other half did not. Crotalaria juncea amendment increased squash shoot and root weights in all soils tested, except in YWC+ soil where the organic matter content was high without the amendment. The amendment suppressed the numbers of M. incognita if the inoculum level was low, and when the soil contained relatively abundant nematode-antagonistic fungi. Microwaved soil resulted in greater numbers of M. incognita and free-living nematodes than frozen or untreated soil, indicating nematode-antagonistic microorganisms played a role in nematode suppression. The effects of C. juncea amendment on nutrient cycling were complex. Amendment with C. juncea increased the abundance of free-living nematodes and Harposporium anguillulae, a fungus antagonistic to them in the second experiment but not in the first experiment. Soil histories, especially long-term yard waste compost treatments that increased soil organic matter, can affect the performance of C. juncea amendment. PMID:19262819

  5. Measuring and Modeling Solute Transport in the Rootzone: Protecting the Receiving Water Environments of the Coral Atolls of Tonga

    NASA Astrophysics Data System (ADS)

    Clothier, B. E.; van der Velde, M.; Green, S. R.; Gee, G. W.; Manu, V.; Menoniti, V.; Vanclooster, M.

    2005-05-01

    Intensification of agriculture on the raised coral atolls of the Tongan archipelago, notably through squash-pumpkin production, has lead to increased use of agrichemicals. Agrichemicals, both fertilisers and pesticides, pose a risk to these fragile environments. Sustainable land-management practices are needed for small-island developing states. On Tongatapu, solutes leaving the rootzone of the squash can rapidly find their way to the underlying freshwater lenses. These lenses are hydraulically linked to the internal lagoon, and the fringing reefs. We have used buried, non-suction fluxmeters to monitor both the quantity and quality of drainage leaving the rootzone of squash. Fertiliser is traditionally applied at planting. During establishment of the squash in 2003, some 350 mm of rain fell, with 70 % of this leaving the rootzone of this permeable soil as drainage. The concentration of nitrate-N in the drainage water was measured at around 50 mg-N/L. All of the initial fertiliser dressing had been lost, along with N mineralised from the plowed-in grass. Pesticides are needed in humid tropical environments to control weeds, pests and diseases. These chemicals can leach though the rootzone to contaminate receiving waters. We modeled the transport and fate of the presticides used in squash production, and we developed a Decision Support Tool (DST). Our DST can be used to select the best pesticides for local conditions, to tailor practices for minimising leaching losses below the rootzone, and to avoid the build-up of residues in the soil. This project, funded by the European Union and NZAID, took a multi-disciplinary approach through measurement and modeling protocols. Our DST enabled us to engage the wider community and stakeholders. There has been increased awareness of the impacts and risks associated with productive land management in the fragile hydrological environments of this small-island developing state.

  6. The Potential Influence of Bumble Bee Visitation on Foraging Behaviors and Assemblages of Honey Bees on Squash Flowers in Highland Agricultural Ecosystems

    PubMed Central

    Xie, Zhenghua; Pan, Dongdong; Teichroew, Jonathan; An, Jiandong

    2016-01-01

    Bee species interactions can benefit plant pollination through synergistic effects and complementary effects, or can be of detriment to plant pollination through competition effects by reducing visitation by effective pollinators. Since specific bee interactions influence the foraging performance of bees on flowers, they also act as drivers to regulate the assemblage of flower visitors. We selected squash (Cucurbita pepo L.) and its pollinators as a model system to study the foraging response of honey bees to the occurrence of bumble bees at two types of sites surrounded by a high amount of natural habitats (≥ 58% of land cover) and a low amount of natural habitats (≤ 12% of land cover) in a highland agricultural ecosystem in China. At the individual level, we measured the elapsed time from the departure of prior pollinator(s) to the arrival of another pollinator, the selection of honey bees for flowers occupied by bumble bees, and the length of time used by honey bees to explore floral resources at the two types of sites. At the community level, we explored the effect of bumble bee visitation on the distribution patterns of honey bees on squash flowers. Conclusively, bumble bee visitation caused an increase in elapsed time before flowers were visited again by a honey bee, a behavioral avoidance by a newly-arriving honey bee to select flowers occupied by bumble bees, and a shortened length of time the honey bee takes to examine and collect floral resources. The number of overall bumble bees on squash flowers was the most important factor explaining the difference in the distribution patterns of honey bees at the community level. Furthermore, decline in the number of overall bumble bees on the squash flowers resulted in an increase in the number of overall honey bees. Therefore, our study suggests that bee interactions provide an opportunity to enhance the resilience of ecosystem pollination services against the decline in pollinator diversity. PMID:26765140

  7. The Potential Influence of Bumble Bee Visitation on Foraging Behaviors and Assemblages of Honey Bees on Squash Flowers in Highland Agricultural Ecosystems.

    PubMed

    Xie, Zhenghua; Pan, Dongdong; Teichroew, Jonathan; An, Jiandong

    2016-01-01

    Bee species interactions can benefit plant pollination through synergistic effects and complementary effects, or can be of detriment to plant pollination through competition effects by reducing visitation by effective pollinators. Since specific bee interactions influence the foraging performance of bees on flowers, they also act as drivers to regulate the assemblage of flower visitors. We selected squash (Cucurbita pepo L.) and its pollinators as a model system to study the foraging response of honey bees to the occurrence of bumble bees at two types of sites surrounded by a high amount of natural habitats (≥ 58% of land cover) and a low amount of natural habitats (≤ 12% of land cover) in a highland agricultural ecosystem in China. At the individual level, we measured the elapsed time from the departure of prior pollinator(s) to the arrival of another pollinator, the selection of honey bees for flowers occupied by bumble bees, and the length of time used by honey bees to explore floral resources at the two types of sites. At the community level, we explored the effect of bumble bee visitation on the distribution patterns of honey bees on squash flowers. Conclusively, bumble bee visitation caused an increase in elapsed time before flowers were visited again by a honey bee, a behavioral avoidance by a newly-arriving honey bee to select flowers occupied by bumble bees, and a shortened length of time the honey bee takes to examine and collect floral resources. The number of overall bumble bees on squash flowers was the most important factor explaining the difference in the distribution patterns of honey bees at the community level. Furthermore, decline in the number of overall bumble bees on the squash flowers resulted in an increase in the number of overall honey bees. Therefore, our study suggests that bee interactions provide an opportunity to enhance the resilience of ecosystem pollination services against the decline in pollinator diversity.

  8. Comparison of motion correction techniques applied to functional near-infrared spectroscopy data from children

    NASA Astrophysics Data System (ADS)

    Hu, Xiao-Su; Arredondo, Maria M.; Gomba, Megan; Confer, Nicole; DaSilva, Alexandre F.; Johnson, Timothy D.; Shalinsky, Mark; Kovelman, Ioulia

    2015-12-01

    Motion artifacts are the most significant sources of noise in the context of pediatric brain imaging designs and data analyses, especially in applications of functional near-infrared spectroscopy (fNIRS), in which it can completely affect the quality of the data acquired. Different methods have been developed to correct motion artifacts in fNIRS data, but the relative effectiveness of these methods for data from child and infant subjects (which is often found to be significantly noisier than adult data) remains largely unexplored. The issue is further complicated by the heterogeneity of fNIRS data artifacts. We compared the efficacy of the six most prevalent motion artifact correction techniques with fNIRS data acquired from children participating in a language acquisition task, including wavelet, spline interpolation, principal component analysis, moving average (MA), correlation-based signal improvement, and combination of wavelet and MA. The evaluation of five predefined metrics suggests that the MA and wavelet methods yield the best outcomes. These findings elucidate the varied nature of fNIRS data artifacts and the efficacy of artifact correction methods with pediatric populations, as well as help inform both the theory and practice of optical brain imaging analysis.

  9. Fourier removal of stripe artifacts in IRAS images

    NASA Technical Reports Server (NTRS)

    Van Buren, Dave

    1987-01-01

    By working in the Fourier plane, approximate removal of stripe artifacts in IRAS images can be effected. The image of interest is smoothed and subtracted from the original, giving the high-spatial-frequency part. This 'filtered' image is then clipped to remove point sources and then Fourier transformed. Subtracting the Fourier components contributing to the stripes in this image from the Fourier transform of the original and transforming back to the image plane yields substantial removal of the stripes.

  10. Synthesis, salvage, and catabolism of uridine nucleotides in boron-deficient squash roots.

    PubMed

    Lovatt, C J; Albert, L S; Tremblay, G C

    1981-12-01

    Previous work has provided evidence that plants may require boron to maintain adequate levels of pyrimidine nucleotides, suggesting that the state of boron deficiency may actually be one of pyrimidine starvation. Since the availability of pyrimidine nucleotides is influenced by their rates of synthesis, salvage, and catabolism, we compared these activities in the terminal 3 centimeters of roots excised from boron-deficient and -sufficient squash plants (Cucurbita pepo L.). Transferring 5-day-old squash plants to a boron-deficient nutrient solution resulted in cessation of root elongation within 18 hours. However, withholding boron for up to 30 hours did not result in either impaired de novo pyrimidine biosynthesis or a change in the sensitivity of the de novo pathway to regulation by end product inhibition. Boron deprivation had no significant effect on pyrimidine salvage or catabolism. These results provide evidence that boron-deficient plants are not starved for uridine nucleotides collectively. Whether a particular pyrimidine nucleotide or derivative is limiting during boron deprivation remains to be examined.

  11. Racquet sports--patterns of injury presenting to a sports injury clinic.

    PubMed Central

    Chard, M D; Lachmann, S M

    1987-01-01

    In an 8-year retrospective study, 631 injuries due to the racquet sports of squash (59%), tennis (21%) and badminton (20%) were seen in a sports injury clinic, males predominating (58 to 66%). The proportion of squash injuries was higher than expected and probably relates to higher physical stress and risk of contact in this sport. Also they occurred mainly in persons over 25 years (59%) i.e. the reverse for sport in general. Acute traumatic injuries were seen especially in squash players, a majority affecting the knee, lumbar region, muscles and ankle. Tennis injuries differed most with lateral epicondylitis, patello-femoral pain and lumbar disc prolapse being relatively common. The badminton injury pattern overlapped the others. Lower limb injuries predominated in all three. Detailed assessment of 106 cases showed many to be new, infrequent, social players. Poor warm-up was a common factor in new and established players. The importance of these findings is discussed. PMID:3435816

  12. Squashed Toric Sigma Models and Mock Modular Forms

    NASA Astrophysics Data System (ADS)

    Gupta, Rajesh Kumar; Murthy, Sameer

    2018-05-01

    We study a class of two-dimensional N}=(2,2)} sigma models called squashed toric sigma models, using their Gauged Linear Sigma Models (GLSM) description. These models are obtained by gauging the global {U(1)} symmetries of toric GLSMs and introducing a set of corresponding compensator superfields. The geometry of the resulting vacuum manifold is a deformation of the corresponding toric manifold in which the torus fibration maintains a constant size in the interior of the manifold, thus producing a neck-like region. We compute the elliptic genus of these models, using localization, in the case when the unsquashed vacuum manifolds obey the Calabi-Yau condition. The elliptic genera have a non-holomorphic dependence on the modular parameter {τ} coming from the continuum produced by the neck. In the simplest case corresponding to squashed {C / Z_{2 the elliptic genus is a mixed mock Jacobi form which coincides with the elliptic genus of the {N=(2,2)} {SL(2,R) / U(1)} cigar coset.

  13. Audio-based performance evaluation of squash players

    PubMed Central

    Hajdú-Szücs, Katalin; Fenyvesi, Nóra; Vattay, Gábor

    2018-01-01

    In competitive sports it is often very hard to quantify the performance. A player to score or overtake may depend on only millesimal of seconds or millimeters. In racquet sports like tennis, table tennis and squash many events will occur in a short time duration, whose recording and analysis can help reveal the differences in performance. In this paper we show that it is possible to architect a framework that utilizes the characteristic sound patterns to precisely classify the types of and localize the positions of these events. From these basic information the shot types and the ball speed along the trajectories can be estimated. Comparing these estimates with the optimal speed and target the precision of the shot can be defined. The detailed shot statistics and precision information significantly enriches and improves data available today. Feeding them back to the players and the coaches facilitates to describe playing performance objectively and to improve strategy skills. The framework is implemented, its hardware and software components are installed and tested in a squash court. PMID:29579067

  14. Real-time multi-channel stimulus artifact suppression by local curve fitting.

    PubMed

    Wagenaar, Daniel A; Potter, Steve M

    2002-10-30

    We describe an algorithm for suppression of stimulation artifacts in extracellular micro-electrode array (MEA) recordings. A model of the artifact based on locally fitted cubic polynomials is subtracted from the recording, yielding a flat baseline amenable to spike detection by voltage thresholding. The algorithm, SALPA, reduces the period after stimulation during which action potentials cannot be detected by an order of magnitude, to less than 2 ms. Our implementation is fast enough to process 60-channel data sampled at 25 kHz in real-time on an inexpensive desktop PC. It performs well on a wide range of artifact shapes without re-tuning any parameters, because it accounts for amplifier saturation explicitly and uses a statistic to verify successful artifact suppression immediately after the amplifiers become operational. We demonstrate the algorithm's effectiveness on recordings from dense monolayer cultures of cortical neurons obtained from rat embryos. SALPA opens up a previously inaccessible window for studying transient neural oscillations and precisely timed dynamics in short-latency responses to electric stimulation. Copyright 2002 Elsevier Science B.V.

  15. T cell lymphoblastic lymphoma/leukemia within an adrenocorticotropic hormone and thyroid stimulating hormone positive pituitary adenoma: A cytohistological correlation emphasizing importance of intra-operative squash smear.

    PubMed

    Gupta, Rakesh K; Saran, Ravindra K; Srivastava, Arvind K; Jagetia, Anita; Garg, Lalit; Sharma, Mehar C

    2017-08-01

    We present a rare case of primary pituitary T cell lymphoma/leukemia (T-LBL) in association with adrenocorticotropic hormone (ACTH) and thyroid stimulating hormone (TSH) expressing pituitary adenoma in a 55-year-old woman highlighting the importance of intra-operative squash smears examination. The patient presented with complaints of headache, diminution of vision and recent onset altered sensorium. MRI revealed a mass lesion in the sellar-suprasellar region with non-visualization of pituitary gland separately, extending to involve adjacent structures diagnosed as invasive pituitary macroadenoma. Intra-operative tissue was sent for squash smear examination. The cytology showed a tumor comprising of sheets of immature lymphoid cells intermixed with clusters of pituitary acinar cells with many mitoses and tingible body macrophages. A diagnosis of presence of immature lymphoid cells within the pituitary was offered and differentials of infiltration by lymphoma cells from systemic disease versus primary central nervous lymphoma-like lymphoma arising in the pituitary adenoma were considered. Later paraffin section examination and immunohistochemistry corroborated with the squash findings and a final diagnosis of primary pituitary T cell lymphoma/leukemia in association with ACTH and TSH expressing pituitary adenoma was made. To date, only six cases of primary pituitary T cell lymphomas, including three T-LBL cases, have been reported. This is the seventh case and first one additionally describing cytohistological correlation and importance of intra-operative cytology. © 2017 Japanese Society of Neuropathology.

  16. Squash preparation: A reliable diagnostic tool in the intraoperative diagnosis of central nervous system tumors

    PubMed Central

    Mitra, Sumit; Kumar, Mohan; Sharma, Vivek; Mukhopadhyay, Debasis

    2010-01-01

    Background: Intraoperative cytology is an important diagnostic modality improving on the accuracy of the frozen sections. It has shown to play an important role especially in the intraoperative diagnosis of central nervous system tumors. Aim: To study the diagnostic accuracy of squash preparation and frozen section (FS) in the intraoperative diagnosis of central nervous system (CNS) tumors. Materials and Methods: This prospective study of 114 patients with CNS tumors was conducted over a period of 18 months (September 2004 to February 2006). The cytological preparations were stained by the quick Papanicolaou method. The squash interpretation and FS diagnosis were later compared with the paraffin section diagnosis. Results: Of the 114 patients, cytological diagnosis was offered in 96 cases. Eighteen nonneoplastic or noncontributory cases were excluded. Using hematoxylin and eosin-stained histopathology sections as the gold standard, the diagnostic accuracy of cytology was 88.5% (85/96) and the accuracy on FS diagnosis was 90.6% (87/96). Among these cases, gliomas formed the largest category of tumors (55.2%). The cytological accuracy in this group was 84.9% (45/53) and the comparative FS figure was 86.8% (46/53). In cases where the smear and the FS diagnosis did not match, the latter opinion was offered. Conclusions: Squash preparation is a reliable, rapid and easy method and can be used as a complement to FS in the intraoperative diagnosis of CNS tumors. PMID:21187881

  17. Simple technologies and diverse food strategies of the Late Pleistocene and Early Holocene at Huaca Prieta, Coastal Peru

    PubMed Central

    Dillehay, Tom D.; Goodbred, Steve; Pino, Mario; Vásquez Sánchez, Víctor F.; Tham, Teresa Rosales; Adovasio, James; Collins, Michael B.; Netherly, Patricia J.; Hastorf, Christine A.; Chiou, Katherine L.; Piperno, Dolores; Rey, Isabel; Velchoff, Nancy

    2017-01-01

    Simple pebble tools, ephemeral cultural features, and the remains of maritime and terrestrial foods are present in undisturbed Late Pleistocene and Early Holocene deposits underneath a large human-made mound at Huaca Prieta and nearby sites on the Pacific coast of northern Peru. Radiocarbon ages indicate an intermittent human presence dated between ~15,000 and 8000 calendar years ago before the mound was built. The absence of fishhooks, harpoons, and bifacial stone tools suggests that technologies of gathering, trapping, clubbing, and exchange were used primarily to procure food resources along the shoreline and in estuarine wetlands and distant mountains. The stone artifacts are minimally worked unifacial stone tools characteristic of several areas of South America. Remains of avocado, bean, and possibly cultivated squash and chile pepper are also present, suggesting human transport and consumption. Our new findings emphasize an early coastal lifeway of diverse food procurement strategies that suggest detailed observation of resource availability in multiple environments and a knowledgeable economic organization, although technologies were simple and campsites were seemingly ephemeral and discontinuous. These findings raise questions about the pace of early human movement along some areas of the Pacific coast and the level of knowledge and technology required to exploit maritime and inland resources. PMID:28560337

  18. Simple technologies and diverse food strategies of the Late Pleistocene and Early Holocene at Huaca Prieta, Coastal Peru.

    PubMed

    Dillehay, Tom D; Goodbred, Steve; Pino, Mario; Vásquez Sánchez, Víctor F; Tham, Teresa Rosales; Adovasio, James; Collins, Michael B; Netherly, Patricia J; Hastorf, Christine A; Chiou, Katherine L; Piperno, Dolores; Rey, Isabel; Velchoff, Nancy

    2017-05-01

    Simple pebble tools, ephemeral cultural features, and the remains of maritime and terrestrial foods are present in undisturbed Late Pleistocene and Early Holocene deposits underneath a large human-made mound at Huaca Prieta and nearby sites on the Pacific coast of northern Peru. Radiocarbon ages indicate an intermittent human presence dated between ~15,000 and 8000 calendar years ago before the mound was built. The absence of fishhooks, harpoons, and bifacial stone tools suggests that technologies of gathering, trapping, clubbing, and exchange were used primarily to procure food resources along the shoreline and in estuarine wetlands and distant mountains. The stone artifacts are minimally worked unifacial stone tools characteristic of several areas of South America. Remains of avocado, bean, and possibly cultivated squash and chile pepper are also present, suggesting human transport and consumption. Our new findings emphasize an early coastal lifeway of diverse food procurement strategies that suggest detailed observation of resource availability in multiple environments and a knowledgeable economic organization, although technologies were simple and campsites were seemingly ephemeral and discontinuous. These findings raise questions about the pace of early human movement along some areas of the Pacific coast and the level of knowledge and technology required to exploit maritime and inland resources.

  19. ARTIST: A fully automated artifact rejection algorithm for single-pulse TMS-EEG data.

    PubMed

    Wu, Wei; Keller, Corey J; Rogasch, Nigel C; Longwell, Parker; Shpigel, Emmanuel; Rolle, Camarin E; Etkin, Amit

    2018-04-01

    Concurrent single-pulse TMS-EEG (spTMS-EEG) is an emerging noninvasive tool for probing causal brain dynamics in humans. However, in addition to the common artifacts in standard EEG data, spTMS-EEG data suffer from enormous stimulation-induced artifacts, posing significant challenges to the extraction of neural information. Typically, neural signals are analyzed after a manual time-intensive and often subjective process of artifact rejection. Here we describe a fully automated algorithm for spTMS-EEG artifact rejection. A key step of this algorithm is to decompose the spTMS-EEG data into statistically independent components (ICs), and then train a pattern classifier to automatically identify artifact components based on knowledge of the spatio-temporal profile of both neural and artefactual activities. The autocleaned and hand-cleaned data yield qualitatively similar group evoked potential waveforms. The algorithm achieves a 95% IC classification accuracy referenced to expert artifact rejection performance, and does so across a large number of spTMS-EEG data sets (n = 90 stimulation sites), retains high accuracy across stimulation sites/subjects/populations/montages, and outperforms current automated algorithms. Moreover, the algorithm was superior to the artifact rejection performance of relatively novice individuals, who would be the likely users of spTMS-EEG as the technique becomes more broadly disseminated. In summary, our algorithm provides an automated, fast, objective, and accurate method for cleaning spTMS-EEG data, which can increase the utility of TMS-EEG in both clinical and basic neuroscience settings. © 2018 Wiley Periodicals, Inc.

  20. MR Imaging with Metal-suppression Sequences for Evaluation of Total Joint Arthroplasty.

    PubMed

    Talbot, Brett S; Weinberg, Eric P

    2016-01-01

    Metallic artifact at orthopedic magnetic resonance (MR) imaging continues to be an important problem, particularly in the realm of total joint arthroplasty. Complications often follow total joint arthroplasty and can be expected for a small percentage of all implanted devices. Postoperative complications involve not only osseous structures but also adjacent soft tissues-a highly problematic area at MR imaging because of artifacts from metallic prostheses. Without special considerations, susceptibility artifacts from ferromagnetic implants can unacceptably degrade image quality. Common artifacts include in-plane distortions (signal loss and signal pileup), poor or absent fat suppression, geometric distortion, and through-section distortion. Basic methods to reduce metallic artifacts include use of spin-echo or fast spin-echo sequences with long echo train lengths, short inversion time inversion-recovery (STIR) sequences for fat suppression, a high bandwidth, thin section selection, and an increased matrix. With care and attention to the alloy type (eg, titanium, cobalt-chromium, stainless steel), orientation of the implant, and magnetic field strength, as well as use of proprietary and nonproprietary metal-suppression techniques, previously nondiagnostic studies can yield key diagnostic information. Specifically, sequences such as the metal artifact reduction sequence (MARS), WARP (Siemens Healthcare, Munich, Germany), slice encoding for metal artifact correction (SEMAC), and multiacquisition with variable-resonance image combination (MAVRIC) can be optimized to reveal pathologic conditions previously hidden by periprosthetic artifacts. Complications of total joint arthroplasty that can be evaluated by using MR imaging with metal-suppression sequences include pseudotumoral conditions such as metallosis and particle disease, infection, aseptic prosthesis loosening, tendon injury, and muscle injury. ©RSNA, 2015.

  1. Faba Greens, Globe Artichoke's Offshoots, Crenate Broomrape and Summer Squash Greens: Unconventional Vegetables of Puglia (Southern Italy) With Good Quality Traits.

    PubMed

    Renna, Massimiliano; Signore, Angelo; Paradiso, Vito M; Santamaria, Pietro

    2018-01-01

    Globe artichoke ( Cynara cardunculus L. subsp. [L.] scolymus Hayek), summer squash ( Cucurbita pepo L.) and faba bean ( Vicia faba L.) are widely cultivated for their immature inflorescences, fruits and seeds, respectively. Nevertheless, in some areas of Puglia (Southern Italy), other organs of these species are traditionally used as vegetables, instead of being considered as by-products. Offshoots (so-called cardoni or carducci ) of globe artichoke, produced during the vegetative growing cycle and removed by common cultural procedures, are used like to the cultivated cardoons ( C. cardunculus L. var. altilis DC). The stems, petioles, flowers and smaller leaves of summer squash are used as greens (so-called cime di zucchini ), like other leafy vegetables such as chicory ( Cichorium intybus L.) and Swiss chard ( Beta vulgaris L.). Also the plant apex of faba bean, about 5-10 cm long, obtained from the green pruning, are used as greens (so-called cime di fava ) like spinach leaves. Moreover, crenate broomrape ( Orobanche crenata Forssk.), a root parasite plant that produces devastating effects on many crops (mostly legumes), is used like asparagus ( Asparagus officinalis L.) to prepare several traditional dishes. In this study ethnobotanical surveys and quality assessment of these unconventional vegetables were performed. For their content of fiber, offshoots of globe artichokes can be considered a useful food to bowel. Summer squash greens could be recommended as a vegetable to use especially in the case of hypoglycemic diets considering both content and composition of their carbohydrates. For their low content of nitrate, faba greens could be recommended as a substitute of nitrate-rich leafy vegetables. Crenate broomrape shows a high antioxidant activity and may be considered as a very nutritious agri-food product. Overall, the results of the present study indicate that offshoots of globe artichoke, summer squash greens, faba greens and crenate broomrape have good potential as novel foods, being nutritious and refined products. Their exploitation aiming to the obtainment of labeled and/or new potential ready-to-eat retail products could satisfy the demand for local functional foods.

  2. Faba Greens, Globe Artichoke’s Offshoots, Crenate Broomrape and Summer Squash Greens: Unconventional Vegetables of Puglia (Southern Italy) With Good Quality Traits

    PubMed Central

    Renna, Massimiliano; Signore, Angelo; Paradiso, Vito M.; Santamaria, Pietro

    2018-01-01

    Globe artichoke (Cynara cardunculus L. subsp. [L.] scolymus Hayek), summer squash (Cucurbita pepo L.) and faba bean (Vicia faba L.) are widely cultivated for their immature inflorescences, fruits and seeds, respectively. Nevertheless, in some areas of Puglia (Southern Italy), other organs of these species are traditionally used as vegetables, instead of being considered as by-products. Offshoots (so-called cardoni or carducci) of globe artichoke, produced during the vegetative growing cycle and removed by common cultural procedures, are used like to the cultivated cardoons (C. cardunculus L. var. altilis DC). The stems, petioles, flowers and smaller leaves of summer squash are used as greens (so-called cime di zucchini), like other leafy vegetables such as chicory (Cichorium intybus L.) and Swiss chard (Beta vulgaris L.). Also the plant apex of faba bean, about 5–10 cm long, obtained from the green pruning, are used as greens (so-called cime di fava) like spinach leaves. Moreover, crenate broomrape (Orobanche crenata Forssk.), a root parasite plant that produces devastating effects on many crops (mostly legumes), is used like asparagus (Asparagus officinalis L.) to prepare several traditional dishes. In this study ethnobotanical surveys and quality assessment of these unconventional vegetables were performed. For their content of fiber, offshoots of globe artichokes can be considered a useful food to bowel. Summer squash greens could be recommended as a vegetable to use especially in the case of hypoglycemic diets considering both content and composition of their carbohydrates. For their low content of nitrate, faba greens could be recommended as a substitute of nitrate-rich leafy vegetables. Crenate broomrape shows a high antioxidant activity and may be considered as a very nutritious agri-food product. Overall, the results of the present study indicate that offshoots of globe artichoke, summer squash greens, faba greens and crenate broomrape have good potential as novel foods, being nutritious and refined products. Their exploitation aiming to the obtainment of labeled and/or new potential ready-to-eat retail products could satisfy the demand for local functional foods. PMID:29636760

  3. Management of Powdery Mildew in Squash by Plant and Alga Extract Biopesticides

    PubMed Central

    Zhang, Shouan; Mersha, Zelalem; Vallad, Gary E.; Huang, Cheng-Hua

    2016-01-01

    Although many fungicides are registered for use to control powdery mildew on cucurbits, management of resistance to fungicides in pathogen populations still remains a major challenge. Two biopesticides Regalia SC and HMO 736 were evaluated in the greenhouse and field for their efficacy against powdery mildew in squash. In greenhouses, Regalia SC alone significantly (P < 0.05) reduced powdery mildew compared to the nontreated control, and was as effective as the chemical standard Procure 480SC (triflumizole). In alternation with Procure 480SC, Regalia SC demonstrated greater or equivalent effects on reducing the disease. HMO 736 alone showed varying levels of disease control, but alternating with Procure 480SC significantly improved control efficacy. In addition, application of Regalia SC or HMO 736 each in alternation with Procure 480SC significantly increased the chlorophyll content in leaves and the total fresh weight of squash plants, when compared with the water control, Regalia SC and HMO 736 alone. In field trials, application of Regalia SC and HMO 736 each alone significantly reduced disease severity in one of two field trials during the early stage of disease development, but not during later stages when disease pressure became high. Both Regalia SC and HMO 736 each applied in alternation with Procure 480SC significantly improved the control efficacy compared to Procure 480SC alone. Results from this study demonstrated that an integrated management program can be developed for powdery mildew in squash by integrating the biopesticides Regalia SC, HMO 736 with the chemical fungicide Procure 480SC. PMID:27904459

  4. Management of Powdery Mildew in Squash by Plant and Alga Extract Biopesticides.

    PubMed

    Zhang, Shouan; Mersha, Zelalem; Vallad, Gary E; Huang, Cheng-Hua

    2016-12-01

    Although many fungicides are registered for use to control powdery mildew on cucurbits, management of resistance to fungicides in pathogen populations still remains a major challenge. Two biopesticides Regalia SC and HMO 736 were evaluated in the greenhouse and field for their efficacy against powdery mildew in squash. In greenhouses, Regalia SC alone significantly ( P < 0.05) reduced powdery mildew compared to the nontreated control, and was as effective as the chemical standard Procure 480SC (triflumizole). In alternation with Procure 480SC, Regalia SC demonstrated greater or equivalent effects on reducing the disease. HMO 736 alone showed varying levels of disease control, but alternating with Procure 480SC significantly improved control efficacy. In addition, application of Regalia SC or HMO 736 each in alternation with Procure 480SC significantly increased the chlorophyll content in leaves and the total fresh weight of squash plants, when compared with the water control, Regalia SC and HMO 736 alone. In field trials, application of Regalia SC and HMO 736 each alone significantly reduced disease severity in one of two field trials during the early stage of disease development, but not during later stages when disease pressure became high. Both Regalia SC and HMO 736 each applied in alternation with Procure 480SC significantly improved the control efficacy compared to Procure 480SC alone. Results from this study demonstrated that an integrated management program can be developed for powdery mildew in squash by integrating the biopesticides Regalia SC, HMO 736 with the chemical fungicide Procure 480SC.

  5. On the Magnetic Squashing Factor and the Lie Transport of Tangents

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Scott, Roger B.; Pontin, David I.; Hornig, Gunnar

    The squashing factor (or squashing degree) of a vector field is a quantitative measure of the deformation of the field line mapping between two surfaces. In the context of solar magnetic fields, it is often used to identify gradients in the mapping of elementary magnetic flux tubes between various flux domains. Regions where these gradients in the mapping are large are referred to as quasi-separatrix layers (QSLs), and are a continuous extension of separators and separatrix surfaces. These QSLs are observed to be potential sites for the formation of strong electric currents, and are therefore important for the study ofmore » magnetic reconnection in three dimensions. Since the squashing factor, Q , is defined in terms of the Jacobian of the field line mapping, it is most often calculated by first determining the mapping between two surfaces (or some approximation of it) and then numerically differentiating. Tassev and Savcheva have introduced an alternative method, in which they parameterize the change in separation between adjacent field lines, and then integrate along individual field lines to get an estimate of the Jacobian without the need to numerically differentiate the mapping itself. But while their method offers certain computational advantages, it is formulated on a perturbative description of the field line trajectory, and the accuracy of this method is not entirely clear. Here we show, through an alternative derivation, that this integral formulation is, in principle, exact. We then demonstrate the result in the case of a linear, 3D magnetic null, which allows for an exact analytical description and direct comparison to numerical estimates.« less

  6. The earliest archaeological maize (Zea mays L.) from highland Mexico: new accelerator mass spectrometry dates and their implications.

    PubMed

    Piperno, D R; Flannery, K V

    2001-02-13

    Accelerator mass spectrometry age determinations of maize cobs (Zea mays L.) from Guilá Naquitz Cave in Oaxaca, Mexico, produced dates of 5,400 carbon-14 years before the present (about 6,250 calendar years ago), making those cobs the oldest in the Americas. Macrofossils and phytoliths characteristic of wild and domesticated Zea fruits are absent from older strata from the site, although Zea pollen has previously been identified from those levels. These results, together with the modern geographical distribution of wild Zea mays, suggest that the cultural practices that led to Zea domestication probably occurred elsewhere in Mexico. Guilá Naquitz Cave has now yielded the earliest macrofossil evidence for the domestication of two major American crop plants, squash (Cucurbita pepo) and maize.

  7. Drosophila Big bang regulates the apical cytocortex and wing growth through junctional tension.

    PubMed

    Tsoumpekos, Giorgos; Nemetschke, Linda; Knust, Elisabeth

    2018-03-05

    Growth of epithelial tissues is regulated by a plethora of components, including signaling and scaffolding proteins, but also by junctional tension, mediated by the actomyosin cytoskeleton. However, how these players are spatially organized and functionally coordinated is not well understood. Here, we identify the Drosophila melanogaster scaffolding protein Big bang as a novel regulator of growth in epithelial cells of the wing disc by ensuring proper junctional tension. Loss of big bang results in the reduction of the regulatory light chain of nonmuscle myosin, Spaghetti squash. This is associated with an increased apical cell surface, decreased junctional tension, and smaller wings. Strikingly, these phenotypic traits of big bang mutant discs can be rescued by expressing constitutively active Spaghetti squash. Big bang colocalizes with Spaghetti squash in the apical cytocortex and is found in the same protein complex. These results suggest that in epithelial cells of developing wings, the scaffolding protein Big bang controls apical cytocortex organization, which is important for regulating cell shape and tissue growth. © 2018 Tsoumpekos et al.

  8. Removing Contamination-Induced Reconstruction Artifacts from Cryo-electron Tomograms

    PubMed Central

    Fernandez, Jose-Jesus; Laugks, Ulrike; Schaffer, Miroslava; Bäuerlein, Felix J.B.; Khoshouei, Maryam; Baumeister, Wolfgang; Lucic, Vladan

    2016-01-01

    Imaging of fully hydrated, vitrified biological samples by electron tomography yields structural information about cellular protein complexes in situ. Here we present a computational procedure that removes artifacts of three-dimensional reconstruction caused by contamination present in samples during imaging by electron microscopy. Applying the procedure to phantom data and electron tomograms of cellular samples significantly improved the resolution and the interpretability of tomograms. Artifacts caused by surface contamination associated with thinning by focused ion beam, as well as those arising from gold fiducial markers and from common, lower contrast contamination, could be removed. Our procedure is widely applicable and is especially suited for applications that strive to reach a higher resolution and involve the use of recently developed, state-of-the-art instrumentation. PMID:26743046

  9. The effect of court location and available time on the tactical shot selection of elite squash players.

    PubMed

    Vučković, Goran; James, Nic; Hughes, Mike; Murray, Stafford; Sporiš, Goran; Perš, Janez

    2013-01-01

    No previous research in squash has considered the time between shots or the proximity of the ball to a wall, which are two important variables that influence shot outcomes. The aim of this paper was to analyse shot types to determine the extent to which they are played in different court areas and a more detailed analysis to determine whether the time available had an influence on the shot selected. Ten elite matches, contested by fifteen of the world's top right handed squash players (age 27 ± 3.2, height 1.81 ± 0.06 m, weight 76.3 ± 3.7 kg), at the men's World Team Championships were processed using the SAGIT/Squash tracking system with shot information manually added to the system. Results suggested that shot responses were dependent upon court location and the time between shots. When these factors were considered repeatable performance existed to the extent that one of two shots was typically played when there was limited time to play the shot (< 1.20s). For example, it was clear that when players did not have a lot of time to hit the ball (low time i.e. < 1.06s, and mid time i.e. 1.06 - 1.20s) in the front left corner close to the side wall, the crosscourt lob was used frequently (44.30% and 36.31% respectively) whereas when there was more time this shot was seldom used (13.64%). Consequently variant and invariant behaviour were shown to exist in elite squash although for the first time it was suggested that the availability of time to play a shot contributed to which of these behaviours was evident. This analysis could be extended by adopting a case study approach to see how individual differences in strategy and tactics affect shot selections. Key pointsPrevious research has suggested that a playing strategy, elements decided in advance of the match, may be evident for elite players by examining court location and preceding shot type, however these parameters alone are unlikely to be sufficient predictors.At present there is no known analysis in squash, or indeed in any of the racket sports, that has quantified the time available to respond to different shot types. An understanding of the time interval between shots and the movement characteristics of the player responding to different shots according to the court positions might facilitate a better understanding of the dynamics that determine shot selection.Some elements of a general playing strategy were evident e.g. predominately hitting to the back left of the court, but tactical differences in shot selection were also evident on the basis of court location and time available to play a shot.

  10. The Effect of Court Location and Available Time on the Tactical Shot Selection of Elite Squash Players

    PubMed Central

    Vučković, Goran; James, Nic; Hughes, Mike; Murray, Stafford; Sporiš, Goran; Perš, Janez

    2013-01-01

    No previous research in squash has considered the time between shots or the proximity of the ball to a wall, which are two important variables that influence shot outcomes. The aim of this paper was to analyse shot types to determine the extent to which they are played in different court areas and a more detailed analysis to determine whether the time available had an influence on the shot selected. Ten elite matches, contested by fifteen of the world’s top right handed squash players (age 27 ± 3.2, height 1.81 ± 0.06 m, weight 76.3 ± 3.7 kg), at the men’s World Team Championships were processed using the SAGIT/Squash tracking system with shot information manually added to the system. Results suggested that shot responses were dependent upon court location and the time between shots. When these factors were considered repeatable performance existed to the extent that one of two shots was typically played when there was limited time to play the shot (< 1.20s). For example, it was clear that when players did not have a lot of time to hit the ball (low time i.e. < 1.06s, and mid time i.e. 1.06 - 1.20s) in the front left corner close to the side wall, the crosscourt lob was used frequently (44.30% and 36.31% respectively) whereas when there was more time this shot was seldom used (13.64%). Consequently variant and invariant behaviour were shown to exist in elite squash although for the first time it was suggested that the availability of time to play a shot contributed to which of these behaviours was evident. This analysis could be extended by adopting a case study approach to see how individual differences in strategy and tactics affect shot selections. Key points Previous research has suggested that a playing strategy, elements decided in advance of the match, may be evident for elite players by examining court location and preceding shot type, however these parameters alone are unlikely to be sufficient predictors. At present there is no known analysis in squash, or indeed in any of the racket sports, that has quantified the time available to respond to different shot types. An understanding of the time interval between shots and the movement characteristics of the player responding to different shots according to the court positions might facilitate a better understanding of the dynamics that determine shot selection. Some elements of a general playing strategy were evident e.g. predominately hitting to the back left of the court, but tactical differences in shot selection were also evident on the basis of court location and time available to play a shot. PMID:24149727

  11. Partial scan artifact reduction (PSAR) for the assessment of cardiac perfusion in dynamic phase-correlated CT.

    PubMed

    Stenner, Philip; Schmidt, Bernhard; Bruder, Herbert; Allmendinger, Thomas; Haberland, Ulrike; Flohr, Thomas; Kachelriess, Marc

    2009-12-01

    Cardiac CT achieves its high temporal resolution by lowering the scan range from 2pi to pi plus fan angle (partial scan). This, however, introduces CT-value variations, depending on the angular position of the pi range. These partial scan artifacts are of the order of a few HU and prevent the quantitative evaluation of perfusion measurements. The authors present the new algorithm partial scan artifact reduction (PSAR) that corrects a dynamic phase-correlated scan without a priori information. In general, a full scan does not suffer from partial scan artifacts since all projections in [0, 2pi] contribute to the data. To maintain the optimum temporal resolution and the phase correlation, PSAR creates an artificial full scan pn(AF) by projectionwise averaging a set of neighboring partial scans pn(P) from the same perfusion examination (typically N approximately 30 phase-correlated partial scans distributed over 20 s and n = 1, ..., N). Corresponding to the angular range of each partial scan, the authors extract virtual partial scans pn(V) from the artificial full scan pn(AF). A standard reconstruction yields the corresponding images fn(P), fn(AF), and fn(V). Subtracting the virtual partial scan image fn(V) from the artificial full scan image fn(AF) yields an artifact image that can be used to correct the original partial scan image: fn(C) = fn(P) - fn(V) + fn(AF), where fn(C) is the corrected image. The authors evaluated the effects of scattered radiation on the partial scan artifacts using simulated and measured water phantoms and found a strong correlation. The PSAR algorithm has been validated with a simulated semianthropomorphic heart phantom and with measurements of a dynamic biological perfusion phantom. For the stationary phantoms, real full scans have been performed to provide theoretical reference values. The improvement in the root mean square errors between the full and the partial scans with respect to the errors between the full and the corrected scans is up to 54% for the simulations and 90% for the measurements. The phase-correlated data now appear accurate enough for a quantitative analysis of cardiac perfusion.

  12. Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

    PubMed

    Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

    2006-02-01

    Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

  13. Energy-constrained two-way assisted private and quantum capacities of quantum channels

    NASA Astrophysics Data System (ADS)

    Davis, Noah; Shirokov, Maksim E.; Wilde, Mark M.

    2018-06-01

    With the rapid growth of quantum technologies, knowing the fundamental characteristics of quantum systems and protocols is essential for their effective implementation. A particular communication setting that has received increased focus is related to quantum key distribution and distributed quantum computation. In this setting, a quantum channel connects a sender to a receiver, and their goal is to distill either a secret key or entanglement, along with the help of arbitrary local operations and classical communication (LOCC). In this work, we establish a general theory of energy-constrained, LOCC-assisted private and quantum capacities of quantum channels, which are the maximum rates at which an LOCC-assisted quantum channel can reliably establish a secret key or entanglement, respectively, subject to an energy constraint on the channel input states. We prove that the energy-constrained squashed entanglement of a channel is an upper bound on these capacities. We also explicitly prove that a thermal state maximizes a relaxation of the squashed entanglement of all phase-insensitive, single-mode input bosonic Gaussian channels, generalizing results from prior work. After doing so, we prove that a variation of the method introduced by Goodenough et al. [New J. Phys. 18, 063005 (2016), 10.1088/1367-2630/18/6/063005] leads to improved upper bounds on the energy-constrained secret-key-agreement capacity of a bosonic thermal channel. We then consider a multipartite setting and prove that two known multipartite generalizations of the squashed entanglement are in fact equal. We finally show that the energy-constrained, multipartite squashed entanglement plays a role in bounding the energy-constrained LOCC-assisted private and quantum capacity regions of quantum broadcast channels.

  14. Early human occupation of Western Europe: Paleomagnetic dates for two paleolithic sites in Spain

    PubMed Central

    Oms, O.; Parés, J. M.; Martínez-Navarro, B.; Agustí, J.; Toro, I.; Martínez-Fernández, G.; Turq, A.

    2000-01-01

    The lacustrine deposits infilling the intramontane Guadix-Baza Basin, in the Betic Range of Southern Spain, have yielded abundant well-preserved lithic artifacts. In addition, the lake beds contain a wide range of micromammals including Mimomys savini and Allophaiomys burgondiae and large mammals such as Mammuthus and Hippopotamus together with the African saber-toothed felid Megantereon. The association of the lithic artifacts along with the fossil assemblages, themselves of prime significance in the Eurasian mammal biochronology, is providing new insight into the controversy of the human settlement in Southern Europe. Despite the importance of the artifacts and fossil assemblage, estimates of the geological age of the site are still in conflict. Some attempts at dating the sediments have included biochronology, uranium series, amino acid racemization, and stratigraphic correlation with other well-dated sections in the basin, but so far have failed to yield unambiguous ages. Here we present paleomagnetic age dating at the relevant localities and thus provide useful age constraints for this critical paleoanthropological and mammal site. Our data provide firm evidence for human occupation in Southern Europe in the Lower Pleistocene, around 1 mega-annum ago. The current view of when and how hominids first dispersed into Europe needs to be reevaluated. PMID:10973485

  15. Purification and Kinetics of Higher Plant NADH:Nitrate Reductase.

    PubMed

    Campbell, W H; Smarrelli, J

    1978-04-01

    Squash cotyledon (Cucurbita pepo L.) NADH:nitrate reductase (NR) was purified 150-fold with 50% recovery by a single step procedure based on the affinity of the NR for blue-Sepharose. Blue-Sepharose, which is prepared by direct coupling of Cibacron blue to Sepharose, appears to bind squash NR at the NADH site. The NR can be purified in 2 to 3 hours to a specific activity of 2 mumol of NADH oxidized/minute * milligram of protein. Corn (Zea mays L.) leaf NR was also purified to a specific activity of 6.9 mumol of NADH oxidized/minute * milligram of protein using a blue-Sepharose affinity step. The blue-Sepharose method offers the advantages of a rapid purification of plant NR to a high specific activity with reasonable recovery of total activity.The kinetic mechanism of higher plant NR was investigated using these highly purified squash and corn NR preparations. Based on initial velocity and product inhibition studies utilizing both enzymes, a two-site ping-pong mechanism is proposed for NR. This kinetic mechanism incorporates the concept of the reduced NR transferring electrons from the NADH site to a physically separated nitrate site.

  16. Tibial shock measured during the fencing lunge: the influence of footwear.

    PubMed

    Sinclair, Jonathan; Bottoms, Lindsay; Taylor, Katrina; Greenhalgh, Andrew

    2010-06-01

    Fencing is a high-intensity sport involving dynamic movements such as the lunge exposing the musculoskeletal system to high impact forces, which emphasises the importance of the shock attenuating properties of footwear as a factor in the prevention of injury. The aim of this study was to investigate the magnitudes of the transient axial impact shock experienced at the tibia between traditional fencing shoes and standard athletic footwear during the impact phase of the fencing lunge. Peak tibial shock was measured in 19 male fencers in 4 different footwear conditions using an accelerometer placed on the distal aspect of the tibia. The standard footwear (11.08 g and 8.75 g for squash and running shoe, respectively) resulted in significant (p < 0.01) reductions in peak impact shock in comparison to the traditional fencing shoes (15.93 g and 13.97 g for the Adidas and Hi-Tec shoe, respectively). No significant differences were found between the running and squash shoes (p = 0.09) or between the fencing shoes (p = 0.48). The documented reduction in impact shock found suggests that running or squash specific footwear may reduce overuse injury occurrence, indicating that there is justification for a re-design of fencing shoes.

  17. Risk assessment of genetically engineered crops: fitness effects of virus-resistance transgenes in wild Cucurbita pepo.

    PubMed

    Laughlin, Karen D; Power, Alison G; Snow, Allison A; Spencer, Lawrence J

    2009-07-01

    The development of crops genetically engineered for pathogen resistance has raised concerns that crop-to-wild gene flow could release wild or weedy relatives from regulation by the pathogens targeted by the transgenes that confer resistance. Investigation of these risks has also raised questions about the impact of gene flow from conventional crops into wild plant populations. Viruses in natural plant populations can play important roles in plant fecundity and competitive interactions. Here, we show that virus-resistance transgenes and conventional crop genes can increase fecundity of wild plants under virus pressure. We asked how gene flow from a cultivated squash (Cucurbita pepo) engineered for virus resistance would affect the fecundity of wild squash (C. pepo) in the presence and absence of virus pressure. A transgenic squash cultivar was crossed and backcrossed with wild C. pepo from Arkansas. Wild C. pepo, transgenic backcross plants, and non-transgenic backcross plants were compared in field plots in Ithaca, New York, USA. The second and third generations of backcrosses (BC2 and BC3) were used in 2002 and 2003, respectively. One-half of the plants were inoculated with zucchini yellow mosaic virus (ZYMV), and one-half of the plants were maintained as healthy controls. Virus pressure dramatically decreased the fecundity of wild C. pepo plants and non-transgenic backcross plants relative to transgenic backcross plants, which showed continued functioning of the virus-resistance transgene. In 2002, non-transgenic backcross fecundity was slightly higher than wild C. pepo fecundity under virus pressure, indicating a possible benefit of conventional crop alleles, but they did not differ in 2003 when fecundity was lower in both groups. We detected no fitness costs of the transgene in the absence of the virus. If viruses play a role in the population dynamics of wild C. pepo, we predict that gene flow from transgenic, virus-resistant squash and, to a much lesser extent, conventionally bred squash would increase C. pepo fecundity. Studies such as this one, in combination with documentation of the probability of crop-to-wild gene flow and surveys of virus incidence in wild populations, can provide a solid basis for environmental risk assessments of crops genetically engineered for virus resistance.

  18. Reducing Interpolation Artifacts for Mutual Information Based Image Registration

    PubMed Central

    Soleimani, H.; Khosravifard, M.A.

    2011-01-01

    Medical image registration methods which use mutual information as similarity measure have been improved in recent decades. Mutual Information is a basic concept of Information theory which indicates the dependency of two random variables (or two images). In order to evaluate the mutual information of two images their joint probability distribution is required. Several interpolation methods, such as Partial Volume (PV) and bilinear, are used to estimate joint probability distribution. Both of these two methods yield some artifacts on mutual information function. Partial Volume-Hanning window (PVH) and Generalized Partial Volume (GPV) methods are introduced to remove such artifacts. In this paper we show that the acceptable performance of these methods is not due to their kernel function. It's because of the number of pixels which incorporate in interpolation. Since using more pixels requires more complex and time consuming interpolation process, we propose a new interpolation method which uses only four pixels (the same as PV and bilinear interpolations) and removes most of the artifacts. Experimental results of the registration of Computed Tomography (CT) images show superiority of the proposed scheme. PMID:22606673

  19. Formation of template-switching artifacts by linear amplification.

    PubMed

    Chakravarti, Dhrubajyoti; Mailander, Paula C

    2008-07-01

    Linear amplification is a method of synthesizing single-stranded DNA from either a single-stranded DNA or one strand of a double-stranded DNA. In this protocol, molecules of a single primer DNA are extended by multiple rounds of DNA synthesis at high temperature using thermostable DNA polymerases. Although linear amplification generates the intended full-length single-stranded product, it is more efficient over single-stranded templates than double-stranded templates. We analyzed linear amplification over single- or double-stranded mouse H-ras DNA (exon 1-2 region). The single-stranded H-ras template yielded only the intended product. However, when the double-stranded template was used, additional artifact products were observed. Increasing the concentration of the double-stranded template produced relatively higher amounts of these artifact products. One of the artifact DNA bands could be mapped and analyzed by sequencing. It contained three template-switching products. These DNAs were formed by incomplete DNA strand extension over the template strand, followed by switching to the complementary strand at a specific Ade nucleotide within a putative hairpin sequence, from which DNA synthesis continued over the complementary strand.

  20. The earliest archaeological maize (Zea mays L.) from highland Mexico: New accelerator mass spectrometry dates and their implications

    PubMed Central

    Piperno, D. R.; Flannery, K. V.

    2001-01-01

    Accelerator mass spectrometry age determinations of maize cobs (Zea mays L.) from Guilá Naquitz Cave in Oaxaca, Mexico, produced dates of 5,400 carbon-14 years before the present (about 6,250 calendar years ago), making those cobs the oldest in the Americas. Macrofossils and phytoliths characteristic of wild and domesticated Zea fruits are absent from older strata from the site, although Zea pollen has previously been identified from those levels. These results, together with the modern geographical distribution of wild Zea mays, suggest that the cultural practices that led to Zea domestication probably occurred elsewhere in Mexico. Guilá Naquitz Cave has now yielded the earliest macrofossil evidence for the domestication of two major American crop plants, squash (Cucurbita pepo) and maize. PMID:11172082

  1. Supervised segmentation of microelectrode recording artifacts using power spectral density.

    PubMed

    Bakstein, Eduard; Schneider, Jakub; Sieger, Tomas; Novak, Daniel; Wild, Jiri; Jech, Robert

    2015-08-01

    Appropriate detection of clean signal segments in extracellular microelectrode recordings (MER) is vital for maintaining high signal-to-noise ratio in MER studies. Existing alternatives to manual signal inspection are based on unsupervised change-point detection. We present a method of supervised MER artifact classification, based on power spectral density (PSD) and evaluate its performance on a database of 95 labelled MER signals. The proposed method yielded test-set accuracy of 90%, which was close to the accuracy of annotation (94%). The unsupervised methods achieved accuracy of about 77% on both training and testing data.

  2. Cultivar-Based Introgression Mapping Reveals Wild Species-Derived Pm-0, the Major Powdery Mildew Resistance Locus in Squash.

    PubMed

    Holdsworth, William L; LaPlant, Kyle E; Bell, Duane C; Jahn, Molly M; Mazourek, Michael

    2016-01-01

    Powdery mildew is a major fungal disease on squash and pumpkin (Cucurbita spp.) in the US and throughout the world. Genetic resistance to the disease is not known to occur naturally within Cucurbita pepo and only infrequently in Cucurbita moschata, but has been achieved in both species through the introgression of a major resistance gene from the wild species Cucurbita okeechobeensis subsp. martinezii. At present, this gene, Pm-0, is used extensively in breeding, and is found in nearly all powdery mildew-resistant C. pepo and C. moschata commercial cultivars. In this study, we mapped C. okeechobeensis subsp. martinezii-derived single nucleotide polymorphism (SNP) alleles in a set of taxonomically and morphologically diverse and resistant C. pepo and C. moschata cultivars bred at Cornell University that, by common possession of Pm-0, form a shared-trait introgression panel. High marker density was achieved using genotyping-by-sequencing, which yielded over 50,000 de novo SNP markers in each of the three Cucurbita species genotyped. A single 516.4 kb wild-derived introgression was present in all of the resistant cultivars and absent in a diverse set of heirlooms that predated the Pm-0 introgression. The contribution of this interval to powdery mildew resistance was confirmed by association mapping in a C. pepo cultivar panel that included the Cornell lines, heirlooms, and 68 additional C. pepo cultivars and with an independent F2 population derived from C. okeechobeensis subsp. martinezii x C. moschata. The interval was refined to a final candidate interval of 76.4 kb and CAPS markers were developed inside this interval to facilitate marker-assisted selection.

  3. Cultivar-Based Introgression Mapping Reveals Wild Species-Derived Pm-0, the Major Powdery Mildew Resistance Locus in Squash

    PubMed Central

    Holdsworth, William L.; LaPlant, Kyle E.; Bell, Duane C.; Jahn, Molly M.; Mazourek, Michael

    2016-01-01

    Powdery mildew is a major fungal disease on squash and pumpkin (Cucurbita spp.) in the US and throughout the world. Genetic resistance to the disease is not known to occur naturally within Cucurbita pepo and only infrequently in Cucurbita moschata, but has been achieved in both species through the introgression of a major resistance gene from the wild species Cucurbita okeechobeensis subsp. martinezii. At present, this gene, Pm-0, is used extensively in breeding, and is found in nearly all powdery mildew-resistant C. pepo and C. moschata commercial cultivars. In this study, we mapped C. okeechobeensis subsp. martinezii-derived single nucleotide polymorphism (SNP) alleles in a set of taxonomically and morphologically diverse and resistant C. pepo and C. moschata cultivars bred at Cornell University that, by common possession of Pm-0, form a shared-trait introgression panel. High marker density was achieved using genotyping-by-sequencing, which yielded over 50,000 de novo SNP markers in each of the three Cucurbita species genotyped. A single 516.4 kb wild-derived introgression was present in all of the resistant cultivars and absent in a diverse set of heirlooms that predated the Pm-0 introgression. The contribution of this interval to powdery mildew resistance was confirmed by association mapping in a C. pepo cultivar panel that included the Cornell lines, heirlooms, and 68 additional C. pepo cultivars and with an independent F2 population derived from C. okeechobeensis subsp. martinezii x C. moschata. The interval was refined to a final candidate interval of 76.4 kb and CAPS markers were developed inside this interval to facilitate marker-assisted selection. PMID:27936008

  4. Diffusion imaging quality control via entropy of principal direction distribution.

    PubMed

    Farzinfar, Mahshid; Oguz, Ipek; Smith, Rachel G; Verde, Audrey R; Dietrich, Cheryl; Gupta, Aditya; Escolar, Maria L; Piven, Joseph; Pujol, Sonia; Vachet, Clement; Gouttard, Sylvain; Gerig, Guido; Dager, Stephen; McKinstry, Robert C; Paterson, Sarah; Evans, Alan C; Styner, Martin A

    2013-11-15

    Diffusion MR imaging has received increasing attention in the neuroimaging community, as it yields new insights into the microstructural organization of white matter that are not available with conventional MRI techniques. While the technology has enormous potential, diffusion MRI suffers from a unique and complex set of image quality problems, limiting the sensitivity of studies and reducing the accuracy of findings. Furthermore, the acquisition time for diffusion MRI is longer than conventional MRI due to the need for multiple acquisitions to obtain directionally encoded Diffusion Weighted Images (DWI). This leads to increased motion artifacts, reduced signal-to-noise ratio (SNR), and increased proneness to a wide variety of artifacts, including eddy-current and motion artifacts, "venetian blind" artifacts, as well as slice-wise and gradient-wise inconsistencies. Such artifacts mandate stringent Quality Control (QC) schemes in the processing of diffusion MRI data. Most existing QC procedures are conducted in the DWI domain and/or on a voxel level, but our own experiments show that these methods often do not fully detect and eliminate certain types of artifacts, often only visible when investigating groups of DWI's or a derived diffusion model, such as the most-employed diffusion tensor imaging (DTI). Here, we propose a novel regional QC measure in the DTI domain that employs the entropy of the regional distribution of the principal directions (PD). The PD entropy quantifies the scattering and spread of the principal diffusion directions and is invariant to the patient's position in the scanner. High entropy value indicates that the PDs are distributed relatively uniformly, while low entropy value indicates the presence of clusters in the PD distribution. The novel QC measure is intended to complement the existing set of QC procedures by detecting and correcting residual artifacts. Such residual artifacts cause directional bias in the measured PD and here called dominant direction artifacts. Experiments show that our automatic method can reliably detect and potentially correct such artifacts, especially the ones caused by the vibrations of the scanner table during the scan. The results further indicate the usefulness of this method for general quality assessment in DTI studies. Copyright © 2013 Elsevier Inc. All rights reserved.

  5. Diffusion imaging quality control via entropy of principal direction distribution

    PubMed Central

    Oguz, Ipek; Smith, Rachel G.; Verde, Audrey R.; Dietrich, Cheryl; Gupta, Aditya; Escolar, Maria L.; Piven, Joseph; Pujol, Sonia; Vachet, Clement; Gouttard, Sylvain; Gerig, Guido; Dager, Stephen; McKinstry, Robert C.; Paterson, Sarah; Evans, Alan C.; Styner, Martin A.

    2013-01-01

    Diffusion MR imaging has received increasing attention in the neuroimaging community, as it yields new insights into the microstructural organization of white matter that are not available with conventional MRI techniques. While the technology has enormous potential, diffusion MRI suffers from a unique and complex set of image quality problems, limiting the sensitivity of studies and reducing the accuracy of findings. Furthermore, the acquisition time for diffusion MRI is longer than conventional MRI due to the need for multiple acquisitions to obtain directionally encoded Diffusion Weighted Images (DWI). This leads to increased motion artifacts, reduced signal-to-noise ratio (SNR), and increased proneness to a wide variety of artifacts, including eddy-current and motion artifacts, “venetian blind” artifacts, as well as slice-wise and gradient-wise inconsistencies. Such artifacts mandate stringent Quality Control (QC) schemes in the processing of diffusion MRI data. Most existing QC procedures are conducted in the DWI domain and/or on a voxel level, but our own experiments show that these methods often do not fully detect and eliminate certain types of artifacts, often only visible when investigating groups of DWI's or a derived diffusion model, such as the most-employed diffusion tensor imaging (DTI). Here, we propose a novel regional QC measure in the DTI domain that employs the entropy of the regional distribution of the principal directions (PD). The PD entropy quantifies the scattering and spread of the principal diffusion directions and is invariant to the patient's position in the scanner. High entropy value indicates that the PDs are distributed relatively uniformly, while low entropy value indicates the presence of clusters in the PD distribution. The novel QC measure is intended to complement the existing set of QC procedures by detecting and correcting residual artifacts. Such residual artifacts cause directional bias in the measured PD and here called dominant direction artifacts. Experiments show that our automatic method can reliably detect and potentially correct such artifacts, especially the ones caused by the vibrations of the scanner table during the scan. The results further indicate the usefulness of this method for general quality assessment in DTI studies. PMID:23684874

  6. Simulation-based artifact correction (SBAC) for metrological computed tomography

    NASA Astrophysics Data System (ADS)

    Maier, Joscha; Leinweber, Carsten; Sawall, Stefan; Stoschus, Henning; Ballach, Frederic; Müller, Tobias; Hammer, Michael; Christoph, Ralf; Kachelrieß, Marc

    2017-06-01

    Computed tomography (CT) is a valuable tool for the metrolocical assessment of industrial components. However, the application of CT to the investigation of highly attenuating objects or multi-material components is often restricted by the presence of CT artifacts caused by beam hardening, x-ray scatter, off-focal radiation, partial volume effects or the cone-beam reconstruction itself. In order to overcome this limitation, this paper proposes an approach to calculate a correction term that compensates for the contribution of artifacts and thus enables an appropriate assessment of these components using CT. Therefore, we make use of computer simulations of the CT measurement process. Based on an appropriate model of the object, e.g. an initial reconstruction or a CAD model, two simulations are carried out. One simulation considers all physical effects that cause artifacts using dedicated analytic methods as well as Monte Carlo-based models. The other one represents an ideal CT measurement i.e. a measurement in parallel beam geometry with a monochromatic, point-like x-ray source and no x-ray scattering. Thus, the difference between these simulations is an estimate for the present artifacts and can be used to correct the acquired projection data or the corresponding CT reconstruction, respectively. The performance of the proposed approach is evaluated using simulated as well as measured data of single and multi-material components. Our approach yields CT reconstructions that are nearly free of artifacts and thereby clearly outperforms commonly used artifact reduction algorithms in terms of image quality. A comparison against tactile reference measurements demonstrates the ability of the proposed approach to increase the accuracy of the metrological assessment significantly.

  7. Real alerts and artifact classification in archived multi-signal vital sign monitoring data: implications for mining big data.

    PubMed

    Hravnak, Marilyn; Chen, Lujie; Dubrawski, Artur; Bose, Eliezer; Clermont, Gilles; Pinsky, Michael R

    2016-12-01

    Huge hospital information system databases can be mined for knowledge discovery and decision support, but artifact in stored non-invasive vital sign (VS) high-frequency data streams limits its use. We used machine-learning (ML) algorithms trained on expert-labeled VS data streams to automatically classify VS alerts as real or artifact, thereby "cleaning" such data for future modeling. 634 admissions to a step-down unit had recorded continuous noninvasive VS monitoring data [heart rate (HR), respiratory rate (RR), peripheral arterial oxygen saturation (SpO 2 ) at 1/20 Hz, and noninvasive oscillometric blood pressure (BP)]. Time data were across stability thresholds defined VS event epochs. Data were divided Block 1 as the ML training/cross-validation set and Block 2 the test set. Expert clinicians annotated Block 1 events as perceived real or artifact. After feature extraction, ML algorithms were trained to create and validate models automatically classifying events as real or artifact. The models were then tested on Block 2. Block 1 yielded 812 VS events, with 214 (26 %) judged by experts as artifact (RR 43 %, SpO 2 40 %, BP 15 %, HR 2 %). ML algorithms applied to the Block 1 training/cross-validation set (tenfold cross-validation) gave area under the curve (AUC) scores of 0.97 RR, 0.91 BP and 0.76 SpO 2 . Performance when applied to Block 2 test data was AUC 0.94 RR, 0.84 BP and 0.72 SpO 2 . ML-defined algorithms applied to archived multi-signal continuous VS monitoring data allowed accurate automated classification of VS alerts as real or artifact, and could support data mining for future model building.

  8. Real Alerts and Artifact Classification in Archived Multi-signal Vital Sign Monitoring Data—Implications for Mining Big Data — Implications for Mining Big Data

    PubMed Central

    Hravnak, Marilyn; Chen, Lujie; Dubrawski, Artur; Bose, Eliezer; Clermont, Gilles; Pinsky, Michael R.

    2015-01-01

    PURPOSE Huge hospital information system databases can be mined for knowledge discovery and decision support, but artifact in stored non-invasive vital sign (VS) high-frequency data streams limits its use. We used machine-learning (ML) algorithms trained on expert-labeled VS data streams to automatically classify VS alerts as real or artifact, thereby “cleaning” such data for future modeling. METHODS 634 admissions to a step-down unit had recorded continuous noninvasive VS monitoring data (heart rate [HR], respiratory rate [RR], peripheral arterial oxygen saturation [SpO2] at 1/20Hz., and noninvasive oscillometric blood pressure [BP]) Time data were across stability thresholds defined VS event epochs. Data were divided Block 1 as the ML training/cross-validation set and Block 2 the test set. Expert clinicians annotated Block 1 events as perceived real or artifact. After feature extraction, ML algorithms were trained to create and validate models automatically classifying events as real or artifact. The models were then tested on Block 2. RESULTS Block 1 yielded 812 VS events, with 214 (26%) judged by experts as artifact (RR 43%, SpO2 40%, BP 15%, HR 2%). ML algorithms applied to the Block 1 training/cross-validation set (10-fold cross-validation) gave area under the curve (AUC) scores of 0.97 RR, 0.91 BP and 0.76 SpO2. Performance when applied to Block 2 test data was AUC 0.94 RR, 0.84 BP and 0.72 SpO2). CONCLUSIONS ML-defined algorithms applied to archived multi-signal continuous VS monitoring data allowed accurate automated classification of VS alerts as real or artifact, and could support data mining for future model building. PMID:26438655

  9. Evaluation of an annular denuder system for carbonaceous aerosol sampling of diesel engine emissions.

    PubMed

    Zhang, Jie; Fan, Xinghua; Graham, Lisa; Chan, Tak W; Brook, Jeffrey R

    2013-01-01

    Sampling of particle-phase organic carbon (OC) from diesel engines is complicated by adsorption and evaporation of semivolatile organic carbon (SVOC), defined as positive and negative artifacts, respectively. In order to explore these artifacts, an integrated organic gas and particle sampler (IOGAPS) was applied, in which an XAD-coated multichannel annular denuder was placed upstream to remove the gas-phase SVOC and two downstream sorbent-impregnated filters (SIFs) were employed to capture the evaporated SVOC. Positive artifacts can be reduced by using a denuder but particle loss also occurs. This paper investigates the IOGAPS with respect to particle loss, denuder efficiency, and particle-phase OC artifacts by comparing OC, elemental carbon (EC), SVOC, and selected organic species, as well as particle size distributions. Compared to the filterpack methods typically used, the IOGAPS approach results in estimation of both positive and negative artifacts, especially the negative artifact. The positive and negative artifacts were 190 microg/m3 and 67 microg/m3, representing 122% and 43% of the total particle OC measured by the IOGAPS, respectively. However particle loss and denuder break-through were also found to exist. Monitoring particle mass loss by particle number or EC concentration yielded similar results ranging from 10% to 24% depending upon flow rate. Using the measurements of selected particle-phase organic species to infer particle loss resulted in larger estimates, on the order of 32%. The denuder collection efficiencyfor SVOCs at 74 L/min was found to be less than 100%, with an average of 84%. In addition to these uncertainties the IOGAPS method requires a considerable amount of extra effort to apply. These disadvantages must be weighed against the benefits of being able to estimate positive artifacts and correct, with some uncertainty, for the negative artifacts when selecting a method for sampling diesel emissions. Measurements of diesel emissions are necessary to understand their adverse impacts. Much of the emissions is organic carbon covering a range ofvolatilities, complicating determination of the particle fraction because of sampling artifacts. In this paper an approach to quantify artifacts is evaluated for a diesel engine. This showed that 63% of the particle organic carbon typically measured could be the positive artifact while the negative artifact is about one-third of this value. However, this approach adds time and expense and leads to other uncertainties, implying that effort is needed to develop methods to accurately measure diesel emissions.

  10. New black holes in D =5 minimal gauged supergravity: Deformed boundaries and frozen horizons

    NASA Astrophysics Data System (ADS)

    Blázquez-Salcedo, Jose Luis; Kunz, Jutta; Navarro-Lérida, Francisco; Radu, Eugen

    2018-04-01

    A new class of black hole solutions of the five-dimensional minimal gauged supergravity is presented. They are characterized by the mass, the electric charge, two equal magnitude angular momenta and the magnitude of the magnetic potential at infinity. These black holes possess a horizon of spherical topology; however, both the horizon and the sphere at infinity can be arbitrarily squashed, with nonextremal solutions interpolating between black strings and black branes. A particular set of extremal configurations corresponds to a new one-parameter family of supersymmetric black holes. While their conserved charges are determined by the squashing of the sphere at infinity, these supersymmetric solutions possess the same horizon geometry.

  11. Causal Reasoning with Mental Models

    DTIC Science & Technology

    2014-08-08

    The initial rubric is equivalent to an exclusive disjunction between the two causal assertions. It 488 yields the following two mental models: 489...are 575 important, whereas the functions of artifacts are important (Ahn, 1998). A genetic code is 576 accordingly more critical to being a goat than

  12. α-Carotene and β-Carotene Content in Raw and Cooked Pulp of Three Mature Stage Winter Squash “Type Butternut”

    PubMed Central

    Zaccari, Fernanda; Galietta, Giovanni

    2015-01-01

    Winter squash “type butternut” is harvested in physiological ripening for better commercial distribution, when sensory and/or nutritional quality is not optimum for consumption. The objective of this study was to quantify the content of α-carotene, β-carotene, color and dry matter in the pulp of raw and microwave-cooked winter squash “type butternut” (variety CosmoF1) in three states of commercial maturity. Immature, mature, and very mature fruit, defined at the time of the harvest by the percentage of orange peel and green stalk, were evaluated. The highest concentration of carotenes (α-carotene + β-carotene) in mg.100 g−1 pulp wet basis was found in very mature fruits (31.96 mg), followed by mature fruits (24.65 mg), and immature fruits (18.82 mg). Microwave cooking caused the loss of β-carotene (28.6% wet basis) and α-carotene (34.1%). Cooking promote a greater reduction of α-carotene in immature (40.3%) and mature (34.5%) fruits. The ratio of β-carotene and α-carotene content increased with commercial maturity from 0.93 for immature fruits to 1.0 for very mature fruit, with higher ratio in cooked pulp (1.04) vs. raw pulp (0.96). PMID:28231218

  13. Effects of Cucumber mosaic virus infection on vector and non-vector herbivores of squash.

    PubMed

    Mauck, Kerry E; De Moraes, Consuelo M; Mescher, Mark C

    2010-11-01

    Plant chemicals mediating interactions with insect herbivores seem a likely target for manipulation by insectvectored plant pathogens. Yet, little is currently known about the chemical ecology of insect-vectored diseases or their effects on the ecology of vector and nonvector insects. We recently reported that a widespread plant pathogen, Cucumber mosaic virus (CMV), greatly reduces the quality of host-plants (squash) for aphid vectors, but that aphids are nevertheless attracted to the odors of infected plants-which exhibit elevated emissions of a volatile blend otherwise similar to the odor of healthy plants. This finding suggests that exaggerating existing host-location cues can be a viable vector attraction strategy for pathogens that otherwise reduce host quality for vectors. Here we report additional data regarding the effects of CMV infection on plant interactions with a common nonvector herbivore, the squash bug, Anasa tristis, which is a pest in this system. We found that adult A. tristis females preferred to oviposit on healthy plants in the field, and that healthy plants supported higher populations of nymphs. Collectively, our recent findings suggest that CMV-induced changes in host plant chemistry influence the behavior of both vector and non-vector herbivores, with significant implications both for disease spread and for broader community-level interactions.

  14. Reduction of artifacts caused by orthopedic hardware in the spine in spectral detector CT examinations using virtual monoenergetic image reconstructions and metal-artifact-reduction algorithms.

    PubMed

    Große Hokamp, Nils; Neuhaus, V; Abdullayev, N; Laukamp, K; Lennartz, S; Mpotsaris, A; Borggrefe, J

    2018-02-01

    Aim of this study was to assess the artifact reduction in patients with orthopedic hardware in the spine as provided by (1) metal-artifact-reduction algorithms (O-MAR) and (2) virtual monoenergetic images (MonoE) as provided by spectral detector CT (SDCT) compared to conventional iterative reconstruction (CI). In all, 28 consecutive patients with orthopedic hardware in the spine who underwent SDCT-examinations were included. CI, O-MAR and MonoE (40-200 keV) images were reconstructed. Attenuation (HU) and noise (SD) were measured in order to calculate signal-to-noise ratio (SNR) of paravertebral muscle and spinal canal. Subjective image quality was assessed by two radiologists in terms of image quality and extent of artifact reduction. O-MAR and high-keV MonoE showed significant decrease of hypodense artifacts in terms of higher attenuation as compared to CI (CI vs O-MAR, 200 keV MonoE: -396.5HU vs. -115.2HU, -48.1HU; both p ≤ 0.001). Further, artifacts as depicted by noise were reduced in O-MAR and high-keV MonoE as compared to CI in (1) paravertebral muscle and (2) spinal canal-CI vs. O-MAR/200 keV: (1) 34.7 ± 19.0 HU vs. 26.4 ± 14.4 HU, p ≤ 0.05/27.4 ± 16.1, n.s.; (2) 103.4 ± 61.3 HU vs. 72.6 ± 62.6 HU/60.9 ± 40.1 HU, both p ≤ 0.001. Subjectively both O-MAR and high-keV images yielded an artifact reduction in up to 24/28 patients. Both, O-MAR and high-keV MonoE reconstructions as provided by SDCT lead to objective and subjective artifact reduction, thus the combination of O-MAR and MonoE seems promising for further reduction.

  15. Removing ballistocardiogram (BCG) artifact from full-scalp EEG acquired inside the MR scanner with Orthogonal Matching Pursuit (OMP)

    PubMed Central

    Xia, Hongjing; Ruan, Dan; Cohen, Mark S.

    2014-01-01

    Ballistocardiogram (BCG) artifact remains a major challenge that renders electroencephalographic (EEG) signals hard to interpret in simultaneous EEG and functional MRI (fMRI) data acquisition. Here, we propose an integrated learning and inference approach that takes advantage of a commercial high-density EEG cap, to estimate the BCG contribution in noisy EEG recordings from inside the MR scanner. To estimate reliably the full-scalp BCG artifacts, a near-optimal subset (20 out of 256) of channels first was identified using a modified recording setup. In subsequent recordings inside the MR scanner, BCG-only signal from this subset of channels was used to generate continuous estimates of the full-scalp BCG artifacts via inference, from which the intended EEG signal was recovered. The reconstruction of the EEG was performed with both a direct subtraction and an optimization scheme. We evaluated the performance on both synthetic and real contaminated recordings, and compared it to the benchmark Optimal Basis Set (OBS) method. In the challenging non-event-related-potential (non-ERP) EEG studies, our reconstruction can yield more than fourteen-fold improvement in reducing the normalized RMS error of EEG signals, compared to OBS. PMID:25120421

  16. Rényi squashed entanglement, discord, and relative entropy differences

    NASA Astrophysics Data System (ADS)

    Seshadreesan, Kaushik P.; Berta, Mario; Wilde, Mark M.

    2015-10-01

    The squashed entanglement quantifies the amount of entanglement in a bipartite quantum state, and it satisfies all of the axioms desired for an entanglement measure. The quantum discord is a measure of quantum correlations that are different from those due to entanglement. What these two measures have in common is that they are both based upon the conditional quantum mutual information. In Berta et al (2015 J. Math. Phys. 56 022205), we recently proposed Rényi generalizations of the conditional quantum mutual information of a tripartite state on ABC (with C being the conditioning system), which were shown to satisfy some properties that hold for the original quantity, such as non-negativity, duality, and monotonicity with respect to local operations on the system B (with it being left open to show that the Rényi quantity is monotone with respect to local operations on system A). Here we define a Rényi squashed entanglement and a Rényi quantum discord based on a Rényi conditional quantum mutual information and investigate these quantities in detail. Taking as a conjecture that the Rényi conditional quantum mutual information is monotone with respect to local operations on both systems A and B, we prove that the Rényi squashed entanglement and the Rényi quantum discord satisfy many of the properties of the respective original von Neumann entropy based quantities. In our prior work (Berta et al 2015 Phys. Rev. A 91 022333), we also detailed a procedure to obtain Rényi generalizations of any quantum information measure that is equal to a linear combination of von Neumann entropies with coefficients chosen from the set \\{-1,0,1\\}. Here, we extend this procedure to include differences of relative entropies. Using the extended procedure and a conjectured monotonicity of the Rényi generalizations in the Rényi parameter, we discuss potential remainder terms for well known inequalities such as monotonicity of the relative entropy, joint convexity of the relative entropy, and the Holevo bound.

  17. Comparative spatial spread overtime of Zucchini Yellow Mosaic Virus (ZYMV) and Watermelon Mosaic Virus (WMV) in fields of transgenic squash expressing the coat protein genes of ZYMV and WMV, and in fields of nontransgenic squash.

    PubMed

    Klas, Ferdinand E; Fuchs, Marc; Gonsalves, Dennis

    2006-10-01

    The spatial and temporal patterns of aphid-vectored spread of Zucchini Yellow Mosaic Virus (ZYMV) and Watermelon Mosaic Virus (WMV) were monitored over two consecutive years in plantings of nontransgenic and transgenic squash ZW-20H (commercial cv. Freedom II) and ZW-20B, both expressing the coat protein genes of ZYMV and WMV. All test plants were surrounded by nontransgenic plants that were mechanically inoculated with ZYMV or WMV, and served as primary virus source. Across all trials, none of the transgenic plants exhibited systemic symptoms upon infection by ZYMV and WMV but a few of them developed localized chlorotic dots and/or blotches, and had low mixed infection rates [4% (6 of 139) of ZW-20H and 9% (13 of 139) of ZW-20B], as shown by ELISA. Geostatistical analysis of ELISA positive transgenic plants indicated, (i) a lack of spatial relationship on spread of ZYMV and WMV for ZW-20H with flat omnidirectional experimental semivariograms that fitted poorly theoretical models, and (ii) some extent of spatial dependence on ZYMV spread for ZW-20B with a well structured experimental semivariogram that fitted poorly theoretical models during the first but not the second growing season. In contrast, a strong spatial dependence on spread of ZYMV and WMV was found for nontransgenic plants, which developed severe systemic symptoms, had prevalent mixed infection rates (62%, 86 of 139), and well-defined omnidirectional experimental semivariograms that fitted a spherical model. Geostatistical data were sustained by virus transmission experiments with Myzus persicae in screenhouses, showing that commercial transgenic squash ZW-20H alter the dynamics of ZYMV and WMV epidemics by preventing secondary plant-to-plant spread.

  18. Italian horticultural and culinary records of summer squash (Cucurbita pepo, Cucurbitaceae) and emergence of the zucchini in 19th-century Milan

    PubMed Central

    Lust, Teresa A.; Paris, Harry S.

    2016-01-01

    Background and Aims Summer squash, the young fruits of Cucurbita pepo, are a common, high-value fruit vegetable. Of the summer squash, the zucchini, C. pepo subsp. pepo Zucchini Group, is by far the most cosmopolitan. The zucchini is easily distinguished from other summer squash by its uniformly cylindrical shape and intense colour. The zucchini is a relatively new cultivar-group of C. pepo, the earliest known evidence for its existence having been a description in a book on horticulture published in Milan in 1901. For this study, Italian-language books on agriculture and cookery dating from the 16th to 19th centuries have been collected and searched in an effort to follow the horticultural development and culinary use of young Cucurbita fruits in Italy. Findings The results indicate that Cucurbita fruits, both young and mature, entered Italian kitchens by the mid-16th century. A half-century later, round and elongate young fruits of C. pepo were addressed as separate cookery items and the latter had largely replaced the centuries-old culinary use of young, elongate bottle gourds, Lagenaria siceraria. Allusion to a particular, extant cultivar of the longest fruited C. pepo, the Cocozelle Group, dates to 1811 and derives from the environs of Naples. The Italian diminutive word zucchini arose by the beginning of the 19th century in Tuscany and referred to small, mature, desiccated bottle gourds used as containers to store tobacco. By the 1840s, the Tuscan word zucchini was appropriated to young, primarily elongate fruits of C. pepo. The Zucchini Group traces its origins to the environs of Milan, perhaps as early as 1850. The word zucchini and the horticultural product zucchini arose contemporaneously but independently. The results confirm that the Zucchini Group is the youngest of the four cultivar-groups of C. pepo subsp. pepo but it emerged approximately a half-century earlier than previously known. PMID:27343231

  19. Revisiting the ADT mass of the five-dimensional rotating black holes with squashed horizons

    NASA Astrophysics Data System (ADS)

    Peng, Jun-Jin

    2017-10-01

    We evaluate the Abbott-Deser-Tekin (ADT) mass of the five-dimensional rotating black holes with squashed horizons on two different on-shell reference backgrounds, which are the flat background and the boundary matched Kaluza-Klein (KK) monopole. The mass on the former, identified with the one on the background of the asymptotic geometry, differs from the mass on the latter by that of the KK monopole. However, each mass satisfies the first law of black hole thermodynamics. To test the results in five dimensions, we compute the mass in the context of the dimensionally reduced theory. Finally, in contrast with the original ADT formulation, its off-shell generalisation is applied to calculate the mass as well.

  20. High-fiber foods

    MedlinePlus

    ... potatoes with skin Broccoli, artichokes, squashes, and string beans You can also get more fiber by eating: Legumes, such as lentils, black beans, split peas, kidney beans, lima beans, and chickpeas ...

  1. Mitigating artifacts in back-projection source imaging with implications for frequency-dependent properties of the Tohoku-Oki earthquake

    NASA Astrophysics Data System (ADS)

    Meng, Lingsen; Ampuero, Jean-Paul; Luo, Yingdi; Wu, Wenbo; Ni, Sidao

    2012-12-01

    Comparing teleseismic array back-projection source images of the 2011 Tohoku-Oki earthquake with results from static and kinematic finite source inversions has revealed little overlap between the regions of high- and low-frequency slip. Motivated by this interesting observation, back-projection studies extended to intermediate frequencies, down to about 0.1 Hz, have suggested that a progressive transition of rupture properties as a function of frequency is observable. Here, by adapting the concept of array response function to non-stationary signals, we demonstrate that the "swimming artifact", a systematic drift resulting from signal non-stationarity, induces significant bias on beamforming back-projection at low frequencies. We introduce a "reference window strategy" into the multitaper-MUSIC back-projection technique and significantly mitigate the "swimming artifact" at high frequencies (1 s to 4 s). At lower frequencies, this modification yields notable, but significantly smaller, artifacts than time-domain stacking. We perform extensive synthetic tests that include a 3D regional velocity model for Japan. We analyze the recordings of the Tohoku-Oki earthquake at the USArray and at the European array at periods from 1 s to 16 s. The migration of the source location as a function of period, regardless of the back-projection methods, has characteristics that are consistent with the expected effect of the "swimming artifact". In particular, the apparent up-dip migration as a function of frequency obtained with the USArray can be explained by the "swimming artifact". This indicates that the most substantial frequency-dependence of the Tohoku-Oki earthquake source occurs at periods longer than 16 s. Thus, low-frequency back-projection needs to be further tested and validated in order to contribute to the characterization of frequency-dependent rupture properties.

  2. Influence of metallic artifact filtering on MEG signals for source localization during interictal epileptiform activity

    NASA Astrophysics Data System (ADS)

    Migliorelli, Carolina; Alonso, Joan F.; Romero, Sergio; Mañanas, Miguel A.; Nowak, Rafał; Russi, Antonio

    2016-04-01

    Objective. Medical intractable epilepsy is a common condition that affects 40% of epileptic patients that generally have to undergo resective surgery. Magnetoencephalography (MEG) has been increasingly used to identify the epileptogenic foci through equivalent current dipole (ECD) modeling, one of the most accepted methods to obtain an accurate localization of interictal epileptiform discharges (IEDs). Modeling requires that MEG signals are adequately preprocessed to reduce interferences, a task that has been greatly improved by the use of blind source separation (BSS) methods. MEG recordings are highly sensitive to metallic interferences originated inside the head by implanted intracranial electrodes, dental prosthesis, etc and also coming from external sources such as pacemakers or vagal stimulators. To reduce these artifacts, a BSS-based fully automatic procedure was recently developed and validated, showing an effective reduction of metallic artifacts in simulated and real signals (Migliorelli et al 2015 J. Neural Eng. 12 046001). The main objective of this study was to evaluate its effects in the detection of IEDs and ECD modeling of patients with focal epilepsy and metallic interference. Approach. A comparison between the resulting positions of ECDs was performed: without removing metallic interference; rejecting only channels with large metallic artifacts; and after BSS-based reduction. Measures of dispersion and distance of ECDs were defined to analyze the results. Main results. The relationship between the artifact-to-signal ratio and ECD fitting showed that higher values of metallic interference produced highly scattered dipoles. Results revealed a significant reduction on dispersion using the BSS-based reduction procedure, yielding feasible locations of ECDs in contrast to the other two approaches. Significance. The automatic BSS-based method can be applied to MEG datasets affected by metallic artifacts as a processing step to improve the localization of epileptic foci.

  3. High resolution 4-D spectroscopy with sparse concentric shell sampling and FFT-CLEAN.

    PubMed

    Coggins, Brian E; Zhou, Pei

    2008-12-01

    Recent efforts to reduce the measurement time for multidimensional NMR experiments have fostered the development of a variety of new procedures for sampling and data processing. We recently described concentric ring sampling for 3-D NMR experiments, which is superior to radial sampling as input for processing by a multidimensional discrete Fourier transform. Here, we report the extension of this approach to 4-D spectroscopy as Randomized Concentric Shell Sampling (RCSS), where sampling points for the indirect dimensions are positioned on concentric shells, and where random rotations in the angular space are used to avoid coherent artifacts. With simulations, we show that RCSS produces a very low level of artifacts, even with a very limited number of sampling points. The RCSS sampling patterns can be adapted to fine rectangular grids to permit use of the Fast Fourier Transform in data processing, without an apparent increase in the artifact level. These artifacts can be further reduced to the noise level using the iterative CLEAN algorithm developed in radioastronomy. We demonstrate these methods on the high resolution 4-D HCCH-TOCSY spectrum of protein G's B1 domain, using only 1.2% of the sampling that would be needed conventionally for this resolution. The use of a multidimensional FFT instead of the slow DFT for initial data processing and for subsequent CLEAN significantly reduces the calculation time, yielding an artifact level that is on par with the level of the true spectral noise.

  4. High Resolution 4-D Spectroscopy with Sparse Concentric Shell Sampling and FFT-CLEAN

    PubMed Central

    Coggins, Brian E.; Zhou, Pei

    2009-01-01

    SUMMARY Recent efforts to reduce the measurement time for multidimensional NMR experiments have fostered the development of a variety of new procedures for sampling and data processing. We recently described concentric ring sampling for 3-D NMR experiments, which is superior to radial sampling as input for processing by a multidimensional discrete Fourier transform. Here, we report the extension of this approach to 4-D spectroscopy as Randomized Concentric Shell Sampling (RCSS), where sampling points for the indirect dimensions are positioned on concentric shells, and where random rotations in the angular space are used to avoid coherent artifacts. With simulations, we show that RCSS produces a very low level of artifacts, even with a very limited number of sampling points. The RCSS sampling patterns can be adapted to fine rectangular grids to permit use of the Fast Fourier Transform in data processing, without an apparent increase in the artifact level. These artifacts can be further reduced to the noise level using the iterative CLEAN algorithm developed in radioastronomy. We demonstrate these methods on the high resolution 4-D HCCH-TOCSY spectrum of protein G's B1 domain, using only 1.2% of the sampling that would be needed conventionally for this resolution. The use of a multidimensional FFT instead of the slow DFT for initial data processing and for subsequent CLEAN significantly reduces the calculation time, yielding an artifact level that is on par with the level of the true spectral noise. PMID:18853260

  5. Chlorophyllase is a rate-limiting enzyme in chlorophyll catabolism and is posttranslationally regulated.

    PubMed

    Harpaz-Saad, Smadar; Azoulay, Tamar; Arazi, Tzahi; Ben-Yaakov, Eran; Mett, Anahit; Shiboleth, Yoel M; Hörtensteiner, Stefan; Gidoni, David; Gal-On, Amit; Goldschmidt, Eliezer E; Eyal, Yoram

    2007-03-01

    Chlorophyll is a central player in harvesting light energy for photosynthesis, yet the rate-limiting steps of chlorophyll catabolism and the regulation of the catabolic enzymes remain unresolved. To study the role and regulation of chlorophyllase (Chlase), the first enzyme of the chlorophyll catabolic pathway, we expressed precursor and mature versions of citrus (Citrus sinensis) Chlase in two heterologous plant systems: (1) squash (Cucurbita pepo) plants using a viral vector expression system; and (2) transiently transformed tobacco (Nicotiana tabacum) protoplasts. Expression of full-length citrus Chlase resulted in limited chlorophyll breakdown in protoplasts and no visible leaf phenotype in whole plants, whereas expression of a Chlase version lacking the N-terminal 21 amino acids (ChlaseDeltaN), which corresponds to the mature protein, led to extensive chlorophyll breakdown in both tobacco protoplasts and squash leaves. ChlaseDeltaN-expressing squash leaves displayed a dramatic chlorotic phenotype in plants grown under low-intensity light, whereas under natural light a lesion-mimic phenotype occurred, which was demonstrated to follow the accumulation of chlorophyllide, a photodynamic chlorophyll breakdown product. Full-length and mature citrus Chlase versions were localized to the chloroplast membrane fraction in expressing tobacco protoplasts, where processing of the N-terminal 21 amino acids appears to occur. Results obtained in both plant systems suggest that Chlase functions as a rate-limiting enzyme in chlorophyll catabolism controlled via posttranslational regulation.

  6. Recovering stereo vision by squashing virtual bugs in a virtual reality environment.

    PubMed

    Vedamurthy, Indu; Knill, David C; Huang, Samuel J; Yung, Amanda; Ding, Jian; Kwon, Oh-Sang; Bavelier, Daphne; Levi, Dennis M

    2016-06-19

    Stereopsis is the rich impression of three-dimensionality, based on binocular disparity-the differences between the two retinal images of the same world. However, a substantial proportion of the population is stereo-deficient, and relies mostly on monocular cues to judge the relative depth or distance of objects in the environment. Here we trained adults who were stereo blind or stereo-deficient owing to strabismus and/or amblyopia in a natural visuomotor task-a 'bug squashing' game-in a virtual reality environment. The subjects' task was to squash a virtual dichoptic bug on a slanted surface, by hitting it with a physical cylinder they held in their hand. The perceived surface slant was determined by monocular texture and stereoscopic cues, with these cues being either consistent or in conflict, allowing us to track the relative weighting of monocular versus stereoscopic cues as training in the task progressed. Following training most participants showed greater reliance on stereoscopic cues, reduced suppression and improved stereoacuity. Importantly, the training-induced changes in relative stereo weights were significant predictors of the improvements in stereoacuity. We conclude that some adults deprived of normal binocular vision and insensitive to the disparity information can, with appropriate experience, recover access to more reliable stereoscopic information.This article is part of the themed issue 'Vision in our three-dimensional world'. © 2016 The Author(s).

  7. Drosophila Hox and Sex-Determination Genes Control Segment Elimination through EGFR and extramacrochetae Activity

    PubMed Central

    Foronda, David; Martín, Paloma; Sánchez-Herrero, Ernesto

    2012-01-01

    The formation or suppression of particular structures is a major change occurring in development and evolution. One example of such change is the absence of the seventh abdominal segment (A7) in Drosophila males. We show here that there is a down-regulation of EGFR activity and fewer histoblasts in the male A7 in early pupae. If this activity is elevated, cell number increases and a small segment develops in the adult. At later pupal stages, the remaining precursors of the A7 are extruded under the epithelium. This extrusion requires the up-regulation of the HLH protein Extramacrochetae and correlates with high levels of spaghetti-squash, the gene encoding the regulatory light chain of the non-muscle myosin II. The Hox gene Abdominal-B controls both the down-regulation of spitz, a ligand of the EGFR pathway, and the up-regulation of extramacrochetae, and also regulates the transcription of the sex-determining gene doublesex. The male Doublesex protein, in turn, controls extramacrochetae and spaghetti-squash expression. In females, the EGFR pathway is also down-regulated in the A7 but extramacrochetae and spaghetti-squash are not up-regulated and extrusion of precursor cells is almost absent. Our results show the complex orchestration of cellular and genetic events that lead to this important sexually dimorphic character change. PMID:22912593

  8. The effectiveness of a squash eyewear promotion strategy

    PubMed Central

    Eime, R; Finch, C; Wolfe, R; Owen, N; McCarty, C

    2005-01-01

    Objective: To evaluate the protective eyewear promotion (PEP) project, which was a comprehensive educational strategy to increase the use of appropriate protective eyewear by squash players. Methods: An ecological study design was used. Four squash venues in one playing association were randomly chosen to receive PEP and four in another association maintained usual practice and hence formed a control group. The primary evaluation measurements were surveys of cross sectional samples of players carried out before and after the intervention. The surveys investigated players' knowledge, behaviours, and attitudes associated with the use of protective eyewear. The survey carried out after the intervention also determined players' exposure to PEP. Univariate and multivariate analyses were undertaken to describe differences at PEP venues from pre- to post-intervention and to compare these with the control venues. Results: The PEP players had 2.4 times the odds (95% confidence interval, 1.3 to 4.2) of wearing appropriate eyewear compared with control group players post-intervention, relative to the groups' pre-intervention baselines. Components of PEP, such as stickers and posters and the availability and prominent positioning of the project eyewear, were found to contribute to players adopting favourable eyewear behaviours. Conclusions: Components of the PEP intervention were shown to be effective. The true success will be the sustainability and dissemination of the project, favourable eyewear behaviours, and evidence of the prevention of eye injuries long into the future. PMID:16118310

  9. SU-E-T-329: Dosimetric Impact of Implementing Metal Artifact Reduction Methods and Metal Energy Deposition Kernels for Photon Dose Calculations

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Huang, J; Followill, D; Howell, R

    2015-06-15

    Purpose: To investigate two strategies for reducing dose calculation errors near metal implants: use of CT metal artifact reduction methods and implementation of metal-based energy deposition kernels in the convolution/superposition (C/S) method. Methods: Radiochromic film was used to measure the dose upstream and downstream of titanium and Cerrobend implants. To assess the dosimetric impact of metal artifact reduction methods, dose calculations were performed using baseline, uncorrected images and metal artifact reduction Methods: Philips O-MAR, GE’s monochromatic gemstone spectral imaging (GSI) using dual-energy CT, and GSI imaging with metal artifact reduction software applied (MARs).To assess the impact of metal kernels, titaniummore » and silver kernels were implemented into a commercial collapsed cone C/S algorithm. Results: The CT artifact reduction methods were more successful for titanium than Cerrobend. Interestingly, for beams traversing the metal implant, we found that errors in the dimensions of the metal in the CT images were more important for dose calculation accuracy than reduction of imaging artifacts. The MARs algorithm caused a distortion in the shape of the titanium implant that substantially worsened the calculation accuracy. In comparison to water kernel dose calculations, metal kernels resulted in better modeling of the increased backscatter dose at the upstream interface but decreased accuracy directly downstream of the metal. We also found that the success of metal kernels was dependent on dose grid size, with smaller calculation voxels giving better accuracy. Conclusion: Our study yielded mixed results, with neither the metal artifact reduction methods nor the metal kernels being globally effective at improving dose calculation accuracy. However, some successes were observed. The MARs algorithm decreased errors downstream of Cerrobend by a factor of two, and metal kernels resulted in more accurate backscatter dose upstream of metals. Thus, these two strategies do have the potential to improve accuracy for patients with metal implants in certain scenarios. This work was supported by Public Health Service grants CA 180803 and CA 10953 awarded by the National Cancer Institute, United States of Health and Human Services, and in part by Mobius Medical Systems.« less

  10. Trails of meaning construction: Symbolic artifacts engage the social brain.

    PubMed

    Tylén, Kristian; Philipsen, Johanne Stege; Roepstorff, Andreas; Fusaroli, Riccardo

    2016-07-01

    Symbolic artifacts present a challenge to theories of neurocognitive processing due to their hybrid nature: they are at the same time physical objects and vehicles of intangible social meanings. While their physical properties can be read of their perceptual appearance, the meaning of symbolic artifacts depends on the perceiver's interpretative attitude and embeddedness in cultural practices. In this study, participants built models of LEGO bricks to illustrate their understanding of abstract concepts. They were then scanned with fMRI while presented to photographs of their own and others' models. When participants attended to the meaning of the models in contrast to their bare physical properties, we observed activations in mPFC and TPJ, areas often associated with social cognition, and IFG, possibly related to semantics. When contrasting own and others' models, we also found activations in precuneus, an area associated with autobiographical memory and agency, while looking at one's own collective models yielded interaction effects in rostral ACC, right IFG and left Insula. Interestingly, variability in the insula was predicted by individual differences in participants' feeling of relatedness to their fellow group members during LEGO construction activity. Our findings support a view of symbolic artifacts as neuro-cognitive trails of human social interactions. Copyright © 2016 Elsevier Inc. All rights reserved.

  11. Optimization-Based Image Reconstruction with Artifact Reduction in C-Arm CBCT

    PubMed Central

    Xia, Dan; Langan, David A.; Solomon, Stephen B.; Zhang, Zheng; Chen, Buxin; Lai, Hao; Sidky, Emil Y.; Pan, Xiaochuan

    2016-01-01

    We investigate an optimization-based reconstruction, with an emphasis on image-artifact reduction, from data collected in C-arm cone-beam computed tomography (CBCT) employed in image-guided interventional procedures. In the study, an image to be reconstructed is formulated as a solution to a convex optimization program in which a weighted data divergence is minimized subject to a constraint on the image total variation (TV); a data-derivative fidelity is introduced in the program specifically for effectively suppressing dominant, low-frequency data artifact caused by, e.g., data truncation; and the Chambolle-Pock (CP) algorithm is tailored to reconstruct an image through solving the program. Like any other reconstructions, the optimization-based reconstruction considered depends upon numerous parameters. We elucidate the parameters, illustrate their determination, and demonstrate their impact on the reconstruction. The optimization-based reconstruction, when applied to data collected from swine and patient subjects, yields images with visibly reduced artifacts in contrast to the reference reconstruction, and it also appears to exhibit a high degree of robustness against distinctively different anatomies of imaged subjects and scanning conditions of clinical significance. Knowledge and insights gained in the study may be exploited for aiding in the design of practical reconstructions of truly clinical-application utility. PMID:27694700

  12. Optimization-based image reconstruction with artifact reduction in C-arm CBCT

    NASA Astrophysics Data System (ADS)

    Xia, Dan; Langan, David A.; Solomon, Stephen B.; Zhang, Zheng; Chen, Buxin; Lai, Hao; Sidky, Emil Y.; Pan, Xiaochuan

    2016-10-01

    We investigate an optimization-based reconstruction, with an emphasis on image-artifact reduction, from data collected in C-arm cone-beam computed tomography (CBCT) employed in image-guided interventional procedures. In the study, an image to be reconstructed is formulated as a solution to a convex optimization program in which a weighted data divergence is minimized subject to a constraint on the image total variation (TV); a data-derivative fidelity is introduced in the program specifically for effectively suppressing dominant, low-frequency data artifact caused by, e.g. data truncation; and the Chambolle-Pock (CP) algorithm is tailored to reconstruct an image through solving the program. Like any other reconstructions, the optimization-based reconstruction considered depends upon numerous parameters. We elucidate the parameters, illustrate their determination, and demonstrate their impact on the reconstruction. The optimization-based reconstruction, when applied to data collected from swine and patient subjects, yields images with visibly reduced artifacts in contrast to the reference reconstruction, and it also appears to exhibit a high degree of robustness against distinctively different anatomies of imaged subjects and scanning conditions of clinical significance. Knowledge and insights gained in the study may be exploited for aiding in the design of practical reconstructions of truly clinical-application utility.

  13. Comparison of DWI Methods in the Pediatric Brain: PROPELLER Turbo Spin-Echo Imaging Versus Readout-Segmented Echo-Planar Imaging Versus Single-Shot Echo-Planar Imaging.

    PubMed

    Kim, Tae-Hyung; Baek, Moon-Young; Park, Ji Eun; Ryu, Young Jin; Cheon, Jung-Eun; Kim, In-One; Choi, Young Hun

    2018-06-01

    The purpose of this study is to compare DWI for pediatric brain evaluation using single-shot echo-planar imaging (EPI), periodically rotated overlapping parallel lines with enhanced reconstruction (Blade), and readout-segmented EPI (Resolve). Blade, Resolve, and single-shot EPI were performed for 27 pediatric patients (median age, 9 years), and three datasets were independently reviewed by two radiologists. Qualitative analyses were performed for perceptive coarseness, image distortion, susceptibility-related changes, motion artifacts, and lesion conspicuity using a 5-point Likert scale. Quantitative analyses were conducted for spatial distortion and signal uniformity of each sequence. Mean scores were 2.13, 3.17, and 3.76 for perceptive coarseness; 4.85, 3.96, and 2.19 for image distortion; 4.76, 3.96, and 2.30 for susceptibility-related change; 4.96, 3.83, and 4.69 for motion artifacts; and 2.71, 3.75, and 1.92 for lesion conspicuity, for Blade, Resolve, and single-shot EPI, respectively. Blade and Resolve showed better quality than did single-shot EPI for image distortion, susceptibility-related changes, and lesion conspicuity. Blade showed less image distortion, fewer susceptibility-related changes, and fewer motion artifacts than did Resolve, whereas lesion conspicuity was better with Resolve. Blade showed increased signal variation compared with Resolve and single-shot EPI (coefficients of variation were 0.10, 0.08, and 0.05 for lateral ventricle; 0.13, 0.09, and 0.05 for centrum semiovale; and 0.16, 0.09, and 0.06 for pons in Blade, Resolve, and single-shot EPI, respectively). DWI with Resolve or Blade yields better quality regarding distortion, susceptibility-related changes, and lesion conspicuity, compared with single-shot EPI. Blade is less susceptible to motion artifacts than is Resolve, whereas Resolve yields less noise and better lesion conspicuity than does Blade.

  14. Unsupervised detection and removal of muscle artifacts from scalp EEG recordings using canonical correlation analysis, wavelets and random forests.

    PubMed

    Anastasiadou, Maria N; Christodoulakis, Manolis; Papathanasiou, Eleftherios S; Papacostas, Savvas S; Mitsis, Georgios D

    2017-09-01

    This paper proposes supervised and unsupervised algorithms for automatic muscle artifact detection and removal from long-term EEG recordings, which combine canonical correlation analysis (CCA) and wavelets with random forests (RF). The proposed algorithms first perform CCA and continuous wavelet transform of the canonical components to generate a number of features which include component autocorrelation values and wavelet coefficient magnitude values. A subset of the most important features is subsequently selected using RF and labelled observations (supervised case) or synthetic data constructed from the original observations (unsupervised case). The proposed algorithms are evaluated using realistic simulation data as well as 30min epochs of non-invasive EEG recordings obtained from ten patients with epilepsy. We assessed the performance of the proposed algorithms using classification performance and goodness-of-fit values for noisy and noise-free signal windows. In the simulation study, where the ground truth was known, the proposed algorithms yielded almost perfect performance. In the case of experimental data, where expert marking was performed, the results suggest that both the supervised and unsupervised algorithm versions were able to remove artifacts without affecting noise-free channels considerably, outperforming standard CCA, independent component analysis (ICA) and Lagged Auto-Mutual Information Clustering (LAMIC). The proposed algorithms achieved excellent performance for both simulation and experimental data. Importantly, for the first time to our knowledge, we were able to perform entirely unsupervised artifact removal, i.e. without using already marked noisy data segments, achieving performance that is comparable to the supervised case. Overall, the results suggest that the proposed algorithms yield significant future potential for improving EEG signal quality in research or clinical settings without the need for marking by expert neurophysiologists, EMG signal recording and user visual inspection. Copyright © 2017 International Federation of Clinical Neurophysiology. Published by Elsevier B.V. All rights reserved.

  15. Is it possible to automatically distinguish resting EEG data of normal elderly vs. mild cognitive impairment subjects with high degree of accuracy?

    PubMed

    Rossini, Paolo M; Buscema, Massimo; Capriotti, Massimiliano; Grossi, Enzo; Rodriguez, Guido; Del Percio, Claudio; Babiloni, Claudio

    2008-07-01

    It has been shown that a new procedure (implicit function as squashing time, IFAST) based on artificial neural networks (ANNs) is able to compress eyes-closed resting electroencephalographic (EEG) data into spatial invariants of the instant voltage distributions for an automatic classification of mild cognitive impairment (MCI) and Alzheimer's disease (AD) subjects with classification accuracy of individual subjects higher than 92%. Here we tested the hypothesis that this is the case also for the classification of individual normal elderly (Nold) vs. MCI subjects, an important issue for the screening of large populations at high risk of AD. Eyes-closed resting EEG data (10-20 electrode montage) were recorded in 171 Nold and in 115 amnesic MCI subjects. The data inputs for the classification by IFAST were the weights of the connections within a nonlinear auto-associative ANN trained to generate the instant voltage distributions of 60-s artifact-free EEG data. The most relevant features were selected and coincidently the dataset was split into two halves for the final binary classification (training and testing) performed by a supervised ANN. The classification of the individual Nold and MCI subjects reached 95.87% of sensitivity and 91.06% of specificity (93.46% of accuracy). These results indicate that IFAST can reliably distinguish eyes-closed resting EEG in individual Nold and MCI subjects. IFAST may be used for large-scale periodic screening of large populations at risk of AD and personalized care.

  16. Reliability of EEG Measures of Interaction: A Paradigm Shift Is Needed to Fight the Reproducibility Crisis

    PubMed Central

    Höller, Yvonne; Uhl, Andreas; Bathke, Arne; Thomschewski, Aljoscha; Butz, Kevin; Nardone, Raffaele; Fell, Jürgen; Trinka, Eugen

    2017-01-01

    Measures of interaction (connectivity) of the EEG are at the forefront of current neuroscientific research. Unfortunately, test-retest reliability can be very low, depending on the measure and its estimation, the EEG-frequency of interest, the length of the signal, and the population under investigation. In addition, artifacts can hamper the continuity of the EEG signal, and in some clinical situations it is impractical to exclude artifacts. We aimed to examine factors that moderate test-retest reliability of measures of interaction. The study involved 40 patients with a range of neurological diseases and memory impairments (age median: 60; range 21–76; 40% female; 22 mild cognitive impairment, 5 subjective cognitive complaints, 13 temporal lobe epilepsy), and 20 healthy controls (age median: 61.5; range 23–74; 70% female). We calculated 14 measures of interaction based on the multivariate autoregressive model from two EEG-recordings separated by 2 weeks. We characterized test-retest reliability by correlating the measures between the two EEG-recordings for variations of data length, data discontinuity, artifact exclusion, model order, and frequency over all combinations of channels and all frequencies, individually for each subject, yielding a correlation coefficient for each participant. Excluding artifacts had strong effects on reliability of some measures, such as classical, real valued coherence (~0.1 before, ~0.9 after artifact exclusion). Full frequency directed transfer function was highly reliable and robust against artifacts. Variation of data length decreased reliability in relation to poor adjustment of model order and signal length. Variation of discontinuity had no effect, but reliabilities were different between model orders, frequency ranges, and patient groups depending on the measure. Pathology did not interact with variation of signal length or discontinuity. Our results emphasize the importance of documenting reliability, which may vary considerably between measures of interaction. We recommend careful selection of measures of interaction in accordance with the properties of the data. When only short data segments are available and when the signal length varies strongly across subjects after exclusion of artifacts, reliability becomes an issue. Finally, measures which show high reliability irrespective of the presence of artifacts could be extremely useful in clinical situations when exclusion of artifacts is impractical. PMID:28912704

  17. Photoacoustic image reconstruction via deep learning

    NASA Astrophysics Data System (ADS)

    Antholzer, Stephan; Haltmeier, Markus; Nuster, Robert; Schwab, Johannes

    2018-02-01

    Applying standard algorithms to sparse data problems in photoacoustic tomography (PAT) yields low-quality images containing severe under-sampling artifacts. To some extent, these artifacts can be reduced by iterative image reconstruction algorithms which allow to include prior knowledge such as smoothness, total variation (TV) or sparsity constraints. These algorithms tend to be time consuming as the forward and adjoint problems have to be solved repeatedly. Further, iterative algorithms have additional drawbacks. For example, the reconstruction quality strongly depends on a-priori model assumptions about the objects to be recovered, which are often not strictly satisfied in practical applications. To overcome these issues, in this paper, we develop direct and efficient reconstruction algorithms based on deep learning. As opposed to iterative algorithms, we apply a convolutional neural network, whose parameters are trained before the reconstruction process based on a set of training data. For actual image reconstruction, a single evaluation of the trained network yields the desired result. Our presented numerical results (using two different network architectures) demonstrate that the proposed deep learning approach reconstructs images with a quality comparable to state of the art iterative reconstruction methods.

  18. Compressed Sensing SEMAC: 8-fold Accelerated High Resolution Metal Artifact Reduction MRI of Cobalt-Chromium Knee Arthroplasty Implants.

    PubMed

    Fritz, Jan; Ahlawat, Shivani; Demehri, Shadpour; Thawait, Gaurav K; Raithel, Esther; Gilson, Wesley D; Nittka, Mathias

    2016-10-01

    The aim of this study was to prospectively test the hypothesis that a compressed sensing-based slice encoding for metal artifact correction (SEMAC) turbo spin echo (TSE) pulse sequence prototype facilitates high-resolution metal artifact reduction magnetic resonance imaging (MRI) of cobalt-chromium knee arthroplasty implants within acquisition times of less than 5 minutes, thereby yielding better image quality than high-bandwidth (BW) TSE of similar length and similar image quality than lengthier SEMAC standard of reference pulse sequences. This prospective study was approved by our institutional review board. Twenty asymptomatic subjects (12 men, 8 women; mean age, 56 years; age range, 44-82 years) with total knee arthroplasty implants underwent MRI of the knee using a commercially available, clinical 1.5 T MRI system. Two compressed sensing-accelerated SEMAC prototype pulse sequences with 8-fold undersampling and acquisition times of approximately 5 minutes each were compared with commercially available high-BW and SEMAC pulse sequences with acquisition times of approximately 5 minutes and 11 minutes, respectively. For each pulse sequence type, sagittal intermediate-weighted (TR, 3750-4120 milliseconds; TE, 26-28 milliseconds; voxel size, 0.5 × 0.5 × 3 mm) and short tau inversion recovery (TR, 4010 milliseconds; TE, 5.2-7.5 milliseconds; voxel size, 0.8 × 0.8 × 4 mm) were acquired. Outcome variables included image quality, display of the bone-implant interfaces and pertinent knee structures, artifact size, signal-to-noise ratio (SNR), and contrast-to-noise ratio (CNR). Statistical analysis included Friedman, repeated measures analysis of variances, and Cohen weighted k tests. Bonferroni-corrected P values of 0.005 and less were considered statistically significant. Image quality, bone-implant interfaces, anatomic structures, artifact size, SNR, and CNR parameters were statistically similar between the compressed sensing-accelerated SEMAC prototype and SEMAC commercial pulse sequences. There was mild blur on images of both SEMAC sequences when compared with high-BW images (P < 0.001), which however did not impair the assessment of knee structures. Metal artifact reduction and visibility of central knee structures and bone-implant interfaces were good to very good and significantly better on both types of SEMAC than on high-BW images (P < 0.004). All 3 pulse sequences showed peripheral structures similarly well. The implant artifact size was 46% to 51% larger on high-BW images when compared with both types of SEMAC images (P < 0.0001). Signal-to-noise ratios and CNRs of fat tissue, tendon tissue, muscle tissue, and fluid were statistically similar on intermediate-weighted MR images of all 3 pulse sequence types. On short tau inversion recovery images, the SNRs of tendon tissue and the CNRs of fat and fluid, fluid and muscle, as well as fluid and tendon were significantly higher on SEMAC and compressed sensing SEMAC images (P < 0.005, respectively). We accept the hypothesis that prospective compressed sensing acceleration of SEMAC is feasible for high-quality metal artifact reduction MRI of cobalt-chromium knee arthroplasty implants in less than 5 minutes and yields better quality than high-BW TSE and similarly high quality than lengthier SEMAC pulse sequences.

  19. Antioxidants: Protecting Healthy Cells

    MedlinePlus

    ... spinach, Brussels sprouts, sweet potatoes, winter squash and broccoli. Vitamin E Research has demonstrated the broad role ... oranges, grapefruits and tangerines), strawberries, sweet peppers, tomatoes, broccoli and potatoes. Challenges to Healthful Eating The best ...

  20. Figuring Out Food Labels

    MedlinePlus

    ... vegetables, such as carrots and squash, and in dark green, leafy vegetables. Vitamin C helps the body ... in iron-fortified cereals, tofu, dried beans, and dark green, leafy vegetables. Label Listings for Avoiding Allergies ...

  1. Vitamin C

    MedlinePlus

    ... tomato juice Winter squash Some cereals and other foods and beverages are fortified with vitamin C. Fortified means a vitamin or mineral has been added to the food. Check the product labels to see how much ...

  2. Italian horticultural and culinary records of summer squash (Cucurbita pepo, Cucurbitaceae) and emergence of the zucchini in 19th-century Milan.

    PubMed

    Lust, Teresa A; Paris, Harry S

    2016-07-01

    Summer squash, the young fruits of Cucurbita pepo, are a common, high-value fruit vegetable. Of the summer squash, the zucchini, C. pepo subsp. pepo Zucchini Group, is by far the most cosmopolitan. The zucchini is easily distinguished from other summer squash by its uniformly cylindrical shape and intense colour. The zucchini is a relatively new cultivar-group of C. pepo, the earliest known evidence for its existence having been a description in a book on horticulture published in Milan in 1901. For this study, Italian-language books on agriculture and cookery dating from the 16th to 19th centuries have been collected and searched in an effort to follow the horticultural development and culinary use of young Cucurbita fruits in Italy. The results indicate that Cucurbita fruits, both young and mature, entered Italian kitchens by the mid-16th century. A half-century later, round and elongate young fruits of C. pepo were addressed as separate cookery items and the latter had largely replaced the centuries-old culinary use of young, elongate bottle gourds, Lagenaria siceraria Allusion to a particular, extant cultivar of the longest fruited C. pepo, the Cocozelle Group, dates to 1811 and derives from the environs of Naples. The Italian diminutive word zucchini arose by the beginning of the 19th century in Tuscany and referred to small, mature, desiccated bottle gourds used as containers to store tobacco. By the 1840s, the Tuscan word zucchini was appropriated to young, primarily elongate fruits of C. pepo The Zucchini Group traces its origins to the environs of Milan, perhaps as early as 1850. The word zucchini and the horticultural product zucchini arose contemporaneously but independently. The results confirm that the Zucchini Group is the youngest of the four cultivar-groups of C. pepo subsp. pepo but it emerged approximately a half-century earlier than previously known. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  3. SU-F-I-41: Calibration-Free Material Decomposition for Dual-Energy CT

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Zhao, W; Xing, L; Zhang, Q

    2016-06-15

    Purpose: To eliminate tedious phantom calibration or manually region of interest (ROI) selection as required in dual-energy CT material decomposition, we establish a new projection-domain material decomposition framework with incorporation of energy spectrum. Methods: Similar to the case of dual-energy CT, the integral of the basis material image in our model is expressed as a linear combination of basis functions, which are the polynomials of high- and low-energy raw projection data. To yield the unknown coefficients of the linear combination, the proposed algorithm minimizes the quadratic error between the high- and low-energy raw projection data and the projection calculated usingmore » material images. We evaluate the algorithm with an iodine concentration numerical phantom at different dose and iodine concentration levels. The x-ray energy spectra of the high and low energy are estimated using an indirect transmission method. The derived monochromatic images are compared with the high- and low-energy CT images to demonstrate beam hardening artifacts reduction. Quantitative results were measured and compared to the true values. Results: The differences between the true density value used for simulation and that were obtained from the monochromatic images, are 1.8%, 1.3%, 2.3%, and 2.9% for the dose levels from standard dose to 1/8 dose, and are 0.4%, 0.7%, 1.5%, and 1.8% for the four iodine concentration levels from 6 mg/mL to 24 mg/mL. For all of the cases, beam hardening artifacts, especially streaks shown between dense inserts, are almost completely removed in the monochromatic images. Conclusion: The proposed algorithm provides an effective way to yield material images and artifacts-free monochromatic images at different dose levels without the need for phantom calibration or ROI selection. Furthermore, the approach also yields accurate results when the concentration of the iodine concentrate insert is very low, suggesting the algorithm is robust with respect to the low-contrast scenario.« less

  4. Uranium-series dated authigenic carbonates and acheulian sites in southern Egypt

    USGS Publications Warehouse

    Szabo, B. J.; McHugh, W.P.; Schaber, G.G.; Haynes, C.V.; Breed, C.S.

    1989-01-01

    Field investigations in southern Egypt have yielded Acheulian artifacts in situ in authigenic carbonate deposits (CaCO3-cemented alluvium) along the edges of nowaggraded paleovalleys (Wadi Arid and Wadi Safsaf). Uranium-series dating of 25 carbonate samples from various localities as far apart as 70 kilometers indicates that widespread carbonate deposition occurred about 45, 141 and 212 ka (thousand years ago). Most of the carbonate appears to have been precipitated from groundwater, which suggests that these three episodes of deposition may be related to late Pleistocene humid climates that facilitated human settlement in this now hyperarid region. Carbonate cements from sediments containing Acheulian artifacts provide a minimum age of 212 ka for early occupation of the paleovalleys.

  5. Potassium and Your CKD Diet

    MedlinePlus

    ... ¼ whole) Artichoke Chocolate (1.5-2 ounces) Banana (½ whole) Bamboo Shoots Granola Cantaloupe Baked Beans ... Sweet Potatoes, Carrots, Beets, Winter Squash, and Rutabagas: Peel and place the vegetable in cold water so ...

  6. 75 FR 62387 - Pesticide Product Registrations; Conditional Approval

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-10-08

    ... soil fumigant use on soil that will be used to grow fruiting vegetable (tomato, pepper, and eggplant... vegetable (tomato, pepper, and eggplant), cucurbit vegetable (cucumber, squash (all types), and melon (all...

  7. Avoiding Food Hassles with Kids

    MedlinePlus

    ... that have color to make it look interesting. Broccoli, beets, sweet potatoes, yellow squash, red apples, and ... Ask if they would rather have cauliflower or broccoli. Don’t forget to ask them how they’ ...

  8. 40 CFR 407.70 - Applicability; description of the canned and preserved vegetables subcategory.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ...; broccoli; carrots; canned and frozen corn; dehydrated onions and garlic; dehydrated vegetables; dry beans; lima beans; mushrooms; canned onions; peas; sauerkraut canning and cutting; snap beans; spinach; squash...

  9. 40 CFR 407.70 - Applicability; description of the canned and preserved vegetables subcategory.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ...; broccoli; carrots; canned and frozen corn; dehydrated onions and garlic; dehydrated vegetables; dry beans; lima beans; mushrooms; canned onions; peas; sauerkraut canning and cutting; snap beans; spinach; squash...

  10. 40 CFR 407.70 - Applicability; description of the canned and preserved vegetables subcategory.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ...; broccoli; carrots; canned and frozen corn; dehydrated onions and garlic; dehydrated vegetables; dry beans; lima beans; mushrooms; canned onions; peas; sauerkraut canning and cutting; snap beans; spinach; squash...

  11. 40 CFR 407.70 - Applicability; description of the canned and preserved vegetables subcategory.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ...; broccoli; carrots; canned and frozen corn; dehydrated onions and garlic; dehydrated vegetables; dry beans; lima beans; mushrooms; canned onions; peas; sauerkraut canning and cutting; snap beans; spinach; squash...

  12. 40 CFR 407.70 - Applicability; description of the canned and preserved vegetables subcategory.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ...; broccoli; carrots; canned and frozen corn; dehydrated onions and garlic; dehydrated vegetables; dry beans; lima beans; mushrooms; canned onions; peas; sauerkraut canning and cutting; snap beans; spinach; squash...

  13. 5 Top Foods for Eye Health

    MedlinePlus

    ... such as collard greens, turnip greens and spinach, broccoli, peas, kiwi, red grapes, yellow squash, oranges, corn, ... other vitamin C-rich foods including bell peppers, broccoli, citrus (such as orange and grapefruit) and cantaloupe. ...

  14. Artist Concept: Active Black Hole Squashes Star Formation

    NASA Image and Video Library

    2012-05-09

    Herschel Space Observatory has shown that galaxies with the most powerful, active, supermassive black holes at their cores produce fewer stars than galaxies with less active black holes in this artist concept.

  15. Black Holes to Blackboards

    NASA Astrophysics Data System (ADS)

    Lockwood, Jeffrey F.

    1996-03-01

    Falling stars have always had a magical aura, whether people think of them as omens or simply as natural fireworks. So why squash that natural fascination by making students memorize the difference between -ites and -oids?

  16. Squashed, magnetized black holes in D = 5 minimal gauged supergravity

    NASA Astrophysics Data System (ADS)

    Blázquez-Salcedo, Jose Luis; Kunz, Jutta; Navarro-Lérida, Francisco; Radu, Eugen

    2018-02-01

    We construct a new class of black hole solutions in five-dimensional Einstein-Maxwell-Chern-Simons theory with a negative cosmological constant. These configurations are cohomogeneity-1, with two equal-magnitude angular momenta. In the generic case, they possess a non-vanishing magnetic potential at infinity with a boundary metric which is the product of time and a squashed three-dimensional sphere. Both extremal and non-extremal black holes are studied. The non-extremal black holes satisfying a certain relation between electric charge, angular momenta and magnitude of the magnetic potential at infinity do not trivialize in the limit of vanishing event horizon size, becoming particle-like (non-topological) solitonic configurations. Among the extremal black holes, we show the existence of a new one-parameter family of supersymmetric solutions, which bifurcate from a critical Gutowski-Reall configuration.

  17. Effect of Infection by Hypomyces solani f. sp. Cucurbitac on Apparent Free Space, Cell Membrane Permeability, and Respiration of Squash Hypocotyls 1

    PubMed Central

    Hancock, Joseph G.

    1968-01-01

    Initial symptoms and increases in respiration, apparent free space, and rate of leakage of amino acids occurred concomitantly in squash (Cucurbita maxima Dcne) hypocotyls infected by Hypomyces solani f. sp. cucurbitae Snyd. and Hans. Young, rapidly expanding lesions had greater respiratory rates and apparent free space than comparable tissues from healthy plants. Hypocotyl tissues above (1-45 mm) lesions possessed greater endogenous respiratory rates (2-3 times) and lower respiratory quotients than similar tissues from healthy plants. But no differences were found in membrane permeability to nonelectrolytes and water and in apparent free space between cells above lesions and healthy hypocotyls. Host cells contiguous to fungal hyphae at lesion margins were completely permeable to solutes and failed to accumulate neutral red or exhibit cyclosis. Images PMID:16656953

  18. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Kawaguchi, Io; Yoshida, Kentaroh

    We proceed to study infinite-dimensional symmetries in two-dimensional squashed Wess-Zumino-Novikov-Witten models at the classical level. The target space is given by squashed S³ and the isometry is SU(2){sub L}×U(1){sub R}. It is known that SU(2){sub L} is enhanced to a couple of Yangians. We reveal here that an infinite-dimensional extension of U(1){sub R} is a deformation of quantum affine algebra, where a new deformation parameter is provided with the coefficient of the Wess-Zumino term. Then we consider the relation between the deformed quantum affine algebra and the pair of Yangians from the viewpoint of the left-right duality of monodromy matrices.more » The integrable structure is also discussed by computing the r/s-matrices that satisfy the extended classical Yang-Baxter equation. Finally, two degenerate limits are discussed.« less

  19. The cultural and chronological context of early Holocene maize and squash domestication in the Central Balsas River Valley, Mexico

    PubMed Central

    Ranere, Anthony J.; Piperno, Dolores R.; Holst, Irene; Dickau, Ruth; Iriarte, José

    2009-01-01

    Molecular evidence indicates that the wild ancestor of maize is presently native to the seasonally dry tropical forest of the Central Balsas watershed in southwestern Mexico. We report here on archaeological investigations in a region of the Central Balsas located near the Iguala Valley in Guerrero state that show for the first time a long sequence of human occupation and plant exploitation reaching back to the early Holocene. One of the sites excavated, the Xihuatoxtla Shelter, contains well-stratified deposits and a stone tool assemblage of bifacially flaked points, simple flake tools, and numerous handstones and milling stone bases radiocarbon dated to at least 8700 calendrical years B.P. As reported in a companion paper (Piperno DR, et al., in this issue of PNAS), starch grain and phytolith residues from the ground and chipped stone tools, plus phytoliths from directly associated sediments, provide evidence for maize (Zea mays L.) and domesticated squash (Cucurbita spp.) in contexts contemporaneous with and stratigraphically below the 8700 calendrical years B.P. date. The radiocarbon determinations, stratigraphic integrity of Xihuatoxtla's deposits, and characteristics of the stone tool assemblages associated with the maize and squash remains all indicate that these plants were early Holocene domesticates. Early agriculture in this region of Mexico appears to have involved small groups of cultivators who were shifting their settlements seasonally and engaging in a variety of subsistence pursuits. PMID:19307573

  20. Feasibility of Whole-Body Functional Mouse Imaging Using Helical Pinhole SPECT

    PubMed Central

    Metzler, Scott D.; Vemulapalli, Sreekanth; Jaszczak, Ronald J.; Akabani, Gamal; Chin, Bennett B.

    2010-01-01

    Purpose Detailed in vivo whole-body biodistributions of radiolabeled tracers may characterize the longitudinal progression of disease, and changes with therapeutic interventions. Small-animal imaging in mice is particularly attractive due to the wide array of well characterized genetically and surgically created models of disease. Single Photon Emission Computed Tomography (SPECT) imaging using pinhole collimation provides high resolution and sensitivity, but conventional methods using circular acquisitions result in severe image truncation and incomplete sampling of data which prevent the accurate determination of whole-body radiotracer biodistributions. This study describes the feasibility of helical acquisition paths to mitigate these effects. Procedures Helical paths of pinhole apertures were implemented using an external robotic stage aligned with the axis of rotation (AOR) of the scanner. Phantom and mouse scans were performed using helical paths and either circular or bi-circular orbits at the same radius of rotation (ROR). The bi-circular orbits consisted of two 360-degree scans separated by an axial shift to increase the axial field of view (FOV) and to improve the complete-sampling properties. Results Reconstructions of phantoms and mice acquired with helical paths show good image quality and are visually free of both truncation and axial-blurring artifacts. Circular orbits yielded reconstructions with both artifacts and a limited effective FOV. The bi-circular scans enlarged the axial FOV, but still suffered from truncation and sampling artifacts. Conclusions Helical paths can provide complete sampling data and large effective FOV, yielding 3D full-body in vivo biodistributions while still maintaining a small distance from the aperture to the object for good sensitivity and resolution. PMID:19521736

  1. C-arm based cone-beam CT using a two-concentric-arc source trajectory: system evaluation

    NASA Astrophysics Data System (ADS)

    Zambelli, Joseph; Zhuang, Tingliang; Nett, Brian E.; Riddell, Cyril; Belanger, Barry; Chen, Guang-Hong

    2008-03-01

    The current x-ray source trajectory for C-arm based cone-beam CT is a single arc. Reconstruction from data acquired with this trajectory yields cone-beam artifacts for regions other than the central slice. In this work we present the preliminary evaluation of reconstruction from a source trajectory of two concentric arcs using a flat-panel detector equipped C-arm gantry (GE Healthcare Innova 4100 system, Waukesha, Wisconsin). The reconstruction method employed is a summation of FDK-type reconstructions from the two individual arcs. For the angle between arcs studied here, 30°, this method offers a significant reduction in the visibility of cone-beam artifacts, with the additional advantages of simplicity and ease of implementation due to the fact that it is a direct extension of the reconstruction method currently implemented on commercial systems. Reconstructed images from data acquired from the two arc trajectory are compared to those reconstructed from a single arc trajectory and evaluated in terms of spatial resolution, low contrast resolution, noise, and artifact level.

  2. C-arm based cone-beam CT using a two-concentric-arc source trajectory: system evaluation.

    PubMed

    Zambelli, Joseph; Zhuang, Tingliang; Nett, Brian E; Riddell, Cyril; Belanger, Barry; Chen, Guang-Hong

    2008-01-01

    The current x-ray source trajectory for C-arm based cone-beam CT is a single arc. Reconstruction from data acquired with this trajectory yields cone-beam artifacts for regions other than the central slice. In this work we present the preliminary evaluation of reconstruction from a source trajectory of two concentric arcs using a flat-panel detector equipped C-arm gantry (GE Healthcare Innova 4100 system, Waukesha, Wisconsin). The reconstruction method employed is a summation of FDK-type reconstructions from the two individual arcs. For the angle between arcs studied here, 30°, this method offers a significant reduction in the visibility of cone-beam artifacts, with the additional advantages of simplicity and ease of implementation due to the fact that it is a direct extension of the reconstruction method currently implemented on commercial systems. Reconstructed images from data acquired from the two arc trajectory are compared to those reconstructed from a single arc trajectory and evaluated in terms of spatial resolution, low contrast resolution, noise, and artifact level.

  3. Magnetic susceptibility, artifact volume in MRI, and tensile properties of swaged Zr-Ag composites for biomedical applications.

    PubMed

    Imai, Haruki; Tanaka, Yoji; Nomura, Naoyuki; Doi, Hisashi; Tsutsumi, Yusuke; Ono, Takashi; Hanawa, Takao

    2017-02-01

    Zr-Ag composites were fabricated to decrease the magnetic susceptibility by compensating for the magnetic susceptibility of their components. The Zr-Ag composites with a different Zr-Ag ratio were swaged, and their magnetic susceptibility, artifact volume, and mechanical properties were evaluated by magnetic balance, three-dimensional (3-D) artifact rendering, and a tensile test, respectively. These properties were correlated with the volume fraction of Ag using the linear rule of mixture. We successfully obtained the swaged Zr-Ag composites up to the reduction ratio of 96% for Zr-4, 16, 36, 64Ag and 86% for Zr-81Ag. However, the volume fraction of Ag after swaging tended to be lower than that before swaging, especially for Ag-rich Zr-Ag composites. The magnetic susceptibility of the composites linearly decreased with the increasing volume fraction of Ag. No artifact could be estimated with the Ag volume fraction in the range from 93.7% to 95.4% in three conditions. Young's modulus, ultimate tensile strength (UTS), and 0.2% yield strength of Zr-Ag composites showed slightly lower values compared to the estimated values using a linear rule of mixture. The decrease in magnetic susceptibility of Zr and Ag by alloying or combining would contribute to the decrease of the Ag fraction, leading to the improvement of mechanical properties. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. 21 CFR 172.130 - Dehydroacetic acid.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... Food Preservatives § 172.130 Dehydroacetic acid. The food additive dehydroacetic acid and/or its sodium... used or intended for use as a preservative for cut or peeled squash, and is so used that no more than...

  5. 40 CFR 180.588 - Quinoxyfen; tolerances for residues.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances... Pepper, bell 0.35 Pepper, nonbell 1.7 Pumpkin 0.20 Squash, winter 0.20 Strawberry 0.90 (b) Section 18...

  6. MO-DE-207A-10: One-Step CT Reconstruction for Metal Artifact Reduction by a Modification of Penalized Weighted Least-Squares (PWLS)

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Kim, H; Chen, J

    Purpose: Metal objects create severe artifacts in kilo-voltage (kV) CT image reconstructions due to the high attenuation coefficients of high atomic number objects. Most of the techniques devised to reduce this artifact utilize a two-step approach, which do not reliably yield the qualified reconstructed images. Thus, for accuracy and simplicity, this work presents a one-step reconstruction method based on a modified penalized weighted least-squares (PWLS) technique. Methods: Existing techniques for metal artifact reduction mostly adopt a two-step approach, which conduct additional reconstruction with the modified projection data from the initial reconstruction. This procedure does not consistently perform well due tomore » the uncertainties in manipulating the metal-contaminated projection data by thresholding and linear interpolation. This study proposes a one-step reconstruction process using a new PWLS operation with total-variation (TV) minimization, while not manipulating the projection. The PWLS for CT reconstruction has been investigated using a pre-defined weight, based on the variance of the projection datum at each detector bin. It works well when reconstructing CT images from metal-free projection data, which does not appropriately penalize metal-contaminated projection data. The proposed work defines the weight at each projection element under the assumption of a Poisson random variable. This small modification using element-wise penalization has a large impact in reducing metal artifacts. For evaluation, the proposed technique was assessed with two noisy, metal-contaminated digital phantoms, against the existing PWLS with TV minimization and the two-step approach. Result: The proposed PWLS with TV minimization greatly improved the metal artifact reduction, relative to the other techniques, by watching the results. Numerically, the new approach lowered the normalized root-mean-square error about 30 and 60% for the two cases, respectively, compared to the two-step method. Conclusion: A new PWLS operation shows promise for improving metal artifact reduction in CT imaging, as well as simplifying the reconstructing procedure.« less

  7. SU-E-J-207: Effect of Pulse Sequence Parameters On Geometric Distortions Induced by a Titanium Brachytherapy Applicator

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Shea, S; Diak, A; Surucu, M

    2015-06-15

    Purpose: To investigate the effect of readout bandwidth and voxel size on the appearance of distortion artifacts caused by a titanium brachytherapy applicator. Methods: An acrylic phantom was constructed to rigidly hold a MR conditional, titanium Fletcher-Suit-Delclos-style applicator set (Varian Medical Systems) for imaging on CT (Philips Brilliance) and 1.5T MRI (Siemens Magnetom Aera). Several variants of MRI parameters were tried for 2D T2-weighted turbo spin echo imaging in comparison against the standard clinical protocol with the criteria to keep relative SNR loss less than 20% and imaging time as short as possible. Two 3D sequences were also used formore » comparison with similar parameters. The applicator tandem was segmented on axial CT images (0.4×0.4×1.5mm {sup 3} resolution) and the CT images were registered to the 3D MR images in Eclipse (Varian). The applicator volume was then overlaid on all MRI sets in 3D-Slicer and distances were measured from the tandem tip to the MRI artifact edge in right/left/superior and anterior/posterior/superior directions from coronal and sagittal 2D acquisitions, respectively, or 3D data reformats. Artifact regions were also manually contoured in coronal/sagittal orientations for area measurements. Results: As would be expected, reductions in voxel size and increases in readout bandwidth reduced artifact size (average max artifact length decreased by 0.95 mm and average max area decrease by 0.27 cm{sup 2}). Interestingly, bandwidth increases yielded reductions in area (0.19 cm{sup 2}) and in distance measurements (1 mm) even with voxel increases, as compared to a standard protocol. This could be useful when high performance protocols are not feasible due to long imaging times. Conclusion: We have characterized artifacts caused by cervical brachytherapy applicator across multiple sequence parameters at 1.5T. Future work will focus on finalizing an optimal protocol that balances artifact reduction with imaging time and then testing this new protocol in patients.« less

  8. iPhone 4s Photoplethysmography: Which Light Color Yields the Most Accurate Heart Rate and Normalized Pulse Volume Using the iPhysioMeter Application in the Presence of Motion Artifact?

    PubMed Central

    Matsumura, Kenta; Rolfe, Peter; Lee, Jihyoung; Yamakoshi, Takehiro

    2014-01-01

    Recent progress in information and communication technologies has made it possible to measure heart rate (HR) and normalized pulse volume (NPV), which are important physiological indices, using only a smartphone. This has been achieved with reflection mode photoplethysmography (PPG), by using a smartphone’s embedded flash as a light source and the camera as a light sensor. Despite its widespread use, the method of PPG is susceptible to motion artifacts as physical displacements influence photon propagation phenomena and, thereby, the effective optical path length. Further, it is known that the wavelength of light used for PPG influences the photon penetration depth and we therefore hypothesized that influences of motion artifact could be wavelength-dependant. To test this hypothesis, we made measurements in 12 healthy volunteers of HR and NPV derived from reflection mode plethysmograms recorded simultaneously at three different spectral regions (red, green and blue) at the same physical location with a smartphone. We then assessed the accuracy of the HR and NPV measurements under the influence of motion artifacts. The analyses revealed that the accuracy of HR was acceptably high with all three wavelengths (all rs > 0.996, fixed biases: −0.12 to 0.10 beats per minute, proportional biases: r = −0.29 to 0.03), but that of NPV was the best with green light (r = 0.791, fixed biases: −0.01 arbitrary units, proportional bias: r = 0.11). Moreover, the signal-to-noise ratio obtained with green and blue light PPG was higher than that of red light PPG. These findings suggest that green is the most suitable color for measuring HR and NPV from the reflection mode photoplethysmogram under motion artifact conditions. We conclude that the use of green light PPG could be of particular benefit in ambulatory monitoring where motion artifacts are a significant issue. PMID:24618594

  9. Linear separability in superordinate natural language concepts.

    PubMed

    Ruts, Wim; Storms, Gert; Hampton, James

    2004-01-01

    Two experiments are reported in which linear separability was investigated in superordinate natural language concept pairs (e.g., toiletry-sewing gear). Representations of the exemplars of semantically related concept pairs were derived in two to five dimensions using multidimensional scaling (MDS) of similarities based on possession of the concept features. Next, category membership, obtained from an exemplar generation study (in Experiment 1) and from a forced-choice classification task (in Experiment 2) was predicted from the coordinates of the MDS representation using log linear analysis. The results showed that all natural kind concept pairs were perfectly linearly separable, whereas artifact concept pairs showed several violations. Clear linear separability of natural language concept pairs is in line with independent cue models. The violations in the artifact pairs, however, yield clear evidence against the independent cue models.

  10. Shedding Some Light.

    ERIC Educational Resources Information Center

    Whitney, Tim

    1998-01-01

    Discusses the basics of designing natural and artificial light in an indoor athletic facility. Also examines individual lighting requirements of typical rooms such as weight and fitness rooms, aerobics and multipurpose rooms, gymnasiums, field houses, pools, and racquetball and squash courts. (GR)

  11. Botany and culture

    USDA-ARS?s Scientific Manuscript database

    The cucurbits (family Cucurbitaceae) form a diverse group of species grown around the world under many different conditions and for many different purposes. The major cultivated types include cucumber, melon (cantaloupe or muskmelon, honeydew, etc.), watermelon, squash, and pumpkin. Minor cultivated...

  12. [Influence of nutritional substrates on the development of Diaphania hyalinata L. (Lepidoptera: Crambidae)].

    PubMed

    Pratissoli, Dirceu; Polanczyk, Ricardo A; Holtz, Anderson M; Tamanhoni, Tiago; Celestino, Flávio N; Borges Filho, Raul da C

    2008-01-01

    The aim of this research was to evaluate the biological behaviour of melonworm at different natural and artificial diets. Squash cultivar jacaré, cucumber, summer squash and an artificial diets developed by Hensley & Hammond for the sugarcane borer were tried. The research was carried out in the Laboratório de Entomologia do Centro de Ciências Agrárias of the Universidade Federal do Espírito Santo, in climatized room at 25 +/- 1 masculineC, relative humidity of 70 +/- 10% and 14h photofase. The caterpillars fed on each substrate during the whole life cycle. Differences in duration of the larval period, larvae and pupae survival, adult longevity and number of eggs were registered between the substrates. The results show that the best diet for rearing is the artificial one. Between the natural diets the cucumber showed the best results.

  13. Highly entangled states with almost no secrecy.

    PubMed

    Christandl, Matthias; Schuch, Norbert; Winter, Andreas

    2010-06-18

    In this Letter we illuminate the relation between entanglement and secrecy by providing the first example of a quantum state that is highly entangled, but from which, nevertheless, almost no secrecy can be extracted. More precisely, we provide two bounds on the bipartite entanglement of the totally antisymmetric state in dimension d×d. First, we show that the amount of secrecy that can be extracted from the state is low; to be precise it is bounded by O(1/d). Second, we show that the state is highly entangled in the sense that we need a large amount of singlets to create the state: entanglement cost is larger than a constant, independent of d. In order to obtain our results we use representation theory, linear programming, and the entanglement measure known as squashed entanglement. Our findings also clarify the relation between the squashed entanglement and the relative entropy of entanglement.

  14. Reference-free ground truth metric for metal artifact evaluation in CT images.

    PubMed

    Kratz, Bärbel; Ens, Svitlana; Müller, Jan; Buzug, Thorsten M

    2011-07-01

    In computed tomography (CT), metal objects in the region of interest introduce data inconsistencies during acquisition. Reconstructing these data results in an image with star shaped artifacts induced by the metal inconsistencies. To enhance image quality, the influence of the metal objects can be reduced by different metal artifact reduction (MAR) strategies. For an adequate evaluation of new MAR approaches a ground truth reference data set is needed. In technical evaluations, where phantoms can be measured with and without metal inserts, ground truth data can easily be obtained by a second reference data acquisition. Obviously, this is not possible for clinical data. Here, an alternative evaluation method is presented without the need of an additionally acquired reference data set. The proposed metric is based on an inherent ground truth for metal artifacts as well as MAR methods comparison, where no reference information in terms of a second acquisition is needed. The method is based on the forward projection of a reconstructed image, which is compared to the actually measured projection data. The new evaluation technique is performed on phantom and on clinical CT data with and without MAR. The metric results are then compared with methods using a reference data set as well as an expert-based classification. It is shown that the new approach is an adequate quantification technique for artifact strength in reconstructed metal or MAR CT images. The presented method works solely on the original projection data itself, which yields some advantages compared to distance measures in image domain using two data sets. Beside this, no parameters have to be manually chosen. The new metric is a useful evaluation alternative when no reference data are available.

  15. On the radiobiological impact of metal artifacts in head-and-neck IMRT in terms of tumor control probability (TCP) and normal tissue complication probability (NTCP).

    PubMed

    Kim, Yusung; Tomé, Wolfgang A

    2007-11-01

    To investigate the effects of distorted head-and-neck (H&N) intensity-modulated radiation therapy (IMRT) dose distributions (hot and cold spots) on normal tissue complication probability (NTCP) and tumor control probability (TCP) due to dental-metal artifacts. Five patients' IMRT treatment plans have been analyzed, employing five different planning image data-sets: (a) uncorrected (UC); (b) homogeneous uncorrected (HUC); (c) sinogram completion corrected (SCC); (d) minimum-value-corrected (MVC); and (e) streak-artifact-reduction including minimum-value-correction (SAR-MVC), which has been taken as the reference data-set. The effects on NTCP and TCP were evaluated using the Lyman-NTCP model and the Logistic-TCP model, respectively. When compared to the predicted NTCP obtained using the reference data-set, the treatment plan based on the original CT data-set (UC) yielded an increase in NTCP of 3.2 and 2.0% for the spared parotid gland and the spinal cord, respectively. While for the treatment plans based on the MVC CT data-set the NTCP increased by a 1.1% and a 0.1% for the spared parotid glands and the spinal cord, respectively. In addition, the MVC correction method showed a reduction in TCP for target volumes (MVC: delta TCP = -0.6% vs. UC: delta TCP = -1.9%) with respect to that of the reference CT data-set. Our results indicate that the presence of dental-metal-artifacts in H&N planning CT data-sets has an impact on the estimates of TCP and NTCP. In particular dental-metal-artifacts lead to an increase in NTCP for the spared parotid glands and a slight decrease in TCP for target volumes.

  16. Removal of BCG artifacts from EEG recordings inside the MR scanner: a comparison of methodological and validation-related aspects.

    PubMed

    Vanderperren, Katrien; De Vos, Maarten; Ramautar, Jennifer R; Novitskiy, Nikolay; Mennes, Maarten; Assecondi, Sara; Vanrumste, Bart; Stiers, Peter; Van den Bergh, Bea R H; Wagemans, Johan; Lagae, Lieven; Sunaert, Stefan; Van Huffel, Sabine

    2010-04-15

    Multimodal approaches are of growing interest in the study of neural processes. To this end much attention has been paid to the integration of electroencephalographic (EEG) and functional magnetic resonance imaging (fMRI) data because of their complementary properties. However, the simultaneous acquisition of both types of data causes serious artifacts in the EEG, with amplitudes that may be much larger than those of EEG signals themselves. The most challenging of these artifacts is the ballistocardiogram (BCG) artifact, caused by pulse-related electrode movements inside the magnetic field. Despite numerous efforts to find a suitable approach to remove this artifact, still a considerable discrepancy exists between current EEG-fMRI studies. This paper attempts to clarify several methodological issues regarding the different approaches with an extensive validation based on event-related potentials (ERPs). More specifically, Optimal Basis Set (OBS) and Independent Component Analysis (ICA) based methods were investigated. Their validation was not only performed with measures known from previous studies on the average ERPs, but most attention was focused on task-related measures, including their use on trial-to-trial information. These more detailed validation criteria enabled us to find a clearer distinction between the most widely used cleaning methods. Both OBS and ICA proved to be able to yield equally good results. However, ICA methods needed more parameter tuning, thereby making OBS more robust and easy to use. Moreover, applying OBS prior to ICA can optimize the data quality even more, but caution is recommended since the effect of the additional ICA step may be strongly subject-dependent. Copyright 2010 Elsevier Inc. All rights reserved.

  17. Usefulness of the twinkling artifact on Doppler ultrasound for the detection of breast microcalcifications.

    PubMed

    Relea, A; Alonso, J A; González, M; Zornoza, C; Bahamonde, S; Viñuela, B E; Encinas, M B

    2018-06-12

    To determine whether the twinkling artifact on Doppler ultrasound imaging corresponds to microcalcifications previously seen on mammograms and to evaluate the usefulness of this finding in the ultrasound management of suspicious microcalcifications. We used ultrasonography to prospectively examine 46 consecutive patients with groups of microcalcifications suspicious for malignancy identified at mammography, searching for the presence of the twinkling artifact to identify the microcalcifications. Once we identified the microcalcifications, we obtained core-needle biopsy specimens with 11G needles and then used X-rays to check the specimens for the presence of microcalcifications. We analyzed the percentage of detection and obtainment of microcalcifications by core-needle biopsy with this technique and the radiopathologic correlation. Microcalcifications that were not detected by ultrasound or discordant lesions were biopsied by stereotaxy at another center. We also used ultrasound guidance for preoperative marking with clips, usually orienting them radially. We identified and biopsied 41 of the 46 lesions under ultrasound guidance, including 24 of 25 carcinomas (17 in situ). B-mode ultrasound was sufficient for biopsying the microcalcifications in 14 patients, although the presence of the twinkling artifact increased the number of microcalcifications detected and thus enabled more accurate preoperative marking. Thanks to the twinkling sign, we were able to identify 27 additional groups of microcalcifications (89% vs. 30%; p < 0.05). All the surgical specimens had margins free of disease. The twinkling artifact is useful for microcalcifications in ultrasound examinations, enabling a significant increase in the yield of ultrasound-guided biopsies and better preoperative marking of groups of microcalcifications. Copyright © 2018 SERAM. Publicado por Elsevier España, S.L.U. All rights reserved.

  18. Volume-of-interest reconstruction from severely truncated data in dental cone-beam CT

    NASA Astrophysics Data System (ADS)

    Zhang, Zheng; Kusnoto, Budi; Han, Xiao; Sidky, E. Y.; Pan, Xiaochuan

    2015-03-01

    As cone-beam computed tomography (CBCT) has gained popularity rapidly in dental imaging applications in the past two decades, radiation dose in CBCT imaging remains a potential, health concern to the patients. It is a common practice in dental CBCT imaging that only a small volume of interest (VOI) containing the teeth of interest is illuminated, thus substantially lowering imaging radiation dose. However, this would yield data with severe truncations along both transverse and longitudinal directions. Although images within the VOI reconstructed from truncated data can be of some practical utility, they often are compromised significantly by truncation artifacts. In this work, we investigate optimization-based reconstruction algorithms for VOI image reconstruction from CBCT data of dental patients containing severe truncations. In an attempt to further reduce imaging dose, we also investigate optimization-based image reconstruction from severely truncated data collected at projection views substantially fewer than those used in clinical dental applications. Results of our study show that appropriately designed optimization-based reconstruction can yield VOI images with reduced truncation artifacts, and that, when reconstructing from only one half, or even one quarter, of clinical data, it can also produce VOI images comparable to that of clinical images.

  19. Generalized Squashing Factors for Covariant Description of Magnetic Connectivity in the Solar Corona

    NASA Technical Reports Server (NTRS)

    Titov, V. S.

    2007-01-01

    The study of magnetic connectivity in the solar corona reveals a need to generalize the field line mapping technique to arbitrary geometry of the boundaries and systems of coordinates. Indeed, the global description of the connectivity in the corona requires the use of the photospheric and solar wind boundaries. Both are closed surfaces and therefore do not admit a global regular system of coordinates. At least two overlapping regular systems of coordinates for each of the boundaries are necessary in this case to avoid spherical-pole-like singularities in the coordinates of the footpoints. This implies that the basic characteristic of magnetic connectivity-the squashing degree or factor Q of elemental flux tubes, according to Titov and coworkers-must be rewritten in covariant form. Such a covariant expression of Q is derived in this work. The derived expression is very flexible and highly efficient for describing the global magnetic connectivity in the solar corona. In addition, a general expression for a new characteristic Q1, which defines a squashing of the flux tubes in the directions perpendicular to the field lines, is determined. This new quantity makes it possible to filter out the quasi-separatrix layers whose large values of Q are caused by a projection effect at the field lines nearly touching the photosphere. Thus, the value Q1 provides a much more precise description of the volumetric properties of the magnetic field structure. The difference between Q and Q1 is illustrated by comparing their distributions for two configurations, one of which is the Titov-Demoulin model of a twisted magnetic field.

  20. Solution Structure of the Squash Aspartic Acid Proteinase Inhibitor (SQAPI) and Mutational Analysis of Pepsin Inhibition

    PubMed Central

    Headey, Stephen J.; MacAskill, Ursula K.; Wright, Michele A.; Claridge, Jolyon K.; Edwards, Patrick J. B.; Farley, Peter C.; Christeller, John T.; Laing, William A.; Pascal, Steven M.

    2010-01-01

    The squash aspartic acid proteinase inhibitor (SQAPI), a proteinaceous proteinase inhibitor from squash, is an effective inhibitor of a range of aspartic proteinases. Proteinaceous aspartic proteinase inhibitors are rare in nature. The only other example in plants probably evolved from a precursor serine proteinase inhibitor. Earlier work based on sequence homology modeling suggested SQAPI evolved from an ancestral cystatin. In this work, we determined the solution structure of SQAPI using NMR and show that SQAPI shares the same fold as a plant cystatin. The structure is characterized by a four-strand anti-parallel β-sheet gripping an α-helix in an analogous manner to fingers of a hand gripping a tennis racquet. Truncation and site-specific mutagenesis revealed that the unstructured N terminus and the loop connecting β-strands 1 and 2 are important for pepsin inhibition, but the loop connecting strands 3 and 4 is not. Using ambiguous restraints based on the mutagenesis results, SQAPI was then docked computationally to pepsin. The resulting model places the N-terminal strand of SQAPI in the S′ side of the substrate binding cleft, whereas the first SQAPI loop binds on the S side of the cleft. The backbone of SQAPI does not interact with the pepsin catalytic Asp32–Asp215 diad, thus avoiding cleavage. The data show that SQAPI does share homologous structural elements with cystatin and appears to retain a similar protease inhibitory mechanism despite its different target. This strongly supports our hypothesis that SQAPI evolved from an ancestral cystatin. PMID:20538608

  1. Myocardial T1 mapping at 3.0 tesla using an inversion recovery spoiled gradient echo readout and bloch equation simulation with slice profile correction (BLESSPC) T1 estimation algorithm.

    PubMed

    Shao, Jiaxin; Rapacchi, Stanislas; Nguyen, Kim-Lien; Hu, Peng

    2016-02-01

    To develop an accurate and precise myocardial T1 mapping technique using an inversion recovery spoiled gradient echo readout at 3.0 Tesla (T). The modified Look-Locker inversion-recovery (MOLLI) sequence was modified to use fast low angle shot (FLASH) readout, incorporating a BLESSPC (Bloch Equation Simulation with Slice Profile Correction) T1 estimation algorithm, for accurate myocardial T1 mapping. The FLASH-MOLLI with BLESSPC fitting was compared with different approaches and sequences with regards to T1 estimation accuracy, precision and image artifact based on simulation, phantom studies, and in vivo studies of 10 healthy volunteers and three patients at 3.0 Tesla. The FLASH-MOLLI with BLESSPC fitting yields accurate T1 estimation (average error = -5.4 ± 15.1 ms, percentage error = -0.5% ± 1.2%) for T1 from 236-1852 ms and heart rate from 40-100 bpm in phantom studies. The FLASH-MOLLI sequence prevented off-resonance artifacts in all 10 healthy volunteers at 3.0T. In vivo, there was no significant difference between FLASH-MOLLI-derived myocardial T1 values and "ShMOLLI+IE" derived values (1458.9 ± 20.9 ms versus 1464.1 ± 6.8 ms, P = 0.50); However, the average precision by FLASH-MOLLI was significantly better than that generated by "ShMOLLI+IE" (1.84 ± 0.36% variance versus 3.57 ± 0.94%, P < 0.001). The FLASH-MOLLI with BLESSPC fitting yields accurate and precise T1 estimation, and eliminates banding artifacts associated with bSSFP at 3.0T. © 2015 Wiley Periodicals, Inc.

  2. Region-of-interest image reconstruction in circular cone-beam microCT

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Cho, Seungryong; Bian, Junguo; Pelizzari, Charles A.

    2007-12-15

    Cone-beam microcomputed tomography (microCT) is one of the most popular choices for small animal imaging which is becoming an important tool for studying animal models with transplanted diseases. Region-of-interest (ROI) imaging techniques in CT, which can reconstruct an ROI image from the projection data set of the ROI, can be used not only for reducing imaging-radiation exposure to the subject and scatters to the detector but also for potentially increasing spatial resolution of the reconstructed images. Increasing spatial resolution in microCT images can facilitate improved accuracy in many assessment tasks. A method proposed previously for increasing CT image spatial resolutionmore » entails the exploitation of the geometric magnification in cone-beam CT. Due to finite detector size, however, this method can lead to data truncation for a large geometric magnification. The Feldkamp-Davis-Kress (FDK) algorithm yields images with artifacts when truncated data are used, whereas the recently developed backprojection filtration (BPF) algorithm is capable of reconstructing ROI images without truncation artifacts from truncated cone-beam data. We apply the BPF algorithm to reconstructing ROI images from truncated data of three different objects acquired by our circular cone-beam microCT system. Reconstructed images by use of the FDK and BPF algorithms from both truncated and nontruncated cone-beam data are compared. The results of the experimental studies demonstrate that, from certain truncated data, the BPF algorithm can reconstruct ROI images with quality comparable to that reconstructed from nontruncated data. In contrast, the FDK algorithm yields ROI images with truncation artifacts. Therefore, an implication of the studies is that, when truncated data are acquired with a configuration of a large geometric magnification, the BPF algorithm can be used for effective enhancement of the spatial resolution of a ROI image.« less

  3. TheClinical Research Tool: a high-performance microdialysis-based system for reliably measuring interstitial fluid glucose concentration.

    PubMed

    Ocvirk, Gregor; Hajnsek, Martin; Gillen, Ralph; Guenther, Arnfried; Hochmuth, Gernot; Kamecke, Ulrike; Koelker, Karl-Heinz; Kraemer, Peter; Obermaier, Karin; Reinheimer, Cornelia; Jendrike, Nina; Freckmann, Guido

    2009-05-01

    A novel microdialysis-based continuous glucose monitoring system, the so-called Clinical Research Tool (CRT), is presented. The CRT was designed exclusively for investigational use to offer high analytical accuracy and reliability. The CRT was built to avoid signal artifacts due to catheter clogging, flow obstruction by air bubbles, and flow variation caused by inconstant pumping. For differentiation between physiological events and system artifacts, the sensor current, counter electrode and polarization voltage, battery voltage, sensor temperature, and flow rate are recorded at a rate of 1 Hz. In vitro characterization with buffered glucose solutions (c(glucose) = 0 - 26 x 10(-3) mol liter(-1)) over 120 h yielded a mean absolute relative error (MARE) of 2.9 +/- 0.9% and a recorded mean flow rate of 330 +/- 48 nl/min with periodic flow rate variation amounting to 24 +/- 7%. The first 120 h in vivo testing was conducted with five type 1 diabetes subjects wearing two systems each. A mean flow rate of 350 +/- 59 nl/min and a periodic variation of 22 +/- 6% were recorded. Utilizing 3 blood glucose measurements per day and a physical lag time of 1980 s, retrospective calibration of the 10 in vivo experiments yielded a MARE value of 12.4 +/- 5.7. Clarke error grid analysis resulted in 81.0%, 16.6%, 0.8%, 1.6%, and 0% in regions A, B, C, D, and E, respectively. The CRT demonstrates exceptional reliability of system operation and very good measurement performance. The ability to differentiate between artifacts and physiological effects suggests the use of the CRT as a reference tool in clinical investigations. 2009 Diabetes Technology Society.

  4. The Clinical Research Tool: A High-Performance Microdialysis-Based System for Reliably Measuring Interstitial Fluid Glucose Concentration

    PubMed Central

    Ocvirk, Gregor; Hajnsek, Martin; Gillen, Ralph; Guenther, Arnfried; Hochmuth, Gernot; Kamecke, Ulrike; Koelker, Karl-Heinz; Kraemer, Peter; Obermaier, Karin; Reinheimer, Cornelia; Jendrike, Nina; Freckmann, Guido

    2009-01-01

    Background A novel microdialysis-based continuous glucose monitoring system, the so-called Clinical Research Tool (CRT), is presented. The CRT was designed exclusively for investigational use to offer high analytical accuracy and reliability. The CRT was built to avoid signal artifacts due to catheter clogging, flow obstruction by air bubbles, and flow variation caused by inconstant pumping. For differentiation between physiological events and system artifacts, the sensor current, counter electrode and polarization voltage, battery voltage, sensor temperature, and flow rate are recorded at a rate of 1 Hz. Method In vitro characterization with buffered glucose solutions (cglucose = 0 - 26 × 10-3 mol liter-1) over 120 h yielded a mean absolute relative error (MARE) of 2.9 ± 0.9% and a recorded mean flow rate of 330 ± 48 nl/min with periodic flow rate variation amounting to 24 ± 7%. The first 120 h in vivo testing was conducted with five type 1 diabetes subjects wearing two systems each. A mean flow rate of 350 ± 59 nl/min and a periodic variation of 22 ± 6% were recorded. Results Utilizing 3 blood glucose measurements per day and a physical lag time of 1980 s, retrospective calibration of the 10 in vivo experiments yielded a MARE value of 12.4 ± 5.7. Clarke error grid analysis resulted in 81.0%, 16.6%, 0.8%, 1.6%, and 0% in regions A, B, C, D, and E, respectively. Conclusion The CRT demonstrates exceptional reliability of system operation and very good measurement performance. The ability to differentiate between artifacts and physiological effects suggests the use of the CRT as a reference tool in clinical investigations. PMID:20144284

  5. Early Childhood: Fall Harvest and Science.

    ERIC Educational Resources Information Center

    Science and Children, 1982

    1982-01-01

    Provides instructional strategies for using fall fruits/vegetables in science lessons, including activities related to melons, pumpkins, grapes, pears, squash, and yams. Suggests extending the activities over a month or more to allow children time to explore and investigate. (JN)

  6. East Europe Report

    DTIC Science & Technology

    1986-01-15

    administration of low- and moderately esterified pectins-each kind for one month as an ingred- ient of fruit nectars and fruit squashes . A reduced... entanglements became virtually insolvable. It is being ad- mitted that before the incidents of 20 October the police repeatedly displayed

  7. Comparison of Battery-Powered and Manual Bone Biopsy Systems for Core Needle Biopsy of Sclerotic Bone Lesions.

    PubMed

    Cohen, Micah G; McMahon, Colm J; Kung, Justin W; Wu, Jim S

    2016-05-01

    The purpose of this study was to compare manual and battery-powered bone biopsy systems for diagnostic yield and procedural factors during core needle biopsy of sclerotic bone lesions. A total of 155 consecutive CT-guided core needle biopsies of sclerotic bone lesions were performed at one institution from January 2006 to November 2014. Before March 2012, lesions were biopsied with manual bone drill systems. After March 2012, most biopsies were performed with a battery-powered system and either noncoaxial or coaxial biopsy needles. Diagnostic yield, crush artifact, CT procedure time, procedure radiation dose, conscious sedation dose, and complications were compared between the manual and battery-powered core needle biopsy systems by Fisher exact test and t test. One-way ANOVA was used for subgroup analysis of the two battery-powered systems for procedure time and radiation dose. The diagnostic yield for all sclerotic lesions was 60.0% (93/155) and was significantly higher with the battery-powered system (73.0% [27/37]) than with the manual systems (55.9% [66/118]) (p = 0.047). There was no significant difference between the two systems in terms of crush artifact, procedure time, radiation dose, conscious sedation administered, or complications. In subgroup analysis, the coaxial battery-powered biopsies had shorter procedure times (p = 0.01) and lower radiation doses (p = 0.002) than the coaxial manual systems, but the noncoaxial battery-powered biopsies had longer average procedure times and higher radiation doses than the coaxial manual systems. In biopsy of sclerotic bone lesions, use of a battery-powered bone drill system improves diagnostic yield over use of a manual system.

  8. Time course based artifact identification for independent components of resting-state FMRI.

    PubMed

    Rummel, Christian; Verma, Rajeev Kumar; Schöpf, Veronika; Abela, Eugenio; Hauf, Martinus; Berruecos, José Fernando Zapata; Wiest, Roland

    2013-01-01

    In functional magnetic resonance imaging (fMRI) coherent oscillations of the blood oxygen level-dependent (BOLD) signal can be detected. These arise when brain regions respond to external stimuli or are activated by tasks. The same networks have been characterized during wakeful rest when functional connectivity of the human brain is organized in generic resting-state networks (RSN). Alterations of RSN emerge as neurobiological markers of pathological conditions such as altered mental state. In single-subject fMRI data the coherent components can be identified by blind source separation of the pre-processed BOLD data using spatial independent component analysis (ICA) and related approaches. The resulting maps may represent physiological RSNs or may be due to various artifacts. In this methodological study, we propose a conceptually simple and fully automatic time course based filtering procedure to detect obvious artifacts in the ICA output for resting-state fMRI. The filter is trained on six and tested on 29 healthy subjects, yielding mean filter accuracy, sensitivity and specificity of 0.80, 0.82, and 0.75 in out-of-sample tests. To estimate the impact of clearly artifactual single-subject components on group resting-state studies we analyze unfiltered and filtered output with a second level ICA procedure. Although the automated filter does not reach performance values of visual analysis by human raters, we propose that resting-state compatible analysis of ICA time courses could be very useful to complement the existing map or task/event oriented artifact classification algorithms.

  9. Robust power spectral estimation for EEG data

    PubMed Central

    Melman, Tamar; Victor, Jonathan D.

    2016-01-01

    Background Typical electroencephalogram (EEG) recordings often contain substantial artifact. These artifacts, often large and intermittent, can interfere with quantification of the EEG via its power spectrum. To reduce the impact of artifact, EEG records are typically cleaned by a preprocessing stage that removes individual segments or components of the recording. However, such preprocessing can introduce bias, discard available signal, and be labor-intensive. With this motivation, we present a method that uses robust statistics to reduce dependence on preprocessing by minimizing the effect of large intermittent outliers on the spectral estimates. New method Using the multitaper method[1] as a starting point, we replaced the final step of the standard power spectrum calculation with a quantile-based estimator, and the Jackknife approach to confidence intervals with a Bayesian approach. The method is implemented in provided MATLAB modules, which extend the widely used Chronux toolbox. Results Using both simulated and human data, we show that in the presence of large intermittent outliers, the robust method produces improved estimates of the power spectrum, and that the Bayesian confidence intervals yield close-to-veridical coverage factors. Comparison to existing method The robust method, as compared to the standard method, is less affected by artifact: inclusion of outliers produces fewer changes in the shape of the power spectrum as well as in the coverage factor. Conclusion In the presence of large intermittent outliers, the robust method can reduce dependence on data preprocessing as compared to standard methods of spectral estimation. PMID:27102041

  10. Robust power spectral estimation for EEG data.

    PubMed

    Melman, Tamar; Victor, Jonathan D

    2016-08-01

    Typical electroencephalogram (EEG) recordings often contain substantial artifact. These artifacts, often large and intermittent, can interfere with quantification of the EEG via its power spectrum. To reduce the impact of artifact, EEG records are typically cleaned by a preprocessing stage that removes individual segments or components of the recording. However, such preprocessing can introduce bias, discard available signal, and be labor-intensive. With this motivation, we present a method that uses robust statistics to reduce dependence on preprocessing by minimizing the effect of large intermittent outliers on the spectral estimates. Using the multitaper method (Thomson, 1982) as a starting point, we replaced the final step of the standard power spectrum calculation with a quantile-based estimator, and the Jackknife approach to confidence intervals with a Bayesian approach. The method is implemented in provided MATLAB modules, which extend the widely used Chronux toolbox. Using both simulated and human data, we show that in the presence of large intermittent outliers, the robust method produces improved estimates of the power spectrum, and that the Bayesian confidence intervals yield close-to-veridical coverage factors. The robust method, as compared to the standard method, is less affected by artifact: inclusion of outliers produces fewer changes in the shape of the power spectrum as well as in the coverage factor. In the presence of large intermittent outliers, the robust method can reduce dependence on data preprocessing as compared to standard methods of spectral estimation. Copyright © 2016 Elsevier B.V. All rights reserved.

  11. Vibro-acoustography and multifrequency image compounding.

    PubMed

    Urban, Matthew W; Alizad, Azra; Fatemi, Mostafa

    2011-08-01

    Vibro-acoustography is an ultrasound based imaging modality that can visualize normal and abnormal soft tissue through mapping the acoustic response of the object to a harmonic radiation force at frequency Δf induced by focused ultrasound. In this method, the ultrasound energy is converted from high ultrasound frequencies to a low acoustic frequency (acoustic emission) that is often two orders of magnitude smaller than the ultrasound frequency. The acoustic emission is normally detected by a hydrophone. Depending on the setup, this low frequency sound may reverberate by object boundaries or other structures present in the acoustic paths before it reaches the hydrophone. This effect produces an artifact in the image in the form of gradual variations in image intensity that may compromise image quality. The use of tonebursts with finite length yields acoustic emission at Δf and at sidebands centered about Δf. Multiple images are formed by selectively applying bandpass filters on the acoustic emission at Δf and the associated sidebands. The data at these multiple frequencies are compounded through both coherent and incoherent processes to reduce the acoustic emission reverberation artifacts. Experimental results from a urethane breast phantom are described. The coherent and incoherent compounding of multifrequency data show, both qualitatively and quantitatively, the efficacy of this reverberation reduction method. This paper presents theory describing the physical origin of this artifact and use of image data created using multifrequency vibro-acoustography for reducing reverberation artifacts. Copyright © 2011 Elsevier B.V. All rights reserved.

  12. O-space with high resolution readouts outperforms radial imaging.

    PubMed

    Wang, Haifeng; Tam, Leo; Kopanoglu, Emre; Peters, Dana C; Constable, R Todd; Galiana, Gigi

    2017-04-01

    While O-Space imaging is well known to accelerate image acquisition beyond traditional Cartesian sampling, its advantages compared to undersampled radial imaging, the linear trajectory most akin to O-Space imaging, have not been detailed. In addition, previous studies have focused on ultrafast imaging with very high acceleration factors and relatively low resolution. The purpose of this work is to directly compare O-Space and radial imaging in their potential to deliver highly undersampled images of high resolution and minimal artifacts, as needed for diagnostic applications. We report that the greatest advantages to O-Space imaging are observed with extended data acquisition readouts. A sampling strategy that uses high resolution readouts is presented and applied to compare the potential of radial and O-Space sequences to generate high resolution images at high undersampling factors. Simulations and phantom studies were performed to investigate whether use of extended readout windows in O-Space imaging would increase k-space sampling and improve image quality, compared to radial imaging. Experimental O-Space images acquired with high resolution readouts show fewer artifacts and greater sharpness than radial imaging with equivalent scan parameters. Radial images taken with longer readouts show stronger undersampling artifacts, which can cause small or subtle image features to disappear. These features are preserved in a comparable O-Space image. High resolution O-Space imaging yields highly undersampled images of high resolution and minimal artifacts. The additional nonlinear gradient field improves image quality beyond conventional radial imaging. Copyright © 2016 Elsevier Inc. All rights reserved.

  13. Vibro-acoustography and Multifrequency Image Compounding

    PubMed Central

    Urban, Matthew W.; Alizad, Azra; Fatemi, Mostafa

    2011-01-01

    Vibro-acoustography is an ultrasound based imaging modality that can visualize normal and abnormal soft tissue through mapping the acoustic response of the object to a harmonic radiation force at frequency Δf induced by focused ultrasound. In this method, the ultrasound energy is converted from high ultrasound frequencies to a low acoustic frequency (acoustic emission) that is often two orders of magnitude smaller than the ultrasound frequency. The acoustic emission is normally detected by a hydrophone. Depending on the setup, this low frequency sound may reverberate by object boundaries or other structures present in the acoustic paths before it reaches the hydrophone. This effect produces an artifact in the image in the form of gradual variations in image intensity that may compromise image quality. The use of tonebursts with finite length yields acoustic emission at Δf and at sidebands centered about Δf. Multiple images are formed by selectively applying bandpass filters on the acoustic emission at Δf and the associated sidebands. The data at these multiple frequencies are compounded through both coherent and incoherent processes to reduce the acoustic emission reverberation artifacts. Experimental results from a urethane breast phantom are described. The coherent and incoherent compounding of multifrequency data show, both qualitatively and quantitatively, the efficacy of this reverberation reduction method. This paper presents theory describing the physical origin of this artifact and use of image data created using multifrequency vibro-acoustography for reducing reverberation artifacts. PMID:21377181

  14. Palindromic Sequence Artifacts Generated during Next Generation Sequencing Library Preparation from Historic and Ancient DNA

    PubMed Central

    Star, Bastiaan; Nederbragt, Alexander J.; Hansen, Marianne H. S.; Skage, Morten; Gilfillan, Gregor D.; Bradbury, Ian R.; Pampoulie, Christophe; Stenseth, Nils Chr; Jakobsen, Kjetill S.; Jentoft, Sissel

    2014-01-01

    Degradation-specific processes and variation in laboratory protocols can bias the DNA sequence composition from samples of ancient or historic origin. Here, we identify a novel artifact in sequences from historic samples of Atlantic cod (Gadus morhua), which forms interrupted palindromes consisting of reverse complementary sequence at the 5′ and 3′-ends of sequencing reads. The palindromic sequences themselves have specific properties – the bases at the 5′-end align well to the reference genome, whereas extensive misalignments exists among the bases at the terminal 3′-end. The terminal 3′ bases are artificial extensions likely caused by the occurrence of hairpin loops in single stranded DNA (ssDNA), which can be ligated and amplified in particular library creation protocols. We propose that such hairpin loops allow the inclusion of erroneous nucleotides, specifically at the 3′-end of DNA strands, with the 5′-end of the same strand providing the template. We also find these palindromes in previously published ancient DNA (aDNA) datasets, albeit at varying and substantially lower frequencies. This artifact can negatively affect the yield of endogenous DNA in these types of samples and introduces sequence bias. PMID:24608104

  15. Heart rate calculation from ensemble brain wave using wavelet and Teager-Kaiser energy operator.

    PubMed

    Srinivasan, Jayaraman; Adithya, V

    2015-01-01

    Electroencephalogram (EEG) signal artifacts are caused by various factors, such as, Electro-oculogram (EOG), Electromyogram (EMG), Electrocardiogram (ECG), movement artifact and line interference. The relatively high electrical energy cardiac activity causes EEG artifacts. In EEG signal processing the general approach is to remove the ECG signal. In this paper, we introduce an automated method to extract the ECG signal from EEG using wavelet and Teager-Kaiser energy operator for R-peak enhancement and detection. From the detected R-peaks the heart rate (HR) is calculated for clinical diagnosis. To check the efficiency of our method, we compare the HR calculated from ECG signal recorded in synchronous with EEG. The proposed method yields a mean error of 1.4% for the heart rate and 1.7% for mean R-R interval. The result illustrates that, proposed method can be used for ECG extraction from single channel EEG and used in clinical diagnosis like estimation for stress analysis, fatigue, and sleep stages classification studies as a multi-model system. In addition, this method eliminates the dependence of additional synchronous ECG in extraction of ECG from EEG signal process.

  16. Cucurbits [Cucumber, melon, pumpkin and squash

    USDA-ARS?s Scientific Manuscript database

    The focus of this chapter is on the edible members of the Cucurbitaceae family. The three important food-grade cucurbit genera Citrullus, Cucumis, and Cucurbita include the species Citrullus lanatus watermelons), Cucumis melo (cantaloupes and other sweet melons), Cucumis sativa (cucumbers and pick...

  17. Virus movement within grafted watermelon plants

    USDA-ARS?s Scientific Manuscript database

    Watermelon production in Florida is impacted by several viruses including whitefly-transmitted Squash vein yellowing virus (SqVYV), Cucurbit yellow stunting disorder virus and Cucurbit leaf crumple virus, and aphid-transmitted Papaya ringspot virus type W (PRSV-W). While germplasm resistant to some...

  18. l0 regularization based on a prior image incorporated non-local means for limited-angle X-ray CT reconstruction.

    PubMed

    Zhang, Lingli; Zeng, Li; Guo, Yumeng

    2018-01-01

    Restricted by the scanning environment in some CT imaging modalities, the acquired projection data are usually incomplete, which may lead to a limited-angle reconstruction problem. Thus, image quality usually suffers from the slope artifacts. The objective of this study is to first investigate the distorted domains of the reconstructed images which encounter the slope artifacts and then present a new iterative reconstruction method to address the limited-angle X-ray CT reconstruction problem. The presented framework of new method exploits the structural similarity between the prior image and the reconstructed image aiming to compensate the distorted edges. Specifically, the new method utilizes l0 regularization and wavelet tight framelets to suppress the slope artifacts and pursue the sparsity. New method includes following 4 steps to (1) address the data fidelity using SART; (2) compensate for the slope artifacts due to the missed projection data using the prior image and modified nonlocal means (PNLM); (3) utilize l0 regularization to suppress the slope artifacts and pursue the sparsity of wavelet coefficients of the transformed image by using iterative hard thresholding (l0W); and (4) apply an inverse wavelet transform to reconstruct image. In summary, this method is referred to as "l0W-PNLM". Numerical implementations showed that the presented l0W-PNLM was superior to suppress the slope artifacts while preserving the edges of some features as compared to the commercial and other popular investigative algorithms. When the image to be reconstructed is inconsistent with the prior image, the new method can avoid or minimize the distorted edges in the reconstructed images. Quantitative assessments also showed that applying the new method obtained the highest image quality comparing to the existing algorithms. This study demonstrated that the presented l0W-PNLM yielded higher image quality due to a number of unique characteristics, which include that (1) it utilizes the structural similarity between the reconstructed image and prior image to modify the distorted edges by slope artifacts; (2) it adopts wavelet tight frames to obtain the first and high derivative in several directions and levels; and (3) it takes advantage of l0 regularization to promote the sparsity of wavelet coefficients, which is effective for the inhibition of the slope artifacts. Therefore, the new method can address the limited-angle CT reconstruction problem effectively and have practical significance.

  19. Universal artifacts affect the branching of phylogenetic trees, not universal scaling laws.

    PubMed

    Altaba, Cristian R

    2009-01-01

    The superficial resemblance of phylogenetic trees to other branching structures allows searching for macroevolutionary patterns. However, such trees are just statistical inferences of particular historical events. Recent meta-analyses report finding regularities in the branching pattern of phylogenetic trees. But is this supported by evidence, or are such regularities just methodological artifacts? If so, is there any signal in a phylogeny? In order to evaluate the impact of polytomies and imbalance on tree shape, the distribution of all binary and polytomic trees of up to 7 taxa was assessed in tree-shape space. The relationship between the proportion of outgroups and the amount of imbalance introduced with them was assessed applying four different tree-building methods to 100 combinations from a set of 10 ingroup and 9 outgroup species, and performing covariance analyses. The relevance of this analysis was explored taking 61 published phylogenies, based on nucleic acid sequences and involving various taxa, taxonomic levels, and tree-building methods. All methods of phylogenetic inference are quite sensitive to the artifacts introduced by outgroups. However, published phylogenies appear to be subject to a rather effective, albeit rather intuitive control against such artifacts. The data and methods used to build phylogenetic trees are varied, so any meta-analysis is subject to pitfalls due to their uneven intrinsic merits, which translate into artifacts in tree shape. The binary branching pattern is an imposition of methods, and seldom reflects true relationships in intraspecific analyses, yielding artifactual polytomies in short trees. Above the species level, the departure of real trees from simplistic random models is caused at least by two natural factors--uneven speciation and extinction rates; and artifacts such as choice of taxa included in the analysis, and imbalance introduced by outgroups and basal paraphyletic taxa. This artifactual imbalance accounts for tree shape convergence of large trees. There is no evidence for any universal scaling in the tree of life. Instead, there is a need for improved methods of tree analysis that can be used to discriminate the noise due to outgroups from the phylogenetic signal within the taxon of interest, and to evaluate realistic models of evolution, correcting the retrospective perspective and explicitly recognizing extinction as a driving force. Artifacts are pervasive, and can only be overcome through understanding the structure and biological meaning of phylogenetic trees. Catalan Abstract in Translation S1.

  20. Methyl Bromide alternatives for vegetable production in Georgia: Small-plot trials

    USDA-ARS?s Scientific Manuscript database

    In Georgia, the loss of MeBr directly impacts the production and profitability of several fruiting vegetables [specifically, pepper (Capsicum annuum L.), eggplant (Solanum melogena L.), and tomato (Lycopersicum esculentum Mill)) and cucurbits (specifically, squash [yellow (Cucurbita pepo L.)], melon...

  1. "Emerging" Sports for Women.

    ERIC Educational Resources Information Center

    Blum, Debra E.

    1994-01-01

    The National Collegiate Athletic Association has recently introduced nine new sports to intercollegiate athletics: team handball, archery, badminton, bowling, crew, ice hockey, squash, synchronized swimming, and water polo. The initiative is intended to encourage colleges to create more athletic opportunities for women. It sets scholarship limits…

  2. Grafting for Management of Root-Knot Nematodes in Watermelon

    USDA-ARS?s Scientific Manuscript database

    Five wild watermelon (Citrullus lanatus var. citroides) germplasm lines, four bottlegourd (Lagenaria siceraria) cultivars, one squash (Cucurbita moschata x C. maxima) hybrid, and one commercial wild watermelon (C. lanatus spp.) cultivar were evaluated as rootstocks for watermelon in a field infested...

  3. Grafting for Management of Southern Root-knot Nematode, Meloidogyne Incognita, in Watermelon

    USDA-ARS?s Scientific Manuscript database

    Four bottlegourd (Lagenaria siceraria) cultivars, one squash (Cucurbita moschata x C. maxima) hybrid, four wild watermelon (Citrullus lanatus var. citroides) germplasm lines, and one commercial wild watermelon (C. lanatus var. citroides) cultivar were evaluated as rootstocks for cultivated watermelo...

  4. Some Techniques for Teaching about the Structure and Function of Chromosomes.

    ERIC Educational Resources Information Center

    Lowery, Roger; Taylor, Neil; Nathan, Subhashni

    2000-01-01

    Presents a teaching activity that uses photographs and diagrams to simulate two microscopic laboratory techniques used to observe the structure of chromosomes. Techniques include observation of squashed onion root tips and the salivary glands of some fruitfly larvae. (WRM)

  5. Cultivation and uses of cucurbits

    USDA-ARS?s Scientific Manuscript database

    Cultivated cucurbits have spread through trade and exploration from their respective Old and New World centers of origin to the six arable continents and are important in local, regional and world trade. Cucumber (Cucumis sativus L.), melon (Cucumis melo L.), pumpkin, squash and gourd (Cucurbita spp...

  6. Crown blight of melons and crown decline of watermelon

    USDA-ARS?s Scientific Manuscript database

    The cucurbits (family Cucurbitaceae) form a diverse group of species grown around the world under many different conditions and for many different purposes. The major cultivated types include cucumber, melon (cantaloupe or muskmelon, honeydew, etc.), watermelon, squash, and pumpkin. Minor cultivated...

  7. The Place for Thermoplastic Composites in Structural Components

    DTIC Science & Technology

    1987-12-01

    The molten tube is then squashed flat and consolidated into ribbon form by continuous opposed-belt laminating. Existing graphite-epoxy pultrusion...the solid form it must have a molecular weight that exceeds the critical entanglement value. Thus thermoplastic materials of commercial worth almost

  8. The relationship between loading history and proximal femoral diaphysis cross-sectional geometry.

    PubMed

    Niinimäki, Sirpa; Narra, Nathaniel; Härkönen, Laura; Abe, Shinya; Nikander, Riku; Hyttinen, Jari; Knüsel, Christopher; Sievänen, Harri

    2017-07-08

    We investigated the relationship between loading history and bone biomechanical properties used in physical activity reconstructions. These bone properties included bone bending and torsional strength (J), cortical area (CA), the direction of the major axis (theta angle), and element shape ratios determined from cross sections of standardized bone length. In addition, we explored the applicability of anatomically determined cross sections. Our material consisted of hip and proximal thigh magnetic resonance images of Finnish female athletes (N = 91) engaged in high-jump, triple-jump, endurance running, swimming, power-lifting, soccer and squash; along with a group of active non-athlete individuals (N = 20). We used regression analysis for size-adjustment, and the extracted residuals were then used to compare differences in the bone properties between groups. We found that triple-jumpers, soccer players, and squash players had the greatest values in CA and J, swimmers and non-athletes had the smallest, whereas high-jumpers, power-lifters, and endurance runners exhibited interim values. No between-the-group differences in element shape ratios or theta angles were found. We found that influences of activity were similar regardless of whether standardized length or anatomically determined cross sections were used. Extreme (triple-jump) and directionally inconsistent loading (soccer and squash) necessitate a more robust skeleton compared to directionally consistent loading (high-jump, power-lifting, and endurance running) or non-impact loading (swimming and non-athletes). However, not all of these relationships were statistically significant. Thus, information gained about physical activity using bone properties is informative but limited. Accounting for the limitations, the method is applicable on fragmented skeletal material as anatomically determined cross sections can be used. © 2017 Wiley Periodicals, Inc.

  9. Have the attitudes of Australian squash players towards protective eyewear changed over the past decade?

    PubMed Central

    Eime, R; Finch, C

    2002-01-01

    Objective: To assess indicative trends in the use of protective eyewear by Australian squash players and their attitudes towards its use since 1989. Methods: Data were extracted from three Australian surveys of squash players conducted in 1989, 1995, and 2000. Responses to directly similar attitudinal questions relating to protective eyewear use from each survey were compared. The proportion of players giving each response was calculated for each survey, along with 95% confidence intervals for the differences between the 2000 survey and those from the earlier surveys. Results: Self reported use of protective eyewear ranged from 10.0% in 1989, to 8.6% in 1995, and 18.8% in 2000. However, only 8.9% of the players surveyed in 2000 actually wore appropriate standards approved/polycarbonate lens eyewear. This can be compared with 8.0% and 2.0% of players who reported wearing appropriate polycarbonate lens eyewear in the 1989 and 1995 surveys respectively. Compared with the 1995 survey, significantly more players in 2000 believed that more players should wear protective eyewear (95% confidence interval (CI) for difference 1 to 18). A significantly higher proportion of players also supported the compulsory use of protective eyewear by juniors in 2000 than in both 1989 (95% CI for difference 6 to 24) and 1995 (95% CI for difference 5 to 22). No other attitudes had significantly changed over the decade. Conclusion: These data suggest that self reported use of protective eyewear has probably increased over the past decade. However, many players report wearing inappropriate eyewear. A transition from positive attitudes to appropriate eyewear behaviours is required before mandatory protective eyewear use can be effectively introduced. PMID:12453839

  10. Investigating differences in the root to shoot transfer and xylem sap solubility of organic compounds between zucchini, squash and soybean using a pressure chamber method.

    PubMed

    Garvin, Naho; Doucette, William J; White, Jason C

    2015-07-01

    A pressure chamber method was used to examine differences in the root to shoot transfer and xylem sap solubility of caffeine (log Kow=-0.07), triclocarban (log Kow=3.5-4.2) and endosulfan (log Kow=3.8-4.8) for zucchini (cucurbita pepo ssp pepo), squash (cucurbita pepo ssp ovifera), and soybean (glycine max L.). Transpiration stream concentration factors (TSCF) for caffeine (TSCF=0.8) were statistically equivalent for all plant species. However, for the more hydrophobic endosulfan and triclocarban, the TSCF values for zucchini (TSCF=0.6 and 0.4, respectively) were 3 and 10 times greater than the soybean and squash (TSCF=0.2 and 0.05, respectively). The difference in TSCF values was examined by comparing the measured solubilities of caffeine, endosulfan and triclocarban in deionized water to those in soybean and zucchini xylem saps using a modified shake flask method. The measured solubility of organic contaminants in xylem sap has not previously been reported. Caffeine solubilities in the xylem saps of soybean and zucchini were statistically equal to deionized water (21500mgL(-1)) while endosulfan and triclocarban solubilities in the zucchini xylem sap were significantly greater (0.43 and 0.21mgL(-1), respectively) than that of the soybean xylem sap (0.31 and 0.11mgL(-1), respectively) and deionized water (0.34 and 0.11mgL(-1), respectively). This suggests that the enhanced root to shoot transfer of hydrophobic organics reported for zucchini is partly due to increased solubility in the xylem sap. Further xylem sap characterization is needed to determine the mechanism of solubility enhancement. Copyright © 2014 Elsevier Ltd. All rights reserved.

  11. Utility of Grafting for Managing Southern Root-knot Nematode, Meloidogyne Incognita, in Watermelon

    USDA-ARS?s Scientific Manuscript database

    Four bottlegourd (Lagenaria siceraria) cultivars, one squash (Cucurbita moschata x C. maxima) hybrid, four wild watermelon (Citrullus lanatus var. citroides) germplasm lines, and one commercial wild watermelon (C. lanatus var. citroides) cultivar were evaluated as rootstocks for cultivated watermelo...

  12. The Foreign Policy of Angola under Agostinho Neto

    DTIC Science & Technology

    1983-12-01

    Angolan conflict soon entangled the sideline actors South Africa and SVAPO. An evaluation of the prevailing political and ethnic dynamics in southern...forces, with Soviet arms and Cuban troops, quickly sought to squash the Ovimbundu-based liberation movement. A series of Cuban-led offensives routed

  13. Computing quantum discord is NP-complete

    NASA Astrophysics Data System (ADS)

    Huang, Yichen

    2014-03-01

    We study the computational complexity of quantum discord (a measure of quantum correlation beyond entanglement), and prove that computing quantum discord is NP-complete. Therefore, quantum discord is computationally intractable: the running time of any algorithm for computing quantum discord is believed to grow exponentially with the dimension of the Hilbert space so that computing quantum discord in a quantum system of moderate size is not possible in practice. As by-products, some entanglement measures (namely entanglement cost, entanglement of formation, relative entropy of entanglement, squashed entanglement, classical squashed entanglement, conditional entanglement of mutual information, and broadcast regularization of mutual information) and constrained Holevo capacity are NP-hard/NP-complete to compute. These complexity-theoretic results are directly applicable in common randomness distillation, quantum state merging, entanglement distillation, superdense coding, and quantum teleportation; they may offer significant insights into quantum information processing. Moreover, we prove the NP-completeness of two typical problems: linear optimization over classical states and detecting classical states in a convex set, providing evidence that working with classical states is generically computationally intractable.

  14. Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica

    PubMed Central

    Castro, Ruth M.; Moreira, Lisela; Rojas, María R.; Gilbertson, Robert L.; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar

    2013-01-01

    Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere. PMID:25288955

  15. Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica.

    PubMed

    Castro, Ruth M; Moreira, Lisela; Rojas, María R; Gilbertson, Robert L; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar

    2013-09-01

    Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere.

  16. Complete Nucleotide Sequence of Watermelon Chlorotic Stunt Virus Originating from Oman

    PubMed Central

    Khan, Akhtar J.; Akhtar, Sohail; Briddon, Rob W.; Ammara, Um; Al-Matrooshi, Abdulrahman M.; Mansoor, Shahid

    2012-01-01

    Watermelon chlorotic stunt virus (WmCSV) is a bipartite begomovirus (genus Begomovirus, family Geminiviridae) that causes economic losses to cucurbits, particularly watermelon, across the Middle East and North Africa. Recently squash (Cucurbita moschata) grown in an experimental field in Oman was found to display symptoms such as leaf curling, yellowing and stunting, typical of a begomovirus infection. Sequence analysis of the virus isolated from squash showed 97.6–99.9% nucleotide sequence identity to previously described WmCSV isolates for the DNA A component and 93–98% identity for the DNA B component. Agrobacterium-mediated inoculation to Nicotiana benthamiana resulted in the development of symptoms fifteen days post inoculation. This is the first bipartite begomovirus identified in Oman. Overall the Oman isolate showed the highest levels of sequence identity to a WmCSV isolate originating from Iran, which was confirmed by phylogenetic analysis. This suggests that WmCSV present in Oman has been introduced from Iran. The significance of this finding is discussed. PMID:22852046

  17. Complete nucleotide sequence of watermelon chlorotic stunt virus originating from Oman.

    PubMed

    Khan, Akhtar J; Akhtar, Sohail; Briddon, Rob W; Ammara, Um; Al-Matrooshi, Abdulrahman M; Mansoor, Shahid

    2012-07-01

    Watermelon chlorotic stunt virus (WmCSV) is a bipartite begomovirus (genus Begomovirus, family Geminiviridae) that causes economic losses to cucurbits, particularly watermelon, across the Middle East and North Africa. Recently squash (Cucurbita moschata) grown in an experimental field in Oman was found to display symptoms such as leaf curling, yellowing and stunting, typical of a begomovirus infection. Sequence analysis of the virus isolated from squash showed 97.6-99.9% nucleotide sequence identity to previously described WmCSV isolates for the DNA A component and 93-98% identity for the DNA B component. Agrobacterium-mediated inoculation to Nicotiana benthamiana resulted in the development of symptoms fifteen days post inoculation. This is the first bipartite begomovirus identified in Oman. Overall the Oman isolate showed the highest levels of sequence identity to a WmCSV isolate originating from Iran, which was confirmed by phylogenetic analysis. This suggests that WmCSV present in Oman has been introduced from Iran. The significance of this finding is discussed.

  18. Growth of plants fumigated with saturated and unsaturated hydrocarbon gases and their derivatives

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Heck, W.W.; Pires, E.G.

    1962-01-01

    Fourteen gases were investigated for their toxicity to plant growth and development. Five of these gases (acetylene, ethylene, ethylene oxide, propylene and vinyl chloride) produced pronounced effects on the five plant species studied. The plants were fumigated at 10, 100 and 1000 ppm by each of the test gases, using a set of 10 small fumigation chambers. The effects of the five gases on squash, cotton, corn, soybean and cowpea were carefully catalogued. Both quantitative and qualitative growth data were obtained. Plant height, leaf size, flower bud number, cotyledon injury and an injury index are useful criteria for analysis ofmore » gas effects. Cowpea is the most sensitive of the plants studied, followed by cotton, squash, soybean and corn. The injurious effects of ethylene were the greatest, followed by acetylene, propylene, ethylene oxide and vinyl chloride. It is suggested that ethylene oxide acts as a true toxicant while the other four gases may be considered as physiologically active gases.« less

  19. 40 CFR 180.1087 - Sesame stalks; exemption from the requirement of a tolerance.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... AGENCY (CONTINUED) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD... exemption from the requirement of a tolerance is established for residues of the biorational nematicide... fractions; potato; beet, sugar, roots; beet, sugar, tops; tomato; pepper, bell; squash; strawberry; eggplant...

  20. 40 CFR 180.1087 - Sesame stalks; exemption from the requirement of a tolerance.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... AGENCY (CONTINUED) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD... exemption from the requirement of a tolerance is established for residues of the biorational nematicide... fractions; potato; beet, sugar, roots; beet, sugar, tops; tomato; pepper, bell; squash; strawberry; eggplant...

  1. Foods The Indians Gave Us. Coloring Book.

    ERIC Educational Resources Information Center

    Hail, Raven

    This children's coloring book devotes a page to each of twenty of the most familiar American Indian plant foods: avocado, green beans, black walnuts, cocoa, corn, peanuts, pecans, chile peppers, pineapples, popcorn, potatoes, pumpkins, squash, strawberries, sugar maple, sunflowers, sweet potatoes, tapioca, tomatoes, and vanilla. Illustrating each…

  2. Native American Foods and Cookery.

    ERIC Educational Resources Information Center

    Taylor, Tom; Potter, Eloise F.

    Native Americans had a well-developed agriculture long before the arrival of the Europeans. Three staples--corn, beans, and squash--were supplemented with other gathered plants or cultivated crops such as white potatoes, sweet potatoes, pumpkins, and peanuts. Native Americans had no cows, pigs, or domesticated chickens; they depended almost…

  3. Spatial And Temporal Analysis Of Multiple Whitefly Transmitted Virus Infections In Watermelon

    USDA-ARS?s Scientific Manuscript database

    Squash vein yellowing virus (SqVYV), Cucurbit leaf crumple virus (CuLCrV), and Cucurbit yellow stunting disorder virus (CYSDV) are three whitefly-transmitted viruses recently introduced to Florida that induce visually distinguishable symptoms on watermelon. The epidemiology of these three viruses wa...

  4. 7 CFR 201.56-4 - Cucurbit family, (Cucurbitaceae).

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ..., squash, and watermelon. (a) General description. (1) Germination habit: Epigeal dicot. (2) Food reserves... does not show any development within the test period. (4) Root system: A long primary root with numerous secondary roots. (b) Abnormal seedling description. (1) Cotyledons: (i) Less than half of the...

  5. 7 CFR 201.56-4 - Cucurbit family, (Cucurbitaceae).

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ..., squash, and watermelon. (a) General description. (1) Germination habit: Epigeal dicot. (2) Food reserves... does not show any development within the test period. (4) Root system: A long primary root with numerous secondary roots. (b) Abnormal seedling description. (1) Cotyledons: (i) Less than half of the...

  6. China Report, Red Flag, Number 20, 16 October 1986.

    DTIC Science & Technology

    1986-12-09

    regions will allow cadres to shake off the entanglements of "relationship networks" and to step over the obstacles of personal rela- tionships. On...individuals and required the members of the party committee to accept inappropriate personnel selection or squashed the appointment of outstanding

  7. Ratiometric Matryoshka biosensors from a nested cassette of green- and orange-emitting fluorescent proteins.

    PubMed

    Ast, Cindy; Foret, Jessica; Oltrogge, Luke M; De Michele, Roberto; Kleist, Thomas J; Ho, Cheng-Hsun; Frommer, Wolf B

    2017-09-05

    Sensitivity, dynamic and detection range as well as exclusion of expression and instrumental artifacts are critical for the quantitation of data obtained with fluorescent protein (FP)-based biosensors in vivo. Current biosensors designs are, in general, unable to simultaneously meet all these criteria. Here, we describe a generalizable platform to create dual-FP biosensors with large dynamic ranges by employing a single FP-cassette, named GO-(Green-Orange) Matryoshka. The cassette nests a stable reference FP (large Stokes shift LSSmOrange) within a reporter FP (circularly permuted green FP). GO- Matryoshka yields green and orange fluorescence upon blue excitation. As proof of concept, we converted existing, single-emission biosensors into a series of ratiometric calcium sensors (MatryoshCaMP6s) and ammonium transport activity sensors (AmTryoshka1;3). We additionally identified the internal acid-base equilibrium as a key determinant of the GCaMP dynamic range. Matryoshka technology promises flexibility in the design of a wide spectrum of ratiometric biosensors and expanded in vivo applications.Single fluorescent protein biosensors are susceptible to expression and instrumental artifacts. Here Ast et al. describe a dual fluorescent protein design whereby a reference fluorescent protein is nested within a reporter fluorescent protein to control for such artifacts while preserving sensitivity and dynamic range.

  8. Deep learning methods to guide CT image reconstruction and reduce metal artifacts

    NASA Astrophysics Data System (ADS)

    Gjesteby, Lars; Yang, Qingsong; Xi, Yan; Zhou, Ye; Zhang, Junping; Wang, Ge

    2017-03-01

    The rapidly-rising field of machine learning, including deep learning, has inspired applications across many disciplines. In medical imaging, deep learning has been primarily used for image processing and analysis. In this paper, we integrate a convolutional neural network (CNN) into the computed tomography (CT) image reconstruction process. Our first task is to monitor the quality of CT images during iterative reconstruction and decide when to stop the process according to an intelligent numerical observer instead of using a traditional stopping rule, such as a fixed error threshold or a maximum number of iterations. After training on ground truth images, the CNN was successful in guiding an iterative reconstruction process to yield high-quality images. Our second task is to improve a sinogram to correct for artifacts caused by metal objects. A large number of interpolation and normalization-based schemes were introduced for metal artifact reduction (MAR) over the past four decades. The NMAR algorithm is considered a state-of-the-art method, although residual errors often remain in the reconstructed images, especially in cases of multiple metal objects. Here we merge NMAR with deep learning in the projection domain to achieve additional correction in critical image regions. Our results indicate that deep learning can be a viable tool to address CT reconstruction challenges.

  9. Tennis-Badminton-Squash, June 1976-June 1978. NAGWS Guide.

    ERIC Educational Resources Information Center

    Van Oteghen, Sharon L., Ed.; And Others

    The National Association for Girls and Women in Sport (NAGWS) publishes ten biennial and two annual guides for 22 sports. Guides contain information on NAGWS or NAGWS-approved playing rules, officials' ratings in most sports, articles on coaching techniques and organization, regulations governing AIAW National Championships in applicable sports,…

  10. 40 CFR 180.1016 - Ethylene; exemption from the requirement of a tolerance.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 25 2012-07-01 2012-07-01 false Ethylene; exemption from the requirement of a tolerance. 180.1016 Section 180.1016 Protection of Environment ENVIRONMENTAL PROTECTION..., soybean, squash, tomato, turnip, and watermelon fields as part of the U.S. Department of Agriculture...

  11. 1997 Arthur Ashe Jr. Sport Scholars Awards.

    ERIC Educational Resources Information Center

    Roach, Ronald

    1997-01-01

    Winners of the "Black Issues in Higher Education" Arthur Ashe Jr. 1997 athletes of the year, one male and one female, are profiled and Sport Scholars are listed for baseball, softball, basketball, fencing, archery, football, handball, soccer, field hockey, crew, swimming, gymnastics, tennis, squash, golf, volleyball, lacrosse, wrestling, water…

  12. Investigating the Boron Requirement of Plants.

    ERIC Educational Resources Information Center

    Bohnsack, Charles W.

    1991-01-01

    This article describes a simple and rapid method for using summer squash to investigate born deficiency in plants. Author asserts that students are likely to feel challenged by laboratory exercises and projects that focus on the role boron plays in plant growth because it is an unresolved problem in biology. (PR)

  13. Epidemiology and Association of Four Insect-Vectored Viruses in Florida Watermelon

    USDA-ARS?s Scientific Manuscript database

    Whitefly-transmitted Squash vein yellowing virus (SqVYV), Cucurbit leaf crumple virus (CuLCrV), Cucurbit yellow stunting disorder virus (CYSDV) and aphid-transmitted Papaya ringspot virus type W (PRSV-W) have had serious impact on watermelon production in southwest and west-central Florida in the pa...

  14. Patterns of Virus Distribution in Single and Mixed Infections of Florida Watermelons

    USDA-ARS?s Scientific Manuscript database

    Whitefly-transmitted Squash vein yellowing virus (SqVYV) and Cucurbit leaf crumple virus (CuLCrV), and aphid-transmitted Papaya ringspot virus type W (PRSV-W) have had serious impact on watermelon production in southwest and west-central Florida in recent years. Tissue blot nucleic acid hybridizati...

  15. Investigations of Crown Gall in the Commercial Propagation of Weeping Fig

    USDA-ARS?s Scientific Manuscript database

    Whitefly-transmitted Squash vein yellowing virus (SqVYV) and Cucurbit leaf crumple virus (CuLCrV), and aphid-transmitted Papaya ringspot virus type W (PRSV-W) have had serious impact on watermelon production in southwest and west-central Florida in recent years. Tissue blot nucleic acid hybridizati...

  16. JPRS Report Near East South Asia.

    DTIC Science & Technology

    1987-09-14

    Table 10 shows. This group includes potatoes, sweet potatoes, poi, squash and yams. However, potatoes are the most important and widespread of...you will see that many of the countries of the world in various areas are in some way or another either related to, or entangled with, such regional

  17. Translations on Eastern Europe, Political, Sociological, and Military Affairs, Number 1337

    DTIC Science & Technology

    1976-12-29

    as an inexhaustible source, produces and which capitalism squashed , suppressed and squelched by the thousands and millions.ŕ 48 Socialist...where they are most dangerously- entangled and tense, in opening up prospects for an arms ban as soon as possible’, in encouragement for the efforts of

  18. Draft genome sequence of Erwinia tracheiphila, an economically important bacterial pathogen of cucurbits

    USDA-ARS?s Scientific Manuscript database

    Erwinia tracheiphila is one of the most economically important pathogen of cucumbers, melons, squashes, pumpkins, and gourds, in the Northeastern and Midwestern United States, yet the molecular pathology remains uninvestigated. Here we report the first draft genome sequence of an E. tracheiphila str...

  19. A resolution congratulating the Trinity College Bantams for their 11th-straight College Squash Association Men's Team Championship.

    THOMAS, 111th Congress

    Sen. Lieberman, Joseph I. [ID-CT

    2009-04-29

    Senate - 04/29/2009 Submitted in the Senate, considered, and agreed to without amendment and with a preamble by Unanimous Consent. (All Actions) Tracker: This bill has the status Agreed to in SenateHere are the steps for Status of Legislation:

  20. 78 FR 67042 - Boscalid; Pesticide Tolerances

    Federal Register 2010, 2011, 2012, 2013, 2014

    2013-11-08

    ..., group 11 at 3.0 ppm; grape at 3.5 ppm; strawberry at 4.5 ppm; sunflower, seed at 0.6 ppm; vegetable...%; squash 5%; strawberries 55%; tomatoes 5%; walnuts 1%; and watermelons 25%. In most cases, EPA uses... 10; fruit, pome, group 11; grape; strawberry; sunflower, seed; vegetable, bulb, group 3; and...

  1. Evaluation of native bees as pollinators of cucurbit crops under floating row covers.

    PubMed

    Minter, Logan M; Bessin, Ricardo T

    2014-10-01

    Production of cucurbit crops presents growers with numerous challenges. Several severe pests and diseases can be managed through the use of rotation, trap cropping, mechanical barriers, such as row covers, and chemical applications. However, considerations must also be made for pollinating insects, as adequate pollination affects the quantity and quality of fruit. Insecticides may negatively affect pollinators; a concern enhanced in recent years due to losses in managed Apis melifera L. colonies. Row covers can be used in place of chemical control before pollination, but when removed, pests have access to fields along with the pollinators. If pollination services of native bees could be harnessed for use under continuous row covers, both concerns could be balanced for growers. The potential of two bee species which specialize on cucurbit flowers, Peponapis pruinosa Say and Xenoglossa strenua Cresson, were assessed under continuous row covers, employed over acorn squash. Experimental treatments included plots with either naturally or artificially introduced bees under row covers and control plots with row covers either permanently removed at crop flowering, or employed continuously with no added pollinating insects. Pests in plots with permanently removed row covers were managed using standard practices used in certified organic production. Marketable yields from plots inoculated with bees were indistinguishable from those produced under standard practices, indicating this system would provide adequate yields to growers without time and monetary inputs of insecticide applications. Additionally, application of this technique was investigated for muskmelon production and discussed along with considerations for farm management.

  2. Ridding fMRI data of motion-related influences: Removal of signals with distinct spatial and physical bases in multiecho data.

    PubMed

    Power, Jonathan D; Plitt, Mark; Gotts, Stephen J; Kundu, Prantik; Voon, Valerie; Bandettini, Peter A; Martin, Alex

    2018-02-27

    "Functional connectivity" techniques are commonplace tools for studying brain organization. A critical element of these analyses is to distinguish variance due to neurobiological signals from variance due to nonneurobiological signals. Multiecho fMRI techniques are a promising means for making such distinctions based on signal decay properties. Here, we report that multiecho fMRI techniques enable excellent removal of certain kinds of artifactual variance, namely, spatially focal artifacts due to motion. By removing these artifacts, multiecho techniques reveal frequent, large-amplitude blood oxygen level-dependent (BOLD) signal changes present across all gray matter that are also linked to motion. These whole-brain BOLD signals could reflect widespread neural processes or other processes, such as alterations in blood partial pressure of carbon dioxide (pCO 2 ) due to ventilation changes. By acquiring multiecho data while monitoring breathing, we demonstrate that whole-brain BOLD signals in the resting state are often caused by changes in breathing that co-occur with head motion. These widespread respiratory fMRI signals cannot be isolated from neurobiological signals by multiecho techniques because they occur via the same BOLD mechanism. Respiratory signals must therefore be removed by some other technique to isolate neurobiological covariance in fMRI time series. Several methods for removing global artifacts are demonstrated and compared, and were found to yield fMRI time series essentially free of motion-related influences. These results identify two kinds of motion-associated fMRI variance, with different physical mechanisms and spatial profiles, each of which strongly and differentially influences functional connectivity patterns. Distance-dependent patterns in covariance are nearly entirely attributable to non-BOLD artifacts.

  3. A comparison of two centrifuge techniques for constructing vulnerability curves: insight into the 'open-vessel' artifact.

    PubMed

    Yin, Pengxian; Meng, Feng; Liu, Qing; An, Rui; Cai, Jing; Du, Guangyuan

    2018-03-30

    A vulnerability curve (VC) describes the extent of xylem cavitation resistance. Centrifuges have been used to generate VCs for decades via static- and flow-centrifuge methods. Recently, the validity of the centrifuge techniques has been questioned. Researchers have hypothesized that the centrifuge techniques might yield unreliable VCs due to the open-vessel artifact. However, other researchers reject this hypothesis. The focus of the dispute is centred on whether exponential VCs are more reliable when the static-centrifuge method is used than with the flow-centrifuge method. To further test the reliability of the centrifuge technique, two centrifuges were manufactured to simulate the static- and flow-centrifuge methods. VCs of three species with open vessels of known lengths were constructed using the two centrifuges. The results showed that both centrifuge techniques produced invalid VCs for Robinia because the water flow through stems under mild tension in centrifuges led to an increasing loss of water conductivity. Additionally, the injection of water in the flow-centrifuge exacerbated the loss of water conductivity. However, both centrifuge techniques yielded reliable VCs for Prunus, regardless of the presence of open vessels in the tested samples. We conclude that centrifuge techniques can be used in species with open vessels only when the centrifuge produces a VC that matches the bench-dehydration VC. This article is protected by copyright. All rights reserved.

  4. caCORRECT2: Improving the accuracy and reliability of microarray data in the presence of artifacts

    PubMed Central

    2011-01-01

    Background In previous work, we reported the development of caCORRECT, a novel microarray quality control system built to identify and correct spatial artifacts commonly found on Affymetrix arrays. We have made recent improvements to caCORRECT, including the development of a model-based data-replacement strategy and integration with typical microarray workflows via caCORRECT's web portal and caBIG grid services. In this report, we demonstrate that caCORRECT improves the reproducibility and reliability of experimental results across several common Affymetrix microarray platforms. caCORRECT represents an advance over state-of-art quality control methods such as Harshlighting, and acts to improve gene expression calculation techniques such as PLIER, RMA and MAS5.0, because it incorporates spatial information into outlier detection as well as outlier information into probe normalization. The ability of caCORRECT to recover accurate gene expressions from low quality probe intensity data is assessed using a combination of real and synthetic artifacts with PCR follow-up confirmation and the affycomp spike in data. The caCORRECT tool can be accessed at the website: http://cacorrect.bme.gatech.edu. Results We demonstrate that (1) caCORRECT's artifact-aware normalization avoids the undesirable global data warping that happens when any damaged chips are processed without caCORRECT; (2) When used upstream of RMA, PLIER, or MAS5.0, the data imputation of caCORRECT generally improves the accuracy of microarray gene expression in the presence of artifacts more than using Harshlighting or not using any quality control; (3) Biomarkers selected from artifactual microarray data which have undergone the quality control procedures of caCORRECT are more likely to be reliable, as shown by both spike in and PCR validation experiments. Finally, we present a case study of the use of caCORRECT to reliably identify biomarkers for renal cell carcinoma, yielding two diagnostic biomarkers with potential clinical utility, PRKAB1 and NNMT. Conclusions caCORRECT is shown to improve the accuracy of gene expression, and the reproducibility of experimental results in clinical application. This study suggests that caCORRECT will be useful to clean up possible artifacts in new as well as archived microarray data. PMID:21957981

  5. Characterization of the USDA germplasm collections for watermelon, melon, cucumber and squash using genotyping-by-sequencing

    USDA-ARS?s Scientific Manuscript database

    Germplasm collections are a critically valuable source of genetic diversity for plant breeding efforts. Our ability to make optimal use of such resources for crop improvement is facilitated by genetic characterization. Therefore, one of the objectives of the CucCAP project, “CucCAP: Leveraging app...

  6. Podosphaera xanthii but not Golovinomyces cichoracearum infects Cucurbits in a Greenhouse at Salinas, California

    USDA-ARS?s Scientific Manuscript database

    Two fungal species are the primary causes of cucurbit powdery mildew (CPM): Podosphaera xanthii and Golovinomyces cichoracearum. CPM on melon (Cucumis melo L.), cucumber (C. sativus L.) and summer squash (Cucurbita pepo L.) in a greenhouse at Salinas, California in winter 2011 was confirmed to be in...

  7. Characterization of a soluble phosphatidic acid phosphatase in bitter melon (Momordica charantia)

    USDA-ARS?s Scientific Manuscript database

    Momordica charantia is often called bitter melon, bitter gourd or bitter squash because its fruit has a bitter taste. The fruit has been widely used as vegetable and herbal medicine. Alpha-eleostearic acid is the major fatty acid in the seeds, but little is known about its biosynthesis. As an initia...

  8. Distribution of Four Viruses in Single and Mixed Infections Within Infected Watermelon Plants in Florida

    USDA-ARS?s Scientific Manuscript database

    Whitefly-transmitted Squash vein yellowing virus (SqVYV) and Cucurbit leaf crumple virus (CuLCrV), and aphid-transmitted Papaya ringspot virus type W (PRSV-W) have had serious impact on watermelon production in southwest and west-central Florida in recent years. Tissue blot nucleic acid hybridizati...

  9. Patterns of Virus Distribution in Single and Mixed Infections of Florida Watermelons

    USDA-ARS?s Scientific Manuscript database

    Whitefly-transmitted Squash vein yellowing virus (SqVYV) and Cucurbit leaf crumple virus (CuLCrV), and aphid-transmitted Papaya ringspot virus type W (PRSV-W) have had serious impact on watermelon production in southwest and west-central Florida in recent years. To determine the distribution of vir...

  10. Epidemiological Analysis of Multi-Virus Infections of Watermelon in Experimental Fields in Southwest Florida

    USDA-ARS?s Scientific Manuscript database

    Whitefly-transmitted Squash vein yellowing virus (SqVYV) and Cucurbit leaf crumple virus (CuLCrV), and aphid-transmitted Papaya ringspot virus type W (PRSV-W) have had serious impact on watermelon production in southwest and west-central Florida in recent years. Tissue blot nucleic acid hybridizati...

  11. Under the Shadow of the Big Stick: U.S. Intervention in Cuba, 1906-1909

    DTIC Science & Technology

    2009-05-21

    and treaties that would entangle the U.S. with European powers and instead emphasized economic trade. 71 As the U.S. sought greater resources and...against Spain. Spain acted harshly to squash the insurgency, and 170,000 Cubans are believed to have died in Spanish concentration camps

  12. Archeological Investigations at Big Hill Lake, Southeastern Kansas, 1980.

    DTIC Science & Technology

    1982-09-01

    miles above the Neosho river, Irving noted the presence of "Fine trees..." and ... wood entangled with rich underwood..." (McDermott 1944:98-100). A few...Horticultural activities centered on the familiar corn/beans/ squash triad, although the gathering of wild foods continued to be of importance. Bison hunting was

  13. North Korea The Reality of a Rogue State in the International Order

    DTIC Science & Technology

    2004-09-01

    military force, to say the least, was not a formidable one. After squashing a pro-communist rebellion in 1948, the military was purged, leaving it...North Korea tried to avoid becoming entangled in the Sino- Soviet split, obtaining aid from both the Soviet Union and China and trying to avoid

  14. JPRS Report, Near East and South Asia.

    DTIC Science & Technology

    1991-05-23

    It broke out there and gave rise to the dispute in Israel Eventually they will tie together a few squashed cartons whether the intifadah was the... entangle the Sindhis in bad, the MQM has not been able to bring about any "typical journalistic quagmires." major change that marks out its rule as being

  15. Heavy metals in produce from urban farms in the San Francisco Bay Area.

    PubMed

    Kohrman, Hannah; Chamberlain, C Page

    2014-01-01

    Cadmium (Cd) and lead (Pb) concentrations were analysed in 96 samples of produce from seven urban farms, three suburban farms and three grocery stores in the San Francisco Bay Area in 2011-2012. Cd concentrations were highest in urban chard (0.043 mg kg(-1)) and lowest in urban, suburban and grocery squash (0.003 mg kg(-1)). Pb concentrations were highest in urban kale (0.080 mg kg(-1)) and lowest in grocery squash (0.008 mg kg(-1)). The mean heavy metal concentrations for Cd and Pb in all produce types were well below the maximum limits as set by the Food and Agriculture Organization (FAO) and the World Health Organization (WHO). Individual concentrations of Cd and Pb were below the limits of detection in 26 of 192 analyses. Cd and Pb concentrations in produce from urban farms were not significantly different from produce grown in suburban farms or grocery stores. It was concluded that produce from urban community farms in San Francisco, at least for the farms studied, is safe for human consumption.

  16. Wilson loops and chiral correlators on squashed spheres

    NASA Astrophysics Data System (ADS)

    Fucito, F.; Morales, J. F.; Poghossian, R.

    2015-11-01

    We study chiral deformations of N=2 and N=4 supersymmetric gauge theories obtained by turning on τ J tr Φ J interactions with Φ the N=2 superfield. Using localization, we compute the deformed gauge theory partition function Z(overrightarrow{τ}|q) and the expectation value of circular Wilson loops W on a squashed four-sphere. In the case of the deformed {N}=4 theory, exact formulas for Z and W are derived in terms of an underlying U( N) interacting matrix model replacing the free Gaussian model describing the {N}=4 theory. Using the AGT correspondence, the τ J -deformations are related to the insertions of commuting integrals of motion in the four-point CFT correlator and chiral correlators are expressed as τ-derivatives of the gauge theory partition function on a finite Ω-background. In the so called Nekrasov-Shatashvili limit, the entire ring of chiral relations is extracted from the ɛ-deformed Seiberg-Witten curve. As a byproduct of our analysis we show that SU(2) gauge theories on rational Ω-backgrounds are dual to CFT minimal models.

  17. Plasticity in host utilization by two host-associated populations of Aphis gossypii Glover.

    PubMed

    Barman, A K; Gadhave, K R; Dutta, B; Srinivasan, R

    2018-06-01

    Biological and morphological plasticity in polyphagous insect herbivores allow them to exploit diverse host plant species. Geographical differences in resource availability can lead to preferential host exploitation and result in inconsistent host specialization. Biological and molecular data provide insights into specialization and plasticity of such herbivore populations. In agricultural landscapes, Aphis gossypii encounters several crop and non-crop hosts, which exist in temporal and spatial proximity. We investigated the host-specialization of two A. gossypii host-associated populations (HAPs), which were field collected from cotton and squash (cotton-associated population and melon-associated population), and later maintained separately in the greenhouse. The two aphid populations were exposed to seven plant species (cotton, okra, watermelon, squash, cucumber, pigweed, and morning glory), and evaluated for their host utilization plasticity by estimating aphid's fitness parameters (nymphal period, adult period, fecundity, and intrinsic rate of increase). Four phenotypical characters (body length, head capsule width, hind tibia length and cornicle length) were also measured from the resulting 14 different HAP × host plant combinations. Phylogenetic analysis of mitochondrial COI sequences showed no genetic variation between the two HAPs. Fitness parameters indicated a significant variation between the two aphid populations, and the variation was influenced by host plants. The performance of melon-aphids was poor (up to 89% reduction in fecundity) on malvaceous hosts, cotton and okra. However, cotton-aphids performed better on cucurbitaceous hosts, squash and watermelon (up to 66% increased fecundity) compared with the natal host, cotton. Both HAPs were able to reproduce on two weed hosts. Cotton-aphids were smaller than melon-aphids irrespective of their host plants. Results from this study suggest that the two HAPs in the study area do not have strict host specialization; rather they exhibit plasticity in utilizing several hosts. In this scenario, it is unlikely that host-associated A. gossypii populations would evolve into host-specific biotypes.

  18. Effect of Time-of-Flight Information on PET/MR Reconstruction Artifacts: Comparison of Free-breathing versus Breath-hold MR-based Attenuation Correction.

    PubMed

    Delso, Gaspar; Khalighi, Mohammed; Ter Voert, Edwin; Barbosa, Felipe; Sekine, Tetsuro; Hüllner, Martin; Veit-Haibach, Patrick

    2017-01-01

    Purpose To evaluate the magnitude and anatomic extent of the artifacts introduced on positron emission tomographic (PET)/magnetic resonance (MR) images by respiratory state mismatch in the attenuation map. Materials and Methods The method was tested on 14 patients referred for an oncologic examination who underwent PET/MR imaging. The acquisition included standard PET and MR series for each patient, and an additional attenuation correction series was acquired by using breath hold. PET data were reconstructed with and without time-of-flight (TOF) information, first by using the standard free-breathing attenuation map and then again by using the additional breath-hold map. Two-tailed paired t testing and linear regression with 0 intercept was performed on TOF versus non-TOF and free-breathing versus breath-hold data for all detected lesions. Results Fluorodeoxyglucose-avid lesions were found in eight of the 14 patients included in the study. The uptake differences (maximum standardized uptake values) between PET reconstructions with free-breathing versus breath-hold attenuation ranged, for non-TOF reconstructions, from -18% to 26%. The corresponding TOF reconstructions yielded differences from -15% to 18%. Conclusion TOF information was shown to reduce the artifacts caused at PET/MR by respiratory mismatch between emission and attenuation data. © RSNA, 2016 Online supplemental material is available for this article.

  19. Differential barometric-based positioning technique for indoor elevation measurement in IoT medical applications.

    PubMed

    Wang, Hua; Wen, Yingyou; Zhao, Dazhe

    2017-07-20

    Medical applications have begun to benefit from Internet of Things (IoT) technology through the introduction of wearable devices. Several medical applications require accurate patient location as various changes affect pressure parameters inside the body. This study aims to develop a system to measure indoor altitude for IoT medical applications. We propose a differential barometric-based positioning system to estimate the altitude between a reference sensor and a localizing sensor connected to the human body. The differential barometric altimetry model is introduced to estimate indoor elevations and eliminate environmental artifacts. In addition, a Gaussian filter processing is adopted to remove noise from the elevation measurements. The proposed system is then investigated through extensive experiments, using various evaluation criteria. The results indicate that the proposed system yielded good accuracy with reduced implementation complexity and fewer costs. The proposed system is resilient compared to other indoor localization approaches, even when numerous environmental artifacts in indoor environments are present.

  20. A radar image of Venus.

    NASA Technical Reports Server (NTRS)

    Goldstein, R. M.; Rumsey, H. C.

    1972-01-01

    Radar scans of Venus have yielded a brightness map of a large portion of the surface. The bright area in the south (alpha) and the twin such areas in the north (beta and delta) were first discovered by spectral analysis of radar echos. When range-gating is also applied, their shapes are revealed, and they are seen to be roundish and about 1000 km across. Although radar brightness can be the result of either intrinsic reflectivity or surface roughness, polarization studies show these features to be rough (to the scale of the wavelength, 12.5 cm). Dark, circular areas can also be seen, many with bright central spots. The dark areas are probably smooth. The blurring of the equatorial strip is an artifact of the range-Doppler geometry; all resolution disappears at the equator. Another artifact of the method is the 'ghost', in the south, of the images of beta and delta. Such ghosts appear only at the eastern and western extremes of the map.

  1. Radiocarbon dating of charcoal and bone collagen associated with early pottery at Yuchanyan Cave, Hunan Province, China

    PubMed Central

    Boaretto, Elisabetta; Wu, Xiaohong; Yuan, Jiarong; Bar-Yosef, Ofer; Chu, Vikki; Pan, Yan; Liu, Kexin; Cohen, David; Jiao, Tianlong; Li, Shuicheng; Gu, Haibin; Goldberg, Paul; Weiner, Steve

    2009-01-01

    Yuchanyan Cave in Daoxian County, Hunan Province (People's Republic of China), yielded fragmentary remains of 2 or more ceramic vessels, in addition to large amounts of ash, a rich animal bone assemblage, cobble and flake artifacts, bone tools, and shell tools. The artifacts indicate that the cave was a Late Paleolithic foragers' camp. Here we report on the radiocarbon ages of the sediments based on analyses of charcoal and bone collagen. The best-preserved charcoal and bone samples were identified by prescreening in the field and laboratory. The dates range from around 21,000 to 13,800 cal BP. We show that the age of the ancient pottery ranges between 18,300 and 15,430 cal BP. Charcoal and bone collagen samples located above and below one of the fragments produced dates of around 18,000. These ceramic potsherds therefore provide some of the earliest evidence for pottery making in China. PMID:19487667

  2. The impact of system matrix dimension on small FOV SPECT reconstruction with truncated projections

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Chan, Chung, E-mail: Chung.Chan@yale.edu, E-mail: Chi.Liu@yale.edu; Wu, Jing; Liu, Chi, E-mail: Chung.Chan@yale.edu, E-mail: Chi.Liu@yale.edu

    Purpose: A dedicated cardiac hybrid single photon emission computed tomography (SPECT)/CT scanner that uses cadmium zinc telluride detectors and multiple pinhole collimators for stationary acquisition offers many advantages. However, the impact of the reconstruction system matrix (SM) dimension on the reconstructed image quality from truncated projections and 19 angular samples acquired on this scanner has not been extensively investigated. In this study, the authors aimed to investigate the impact of the dimensions of SM and the use of body contour derived from adjunctive CT imaging as an object support in reconstruction on this scanner, in relation to background extracardiac activity.more » Methods: The authors first simulated a generic SPECT/CT system to image four NCAT phantoms with various levels of extracardiac activity and compared the reconstructions using SM in different dimensions and with/without body contour as a support for quantitative evaluations. The authors then compared the reconstructions of 18 patient studies, which were acquired on a GE Discovery NM570c scanner following injection of different radiotracers, including {sup 99m}Tc-Tetrofosmin and {sup 123}I-mIBG, comparing the scanner’s default SM that incompletely covers the body with a large SM that incorporates a patient specific full body contour. Results: The simulation studies showed that the reconstructions using a SM that only partially covers the body yielded artifacts on the edge of the field of view (FOV), overestimation of activity and increased nonuniformity in the blood pool for the phantoms with higher relative levels of extracardiac activity. However, the impact on the quantitative accuracy in the high activity region, such as the myocardium, was subtle. On the other hand, an excessively large SM that enclosed the entire body alleviated the artifacts and reduced overestimation in the blood pool, but yielded slight underestimation in myocardium and defect regions. The reconstruction using the larger SM with body contour yielded the most quantitatively accurate results in all the regions of interest for a range of uptake levels in the extracardiac regions. In patient studies, the SM incorporating patient specific body contour minimized extracardiac artifacts, yielded similar myocardial activity, lower blood pool activity, and subsequently improved myocardium-to-blood pool contrast (p < 0.0001) by an average of 7% (range 0%–18%) across all the patients, compared to the reconstructions using the scanner’s default SM. Conclusions: Their results demonstrate that using a large SM that incorporates a CT derived body contour in the reconstruction could improve quantitative accuracy within the FOV for clinical studies with high extracardiac activity.« less

  3. Automatic Artifact Removal from Electroencephalogram Data Based on A Priori Artifact Information.

    PubMed

    Zhang, Chi; Tong, Li; Zeng, Ying; Jiang, Jingfang; Bu, Haibing; Yan, Bin; Li, Jianxin

    2015-01-01

    Electroencephalogram (EEG) is susceptible to various nonneural physiological artifacts. Automatic artifact removal from EEG data remains a key challenge for extracting relevant information from brain activities. To adapt to variable subjects and EEG acquisition environments, this paper presents an automatic online artifact removal method based on a priori artifact information. The combination of discrete wavelet transform and independent component analysis (ICA), wavelet-ICA, was utilized to separate artifact components. The artifact components were then automatically identified using a priori artifact information, which was acquired in advance. Subsequently, signal reconstruction without artifact components was performed to obtain artifact-free signals. The results showed that, using this automatic online artifact removal method, there were statistical significant improvements of the classification accuracies in both two experiments, namely, motor imagery and emotion recognition.

  4. Automatic Artifact Removal from Electroencephalogram Data Based on A Priori Artifact Information

    PubMed Central

    Zhang, Chi; Tong, Li; Zeng, Ying; Jiang, Jingfang; Bu, Haibing; Li, Jianxin

    2015-01-01

    Electroencephalogram (EEG) is susceptible to various nonneural physiological artifacts. Automatic artifact removal from EEG data remains a key challenge for extracting relevant information from brain activities. To adapt to variable subjects and EEG acquisition environments, this paper presents an automatic online artifact removal method based on a priori artifact information. The combination of discrete wavelet transform and independent component analysis (ICA), wavelet-ICA, was utilized to separate artifact components. The artifact components were then automatically identified using a priori artifact information, which was acquired in advance. Subsequently, signal reconstruction without artifact components was performed to obtain artifact-free signals. The results showed that, using this automatic online artifact removal method, there were statistical significant improvements of the classification accuracies in both two experiments, namely, motor imagery and emotion recognition. PMID:26380294

  5. Lively Jack-O'-Lantern Still Life

    ERIC Educational Resources Information Center

    Sanzaro, Christy

    2010-01-01

    Pumpkin carving is a favorite classroom activity. Around late October, the halls are filled with the sour smell of raw pumpkin innards, as parents, teachers and students are up to their elbows in yellowish strings and slime. These round, orange squash are transformed into jack-o'-lanterns that are placed around the school. The day after Halloween,…

  6. Comparative performance of sugarcane bagasse and black polyethylene as mulch for squash (Cucurbita pepo L.) production

    USDA-ARS?s Scientific Manuscript database

    Louisiana processed 11.6 million mt of sugarcane in 2014, producing 1.36 million mt of raw sugar and an estimated 3.5 million mt of bagasse. Sugarcane bagasse is the fibrous material remaining after removing the sucrose, water, and other impurities (filter mud) from the millable sugarcane. Typically...

  7. 77 FR 48536 - Notice of Inventory Completion: Logan Museum of Anthropology, Beloit College, Beloit, WI

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-08-14

    ... individuals were identified. Bowers identified two funerary objects associated with Burial 5 as a bone squash... individuals were identified. The eleven associated funerary objects are four bone awls associated with the sub...-shaped bracelet, 1 dog bone pendant, 1 wooden bowl, 1 lot of leather pieces, 1 horse effigy catlinite...

  8. Military Librarians Workshop (19th). Intellectual Updating: Changes in the State of the Art of Librarianship, 30 September - 2 October 1975

    DTIC Science & Technology

    1975-01-01

    Force instructor pilots two swimming pools, basketball will administer the 18 hours of this courts, squash and handball courts, program. Additional...Group Annex Fort Lee, VA 23801 Naval Weapons Station. Seal Beach Corona, CA 91720 ELDEEN J. GREENLAND Library Technician MARGARET L. GALLAGHER USA

  9. Evaluation of virus resistant rootstocks to manage watermelon vine decline and diseases caused by other potyviruses

    USDA-ARS?s Scientific Manuscript database

    Watermelon vine decline caused by Squash vein yellowing virus (SqVYV) is an emerging disease that has caused severe losses to Florida watermelon growers in recent years. Papaya ringspot virus type W (PRSV-W) is one of several watermelon-infecting potyviruses long present in the southeastern U.S. L...

  10. Abbott-Deser-Tekin Charge of Dilaton Black Holes with Squashed Horizons

    NASA Astrophysics Data System (ADS)

    Peng, Jun-Jin; Xiang, Wen-Chang; Cai, Shao-Hong

    2016-08-01

    Not Available Supported by the National Natural Science Foundation of China under Grant Nos 11275157 and 11505036, the Doctoral Research Fund of Guizhou Normal University in 2014, the Technology Department of Guizhou Province Fund under Grant No [2015]2114, and the Science and Technology Innovation Talent Team of Guizhou Province under Grant No (2015)4015.

  11. Measuring the Rebound Resilience of a Bouncing Ball

    ERIC Educational Resources Information Center

    Wadhwa, Ajay

    2012-01-01

    Some balls which are made of high-quality rubber (an elastomeric) material, such as tennis or squash balls, could be used for the determination of an important property of such materials called resilience. Since a bouncing ball involves a single impact we call this property "rebound resilience" and express it as the ratio of the rebound height to…

  12. Effectiveness of the Geneva Convention Relative to American POW’s (Prisoner of War)

    DTIC Science & Technology

    1973-05-01

    Vietnamese soldiers, Dengler was spread -eagled by his captors and at night left to the mercy of jungle insects, tied to a tree for harassment...was somewhat better. The daily routine was more formalized. Prisoners were fed two meals a day. Food consisted mainly of pumpkin or squash, pork fat

  13. Epidemiological Analysis of Multi-Virus Infections of Watermelon in Experimental Fields in Southwest Florida

    USDA-ARS?s Scientific Manuscript database

    The whitefly-transmitted viruses Squash vein yellowing virus (SqVYV) and Cucurbit leaf crumple virus (CuLCrV) have had serious impact on watermelon production in west-central and southwest Florida in recent years. We monitored the progress of SqVYV and CuLCrV and whitefly density in 2.5 acre experim...

  14. The Current German Debate on the Role of Force: A ’New Nation and a New Statesman’.

    DTIC Science & Technology

    1997-05-14

    While Germany might have preferred to have avoided entanglement in the Bosnian peacekeeping mission, the government could not allow its hesitation to...civilians were killed and hopes for democratic reform in China were squashed . Most nations of the world condemned China’s actions. Only a few hard-line

  15. Determination and reoxidation of the disulfide bridges of a squash-type trypsin inhibitor from Sechium edule seeds.

    PubMed

    Faça, Vitor M; Pereira, Sandra R; Laure, Hélen J; Greene, Lewis J

    2004-07-01

    The determination of the disulfide pairings of SETI-II, a trypsin inhibitor isolated from Sechium edule, is described herein. The inhibitor contains 31 amino acid residues per mol, 6 of which are cysteine. Forty-five nmol (160 microg) of SETI-II was hydrolyzed with 20 microg thermolysin for 48 hr at 45 degrees C, and peptides were separated by reverse phase high performance liquid chromatography (RP-HPLC). The major products were identified by amino acid composition, Edman degradation, and on the basis of the sequence of the inhibitor. The disulfide bridge pairings and (yields) are: Cys1-Cys4 (79%), Cys2-Cys5 (21%) and Cys3-Cys6 (43%). When the reduced inhibitor was reoxidized with glutathione reduced form (GSH)/glutathione oxidized form (GSSG) at pH 8.5 for 3 hr, full activity was recovered. These data show that disulfide bridge pairing and oxidation can be determined at nanomole levels and that sensitive and quantitative Edman degradation can eliminate the final time- and material-consuming step of disulfide determinations by eliminating the need to purify and cleave each peptide containing a disulfide bridge.

  16. Optical and thermoluminescence dating of Middle Stone Age and Kintampo bearing sediments at Birimi, a multi-component archaeological site in Ghana

    NASA Astrophysics Data System (ADS)

    Quickert, Nicole A.; Godfrey-Smith, Dorothy I.; Casey, Joanna L.

    2003-05-01

    We report the first luminescence ages for the archeological and geological sediments forming the substrate of the Birimi archaeological site in the Northern Region of Ghana. The site's significance rests on the fact that it contains a rich collection of artifact assemblages representative of three distinct cultures, and that, on the basis of artifact typology, the earliest assemblage is diagnostic of the Middle Stone Age (MSA) . In situ occurrences of MSA artifacts are found at over 1 m below today's surface. They are overlain by a ceramic-rich complex of a sedentary or semi-sendentary Later Stone Age culture known as the Kintampo. The western half of the site is dominated by the industrial remains of Iron Age smelting activity. Elemental, mineralogical, and sedimentological analysis of the cultural and sub-cultural sedimentary horizons at the site revealed at least three distinct lithostratigraphic units. The quartz sediments are derived from the sandstone of the Gambaga escarpment, mass wasted and accreted fluvially at a rate of 3.2 cm/ka, forming a wide terrace at Birimi. Silts and finer fractions derive from windblown dust, likely from White Volta River and granitic sources to the north. Soil forming processes and wide fluctuations in moisture have progressively reduced the sediments at depth to the resistant quartz and kaolinite, with rich iron oxide coatings, and created two ironstone horizons composed of goethite-cemented quartz nodules. Multiple aliquot green-light stimulated optical ages for 125-150 μm quartz grains yielded ages of 23.6±2.9 and 40.8±11.8 ka for the MSA-bearing sediments, and 58.4±15.3 ka for the base of the terrace. Radiocarbon ages on charcoal from Kintampo-bearing units are 3.36-3.83 ka cal BP, and are supported by thermoluminescence (TL) ages on pottery sherds and burnt house daub fragments of this cultural complex. A 0.4 ka age on sediment from the site's surface confirms that the quartz zeroes well when exposed to natural light. Sediments bearing the Kintampo artifacts, however, yielded ages of 7.8-16.9 ka. These ages were obtained on sediments from large pits, some over 50 cm deep, and they deviate only slightly from the ages expected for naturally aggraded sediments at these depths. We conclude, therefore, that extensive digging of pits by the Kintampo dwellers was followed by rapid refilling, and that the bulk mobilization of the matrix did not permit the sedimentary quartz grains to experience any appreciable zeroing at that time.

  17. Correction of Bowtie-Filter Normalization and Crescent Artifacts for a Clinical CBCT System.

    PubMed

    Zhang, Hong; Kong, Vic; Huang, Ke; Jin, Jian-Yue

    2017-02-01

    To present our experiences in understanding and minimizing bowtie-filter crescent artifacts and bowtie-filter normalization artifacts in a clinical cone beam computed tomography system. Bowtie-filter position and profile variations during gantry rotation were studied. Two previously proposed strategies (A and B) were applied to the clinical cone beam computed tomography system to correct bowtie-filter crescent artifacts. Physical calibration and analytical approaches were used to minimize the norm phantom misalignment and to correct for bowtie-filter normalization artifacts. A combined procedure to reduce bowtie-filter crescent artifacts and bowtie-filter normalization artifacts was proposed and tested on a norm phantom, CatPhan, and a patient and evaluated using standard deviation of Hounsfield unit along a sampling line. The bowtie-filter exhibited not only a translational shift but also an amplitude variation in its projection profile during gantry rotation. Strategy B was better than strategy A slightly in minimizing bowtie-filter crescent artifacts, possibly because it corrected the amplitude variation, suggesting that the amplitude variation plays a role in bowtie-filter crescent artifacts. The physical calibration largely reduced the misalignment-induced bowtie-filter normalization artifacts, and the analytical approach further reduced bowtie-filter normalization artifacts. The combined procedure minimized both bowtie-filter crescent artifacts and bowtie-filter normalization artifacts, with Hounsfield unit standard deviation being 63.2, 45.0, 35.0, and 18.8 Hounsfield unit for the best correction approaches of none, bowtie-filter crescent artifacts, bowtie-filter normalization artifacts, and bowtie-filter normalization artifacts + bowtie-filter crescent artifacts, respectively. The combined procedure also demonstrated reduction of bowtie-filter crescent artifacts and bowtie-filter normalization artifacts in a CatPhan and a patient. We have developed a step-by-step procedure that can be directly used in clinical cone beam computed tomography systems to minimize both bowtie-filter crescent artifacts and bowtie-filter normalization artifacts.

  18. The effect of averaging adjacent planes for artifact reduction in matrix inversion tomosynthesis

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Godfrey, Devon J.; Page McAdams, H.; Dobbins, James T. III

    2013-02-15

    Purpose: Matrix inversion tomosynthesis (MITS) uses linear systems theory and knowledge of the imaging geometry to remove tomographic blur that is present in conventional backprojection tomosynthesis reconstructions, leaving in-plane detail rendered clearly. The use of partial-pixel interpolation during the backprojection process introduces imprecision in the MITS modeling of tomographic blur, and creates low-contrast artifacts in some MITS planes. This paper examines the use of MITS slabs, created by averaging several adjacent MITS planes, as a method for suppressing partial-pixel artifacts. Methods: Human chest tomosynthesis projection data, acquired as part of an IRB-approved pilot study, were used to generate MITS planes,more » three-plane MITS slabs (MITSa3), five-plane MITS slabs (MITSa5), and seven-plane MITS slabs (MITSa7). These were qualitatively examined for partial-pixel artifacts and the visibility of normal and abnormal anatomy. Additionally, small (5 mm) subtle pulmonary nodules were simulated and digitally superimposed upon human chest tomosynthesis projection images, and their visibility was qualitatively assessed in the different reconstruction techniques. Simulated images of a thin wire were used to generate modulation transfer function (MTF) and slice-sensitivity profile curves for the different MITS and MITS slab techniques, and these were examined for indications of partial-pixel artifacts and frequency response uniformity. Finally, mean-subtracted, exposure-normalized noise power spectra (ENNPS) estimates were computed and compared for MITS and MITS slab reconstructions, generated from 10 sets of tomosynthesis projection data of an acrylic slab. The simulated in-plane MTF response of each technique was also combined with the square root of the ENNPS estimate to yield stochastic signal-to-noise ratio (SNR) information about the different reconstruction techniques. Results: For scan angles of 20 Degree-Sign and 5 mm plane separation, seven MITS planes must be averaged to sufficiently remove partial-pixel artifacts. MITSa7 does appear to subtly reduce the contrast of high-frequency 'edge' information, but the removal of partial-pixel artifacts makes the appearance of low-contrast, fine-detail anatomy even more conspicuous in MITSa7 slices. MITSa7 also appears to render simulated subtle 5 mm pulmonary nodules with greater visibility than MITS alone, in both the open lung and regions overlying the mediastinum. Finally, the MITSa7 technique reduces stochastic image variance, though the in-plane stochastic SNR (for very thin objects which do not span multiple MITS planes) is only improved at spatial frequencies between 0.05 and 0.20 cycles/mm. Conclusions: The MITSa7 method is an improvement over traditional single-plane MITS for thoracic imaging and the pulmonary nodule detection task, and thus the authors plan to use the MITSa7 approach for all future MITS research at the authors' institution.« less

  19. The effect of averaging adjacent planes for artifact reduction in matrix inversion tomosynthesis.

    PubMed

    Godfrey, Devon J; McAdams, H Page; Dobbins, James T

    2013-02-01

    Matrix inversion tomosynthesis (MITS) uses linear systems theory and knowledge of the imaging geometry to remove tomographic blur that is present in conventional backprojection tomosynthesis reconstructions, leaving in-plane detail rendered clearly. The use of partial-pixel interpolation during the backprojection process introduces imprecision in the MITS modeling of tomographic blur, and creates low-contrast artifacts in some MITS planes. This paper examines the use of MITS slabs, created by averaging several adjacent MITS planes, as a method for suppressing partial-pixel artifacts. Human chest tomosynthesis projection data, acquired as part of an IRB-approved pilot study, were used to generate MITS planes, three-plane MITS slabs (MITSa3), five-plane MITS slabs (MITSa5), and seven-plane MITS slabs (MITSa7). These were qualitatively examined for partial-pixel artifacts and the visibility of normal and abnormal anatomy. Additionally, small (5 mm) subtle pulmonary nodules were simulated and digitally superimposed upon human chest tomosynthesis projection images, and their visibility was qualitatively assessed in the different reconstruction techniques. Simulated images of a thin wire were used to generate modulation transfer function (MTF) and slice-sensitivity profile curves for the different MITS and MITS slab techniques, and these were examined for indications of partial-pixel artifacts and frequency response uniformity. Finally, mean-subtracted, exposure-normalized noise power spectra (ENNPS) estimates were computed and compared for MITS and MITS slab reconstructions, generated from 10 sets of tomosynthesis projection data of an acrylic slab. The simulated in-plane MTF response of each technique was also combined with the square root of the ENNPS estimate to yield stochastic signal-to-noise ratio (SNR) information about the different reconstruction techniques. For scan angles of 20° and 5 mm plane separation, seven MITS planes must be averaged to sufficiently remove partial-pixel artifacts. MITSa7 does appear to subtly reduce the contrast of high-frequency "edge" information, but the removal of partial-pixel artifacts makes the appearance of low-contrast, fine-detail anatomy even more conspicuous in MITSa7 slices. MITSa7 also appears to render simulated subtle 5 mm pulmonary nodules with greater visibility than MITS alone, in both the open lung and regions overlying the mediastinum. Finally, the MITSa7 technique reduces stochastic image variance, though the in-plane stochastic SNR (for very thin objects which do not span multiple MITS planes) is only improved at spatial frequencies between 0.05 and 0.20 cycles∕mm. The MITSa7 method is an improvement over traditional single-plane MITS for thoracic imaging and the pulmonary nodule detection task, and thus the authors plan to use the MITSa7 approach for all future MITS research at the authors' institution.

  20. Efficacy of Various Application Methods of Fluensulfone for Managing Root-knot Nematodes in Vegetables

    PubMed Central

    Morris, Kelly A.; Langston, David B.; Davis, Richard F.; Noe, James P.; Dickson, Don W.; Timper, Patricia

    2016-01-01

    Fluensulfone is a new nematicide in the flouroalkenyl chemical group. A field experiment was conducted in 2012 and 2013 to evaluate the efficacy of various application methods of fluensulfone for control of Meloidogyne spp. in cucumber (Cucumis sativus). Treatments of fluensulfone (3.0 kg a.i./ha) were applied either as preplant incorporation (PPI) or via different drip irrigation methods: drip without pulse irrigation (Drip NP), pulse irrigation 1 hr after treatment (Drip +1P), and treatment at the same time as pulse irrigation (Drip =P). The experiment had eight replications per treatment and also included a PPI treatment of oxamyl (22.5 kg a.i./ha) and a nontreated control. Compared to the control, neither the oxamyl nor the fluensulfone PPI treatments reduced root galling by Meloidogyne spp. in cucumber. Among the drip treatments, Drip NP and Drip +1P reduced root galling compared to the control. Cucumber yield was greater in all fluensulfone treatments than in the control. In a growth-chamber experiment, the systemic activity and phytotoxicity of fluensulfone were also evaluated on tomato (Solanum lycopersicum), eggplant (Solanum melongena), cucumber, and squash (Curcurbita pepo). At the seedling stage, foliage of each crop was sprayed with fluensulfone at 3, 6, and 12 g a.i./liter, oxamyl at 4.8 g a.i./liter, or water (nontreated control). Each plant was inoculated with Meloidogyne incognita juveniles 2 d after treatment. There were six replications per treatment and the experiment was conducted twice. Foliar applications of fluensulfone reduced plant vigor and dry weight of eggplant and tomato, but not cucumber or squash; application of oxamyl had no effect on the vigor or weight of any of the crops. Typically, only the highest rate of fluensulfone was phytotoxic to eggplant and tomato. Tomato was the only crop tested in which there was a reduction in the number of nematodes or galls when fluensulfone or oxamyl was applied to the foliage compared to the nontreated control. This study demonstrates that control of Meloidogyne spp. may be obtained by drip and foliar applications of fluensulfone; however, the systemic activity of fluensulfone is crop specific and there is a risk of phytotoxicity with foliar applications. PMID:27418698

  1. Artifacts in Sonography - Part 3.

    PubMed

    Bönhof, Jörg A; McLaughlin, Glen

    2018-06-01

    As a continuation of parts 1 1 and 2 2, this article discusses artifacts as caused by insufficient temporal resolution, artifacts in color and spectral Doppler sonography, and information regarding artifacts in sonography with contrast agents. There are artifacts that occur in B-mode sonography as well as in Doppler imaging methods and sonography with contrast agents, such as slice thickness artifacts and bow artifacts, shadows, mirroring, and artifacts due to refraction that appear, for example, as double images, because they are based on the same formation mechanisms. In addition, there are artifacts specific to Doppler sonography, such as the twinkling artifact, and method-based motion artifacts, such as aliasing, the ureteric jet, and due to tissue vibration. The artifacts specific to contrast mode include echoes from usually highly reflective structures that are not contrast bubbles ("leakage"). Contrast agent can also change the transmitting signal so that even structures not containing contrast agent are echogenic ("pseudoenhancement"). While artifacts can cause problems regarding differential diagnosis, they can also be useful for determining the diagnosis. Therefore, effective use of sonography requires both profound knowledge and skilled interpretation of artifacts. © Georg Thieme Verlag KG Stuttgart · New York.

  2. Lunar Proton Albedo Anomalies: Soil, Surveyors, and Statistics

    NASA Astrophysics Data System (ADS)

    Wilson, J. K.; Schwadron, N.; Spence, H. E.; Case, A. W.; Golightly, M. J.; Jordan, A.; Looper, M. D.; Petro, N. E.; Robinson, M. S.; Stubbs, T. J.; Zeitlin, C. J.; Blake, J. B.; Kasper, J. C.; Mazur, J. E.; Smith, S. S.; Townsend, L. W.

    2014-12-01

    Since the launch of LRO in 2009, the CRaTER instrument has been mapping albedo protons (~100 MeV) from the Moon. These protons are produced by nuclear spallation, a consequence of galactic cosmic ray (GCR) bombardment of the lunar regolith. Just as spalled neutrons and gamma rays reveal elemental abundances in the lunar regolith, albedo protons may be a complimentary method for mapping compositional variations. We presently find that the lunar maria have an average proton yield 0.9% ±0.3% higher than the average yield in the highlands; this is consistent with neutron data that is sensitive to the regolith's average atomic weight. We also see cases where two or more adjacent pixels (15° × 15°) have significantly anomalous yields above or below the mean. These include two high-yielding regions in the maria, and three low-yielding regions in the far-side highlands. Some of the regions could be artifacts of Poisson noise, but for completeness we consider possible effects from compositional anomalies in the lunar regolith, including pyroclastic flows, antipodes of fresh craters, and so-called "red spots". We also consider man-made landers and crash sites that may have brought elements not normally found in the lunar regolith.

  3. Biochemical artifacts in experiments involving repeated biopsies in the same muscle

    PubMed Central

    Van Thienen, Ruud; D'Hulst, Gommaar; Deldicque, Louise; Hespel, Peter

    2014-01-01

    Abstract Needle biopsies are being extensively used in clinical trials addressing muscular adaptation to exercise and diet. Still, the potential artifacts due to biopsy sampling are often overlooked. Healthy volunteers (n = 9) underwent two biopsies through a single skin incision in a pretest. Two days later (posttest) another biopsy was taken 3 cm proximally and 3 cm distally to the pretest incision. Muscle oxygenation status (tissue oxygenation index [TOI]) was measured by near‐infrared spectroscopy. Biopsy samples were analyzed for 40 key markers (mRNA and protein contents) of myocellular O2 sensing, inflammation, cell proliferation, mitochondrial biogenesis, protein synthesis and breakdown, oxidative stress, and energy metabolism. In the pretest, all measurements were identical between proximal and distal biopsies. However, compared with the pretest, TOI in the posttest was reduced in the proximal (−10%, P < 0.05), but not in the distal area. Conversely, most inflammatory markers were upregulated at the distal (100–500%, P < 0.05), but not at the proximal site. Overall, 29 of the 40 markers measured, equally distributed over all pathways studied, were either up‐ or downregulated by 50–500% (P < 0.05). In addition, 19 markers yielded conflicting results between the proximal and distal measurements (P < 0.05). This study clearly documents that prior muscle biopsies can cause major disturbances in myocellular signaling pathways in needle biopsies specimens sampled 48 h later. In addition, different biopsy sites within identical experimental conditions yielded conflicting results. PMID:24819751

  4. Biochemical artifacts in experiments involving repeated biopsies in the same muscle.

    PubMed

    Van Thienen, Ruud; D'Hulst, Gommaar; Deldicque, Louise; Hespel, Peter

    2014-01-01

    Needle biopsies are being extensively used in clinical trials addressing muscular adaptation to exercise and diet. Still, the potential artifacts due to biopsy sampling are often overlooked. Healthy volunteers (n = 9) underwent two biopsies through a single skin incision in a pretest. Two days later (posttest) another biopsy was taken 3 cm proximally and 3 cm distally to the pretest incision. Muscle oxygenation status (tissue oxygenation index [TOI]) was measured by near-infrared spectroscopy. Biopsy samples were analyzed for 40 key markers (mRNA and protein contents) of myocellular O2 sensing, inflammation, cell proliferation, mitochondrial biogenesis, protein synthesis and breakdown, oxidative stress, and energy metabolism. In the pretest, all measurements were identical between proximal and distal biopsies. However, compared with the pretest, TOI in the posttest was reduced in the proximal (-10%, P < 0.05), but not in the distal area. Conversely, most inflammatory markers were upregulated at the distal (100-500%, P < 0.05), but not at the proximal site. Overall, 29 of the 40 markers measured, equally distributed over all pathways studied, were either up- or downregulated by 50-500% (P < 0.05). In addition, 19 markers yielded conflicting results between the proximal and distal measurements (P < 0.05). This study clearly documents that prior muscle biopsies can cause major disturbances in myocellular signaling pathways in needle biopsies specimens sampled 48 h later. In addition, different biopsy sites within identical experimental conditions yielded conflicting results.

  5. Estimation of quantum yields of weak fluorescence from eosin Y dimers formed in aqueous solutions.

    PubMed

    Enoki, Masami; Katoh, Ryuzi

    2018-05-17

    We studied the weak fluorescence from the dimer of eosin Y (EY) in aqueous solutions. We used a newly developed ultrathin optical cell with a thickness ranging from of the order of microns to several hundreds of microns to successfully measure the fluorescence spectra of highly concentrated aqueous solutions of EY without artifacts caused by the reabsorption of fluorescence. The spectra we obtained were similar to the fluorescence spectrum of the EY monomer; almost no fluorescence was observed from the EY dimer. By a careful comparison of the spectra of solutions at low and high concentrations of EY, we succeeded in extracting the fluorescence spectrum of the EY dimer. The fluorescence quantum yield of the EY dimer was estimated to be 0.005.

  6. Wavelet approach to artifact noise removal from Capacitive coupled Electrocardiograph.

    PubMed

    Lee, Seung Min; Kim, Ko Keun; Park, Kwang Suk

    2008-01-01

    Capacitive coupled Electrocardiography (ECG) is introduced as non-invasive measurement technology for ubiquitous health care and appliance are spread out widely. Although it has many merits, however, capacitive coupled ECG is very weak for motion artifacts for its non-skin-contact property. There are many studies for artifact problems which treats all artifact signals below 0.8Hz. In our capacitive coupled ECG measurement system, artifacts exist not only below 0.8Hz but also over than 10Hz. Therefore, artifact noise removal algorithm using wavelet method is tested to reject artifact-wandered signal from measured signals. It is observed that using power calculation each decimation step, artifact-wandered signal is removed as low frequency artifacts as high frequency artifacts. Although some original ECG signal is removed with artifact signal, we could level the signal quality for long term measure which shows the best quality ECG signals as we can get.

  7. Effect of higher rate of quintec for the control of powdery mildew on summer squash, 2012

    USDA-ARS?s Scientific Manuscript database

    The experiment was conducted at the Ohio Agricultural Research and Development Center’s Snyder Farm located in Wooster, OH on Wooster-Riddles silty clay loam soil, pH 6.0. On 2 May, the field was cultivated. On 15 May raised beds on 5 ft centers were prepared, laid with drip tape and plastic. On...

  8. International Symposium on the Effective Teaching of Racquet Sports. Proceedings (1st, Urbana, Illinois, June 11-14, 1980).

    ERIC Educational Resources Information Center

    Groppel, Jack L., Ed.; Sears, Ronald G., Ed.

    Researchers, coaches, and players of racquet sports were brought together for this symposium on four racquet sports. Although most of the papers presented at the symposium were written by Americans, one of the speakers was from Canada, and another was from Australia. The sports represented were badminton, racquetball, tennis, and squash. In Part…

  9. Proceedings of a National Symposium on the Racquet Sports. An Exploration of Research Implications and Teaching Strategies (Urbana, Illinois, June 13-16, 1979).

    ERIC Educational Resources Information Center

    Groppel, Jack L., Ed.

    Conference proceedings from this national symposium on hard scientific research and developments in teaching tennis, squash, racquetball, and badminton are divided into several sections. The first deals with sports medicine and the biomechanics of the racquet sports. The second part discusses the pyschological and sociological aspects of…

  10. In amongst the Glitter and the Squashed Blueberries: Crafting a Collaborative Lens for Children's Literacy Pedagogy in a Community Setting

    ERIC Educational Resources Information Center

    Hackett, Abigail; Pahl, Kate; Pool, Steve

    2017-01-01

    In this article, we bring together relational arts practice (Kester, 2004) with collaborative ethnography (Campbell and Lassiter, 2015) in order to propose art not as a way of teaching children literacy, but as a lens to enable researchers and practitioners to view children's literacies differently. Both relational arts practice and collaborative…

  11. 40 CFR 180.593 - Etoxazole; tolerances for residues.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... Papaya 0.20 Pepper/eggplant subgroup 8-10B 0.20 Peppermint, oil 20 Peppermint, tops 10 Pistachio 0.01..., forage 0.80 Corn, field, grain 0.01 Corn, field, refined oil 0.03 Corn, field, stover 4.0 Corn, pop... Sheep, liver 0.01 Spearmint, oil 20 Spearmint, tops 10 Squash/cucumber subgroup 9B 0.02 Star apple 0.20...

  12. 40 CFR 180.593 - Etoxazole; tolerances for residues.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... Papaya 0.20 Pepper/eggplant subgroup 8-10B 0.20 Peppermint, oil 20 Peppermint, tops 10 Pistachio 0.01..., forage 0.80 Corn, field, grain 0.01 Corn, field, refined oil 0.03 Corn, field, stover 4.0 Corn, pop... Sheep, liver 0.01 Spearmint, oil 20 Spearmint, tops 10 Squash/cucumber subgroup 9B 0.02 Star apple 0.20...

  13. A new and potentially damaging whitefly-transmitted virus of cucurbits was found this fall 2014 in Imperial County, CA

    USDA-ARS?s Scientific Manuscript database

    A new virus that appears to be related to but distinct from Squash vein yellowing virus (SqVYV), a Bemisia tabaci-transmitted ipomovirus (family Potyviridae) that occurs in Florida was found in fall 2014 in Imperial County, CA infecting pumpkin and melon plants and exhibiting symptoms of stunting an...

  14. Update on the watermelon vine decline virus and other whitefly-transmitted cucurbit viruses in Florida, and their effects on watermelon

    USDA-ARS?s Scientific Manuscript database

    Whitefly-transmitted Squash vein yellowing virus (SqVYV) was shown in the mid-2000’s to cause a watermelon vine decline in southwest and west-central Florida. More recently, Cucurbit leaf crumple virus (CuLCrV) and Cucurbit yellow stunting disorder virus (CYSDV), also whitefly-transmitted, have bee...

  15. Low-Noise Implantable Electrode

    NASA Technical Reports Server (NTRS)

    Lund, G. F.

    1982-01-01

    New implantable electrocardiogram electrode much less sensitive than previous designs to spurious biological potentials. Designed in novel "pocket" configuration, new electrode is intended as sensor for radiotelemetry of biological parameters in experiments on unrestrained subjects. Electrode is esentially squashed cylinder that admits body fluid into interior. Cylinder and electrical lead are made of stainless steel. Spot welding and crimping are used for assembly, rather than soldering.

  16. The U.S. Government and the Apache Indians, 1871-1876: A Case Study in Counterinsurgency

    DTIC Science & Technology

    1993-06-05

    sustenance, but this was a very meager source of food for them. When they did plant crops it was usually corn, beans or squash . They relied heavily on...he wish to become entangled with the bureaucracy of the Indian Bureau by attempting to obtain permission to conduct a search in the first place. The

  17. Synthesis, Analysis, and Processing of Fractal Signals

    DTIC Science & Technology

    1991-10-01

    coordinator in hockey, squash, volleyball, and softball, but also for reminding me periodically that 1/f noise can exist outside a computer. More...similar signals as Fourier-based representations are for stationary and periodic signals. Furthermore, because wave- let transformations can be...and periodic signals. Furthermore, just as the discovery of fast Fourier transform (FFT) algorithms dramatically increased the viability the Fourier

  18. Determination of Contact Time of Rubber Balls Using a Digital Oscilloscope

    ERIC Educational Resources Information Center

    Wadhwa, Ajay

    2010-01-01

    We present a new method for determining the contact time of a rubber ball with the rebounding surface by using a sound-detecting electronic circuit and a digital storage oscilloscope. The rubber ball (a tennis ball or squash ball) is dropped from a known height onto a rigid surface and its contact time on first bounce is determined on the…

  19. Study of the dynamic properties and effects of temperature using a spring model for the bouncing ball

    NASA Astrophysics Data System (ADS)

    Wadhwa, Ajay

    2013-05-01

    We studied the motion of a bouncing ball by representing it through an equivalent mass-spring system executing damped harmonic oscillations. We represented the elasticity of the system through the spring constant ‘k’ and the viscous damping effect, causing loss of energy, through damping constant ‘c’. By including these two factors we formed a differential equation for the equivalent mass-spring system of the bouncing ball. This equation was then solved to study the elastic and dynamic properties of its motion by expressing them in terms of experimentally measurable physical quantities such as contact time, coefficient of restitution, etc. We used our analysis for different types of ball material: rubber (lawn-tennis ball, super ball, soccer ball and squash ball) and plastic (table-tennis ball) at room temperature. Since the effect of temperature on the bounce of a squash ball is significant, we studied the temperature dependence of its elastic properties. The experiments were performed using audio and surface-temperature sensors interfaced with a computer through a USB port. The work presented here is suitable for undergraduate laboratories. It particularly emphasizes the use of computer interfacing for conducting conventional physics experiments.

  20. Edge Principal Components and Squash Clustering: Using the Special Structure of Phylogenetic Placement Data for Sample Comparison

    PubMed Central

    Matsen IV, Frederick A.; Evans, Steven N.

    2013-01-01

    Principal components analysis (PCA) and hierarchical clustering are two of the most heavily used techniques for analyzing the differences between nucleic acid sequence samples taken from a given environment. They have led to many insights regarding the structure of microbial communities. We have developed two new complementary methods that leverage how this microbial community data sits on a phylogenetic tree. Edge principal components analysis enables the detection of important differences between samples that contain closely related taxa. Each principal component axis is a collection of signed weights on the edges of the phylogenetic tree, and these weights are easily visualized by a suitable thickening and coloring of the edges. Squash clustering outputs a (rooted) clustering tree in which each internal node corresponds to an appropriate “average” of the original samples at the leaves below the node. Moreover, the length of an edge is a suitably defined distance between the averaged samples associated with the two incident nodes, rather than the less interpretable average of distances produced by UPGMA, the most widely used hierarchical clustering method in this context. We present these methods and illustrate their use with data from the human microbiome. PMID:23505415

  1. The responses of antioxidant system in bitter melon, sponge gourd, and winter squash under flooding and chilling stresses

    NASA Astrophysics Data System (ADS)

    Do, Tuong Ha; Nguyen, Hoang Chinh; Lin, Kuan-Hung

    2018-04-01

    The objective of this paper was to review the responses of antioxidant system and physiological parameters of bitter melon (BM), sponge gourd (SG), and winter squash (WS) under waterlogged and low temperature conditions. The BM and SG plants were subjected to 0-72 h flooding treatments, and BM and WS plants were exposed to chilling at 12/7 °C (day/night) for 0-72 h. Different genotypes responded differently to environmental stress according to their various antioxidant system and physiological parameters. Increased ascorbate peroxidase (APX) and superoxide dismutase (SOD) activities provided SG and WS plants with increased waterlogging and chilling stress tolerance, respectively, compared to BM plants. The APX gene from SG and the SOD gene from WS were then cloned, and the regulation of APX and SOD gene expressions under flooding and chilling stress, respectively, were also measured. Increased expression of APX and SOD genes was accompanied by the increased activity of the enzyme involved in detoxifying reactive oxygen species (ROS) in response to those stresses. Both APX and SOD activities can be used for selecting BM lines with the best tolerances to water logging and chilling stresses.

  2. 1.5 versus 3 versus 7 Tesla in abdominal MRI: A comparative study.

    PubMed

    Laader, Anja; Beiderwellen, Karsten; Kraff, Oliver; Maderwald, Stefan; Wrede, Karsten; Ladd, Mark E; Lauenstein, Thomas C; Forsting, Michael; Quick, Harald H; Nassenstein, Kai; Umutlu, Lale

    2017-01-01

    The aim of this study was to investigate and compare the feasibility as well as potential impact of altered magnetic field properties on image quality and potential artifacts of 1.5 Tesla, 3 Tesla and 7 Tesla non-enhanced abdominal MRI. Magnetic Resonance (MR) imaging of the upper abdomen was performed in 10 healthy volunteers on a 1.5 Tesla, a 3 Tesla and a 7 Tesla MR system. The study protocol comprised a (1) T1-weighted fat-saturated spoiled gradient-echo sequence (2D FLASH), (2) T1-weighted fat-saturated volumetric interpolated breath hold examination sequence (3D VIBE), (3) T1-weighted 2D in and opposed phase sequence, (4) True fast imaging with steady-state precession sequence (TrueFISP) and (5) T2-weighted turbo spin-echo (TSE) sequence. For comparison reasons field of view and acquisition times were kept comparable for each correlating sequence at all three field strengths, while trying to achieve the highest possible spatial resolution. Qualitative and quantitative analyses were tested for significant differences. While 1.5 and 3 Tesla MRI revealed comparable results in all assessed features and sequences, 7 Tesla MRI yielded considerable differences in T1 and T2 weighted imaging. Benefits of 7 Tesla MRI encompassed an increased higher spatial resolution and a non-enhanced hyperintense vessel signal at 7 Tesla, potentially offering a more accurate diagnosis of abdominal parenchymatous and vasculature disease. 7 Tesla MRI was also shown to be more impaired by artifacts, including residual B1 inhomogeneities, susceptibility and chemical shift artifacts, resulting in reduced overall image quality and overall image impairment ratings. While 1.5 and 3 Tesla T2w imaging showed equivalently high image quality, 7 Tesla revealed strong impairments in its diagnostic value. Our results demonstrate the feasibility and overall comparable imaging ability of T1-weighted 7 Tesla abdominal MRI towards 3 Tesla and 1.5 Tesla MRI, yielding a promising diagnostic potential for non-enhanced Magnetic Resonance Angiography (MRA). 1.5 Tesla and 3 Tesla offer comparably high-quality T2w imaging, showing superior diagnostic quality over 7 Tesla MRI.

  3. 1.5 versus 3 versus 7 Tesla in abdominal MRI: A comparative study

    PubMed Central

    Beiderwellen, Karsten; Kraff, Oliver; Maderwald, Stefan; Wrede, Karsten; Ladd, Mark E.; Lauenstein, Thomas C.; Forsting, Michael; Quick, Harald H.; Nassenstein, Kai; Umutlu, Lale

    2017-01-01

    Objectives The aim of this study was to investigate and compare the feasibility as well as potential impact of altered magnetic field properties on image quality and potential artifacts of 1.5 Tesla, 3 Tesla and 7 Tesla non-enhanced abdominal MRI. Materials and methods Magnetic Resonance (MR) imaging of the upper abdomen was performed in 10 healthy volunteers on a 1.5 Tesla, a 3 Tesla and a 7 Tesla MR system. The study protocol comprised a (1) T1-weighted fat-saturated spoiled gradient-echo sequence (2D FLASH), (2) T1-weighted fat-saturated volumetric interpolated breath hold examination sequence (3D VIBE), (3) T1-weighted 2D in and opposed phase sequence, (4) True fast imaging with steady-state precession sequence (TrueFISP) and (5) T2-weighted turbo spin-echo (TSE) sequence. For comparison reasons field of view and acquisition times were kept comparable for each correlating sequence at all three field strengths, while trying to achieve the highest possible spatial resolution. Qualitative and quantitative analyses were tested for significant differences. Results While 1.5 and 3 Tesla MRI revealed comparable results in all assessed features and sequences, 7 Tesla MRI yielded considerable differences in T1 and T2 weighted imaging. Benefits of 7 Tesla MRI encompassed an increased higher spatial resolution and a non-enhanced hyperintense vessel signal at 7 Tesla, potentially offering a more accurate diagnosis of abdominal parenchymatous and vasculature disease. 7 Tesla MRI was also shown to be more impaired by artifacts, including residual B1 inhomogeneities, susceptibility and chemical shift artifacts, resulting in reduced overall image quality and overall image impairment ratings. While 1.5 and 3 Tesla T2w imaging showed equivalently high image quality, 7 Tesla revealed strong impairments in its diagnostic value. Conclusions Our results demonstrate the feasibility and overall comparable imaging ability of T1-weighted 7 Tesla abdominal MRI towards 3 Tesla and 1.5 Tesla MRI, yielding a promising diagnostic potential for non-enhanced Magnetic Resonance Angiography (MRA). 1.5 Tesla and 3 Tesla offer comparably high-quality T2w imaging, showing superior diagnostic quality over 7 Tesla MRI. PMID:29125850

  4. Prospective Heart Tracking for Whole-heart Magnetic Resonance Angiography

    PubMed Central

    Moghari, Mehdi H.; Geva, Tal; Powell, Andrew J.

    2015-01-01

    Purpose To develop a prospective respiratory-gating technique (Heart-NAV) for use with contrast-enhanced 3D inversion recovery (IR) whole-heart magnetic resonance angiography (MRA) acquisitions that directly tracks heart motion without creating image inflow artifact. Methods With Heart-NAV, 1 of the startup pulses for the whole-heart steady-state free precession MRA sequence is used to collect the centerline of k-space, and its 1-dimensional reconstruction is fed into the standard diaphragm-navigator (NAV) signal analysis process to prospectively gate and track respiratory-induced heart displacement. Ten healthy volunteers underwent non-contrast whole-heart MRA acquisitions using the conventional diaphragm-NAV and Heart-NAV with 5 and 10 mm acceptance windows in a 1.5T scanner. Five patients underwent contrast-enhanced IR whole-heart MRA using a diaphragm-NAV and Heart-NAV with a 5 mm acceptance window. Results For non-contrast whole-heart MRA with both the 5 and 10 mm acceptance windows, Heart-NAV yielded coronary artery vessel sharpness and subjective visual scores that were not significantly different than those using a conventional diaphragm-NAV. Scan time for Heart-NAV was 10% shorter (p<0.05). In patients undergoing contrast-enhanced IR whole-heart MRA, inflow artifact was seen with the diaphragm-NAV but not with Heart-NAV. Conclusion Compared to a conventional diaphragm-NAV, Heart-NAV achieves similar image quality in a slightly shorter scan time and eliminates inflow artifact. PMID:26843458

  5. Analysis of x-ray tomography data of an extruded low density styrenic foam: an image analysis study

    NASA Astrophysics Data System (ADS)

    Lin, Jui-Ching; Heeschen, William

    2016-10-01

    Extruded styrenic foams are low density foams that are widely used for thermal insulation. It is difficult to precisely characterize the structure of the cells in low density foams by traditional cross-section viewing due to the frailty of the walls of the cells. X-ray computed tomography (CT) is a non-destructive, three dimensional structure characterization technique that has great potential for structure characterization of styrenic foams. Unfortunately the intrinsic artifacts of the data and the artifacts generated during image reconstruction are often comparable in size and shape to the thin walls of the foam, making robust and reliable analysis of cell sizes challenging. We explored three different image processing methods to clean up artifacts in the reconstructed images, thus allowing quantitative three dimensional determination of cell size in a low density styrenic foam. Three image processing approaches - an intensity based approach, an intensity variance based approach, and a machine learning based approach - are explored in this study, and the machine learning image feature classification method was shown to be the best. Individual cells are segmented within the images after the images were cleaned up using the three different methods and the cell sizes are measured and compared in the study. Although the collected data with the image analysis methods together did not yield enough measurements for a good statistic of the measurement of cell sizes, the problem can be resolved by measuring multiple samples or increasing imaging field of view.

  6. Spectral CT Image Restoration via an Average Image-Induced Nonlocal Means Filter.

    PubMed

    Zeng, Dong; Huang, Jing; Zhang, Hua; Bian, Zhaoying; Niu, Shanzhou; Zhang, Zhang; Feng, Qianjin; Chen, Wufan; Ma, Jianhua

    2016-05-01

    Spectral computed tomography (SCT) images reconstructed by an analytical approach often suffer from a poor signal-to-noise ratio and strong streak artifacts when sufficient photon counts are not available in SCT imaging. In reducing noise-induced artifacts in SCT images, in this study, we propose an average image-induced nonlocal means (aviNLM) filter for each energy-specific image restoration.  Methods:  The present aviNLM algorithm exploits redundant information in the whole energy domain. Specifically, the proposed aviNLM algorithm yields the restored results by performing a nonlocal weighted average operation on the noisy energy-specific images with the nonlocal weight matrix between the target and prior images, in which the prior image is generated from all of the images reconstructed in each energy bin.  Results: Qualitative and quantitative studies are conducted to evaluate the aviNLM filter by using the data of digital phantom, physical phantom, and clinical patient data acquired from the energy-resolved and -integrated detectors, respectively. Experimental results show that the present aviNLM filter can achieve promising results for SCT image restoration in terms of noise-induced artifact suppression, cross profile, and contrast-to-noise ratio and material decomposition assessment. Conclusion and Significance: The present aviNLM algorithm has useful potential for radiation dose reduction by lowering the mAs in SCT imaging, and it may be useful for some other clinical applications, such as in myocardial perfusion imaging and radiotherapy.

  7. EASY: a simple tool for simultaneously removing background, deadtime and acoustic ringing in quantitative NMR spectroscopy--part I: basic principle and applications.

    PubMed

    Jaeger, Christian; Hemmann, Felix

    2014-01-01

    Elimination of Artifacts in NMR SpectroscopY (EASY) is a simple but very effective tool to remove simultaneously any real NMR probe background signal, any spectral distortions due to deadtime ringdown effects and -specifically- severe acoustic ringing artifacts in NMR spectra of low-gamma nuclei. EASY enables and maintains quantitative NMR (qNMR) as only a single pulse (preferably 90°) is used for data acquisition. After the acquisition of the first scan (it contains the wanted NMR signal and the background/deadtime/ringing artifacts) the same experiment is repeated immediately afterwards before the T1 waiting delay. This second scan contains only the background/deadtime/ringing parts. Hence, the simple difference of both yields clean NMR line shapes free of artefacts. In this Part I various examples for complete (1)H, (11)B, (13)C, (19)F probe background removal due to construction parts of the NMR probes are presented. Furthermore, (25)Mg EASY of Mg(OH)2 is presented and this example shows how extremely strong acoustic ringing can be suppressed (more than a factor of 200) such that phase and baseline correction for spectra acquired with a single pulse is no longer a problem. EASY is also a step towards deadtime-free data acquisition as these effects are also canceled completely. EASY can be combined with any other NMR experiment, including 2D NMR, if baseline distortions are a big problem. © 2013 Published by Elsevier Inc.

  8. Background field removal technique based on non-regularized variable kernels sophisticated harmonic artifact reduction for phase data for quantitative susceptibility mapping.

    PubMed

    Kan, Hirohito; Arai, Nobuyuki; Takizawa, Masahiro; Omori, Kazuyoshi; Kasai, Harumasa; Kunitomo, Hiroshi; Hirose, Yasujiro; Shibamoto, Yuta

    2018-06-11

    We developed a non-regularized, variable kernel, sophisticated harmonic artifact reduction for phase data (NR-VSHARP) method to accurately estimate local tissue fields without regularization for quantitative susceptibility mapping (QSM). We then used a digital brain phantom to evaluate the accuracy of the NR-VSHARP method, and compared it with the VSHARP and iterative spherical mean value (iSMV) methods through in vivo human brain experiments. Our proposed NR-VSHARP method, which uses variable spherical mean value (SMV) kernels, minimizes L2 norms only within the volume of interest to reduce phase errors and save cortical information without regularization. In a numerical phantom study, relative local field and susceptibility map errors were determined using NR-VSHARP, VSHARP, and iSMV. Additionally, various background field elimination methods were used to image the human brain. In a numerical phantom study, the use of NR-VSHARP considerably reduced the relative local field and susceptibility map errors throughout a digital whole brain phantom, compared with VSHARP and iSMV. In the in vivo experiment, the NR-VSHARP-estimated local field could sufficiently achieve minimal boundary losses and phase error suppression throughout the brain. Moreover, the susceptibility map generated using NR-VSHARP minimized the occurrence of streaking artifacts caused by insufficient background field removal. Our proposed NR-VSHARP method yields minimal boundary losses and highly precise phase data. Our results suggest that this technique may facilitate high-quality QSM. Copyright © 2017. Published by Elsevier Inc.

  9. Maternal dietary advice as an artifact of time and culture: post-World War II Queensland, Australia.

    PubMed

    Thorley, Virginia

    2002-03-01

    Dietary advice to breastfeeding mothers in post-World War II Queensland, 1945-1965, was not evidence-based, but based on cultural beliefs. Diet-based recommendations for boosting the breastmilk yield included increased intake of milk and protein foods, food supplements, especially chocolate-flavoured supplements, and tablets. Although community beliefs about foods to be avoided during lactation were reflected in informal advice, foods such as green leafy vegetables were specifically recommended by the print materials of the period as part of a healthy diet during breastfeeding.

  10. Automatic Identification of Artifact-Related Independent Components for Artifact Removal in EEG Recordings.

    PubMed

    Zou, Yuan; Nathan, Viswam; Jafari, Roozbeh

    2016-01-01

    Electroencephalography (EEG) is the recording of electrical activity produced by the firing of neurons within the brain. These activities can be decoded by signal processing techniques. However, EEG recordings are always contaminated with artifacts which hinder the decoding process. Therefore, identifying and removing artifacts is an important step. Researchers often clean EEG recordings with assistance from independent component analysis (ICA), since it can decompose EEG recordings into a number of artifact-related and event-related potential (ERP)-related independent components. However, existing ICA-based artifact identification strategies mostly restrict themselves to a subset of artifacts, e.g., identifying eye movement artifacts only, and have not been shown to reliably identify artifacts caused by nonbiological origins like high-impedance electrodes. In this paper, we propose an automatic algorithm for the identification of general artifacts. The proposed algorithm consists of two parts: 1) an event-related feature-based clustering algorithm used to identify artifacts which have physiological origins; and 2) the electrode-scalp impedance information employed for identifying nonbiological artifacts. The results on EEG data collected from ten subjects show that our algorithm can effectively detect, separate, and remove both physiological and nonbiological artifacts. Qualitative evaluation of the reconstructed EEG signals demonstrates that our proposed method can effectively enhance the signal quality, especially the quality of ERPs, even for those that barely display ERPs in the raw EEG. The performance results also show that our proposed method can effectively identify artifacts and subsequently enhance the classification accuracies compared to four commonly used automatic artifact removal methods.

  11. Automatic Identification of Artifact-related Independent Components for Artifact Removal in EEG Recordings

    PubMed Central

    Zou, Yuan; Nathan, Viswam; Jafari, Roozbeh

    2017-01-01

    Electroencephalography (EEG) is the recording of electrical activity produced by the firing of neurons within the brain. These activities can be decoded by signal processing techniques. However, EEG recordings are always contaminated with artifacts which hinder the decoding process. Therefore, identifying and removing artifacts is an important step. Researchers often clean EEG recordings with assistance from Independent Component Analysis (ICA), since it can decompose EEG recordings into a number of artifact-related and event related potential (ERP)-related independent components (ICs). However, existing ICA-based artifact identification strategies mostly restrict themselves to a subset of artifacts, e.g. identifying eye movement artifacts only, and have not been shown to reliably identify artifacts caused by non-biological origins like high-impedance electrodes. In this paper, we propose an automatic algorithm for the identification of general artifacts. The proposed algorithm consists of two parts: 1) an event-related feature based clustering algorithm used to identify artifacts which have physiological origins and 2) the electrode-scalp impedance information employed for identifying non-biological artifacts. The results on EEG data collected from 10 subjects show that our algorithm can effectively detect, separate, and remove both physiological and non-biological artifacts. Qualitative evaluation of the reconstructed EEG signals demonstrates that our proposed method can effectively enhance the signal quality, especially the quality of ERPs, even for those that barely display ERPs in the raw EEG. The performance results also show that our proposed method can effectively identify artifacts and subsequently enhance the classification accuracies compared to four commonly used automatic artifact removal methods. PMID:25415992

  12. Histologic processing artifacts and inter-pathologist variation in measurement of inked margins of canine mast cell tumors.

    PubMed

    Kiser, Patti K; Löhr, Christiane V; Meritet, Danielle; Spagnoli, Sean T; Milovancev, Milan; Russell, Duncan S

    2018-05-01

    Although quantitative assessment of margins is recommended for describing excision of cutaneous malignancies, there is poor understanding of limitations associated with this technique. We described and quantified histologic artifacts in inked margins and determined the association between artifacts and variance in histologic tumor-free margin (HTFM) measurements based on a novel grading scheme applied to 50 sections of normal canine skin and 56 radial margins taken from 15 different canine mast cell tumors (MCTs). Three broad categories of artifact were 1) tissue deformation at inked edges, 2) ink-associated artifacts, and 3) sectioning-associated artifacts. The most common artifacts in MCT margins were ink-associated artifacts, specifically ink absent from an edge (mean prevalence: 50%) and inappropriate ink coloring (mean: 45%). The prevalence of other artifacts in MCT skin was 4-50%. In MCT margins, frequency-adjusted kappa statistics found fair or better inter-rater reliability for 9 of 10 artifacts; intra-rater reliability was moderate or better in 9 of 10 artifacts. Digital HTFM measurements by 5 blinded pathologists had a median standard deviation (SD) of 1.9 mm (interquartile range: 0.8-3.6 mm; range: 0-6.2 mm). Intraclass correlation coefficients demonstrated good inter-pathologist reliability in HTFM measurement (κ = 0.81). Spearman rank correlation coefficients found negligible correlation between artifacts and HTFM SDs ( r ≤ 0.3). These data confirm that although histologic artifacts commonly occur in inked margin specimens, artifacts are not meaningfully associated with variation in HTFM measurements. Investigators can use the grading scheme presented herein to identify artifacts associated with tissue processing.

  13. Determination of the Dynamics of Healing at the Tissue-Implant Interface by Means of Microcomputed Tomography and Functional Apparent Moduli

    PubMed Central

    Chang, Po-Chun; Seol, Yang-Jo; Goldstein, Steven A.; Giannobile, William V.

    2014-01-01

    Purpose It is currently a challenge to determine the biomechanical properties of the hard tissue–dental implant interface. Recent advances in intraoral imaging and tomographic methods, such as microcomputed tomography (micro-CT), provide three-dimensional details, offering significant potential to evaluate the bone-implant interface, but yield limited information regarding osseointegration because of physical scattering effects emanating from metallic implant surfaces. In the present study, it was hypothesized that functional apparent moduli (FAM), generated from functional incorporation of the peri-implant structure, would eliminate the radiographic artifact–affected layer and serve as a feasible means to evaluate the biomechanical dynamics of tissue-implant integration in vivo. Materials and Methods Cylindric titanium mini-implants were placed in osteotomies and osteotomies with defects in rodent maxillae. The layers affected by radiographic artifacts were identified, and the pattern of tissue-implant integration was evaluated from histology and micro-CT images over a 21-day observation period. Analyses of structural information, FAM, and the relationship between FAM and interfacial stiffness (IS) were done before and after eliminating artifacts. Results Physical artifacts were present within a zone of about 100 to 150 μm around the implant in both experimental defect situations (osteotomy alone and osteotomy + defect). All correlations were evaluated before and after eliminating the artifact-affected layers, most notably during the maturation period of osseointegration. A strong correlation existed between functional bone apparent modulus and IS within 300 μm at the osteotomy defects (r > 0.9) and functional composite tissue apparent modulus in the osteotomy defects (r > 0.75). Conclusion Micro-CT imaging and FAM were of value in measuring the temporal process of tissue-implant integration in vivo. This approach will be useful to complement imaging technologies for longitudinal monitoring of osseointegration. PMID:23377049

  14. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Hui, C; Beddar, S; Wen, Z

    Purpose: The purpose of this study is to develop a technique to obtain four-dimensional (4D) magnetic resonance (MR) images that are more representative of a patient’s typical breathing cycle by utilizing an extended acquisition time while minimizing the image artifacts. Methods: The 4D MR data were acquired with the balanced steady state free precession in two-dimensional sagittal plane of view. Each slice was acquired repeatedly for about 15 s, thereby obtaining multiple images at each of the 10 phases in the respiratory cycle. This improves the probability that at least one of the images were acquired at the desired phasemore » during a regular breathing cycle. To create optimal 4D MR images, an iterative approach was used to identify the set of images that yielded the highest slice-to-slice similarity. To assess the effectiveness of the approach, the data set was truncated into periods of 7 s (50 time points), 11 s (75 time points) and the full 15 s (100 time points). The 4D MR images were then sorted with data of the three different acquisition periods for comparison. Results: In general, the 4D MR images sorted using data from longer acquisition periods showed less mismatched artifacts. In addition, the normalized cross correlation (NCC) between slices of a 4D volume increases with increased acquisition period. The average NCC was 0.791 from the 7 s period, 0.794 from the 11 s period and 0.796 from the 15 s period. Conclusion: Our preliminary study showed that extending the acquisition time with the proposed sorting technique can improve image quality and reduce artifact presence in the 4D MR images. Data acquisition over two breathing cycles is a good trade-off between artifact reduction and scan time. This research was partially funded by the the Center for Radiation Oncology Research from UT MD Anderson Cancer Center.« less

  15. Image Quality of Cardiac Magnetic Resonance Imaging in Patients With an Implantable Cardioverter Defibrillator System Designed for the Magnetic Resonance Imaging Environment.

    PubMed

    Schwitter, Juerg; Gold, Michael R; Al Fagih, Ahmed; Lee, Sung; Peterson, Michael; Ciuffo, Allen; Zhang, Yan; Kristiansen, Nina; Kanal, Emanuel; Sommer, Torsten

    2016-05-01

    Recently, magnetic resonance (MR)-conditional implantable cardioverter defibrillator (ICD) systems have become available. However, associated cardiac MR image (MRI) quality is unknown. The goal was to evaluate the image quality performance of various cardiac MR sequences in a multicenter trial of patients implanted with an MR-conditional ICD system. The Evera-MRI trial enrolled 275 patients in 42 centers worldwide. There were 263 patients implanted with an Evera-MRI single- or dual-chamber ICD and randomized to controls (n=88) and MRI (n=175), 156 of whom underwent a protocol-required MRI (9-12 weeks post implant). Steady-state-free-precession (SSFP) and fast-gradient-echo (FGE) sequences were acquired in short-axis and horizontal long-axis orientations. Qualitative and quantitative assessment of image quality was performed by using a 7-point scale (grades 1-3: good quality, grades 6-7: nondiagnostic) and measuring ICD- and lead-related artifact size. Good to moderate image quality (grades 1-5) was obtained in 53% and 74% of SSFP and FGE acquisitions, respectively, covering the left ventricle, and in 69% and 84%, respectively, covering the right ventricle. Odds for better image quality were greater for right ventricle versus left ventricle (odds ratio, 1.8; 95% confidence interval, 1.5-2.2; P<0.0001) and greater for FGE versus SSFP (odds ratio, 3.5; 95% confidence interval, 2.5-4.8; P<0.0001). Compared with SSFP, ICD-related artifacts on FGE were smaller (141±65 versus 75±57 mm, respectively; P<0.0001). Lead artifacts were much smaller than ICD artifacts (P<0.0001). FGE yields good to moderate quality in 74% of left ventricle and 84% of right ventricle acquisitions and performs better than SSFP in patients with an MRI-conditional ICD system. In these patients, cardiac MRI can offer diagnostic information in most cases. URL: http://www.clinicaltrials.gov. Unique identifier: NCT02117414. © 2016 American Heart Association, Inc.

  16. Sampling Analysis of Aerosol Retrievals by Single-track Spaceborne Instrument for Climate Research

    NASA Astrophysics Data System (ADS)

    Geogdzhayev, I. V.; Cairns, B.; Alexandrov, M. D.; Mishchenko, M. I.

    2012-12-01

    We examine to what extent the reduced sampling of along-track instruments such as Cloud-Aerosol LIdar with Orthogonal Polarisation (CALIOP) and Aerosol Polarimetry Sensor (APS) affects the statistical accuracy of a satellite climatology of retrieved aerosol optical thickness (AOT) by sub-sampling the retrievals from a wide-swath imaging instrument (MODerate resolution Imaging Spectroradiometer (MODIS)). Owing to its global coverage, longevity, and extensive characterization versus ground based data, the MODIS level-2 aerosol product is an instructive testbed for assessing sampling effects on climatic means derived from along-track instrument data. The advantage of using daily pixel-level aerosol retrievals from MODIS is that limitations caused by the presence of clouds are implicit in the sample, so that their seasonal and regional variations are captured coherently. However, imager data can exhibit cross-track variability of monthly global mean AOTs caused by a scattering-angle dependence. We found that single along-track values can deviate from the imager mean by 15% over land and by more than 20% over ocean. This makes it difficult to separate natural variability from viewing-geometry artifacts complicating direct comparisons of an along-track sub-sample with the full imager data. To work around this problem, we introduce "flipped-track" sampling which, by design, is statistically equivalent to along-track sampling and while closely approximating the imager in terms of angular artifacts. We show that the flipped-track variability of global monthly mean AOT is much smaller than the cross-track one for the 7-year period considered. Over the ocean flipped-track standard error is 85% less than the cross-track one (absolute values 0.0012 versus 0.0079), and over land it is about one third of the cross-track value (0.0054 versus 0.0188) on average. This allows us to attribute the difference between the two errors to the viewing-geometry artifacts and obtain an upper limit on AOT errors caused by along-track sampling. Our results show that using along-track subsets of MODIS aerosol data directly to analyze the sampling adequacy of single-track instruments can lead to false conclusions owing to the apparent enhancement of natural aerosol variability by the track-to-track artifacts. The analysis based on the statistics of the flipped-track means yields better estimates because it allows for better separation of the viewing-geometry artifacts and true natural variability. Published assessments estimate that a global AOT change of 0.01 would yield a climatically important flux change of 0.25 W/m2. Since the standard error estimates that we have obtained are comfortably below 0.01, we conclude that along-track instruments flown on a sun-synchronous orbiting platform have sufficient spatial sampling for estimating aerosol effects on climate. Since AOT is believed to be the most variable characteristic of tropospheric aerosols, our results imply that pixel-wide along-track coverage also provides adequate statistical representation of the global distribution of aerosol microphysical parameters.

  17. SU-E-I-38: Improved Metal Artifact Correction Using Adaptive Dual Energy Calibration

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Dong, X; Elder, E; Roper, J

    2015-06-15

    Purpose: The empirical dual energy calibration (EDEC) method corrects for beam-hardening artifacts, but shows limited performance on metal artifact correction. In this work, we propose an adaptive dual energy calibration (ADEC) method to correct for metal artifacts. Methods: The empirical dual energy calibration (EDEC) method corrects for beam-hardening artifacts, but shows limited performance on metal artifact correction. In this work, we propose an adaptive dual energy calibration (ADEC) method to correct for metal artifacts. Results: Highly attenuating copper rods cause severe streaking artifacts on standard CT images. EDEC improves the image quality, but cannot eliminate the streaking artifacts. Compared tomore » EDEC, the proposed ADEC method further reduces the streaking resulting from metallic inserts and beam-hardening effects and obtains material decomposition images with significantly improved accuracy. Conclusion: We propose an adaptive dual energy calibration method to correct for metal artifacts. ADEC is evaluated with the Shepp-Logan phantom, and shows superior metal artifact correction performance. In the future, we will further evaluate the performance of the proposed method with phantom and patient data.« less

  18. Pacemaker-induced Metallic Artifacts in Coronary Computed Tomography Angiography: Clinical Feasibility of Single Energy Metal Artifact Reduction Technique.

    PubMed

    Takayanagi, Tomoya; Arai, Takehiro; Amanuma, Makoto; Sano, Tomonari; Ichiba, Masato; Ishizaka, Kazumasa; Sekine, Takako; Matsutani, Hideyuki; Morita, Hitomi; Takase, Shinichi

    2017-01-01

    Coronary computed tomography angiography (CCTA) in patients with pacemaker suffers from metallic lead-induced artifacts, which often interfere with accurate assessment of coronary luminal stenosis. The purpose of this study was to assess a frequency of the lead-induced artifacts and artifact-suppression effect by the single energy metal artifact reduction (SEMAR) technique. Forty-one patients with a dual-chamber pacemaker were evaluated using a 320 multi-detector row CT (MDCT). Among them, 22 patients with motion-free full data reconstruction images were the final candidates. Images with and without the SMEAR technique were subjectively compared, and the degree of metallic artifacts was compared. On images without SEMAR, severe metallic artifacts were often observed in the right coronary artery (#1, #2, #3) and distal anterior descending branch (#8). These artifacts were effectively suppressed by SEMAR, and the luminal accessibility was significantly improved in #3 and #8. While pacemaker leads often cause metallic-induced artifacts, SEMAR technique reduced the artifacts and significantly improved the accessibility of coronary lumen in #3 and #8.

  19. Automatic segmentation of colon glands using object-graphs.

    PubMed

    Gunduz-Demir, Cigdem; Kandemir, Melih; Tosun, Akif Burak; Sokmensuer, Cenk

    2010-02-01

    Gland segmentation is an important step to automate the analysis of biopsies that contain glandular structures. However, this remains a challenging problem as the variation in staining, fixation, and sectioning procedures lead to a considerable amount of artifacts and variances in tissue sections, which may result in huge variances in gland appearances. In this work, we report a new approach for gland segmentation. This approach decomposes the tissue image into a set of primitive objects and segments glands making use of the organizational properties of these objects, which are quantified with the definition of object-graphs. As opposed to the previous literature, the proposed approach employs the object-based information for the gland segmentation problem, instead of using the pixel-based information alone. Working with the images of colon tissues, our experiments demonstrate that the proposed object-graph approach yields high segmentation accuracies for the training and test sets and significantly improves the segmentation performance of its pixel-based counterparts. The experiments also show that the object-based structure of the proposed approach provides more tolerance to artifacts and variances in tissues.

  20. Blind retrospective motion correction of MR images.

    PubMed

    Loktyushin, Alexander; Nickisch, Hannes; Pohmann, Rolf; Schölkopf, Bernhard

    2013-12-01

    Subject motion can severely degrade MR images. A retrospective motion correction algorithm, Gradient-based motion correction, which significantly reduces ghosting and blurring artifacts due to subject motion was proposed. The technique uses the raw data of standard imaging sequences; no sequence modifications or additional equipment such as tracking devices are required. Rigid motion is assumed. The approach iteratively searches for the motion trajectory yielding the sharpest image as measured by the entropy of spatial gradients. The vast space of motion parameters is efficiently explored by gradient-based optimization with a convergence guarantee. The method has been evaluated on both synthetic and real data in two and three dimensions using standard imaging techniques. MR images are consistently improved over different kinds of motion trajectories. Using a graphics processing unit implementation, computation times are in the order of a few minutes for a full three-dimensional volume. The presented technique can be an alternative or a complement to prospective motion correction methods and is able to improve images with strong motion artifacts from standard imaging sequences without requiring additional data. Copyright © 2013 Wiley Periodicals, Inc., a Wiley company.

  1. Integrated digital error suppression for improved detection of circulating tumor DNA

    PubMed Central

    Kurtz, David M.; Chabon, Jacob J.; Scherer, Florian; Stehr, Henning; Liu, Chih Long; Bratman, Scott V.; Say, Carmen; Zhou, Li; Carter, Justin N.; West, Robert B.; Sledge, George W.; Shrager, Joseph B.; Loo, Billy W.; Neal, Joel W.; Wakelee, Heather A.; Diehn, Maximilian; Alizadeh, Ash A.

    2016-01-01

    High-throughput sequencing of circulating tumor DNA (ctDNA) promises to facilitate personalized cancer therapy. However, low quantities of cell-free DNA (cfDNA) in the blood and sequencing artifacts currently limit analytical sensitivity. To overcome these limitations, we introduce an approach for integrated digital error suppression (iDES). Our method combines in silico elimination of highly stereotypical background artifacts with a molecular barcoding strategy for the efficient recovery of cfDNA molecules. Individually, these two methods each improve the sensitivity of cancer personalized profiling by deep sequencing (CAPP-Seq) by ~3 fold, and synergize when combined to yield ~15-fold improvements. As a result, iDES-enhanced CAPP-Seq facilitates noninvasive variant detection across hundreds of kilobases. Applied to clinical non-small cell lung cancer (NSCLC) samples, our method enabled biopsy-free profiling of EGFR kinase domain mutations with 92% sensitivity and 96% specificity and detection of ctDNA down to 4 in 105 cfDNA molecules. We anticipate that iDES will aid the noninvasive genotyping and detection of ctDNA in research and clinical settings. PMID:27018799

  2. Recent progress in heteronuclear long-range NMR of complex carbohydrates: 3D H2BC and clean HMBC.

    PubMed

    Meier, Sebastian; Petersen, Bent O; Duus, Jens Ø; Sørensen, Ole W

    2009-11-02

    The new NMR experiments 3D H2BC and clean HMBC are explored for challenging applications to a complex carbohydrate at natural abundance of (13)C. The 3D H2BC experiment is crucial for sequential assignment as it yields heteronuclear one- and two-bond together with COSY correlations for the (1)H spins, all in a single spectrum with good resolution and non-informative diagonal-type peaks suppressed. Clean HMBC is a remedy for the ubiquitous problem of strong coupling induced one-bond correlation artifacts in HMBC spectra of carbohydrates. Both experiments work well for one of the largest carbohydrates whose structure has been determined by NMR, not least due to the enhanced resolution offered by the third dimension in 3D H2BC and the improved spectral quality due to artifact suppression in clean HMBC. Hence these new experiments set the scene to take advantage of the sensitivity boost achieved by the latest generation of cold probes for NMR structure determination of even larger and more complex carbohydrates in solution.

  3. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Steelman, K L; Rowe, M W; Turpin, S A

    Plasma oxidation was used to obtain radiocarbon dates on six different materials from a naturally mummified baby bundle from the Lower Pecos River region of southwest Texas. This bundle was selected because it was thought to represent a single event and would illustrate the accuracy and precision of the plasma oxidation method. Five of the materials were clearly components of the original bundle with 13 dates combined to yield a weighted average of 2135 {+-} 11 B.P. Six dates from a wooden stick of Desert Ash averaged 939 {+-} 14 B.P., indicating that this artifact was not part of themore » original burial. Plasma oxidation is shown to be a virtually non-destructive alternative to combustion. Because only sub-milligram amounts of material are removed from an artifact over its exposed surface, no visible change in fragile materials has been observed, even under magnification. The method is best applied when natural organic contamination is unlikely and serious consideration of this issue is needed in all cases. If organic contamination is present, it will have to be removed before plasma oxidation to obtain accurate radiocarbon dates.« less

  4. Development of a real-time RT-PCR assay for squash mosaic virus useful for broad spectrum detection of various serotypes and its incorporation into a multiplex seed health assay

    USDA-ARS?s Scientific Manuscript database

    Seed-borne pathogens pose a serious threat to modern agricultural cropping systems as they can be disseminated to many geographical regions around the world. With trends of increasing global seed production and trade, seed-health testing is an important quality control step to prevent the introduct...

  5. U.S.-European Relations Pre- and Post September 11, 2001

    DTIC Science & Technology

    2002-03-01

    established new institutions, the two organizations should remain at arms length. They feared that the new and fragile ESDP could easily be squashed , or...Long Entanglement . Westport, Connecticut: Praeger, 1999 Kiesinger, Kurt Georg. Archiv der Gegenwart. Berlin, Germany: Sieger Verlag, 1967, p.13020...Germany: ORBIS, 1973, p.94 Kaplan, Lawrence S. The Long Entanglement . Westport, Connecticut: Praeger, 1999 Kay, Sean. NATO and the Future of

  6. Creativity Is More than Silly, More than Art, More than Good: The Diverse Career of Arthur Cropley

    ERIC Educational Resources Information Center

    Kaufman, James C.

    2015-01-01

    In this article, I highlight some of Arthur Cropley's work that has been the most influential to me as a scholar. Cropley's work has continually pushed the boundaries by exploring what creativity is and isn't, squashing myths, and not making assumptions. I specifically discuss Cropley's research and theory on the importance of convergent thinking,…

  7. Morphological and molecular characterization of a marine fish trypanosome from South Africa, including its development in a leech vector.

    PubMed

    Hayes, Polly M; Lawton, Scott P; Smit, Nico J; Gibson, Wendy C; Davies, Angela J

    2014-01-24

    Trypanosomes are ubiquitous blood parasites of marine and freshwater fishes, typically transmitted by aquatic leeches. Phylogenetic studies have been dominated by examples derived from freshwater fishes, with few marine representatives. Furthermore, life cycle studies on marine fish trypanosomes have focused on those of the northern hemisphere. In this investigation, we have examined the life cycle and molecular taxonomy of a marine fish trypanosome from South Africa. To locate trypanosome stages, leeches were removed from fishes captured on the west and south coasts of South Africa, and fish blood films and leech squashes were Giemsa-stained and screened; leeches were also examined histologically. To determine whether trypanosome stages in fishes and leeches were of the same genotype, DNA was extracted from Giemsa-stained fish blood films and leech squashes, and from fish whole blood. Fragments of the 18S rRNA gene were amplified by PCR using trypanosome-specific primers and sequenced. Resulting sequence data were compared with each other and with published trypanosome 18S rDNA sequences, and used for phylogenetic analysis. Trypanosomes were detected in blood films from fishes of the families Clinidae, Blenniidae and Gobiidae. The flagellates ranged in size and staining properties within the films and across fish hosts. In squashes and histological sections of adult and juvenile leeches, identified as Zeylanicobdella arugamensis, trypanosome developmental stages were predominantly slender epimastigotes. Sequence data showed that trypanosomes derived from fishes were identical, irrespective of whether they were small or large forms; sequences derived largely from leech epimastigotes were also identical to those obtained from fish trypanosomes. Fish and leech trypanosome sequences fell into a marine fish aquatic clade, and aligned most closely with two trypanosome sequences from marine fishes off Norway. Combined morphological and molecular methods indicate that the trypanosomes examined here represent a single pleomorphic species, rather than the three species described originally. This species is identified as Trypanosoma nudigobii Fantham, 1919 with the leech Z. arugamensis as its vector, and T. capigobii Fantham, 1919 and T. blenniclini Fantham, 1930 are regarded as junior synonyms of the species. Phylogenetic analysis establishes its affinity with marine fish trypanosomes off Norway.

  8. Isolating gait-related movement artifacts in electroencephalography during human walking

    PubMed Central

    Kline, Julia E.; Huang, Helen J.; Snyder, Kristine L.; Ferris, Daniel P.

    2016-01-01

    Objective High-density electroencephelography (EEG) can provide insight into human brain function during real-world activities with walking. Some recent studies have used EEG to characterize brain activity during walking, but the relative contributions of movement artifact and electrocortical activity have been difficult to quantify. We aimed to characterize movement artifact recorded by EEG electrodes at a range of walking speeds and to test the efficacy of artifact removal methods. We also quantified the similarity between movement artifact recorded by EEG electrodes and a head-mounted accelerometer. Approach We used a novel experimental method to isolate and record movement artifact with EEG electrodes during walking. We blocked electrophysiological signals using a nonconductive layer (silicone swim cap) and simulated an electrically conductive scalp on top of the swim cap using a wig coated with conductive gel. We recorded motion artifact EEG data from nine young human subjects walking on a treadmill at speeds from 0.4–1.6 m/s. We then tested artifact removal methods including moving average and wavelet-based techniques. Main Results Movement artifact recorded with EEG electrodes varied considerably, across speed, subject, and electrode location. The movement artifact measured with EEG electrodes did not correlate well with head acceleration. All of the tested artifact removal methods attenuated low-frequency noise but did not completely remove movement artifact. The spectral power fluctuations in the movement artifact data resembled data from some previously published studies of EEG during walking. Significance Our results suggest that EEG data recorded during walking likely contains substantial movement artifact that: cannot be explained by head accelerations; varies across speed, subject, and channel; and cannot be removed using traditional signal processing methods. Future studies should focus on more sophisticated methods for removing of EEG movement artifact to advance the field. PMID:26083595

  9. Isolating gait-related movement artifacts in electroencephalography during human walking.

    PubMed

    Kline, Julia E; Huang, Helen J; Snyder, Kristine L; Ferris, Daniel P

    2015-08-01

    High-density electroencephelography (EEG) can provide an insight into human brain function during real-world activities with walking. Some recent studies have used EEG to characterize brain activity during walking, but the relative contributions of movement artifact and electrocortical activity have been difficult to quantify. We aimed to characterize movement artifact recorded by EEG electrodes at a range of walking speeds and to test the efficacy of artifact removal methods. We also quantified the similarity between movement artifact recorded by EEG electrodes and a head-mounted accelerometer. We used a novel experimental method to isolate and record movement artifact with EEG electrodes during walking. We blocked electrophysiological signals using a nonconductive layer (silicone swim cap) and simulated an electrically conductive scalp on top of the swim cap using a wig coated with conductive gel. We recorded motion artifact EEG data from nine young human subjects walking on a treadmill at speeds from 0.4 to 1.6 m s(-1). We then tested artifact removal methods including moving average and wavelet-based techniques. Movement artifact recorded with EEG electrodes varied considerably, across speed, subject, and electrode location. The movement artifact measured with EEG electrodes did not correlate well with head acceleration. All of the tested artifact removal methods attenuated low-frequency noise but did not completely remove movement artifact. The spectral power fluctuations in the movement artifact data resembled data from some previously published studies of EEG during walking. Our results suggest that EEG data recorded during walking likely contains substantial movement artifact that: cannot be explained by head accelerations; varies across speed, subject, and channel; and cannot be removed using traditional signal processing methods. Future studies should focus on more sophisticated methods for removal of EEG movement artifact to advance the field.

  10. 3D artifact for calibrating kinematic parameters of articulated arm coordinate measuring machines

    NASA Astrophysics Data System (ADS)

    Zhao, Huining; Yu, Liandong; Xia, Haojie; Li, Weishi; Jiang, Yizhou; Jia, Huakun

    2018-06-01

    In this paper, a 3D artifact is proposed to calibrate the kinematic parameters of articulated arm coordinate measuring machines (AACMMs). The artifact is composed of 14 reference points with three different heights, which provides 91 different reference lengths, and a method is proposed to calibrate the artifact with laser tracker multi-stations. Therefore, the kinematic parameters of an AACMM can be calibrated in one setup of the proposed artifact, instead of having to adjust the 1D or 2D artifacts to different positions and orientations in the existing methods. As a result, it saves time to calibrate the AACMM with the proposed artifact in comparison with the traditional 1D or 2D artifacts. The performance of the AACMM calibrated with the proposed artifact is verified with a 600.003 mm gauge block. The result shows that the measurement accuracy of the AACMM is improved effectively through calibration with the proposed artifact.

  11. An EEG Data Investigation Using Only Artifacts

    DTIC Science & Technology

    2017-02-22

    approach, called artifact separation, was developed to enable the consumer of the EEG data to decide how to handle artifacts. The current...mediation approach, called artifact separation, was developed to enable the consumer of the EEG data to decide how to handle artifacts. The current...contaminated. Having the spectral results flagged as containing an artifact, means that the consumer of the data has the freedom to decide how to

  12. Mesoscale hybrid calibration artifact

    DOEpatents

    Tran, Hy D.; Claudet, Andre A.; Oliver, Andrew D.

    2010-09-07

    A mesoscale calibration artifact, also called a hybrid artifact, suitable for hybrid dimensional measurement and the method for make the artifact. The hybrid artifact has structural characteristics that make it suitable for dimensional measurement in both vision-based systems and touch-probe-based systems. The hybrid artifact employs the intersection of bulk-micromachined planes to fabricate edges that are sharp to the nanometer level and intersecting planes with crystal-lattice-defined angles.

  13. Ripple artifact reduction using slice overlap in slice encoding for metal artifact correction.

    PubMed

    den Harder, J Chiel; van Yperen, Gert H; Blume, Ulrike A; Bos, Clemens

    2015-01-01

    Multispectral imaging (MSI) significantly reduces metal artifacts. Yet, especially in techniques that use gradient selection, such as slice encoding for metal artifact correction (SEMAC), a residual ripple artifact may be prominent. Here, an analysis is presented of the ripple artifact and of slice overlap as an approach to reduce the artifact. The ripple artifact was analyzed theoretically to clarify its cause. Slice overlap, conceptually similar to spectral bin overlap in multi-acquisition with variable resonances image combination (MAVRIC), was achieved by reducing the selection gradient and, thus, increasing the slice profile width. Time domain simulations and phantom experiments were performed to validate the analyses and proposed solution. Discontinuities between slices are aggravated by signal displacement in the frequency encoding direction in areas with deviating B0. Specifically, it was demonstrated that ripple artifacts appear only where B0 varies both in-plane and through-plane. Simulations and phantom studies of metal implants confirmed the efficacy of slice overlap to reduce the artifact. The ripple artifact is an important limitation of gradient selection based MSI techniques, and can be understood using the presented simulations. At a scan-time penalty, slice overlap effectively addressed the artifact, thereby improving image quality near metal implants. © 2014 Wiley Periodicals, Inc.

  14. High-fidelity artifact correction for cone-beam CT imaging of the brain

    NASA Astrophysics Data System (ADS)

    Sisniega, A.; Zbijewski, W.; Xu, J.; Dang, H.; Stayman, J. W.; Yorkston, J.; Aygun, N.; Koliatsos, V.; Siewerdsen, J. H.

    2015-02-01

    CT is the frontline imaging modality for diagnosis of acute traumatic brain injury (TBI), involving the detection of fresh blood in the brain (contrast of 30-50 HU, detail size down to 1 mm) in a non-contrast-enhanced exam. A dedicated point-of-care imaging system based on cone-beam CT (CBCT) could benefit early detection of TBI and improve direction to appropriate therapy. However, flat-panel detector (FPD) CBCT is challenged by artifacts that degrade contrast resolution and limit application in soft-tissue imaging. We present and evaluate a fairly comprehensive framework for artifact correction to enable soft-tissue brain imaging with FPD CBCT. The framework includes a fast Monte Carlo (MC)-based scatter estimation method complemented by corrections for detector lag, veiling glare, and beam hardening. The fast MC scatter estimation combines GPU acceleration, variance reduction, and simulation with a low number of photon histories and reduced number of projection angles (sparse MC) augmented by kernel de-noising to yield a runtime of ~4 min per scan. Scatter correction is combined with two-pass beam hardening correction. Detector lag correction is based on temporal deconvolution of the measured lag response function. The effects of detector veiling glare are reduced by deconvolution of the glare response function representing the long range tails of the detector point-spread function. The performance of the correction framework is quantified in experiments using a realistic head phantom on a testbench for FPD CBCT. Uncorrected reconstructions were non-diagnostic for soft-tissue imaging tasks in the brain. After processing with the artifact correction framework, image uniformity was substantially improved, and artifacts were reduced to a level that enabled visualization of ~3 mm simulated bleeds throughout the brain. Non-uniformity (cupping) was reduced by a factor of 5, and contrast of simulated bleeds was improved from ~7 to 49.7 HU, in good agreement with the nominal blood contrast of 50 HU. Although noise was amplified by the corrections, the contrast-to-noise ratio (CNR) of simulated bleeds was improved by nearly a factor of 3.5 (CNR = 0.54 without corrections and 1.91 after correction). The resulting image quality motivates further development and translation of the FPD-CBCT system for imaging of acute TBI.

  15. An Additive Manufacturing Test Artifact

    PubMed Central

    Moylan, Shawn; Slotwinski, John; Cooke, April; Jurrens, Kevin; Donmez, M Alkan

    2014-01-01

    A test artifact, intended for standardization, is proposed for the purpose of evaluating the performance of additive manufacturing (AM) systems. A thorough analysis of previously proposed AM test artifacts as well as experience with machining test artifacts have inspired the design of the proposed test artifact. This new artifact is designed to provide a characterization of the capabilities and limitations of an AM system, as well as to allow system improvement by linking specific errors measured in the test artifact to specific sources in the AM system. The proposed test artifact has been built in multiple materials using multiple AM technologies. The results of several of the builds are discussed, demonstrating how the measurement results can be used to characterize and improve a specific AM system. PMID:26601039

  16. Classification and simulation of stereoscopic artifacts in mobile 3DTV content

    NASA Astrophysics Data System (ADS)

    Boev, Atanas; Hollosi, Danilo; Gotchev, Atanas; Egiazarian, Karen

    2009-02-01

    We identify, categorize and simulate artifacts which might occur during delivery stereoscopic video to mobile devices. We consider the stages of 3D video delivery dataflow: content creation, conversion to the desired format (multiview or source-plus-depth), coding/decoding, transmission, and visualization on 3D display. Human 3D vision works by assessing various depth cues - accommodation, binocular depth cues, pictorial cues and motion parallax. As a consequence any artifact which modifies these cues impairs the quality of a 3D scene. The perceptibility of each artifact can be estimated through subjective tests. The material for such tests needs to contain various artifacts with different amounts of impairment. We present a system for simulation of these artifacts. The artifacts are organized in groups with similar origins, and each group is simulated by a block in a simulation channel. The channel introduces the following groups of artifacts: sensor limitations, geometric distortions caused by camera optics, spatial and temporal misalignments between video channels, spatial and temporal artifacts caused by coding, transmission losses, and visualization artifacts. For the case of source-plus-depth representation, artifacts caused by format conversion are added as well.

  17. A generic EEG artifact removal algorithm based on the multi-channel Wiener filter

    NASA Astrophysics Data System (ADS)

    Somers, Ben; Francart, Tom; Bertrand, Alexander

    2018-06-01

    Objective. The electroencephalogram (EEG) is an essential neuro-monitoring tool for both clinical and research purposes, but is susceptible to a wide variety of undesired artifacts. Removal of these artifacts is often done using blind source separation techniques, relying on a purely data-driven transformation, which may sometimes fail to sufficiently isolate artifacts in only one or a few components. Furthermore, some algorithms perform well for specific artifacts, but not for others. In this paper, we aim to develop a generic EEG artifact removal algorithm, which allows the user to annotate a few artifact segments in the EEG recordings to inform the algorithm. Approach. We propose an algorithm based on the multi-channel Wiener filter (MWF), in which the artifact covariance matrix is replaced by a low-rank approximation based on the generalized eigenvalue decomposition. The algorithm is validated using both hybrid and real EEG data, and is compared to other algorithms frequently used for artifact removal. Main results. The MWF-based algorithm successfully removes a wide variety of artifacts with better performance than current state-of-the-art methods. Significance. Current EEG artifact removal techniques often have limited applicability due to their specificity to one kind of artifact, their complexity, or simply because they are too ‘blind’. This paper demonstrates a fast, robust and generic algorithm for removal of EEG artifacts of various types, i.e. those that were annotated as unwanted by the user.

  18. Quantitative assessment of biliary stent artifacts on MR images: Potential implications for target delineation in radiotherapy.

    PubMed

    Gurney-Champion, Oliver J; Bruins Slot, Thijs; Lens, Eelco; van der Horst, Astrid; Klaassen, Remy; van Laarhoven, Hanneke W M; van Tienhoven, Geertjan; van Hooft, Jeanin E; Nederveen, Aart J; Bel, Arjan

    2016-10-01

    Biliary stents may cause susceptibility artifacts, gradient-induced artifacts, and radio frequency (RF) induced artifacts on magnetic resonance images, which can hinder accurate target volume delineation in radiotherapy. In this study, the authors investigated and quantified the magnitude of these artifacts for stents of different materials. Eight biliary stents made of nitinol, platinum-cored nitinol, stainless steel, or polyethylene from seven vendors, with different lengths (57-98 mm) and diameters (3.0-11.7 mm), were placed in a phantom. To quantify the susceptibility artifacts sequence-independently, ΔB0-maps and T2 ∗ -maps were acquired at 1.5 and 3 T. To study the effect of the gradient-induced artifacts at 3 T, signal decay in images obtained with maximum readout gradient-induced artifacts was compared to signal decay in reference scans. To quantify the RF induced artifacts at 3 T, B1-maps were acquired. Finally, ΔB0-maps and T2 ∗ -maps were acquired at 3 T of two pancreatic cancer patients who had received platinum-cored nitinol biliary stents. Outside the stent, susceptibility artifacts dominated the other artifacts. The stainless steel stent produced the largest susceptibility artifacts. The other stents caused decreased T2 ∗ up to 5.1 mm (1.5 T) and 8.5 mm (3 T) from the edge of the stent. For sequences with a higher bandwidth per voxel (1.5 T: BW vox > 275 Hz/voxel; 3 T: BW vox > 500 Hz/voxel), the B0-related susceptibility artifacts were negligible (<0.2 voxels). The polyethylene stent showed no artifacts. In vivo, the changes in B0 and T2 ∗ induced by the stent were larger than typical variations in B0 and T2 ∗ induced by anatomy when the stent was at an angle of 30° with the main magnetic field. Susceptibility artifacts were dominating over the other artifacts. The magnitudes of the susceptibility artifacts were determined sequence-independently. This method allows to include additional safety margins that ensure target irradiation.

  19. Analysis of Monoclonal Antibodies in Human Serum as a Model for Clinical Monoclonal Gammopathy by Use of 21 Tesla FT-ICR Top-Down and Middle-Down MS/MS

    NASA Astrophysics Data System (ADS)

    He, Lidong; Anderson, Lissa C.; Barnidge, David R.; Murray, David L.; Hendrickson, Christopher L.; Marshall, Alan G.

    2017-05-01

    With the rapid growth of therapeutic monoclonal antibodies (mAbs), stringent quality control is needed to ensure clinical safety and efficacy. Monoclonal antibody primary sequence and post-translational modifications (PTM) are conventionally analyzed with labor-intensive, bottom-up tandem mass spectrometry (MS/MS), which is limited by incomplete peptide sequence coverage and introduction of artifacts during the lengthy analysis procedure. Here, we describe top-down and middle-down approaches with the advantages of fast sample preparation with minimal artifacts, ultrahigh mass accuracy, and extensive residue cleavages by use of 21 tesla FT-ICR MS/MS. The ultrahigh mass accuracy yields an RMS error of 0.2-0.4 ppm for antibody light chain, heavy chain, heavy chain Fc/2, and Fd subunits. The corresponding sequence coverages are 81%, 38%, 72%, and 65% with MS/MS RMS error 4 ppm. Extension to a monoclonal antibody in human serum as a monoclonal gammopathy model yielded 53% sequence coverage from two nano-LC MS/MS runs. A blind analysis of five therapeutic monoclonal antibodies at clinically relevant concentrations in human serum resulted in correct identification of all five antibodies. Nano-LC 21 T FT-ICR MS/MS provides nonpareil mass resolution, mass accuracy, and sequence coverage for mAbs, and sets a benchmark for MS/MS analysis of multiple mAbs in serum. This is the first time that extensive cleavages for both variable and constant regions have been achieved for mAbs in a human serum background.

  20. A chronological framework for a long and persistent archaeological record: Melka Kunture, Ethiopia.

    PubMed

    Morgan, Leah E; Renne, Paul R; Kieffer, Guy; Piperno, Marcello; Gallotti, Rosalia; Raynal, Jean-Paul

    2012-01-01

    New (40)Ar/(39)Ar geochronological data for several volcanic ash horizons from Melka Kunture, Ethiopia, allow for significantly more precise age constraints to be placed upon the lithostratigraphy, archaeology and paleontology from this long record. Ashes from the Melka Kunture Formation at Gombore yielded the most reliable age constraints, from 1.393 ± 0.162 Ma(2) (millions of years ago) near the base of the section to 0.709 ± 0.013 Ma near the top. Dating the Garba section proved more problematic, but the base of the section, which contains numerous Oldowan obsidian artifacts, may be >1.719 ± 0.199 Ma, while the top is securely dated to 0.869 ± 0.020 Ma. The large ignimbrite from the Kella Formation at Kella and Melka Garba is dated to 1.262 ± 0.034 Ma and pre-dates Acheulean artifacts in the area. The Gombore II site, which has yielded two Homo skull fragments, 'twisted bifaces,' and a preserved butchery site, is now constrained between 0.875 ± 0.010 Ma and 0.709 ± 0.013 Ma. Additional ashes from these and other sites further constrain the timing of deposition throughout the section. Integration with previously published magnetostratigraphy has allowed for the first time a relatively complete, reliable timeline for the deposition of sediments, environmental changes, archaeology, and paleontology at Melka Kunture. Copyright © 2011 Elsevier Ltd. All rights reserved.

  1. Use of cognitive artifacts in chemistry learning

    NASA Astrophysics Data System (ADS)

    Yengin, Ilker

    In everyday life, we interact with cognitive artifacts to receive and/or manipulate information so as to alter our thinking processes. CHEM/TEAC 869Q is a distance course that includes extensive explicit instruction in the use of a cognitive artifact. This study investigates issues related to the design of that online artifact. In order to understand design implications and how cognitive artifacts contribute to students' thinking and learning, a qualitative research methodology was engaged that utilized think aloud sessions. Participants' described constrained and structured cognitive models while using the artifact. The study also was informed by interviews and researcher's field notes. A purposeful sampling method led to the selection of participants, four males and two females, who had no prior history of using a course from the 869 series but who had experienced the scientific content covered by the CHEM869Q course. Analysis of the results showed both that a cognitive artifact may lead users' minds in decision making, and that problem solving processes were affected by cognitive artifact's design. When there is no design flaw, users generally thought that the cognitive artifact was helpful by simplifying steps, overcoming other limitations, and reducing errors in a reliable, effective, and easy to use way. Moreover, results showed that successful implementation of cognitive artifacts into teaching --learning practices depended on user willingness to transfer a task to the artifact. While users may like the idea of benefiting from a cognitive artifact, nevertheless, they may tend to limit their usage. They sometimes think that delegating a task to a cognitive artifact makes them dependent, and that they may not learn how to perform the tasks by themselves. They appear more willing to use a cognitive artifact after they have done the task by themselves.

  2. Iterative image-domain ring artifact removal in cone-beam CT

    NASA Astrophysics Data System (ADS)

    Liang, Xiaokun; Zhang, Zhicheng; Niu, Tianye; Yu, Shaode; Wu, Shibin; Li, Zhicheng; Zhang, Huailing; Xie, Yaoqin

    2017-07-01

    Ring artifacts in cone beam computed tomography (CBCT) images are caused by pixel gain variations using flat-panel detectors, and may lead to structured non-uniformities and deterioration of image quality. The purpose of this study is to propose a method of general ring artifact removal in CBCT images. This method is based on the polar coordinate system, where the ring artifacts manifest as stripe artifacts. Using relative total variation, the CBCT images are first smoothed to generate template images with fewer image details and ring artifacts. By subtracting the template images from the CBCT images, residual images with image details and ring artifacts are generated. As the ring artifact manifests as a stripe artifact in a polar coordinate system, the artifact image can be extracted by mean value from the residual image; the image details are generated by subtracting the artifact image from the residual image. Finally, the image details are compensated to the template image to generate the corrected images. The proposed framework is iterated until the differences in the extracted ring artifacts are minimized. We use a 3D Shepp-Logan phantom, Catphan©504 phantom, uniform acrylic cylinder, and images from a head patient to evaluate the proposed method. In the experiments using simulated data, the spatial uniformity is increased by 1.68 times and the structural similarity index is increased from 87.12% to 95.50% using the proposed method. In the experiment using clinical data, our method shows high efficiency in ring artifact removal while preserving the image structure and detail. The iterative approach we propose for ring artifact removal in cone-beam CT is practical and attractive for CBCT guided radiation therapy.

  3. Evaluation of a metal artifacts reduction algorithm applied to postinterventional flat panel detector CT imaging.

    PubMed

    Stidd, D A; Theessen, H; Deng, Y; Li, Y; Scholz, B; Rohkohl, C; Jhaveri, M D; Moftakhar, R; Chen, M; Lopes, D K

    2014-01-01

    Flat panel detector CT images are degraded by streak artifacts caused by radiodense implanted materials such as coils or clips. A new metal artifacts reduction prototype algorithm has been used to minimize these artifacts. The application of this new metal artifacts reduction algorithm was evaluated for flat panel detector CT imaging performed in a routine clinical setting. Flat panel detector CT images were obtained from 59 patients immediately following cerebral endovascular procedures or as surveillance imaging for cerebral endovascular or surgical procedures previously performed. The images were independently evaluated by 7 physicians for metal artifacts reduction on a 3-point scale at 2 locations: immediately adjacent to the metallic implant and 3 cm away from it. The number of visible vessels before and after metal artifacts reduction correction was also evaluated within a 3-cm radius around the metallic implant. The metal artifacts reduction algorithm was applied to the 59 flat panel detector CT datasets without complications. The metal artifacts in the reduction-corrected flat panel detector CT images were significantly reduced in the area immediately adjacent to the implanted metal object (P = .05) and in the area 3 cm away from the metal object (P = .03). The average number of visible vessel segments increased from 4.07 to 5.29 (P = .1235) after application of the metal artifacts reduction algorithm to the flat panel detector CT images. Metal artifacts reduction is an effective method to improve flat panel detector CT images degraded by metal artifacts. Metal artifacts are significantly decreased by the metal artifacts reduction algorithm, and there was a trend toward increased vessel-segment visualization. © 2014 by American Journal of Neuroradiology.

  4. Gaussian diffusion sinogram inpainting for X-ray CT metal artifact reduction.

    PubMed

    Peng, Chengtao; Qiu, Bensheng; Li, Ming; Guan, Yihui; Zhang, Cheng; Wu, Zhongyi; Zheng, Jian

    2017-01-05

    Metal objects implanted in the bodies of patients usually generate severe streaking artifacts in reconstructed images of X-ray computed tomography, which degrade the image quality and affect the diagnosis of disease. Therefore, it is essential to reduce these artifacts to meet the clinical demands. In this work, we propose a Gaussian diffusion sinogram inpainting metal artifact reduction algorithm based on prior images to reduce these artifacts for fan-beam computed tomography reconstruction. In this algorithm, prior information that originated from a tissue-classified prior image is used for the inpainting of metal-corrupted projections, and it is incorporated into a Gaussian diffusion function. The prior knowledge is particularly designed to locate the diffusion position and improve the sparsity of the subtraction sinogram, which is obtained by subtracting the prior sinogram of the metal regions from the original sinogram. The sinogram inpainting algorithm is implemented through an approach of diffusing prior energy and is then solved by gradient descent. The performance of the proposed metal artifact reduction algorithm is compared with two conventional metal artifact reduction algorithms, namely the interpolation metal artifact reduction algorithm and normalized metal artifact reduction algorithm. The experimental datasets used included both simulated and clinical datasets. By evaluating the results subjectively, the proposed metal artifact reduction algorithm causes fewer secondary artifacts than the two conventional metal artifact reduction algorithms, which lead to severe secondary artifacts resulting from impertinent interpolation and normalization. Additionally, the objective evaluation shows the proposed approach has the smallest normalized mean absolute deviation and the highest signal-to-noise ratio, indicating that the proposed method has produced the image with the best quality. No matter for the simulated datasets or the clinical datasets, the proposed algorithm has reduced the metal artifacts apparently.

  5. Cryobiopsy: should this be used in place of endobronchial forceps biopsies?

    PubMed

    Rubio, Edmundo R; le, Susanti R; Whatley, Ralph E; Boyd, Michael B

    2013-01-01

    Forceps biopsies of airway lesions have variable yields. The yield increases when combining techniques in order to collect more material. With the use of cryotherapy probes (cryobiopsy) larger specimens can be obtained, resulting in an increase in the diagnostic yield. However, the utility and safety of cryobiopsy with all types of lesions, including flat mucosal lesions, is not established. Demonstrate the utility/safety of cryobiopsy versus forceps biopsy to sample exophytic and flat airway lesions. Teaching hospital-based retrospective analysis. Retrospective analysis of patients undergoing cryobiopsies (singly or combined with forceps biopsies) from August 2008 through August 2010. Statistical Analysis. Wilcoxon signed-rank test. The comparative analysis of 22 patients with cryobiopsy and forceps biopsy of the same lesion showed the mean volumes of material obtained with cryobiopsy were significantly larger (0.696 cm(3) versus 0.0373 cm(3), P = 0.0014). Of 31 cryobiopsies performed, one had minor bleeding. Cryopbiopsy allowed sampling of exophytic and flat lesions that were located centrally or distally. Cryobiopsies were shown to be safe, free of artifact, and provided a diagnostic yield of 96.77%. Cryobiopsy allows safe sampling of exophytic and flat airway lesions, with larger specimens, excellent tissue preservation and high diagnostic accuracy.

  6. Clinical Assessment of Mirror Artifacts in Spectral-Domain Optical Coherence Tomography

    PubMed Central

    Ho, Joseph; Castro, Dinorah P. E.; Castro, Leonardo C.; Chen, Yueli; Liu, Jonathan; Mattox, Cynthia; Krishnan, Chandrasekharan; Fujimoto, James G.; Schuman, Joel S.

    2010-01-01

    Purpose. To investigate the characteristics of a spectral-domain optical coherence tomography (SD-OCT) image phenomenon known as the mirror artifact, calculate its prevalence, analyze potential risk factors, measure severity, and correlate it to spherical equivalent and central visual acuity (VA). Methods. OCT macular cube 512 × 128 scans taken between January 2008 and February 2009 at the New England Eye Center were analyzed for the presence of mirror artifacts. Artifact severity was determined by the degree of segmentation breakdown that it caused on the macular map. A retrospective review was conducted of the medical records of patients with artifacts and of a random control group without artifacts. Results. Of 1592 patients, 9.3% (148 patients, 200 eyes) had scans that contained mirror artifacts. A significantly more myopic spherical equivalent (P < 0.001), worse VA (P < 0.001), longer axial lengths (P = 0.004), and higher proportions of moderate to high myopia (P < 0.001) were found in patients with mirror artifacts than in patients without artifacts. Worse VA was associated with increased artifact severity (P = 0.04). Conclusions. In all scans analyzed, a high prevalence of mirror artifacts was found. This image artifact was often associated with patients with moderate to high myopia. Improvements in instrumentation may be necessary to resolve this problem in moderately and highly myopic eyes. Operators should be advised to properly position the retina when scanning eyes. In cases in which peripheral abnormalities in topographic measurements of retinal thickness are found, corresponding OCT scans should be examined for the presence of mirror artifacts. PMID:20181840

  7. Assessing personal talent determinants in young racquet sport players: a systematic review.

    PubMed

    Faber, Irene R; Bustin, Paul M J; Oosterveld, Frits G J; Elferink-Gemser, Marije T; Nijhuis-Van der Sanden, Maria W G

    2016-01-01

    Since junior performances have little predictive value for future success, other solutions are sought to assess a young player's potential. The objectives of this systematic review are (1) to provide an overview of instruments measuring personal talent determinants of young players in racquet sports, and (2) to evaluate these instruments regarding their validity for talent development. Electronic searches were conducted in PubMed, PsychINFO, Web of Knowledge, ScienceDirect and SPORTDiscus (1990 to 31 March 2014). Search terms represented tennis, table tennis, badminton and squash, the concept of talent, methods of testing and children. Thirty articles with information regarding over 100 instruments were included. Validity evaluation showed that instruments focusing on intellectual and perceptual abilities, and coordinative skills discriminate elite from non-elite players and/or are related to current performance, but their predictive validity is not confirmed. There is moderate evidence that the assessments of mental and goal management skills predict future performance. Data on instruments measuring physical characteristics prohibit a conclusion due to conflicting findings. This systematic review yielded an ambiguous end point. The lack of longitudinal studies precludes verification of the instrument's capacity to forecast future performance. Future research should focus on instruments assessing multidimensional talent determinants and their predictive value in longitudinal designs.

  8. The Isolation and Partial Characterization of a Membrane Fraction Containing Phytochrome 12

    PubMed Central

    Marmé, Dieter; Mackenzie, John M.; Boisard, Jean; Briggs, Winslow R.

    1974-01-01

    If 4-day-old dark-grown zucchini squash seedlings (Cucurbita pepo L. cv. Black Beauty) are exposed briefly to red light, subsequent cell fractionation yields about 40% of the total extractable phytochrome in the far red-absorbing form bound to a particulate fraction. The amount of far red-absorbing phytochrome in the pellet is strongly dependent on the Mg concentration in the extraction medium. The apparent density of the Pfr-containing particles following sedimentation on sucrose gradients corresponds to 15% (w/w) sucrose with 0.1 mm Mg and 40% sucrose with 10 mm Mg. This particulate fraction could be readily separated from mitochondria and other particulate material by taking advantage of these apparent density changes with changes in Mg concentration. Electron microscopy of negatively stained preparations shows that with 1 mm Mg only minute particles are present. These were too small to reveal structural detail with this technique. With 3 mm Mg, separate membranous vesicles between 400 and 600 Ångstroms in diameter appear. At higher Mg concentrations, the vesicles aggregate, causing obvious turbity. The effect of Mg on vesicle formation and aggregation is completely reversible. Above 10 mm Mg, vesicle aggregation persists, but the percentage of bound Pfr decreases. Images PMID:16658871

  9. The Effects of Category Generalizations and Instance Similarity on Schema Abstraction.

    DTIC Science & Technology

    1980-10-07

    reading; musical ’a-ite: classical, jazz, rock, disco, folk, country; sport: volleyball, basketball. bowling, squash, racquetball, handball . The space...Psychology 1845 Elena Ave., Fourth Floor 33 Kirkland Street Redondo Beach , CA 90277 Cambridge, MA 02138 1 Dr. Donald A Norman Mr. Marlin Kroger Dept. of...So. California Department of Computer Science Behavioral Technology Labs Rutgers University 1845 S. Elena Ave. ew Brunswick, NJ 08903 Redondo Beach

  10. Renyi generalizations of the conditional quantum mutual information

    DTIC Science & Technology

    2015-02-23

    D) for a four-party pure state on systems ABCD. The conditional mutual information also underlies the squashed entanglement , an entanglement measure...that satisfies all of the axioms desired for an entanglement measure. As such, it has been an open question to find Rényi generalizations of the...possessing the C systems, and the sender and receiver sharing noiseless entanglement before communication begins, the optimal rate of quantum communication

  11. Realistic Planning Scenarios.

    DTIC Science & Technology

    1987-07-01

    visibility for U.S. forces. These restrictions were consistent with the new administration’s desire to avoid foreign military entanglements in order to...sought above all to avoid foreign entanglements involving a prospect of military conflict. The dominant view in the administration was that the use...to squash public protests and restore order. 5 All else being equal, the U.S.S.R. clearly would prefer to avoid an intervention in Poland--even the

  12. Effect of simulated rainfall on leaching and efficacy of fenamiphos.

    PubMed

    Johnson, A W; Wauchope, R D; Burgoa, B

    1995-12-01

    There is increasing concern in the United States about the pesticide movement in soil, groundwater contamination, and pesticide residue in food. The objective of this study was to determine the efficacy, degradation, and movement of fenamiphos (Nemacur 15G) in the soil and residues in squash fruit as influenced by four simulated rainfall treatments (2.5 or 5.0 cm each applied 1 or 3 days after nematicide application) under field conditions. In 1990, concentrations of fenamiphos were greater in the top 15 cm of soil in plots with no rainfall than in those treated with rainfall. Eighty to 95 % of the fenamiphos recovered from treated plots was found in the 0-15-cm soil layer. The concentration of fenamiphos recovered from the 0-15-cm soil layer in 1991 was approximately one-half the concentration recovered in 1990, but greater concentrations of fenamiphos sulfoxide (an oxidation product of fenamiphos) were recovered in 1991 than in 1990. Concentrations of fenamiphos, fenamiphos sulfoxide, and fenamiphos sulfone were near or below detectable levels (0.002 mg/kg soil) below the 0-15-cm soil layer. Rainfall treatments did not affect the efficacy of the nematicide against Meloidogyne incognita race 1. The concentration of fenamiphos in squash fruit in 1991 was below the detectable level (0.01 mg/kg).

  13. Using a situation awareness approach to determine decision-making behaviour in squash.

    PubMed

    Murray, Stafford; James, Nic; Perš, Janez; Mandeljc, Rok; Vučković, Goran

    2018-06-01

    Situation awareness (SA) refers to the awareness of all relevant sources of information, an ability to synthesise this information using domain knowledge gained from past experiences and the ability to physically respond to a situation. Expert-novice differences have been widely reported in decision-making in complex situations although determining the small differences in expert behaviour are more elusive. This study considered how expert squash players use SA to decide on what shot to play. Matches at the 2010 (n = 14) and 2011 (n = 27) Rowe British Grand Prix were recorded and processed using Tracker software. Shot type, ball location, players' positions on court and movement parameters between the time an opponent played a shot prior to the player's shot to the time of the opponent's following shot were captured 25 times per second. Six SA clusters were named to relate to the outcome of a shot ranging from a defensive shot played under pressure to create time to an attempted winner played under no pressure with the opponent out of position. This new methodology found fine-grained SA differences in expert behaviour, even for the same shot type played from the same court area, beyond the usual expert-novice differences.

  14. Nutrient-rich versus nutrient-poor foods for depressed patients based on Iranian Traditional Medicine resources.

    PubMed

    Tavakkoli-Kakhki, Mandana; Eslami, Saeid; Motavasselian, Malihe

    2015-01-01

    Considering the positive effects of certain nutrients on depression, increasingly prevalent in the contemporary societies, we investigated the nutritional content of prescribed and prohibited foodstuffs for depressed patients in Iranian Traditional Medicine resources. In order to conduct the study, credible sources of Iranian Traditional Medicine were primarily reviewed for the prescribed and prohibited foodstuffs for depressed patients. USDA database, as a well-known and valuable source, was then visited to determine the amount of effective nutrients in each foodstuff. Finally, the obtained amounts were compared with each other in three food groups, namely vegetables, fruits and nuts and also high protein products. In Iranian Traditional Medicine texts, the following are prescribed for depression management: basil, coriander, spinach, lettuce, squash, peppermint, dill, chicory, celery, chard, quince, cucumber, watermelon, grape, peach, pomegranate, banana, apple, currant, pistachio, dried fig, almond, egg, chicken, lamb, and trout; cabbage, eggplant, onion, garlic, broad beans, lentils, and beef, meanwhile, are prohibited. In this regard, the effective nutritional content of these foodstuffs was obtained and then compared in the three food groups. This study revealed that spinach, lettuce, chicory, and squash (vegetables), pomegranate and almond (fruits and nuts) and ultimately trout (high protein products) are the best effective foodstuffs on depressed patients from nutritional content aspect.

  15. Evolutionary and domestication history of Cucurbita (pumpkin and squash) species inferred from 44 nuclear loci.

    PubMed

    Kates, Heather R; Soltis, Pamela S; Soltis, Douglas E

    2017-06-01

    Phylogenetics can facilitate the study of plant domestication by resolving sister relationships between crops and their wild relatives, thereby identifying the ancestors of cultivated plants. Previous phylogenetic studies of the six Cucurbita crop lineages (pumpkins and squashes) and their wild relatives suggest histories of deep coalescence that complicate uncovering the genetic origins of the six crop taxa. We investigated the evolution of wild and domesticated Cucurbita using the most comprehensive and robust molecular-based phylogeny for Cucurbita to date based on 44 loci derived from introns of single-copy nuclear genes. We discovered novel relationships among Cucurbita species and recovered the first Cucurbita tree with well-supported resolution within species. Cucurbita comprises a clade of mesophytic annual species that includes all six crop taxa and a grade of xerophytic perennial species that represent the ancestral xerophytic habit of the genus. Based on phylogenetic resolution within-species we hypothesize that the magnitude of domestication bottlenecks varies among Cucurbita crop lineages. Our phylogeny clarifies how wild Cucurbita species are related to the domesticated taxa. We find close relationships between two wild species and crop lineages not previously identified. Expanded geographic sampling of key wild species is needed for improved understanding of the evolution of domesticated Cucurbita. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. Functional Immunomics of the Squash Bug, Anasa tristis (De Geer) (Heteroptera: Coreidae)

    PubMed Central

    Shelby, Kent S.

    2013-01-01

    The Squash bug, Anasa tristis (De Geer), is a major piercing/sucking pest of cucurbits, causing extensive damage to plants and fruits, and transmitting phytopathogens. No genomic resources to facilitate field and laboratory studies of this pest were available; therefore the first de novo exome for this destructive pest was assembled. RNA was extracted from insects challenged with bacterial and fungal immunoelicitors, insects fed on different cucurbit species, and insects from all life stages from egg to adult. All treatments and replicates were separately barcoded for subsequent analyses, then pooled for sequencing in a single lane using the Illumina HiSeq2000 platform. Over 211 million 100-base tags generated in this manner were trimmed, filtered, and cleaned, then assembled into a de novo reference transcriptome using the Broad Institute Trinity assembly algorithm. The assembly was annotated using NCBIx NR, BLAST2GO, KEGG and other databases. Of the >130,000 total assemblies 37,327 were annotated identifying the sequences of candidate gene silencing targets from immune, endocrine, reproductive, cuticle, and other physiological systems. Expression profiling of the adult immune response was accomplished by aligning the 100-base tags from each biological replicate from each treatment and controls to the annotated reference assembly of the A. tristis transcriptome. PMID:26462532

  17. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Schuermann, Karl; Vorwerk, Dierk; Buecker, Arno

    Purpose: To compare nonferromagnetic iliac artery prostheses in their suitability for patency monitoring with magnetic resonance angiography (MRA) using conventional angiography as a reference. Methods: In experiment 1, three Memotherm stents were inserted into the iliac arteries of each of six sheep: two 'tandem' stents on one side and a single stent on the other side. In experiment 2, four prostheses (normal and low-porosity Corvita stent-grafts, Memotherm, ZA-stent) were inserted in each of 11 sheep. Patency was monitored before and 1, 3, and 6 months after insertion with 3D phase-contrast and two 2D time-of-flight sequences (TOF-1: TR/TE = 18/6.9, TOF-2:more » 13/2.5) with and without contrast at 1.5 T. On 206 coronal MIP images (72 pre-, 134 post-stenting), three readers analyzed 824 iliac segments (206 x 4) for patency and artifacts. Results: There was no difference in the number of artifacts between tandem and single iliac Memotherm stents. The ZA-stent induced significantly fewer artifacts than the other prostheses (p < 0.00001). With MRA, patency of the ZA-stent was correctly diagnosed in 88% of cases, which was almost comparable to nonstented iliac segments (95%), patency of the Memotherm stent in 59%, and of the Corvita stent-grafts in 57% and 55%. The TOF-2 sequence with contrast yielded the best images. Conclusion: MRA compatibility of nonferromagnetic prostheses depends strongly on the design of the device. MRA may be used to monitor the patency of iliac ZA-stents, whereas iliac Memotherm stents and Corvita stent-grafts appear to be less suited for follow-up with MRA.« less

  18. Performance evaluation of multi-material electronic cleansing for ultra-low-dose dual-energy CT colonography

    NASA Astrophysics Data System (ADS)

    Tachibana, Rie; Kohlhase, Naja; Näppi, Janne J.; Hironaka, Toru; Ota, Junko; Ishida, Takayuki; Regge, Daniele; Yoshida, Hiroyuki

    2016-03-01

    Accurate electronic cleansing (EC) for CT colonography (CTC) enables the visualization of the entire colonic surface without residual materials. In this study, we evaluated the accuracy of a novel multi-material electronic cleansing (MUMA-EC) scheme for non-cathartic ultra-low-dose dual-energy CTC (DE-CTC). The MUMA-EC performs a wateriodine material decomposition of the DE-CTC images and calculates virtual monochromatic images at multiple energies, after which a random forest classifier is used to label the images into the regions of lumen air, soft tissue, fecal tagging, and two types of partial-volume boundaries based on image-based features. After the labeling, materials other than soft tissue are subtracted from the CTC images. For pilot evaluation, 384 volumes of interest (VOIs), which represented sources of subtraction artifacts observed in current EC schemes, were sampled from 32 ultra-low-dose DE-CTC scans. The voxels in the VOIs were labeled manually to serve as a reference standard. The metric for EC accuracy was the mean overlap ratio between the labels of the reference standard and the labels generated by the MUMA-EC, a dualenergy EC (DE-EC), and a single-energy EC (SE-EC) scheme. Statistically significant differences were observed between the performance of the MUMA/DE-EC and the SE-EC methods (p<0.001). Visual assessment confirmed that the MUMA-EC generated less subtraction artifacts than did DE-EC and SE-EC. Our MUMA-EC scheme yielded superior performance over conventional SE-EC scheme in identifying and minimizing subtraction artifacts on noncathartic ultra-low-dose DE-CTC images.

  19. Prospective heart tracking for whole-heart magnetic resonance angiography.

    PubMed

    Moghari, Mehdi H; Geva, Tal; Powell, Andrew J

    2017-02-01

    To develop a prospective respiratory-gating technique (Heart-NAV) for use with contrast-enhanced three-dimensional (3D) inversion recovery (IR) whole-heart magnetic resonance angiography (MRA) acquisitions that directly tracks heart motion without creating image inflow artifact. With Heart-NAV, one of the startup pulses for the whole-heart steady-state free precession MRA sequence is used to collect the centerline of k-space, and its one-dimensional reconstruction is fed into the standard diaphragm-navigator (NAV) signal analysis process to prospectively gate and track respiratory-induced heart displacement. Ten healthy volunteers underwent non-contrast whole-heart MRA acquisitions using the conventional diaphragm-NAV and Heart-NAV with 5 and 10-mm acceptance windows in a 1.5T scanner. Five patients underwent contrast-enhanced IR whole-heart MRA using a diaphragm-NAV and Heart-NAV with a 5-mm acceptance window. For non-contrast whole-heart MRA with both the 5 and 10-mm acceptance windows, Heart-NAV yielded coronary artery vessel sharpness and subjective visual scores that were not significantly different than those using a conventional diaphragm-NAV. Scan time for Heart-NAV was 10% shorter (p < 0.05). In patients undergoing contrast-enhanced IR whole-heart MRA, inflow artifact was seen with the diaphragm-NAV but not with Heart-NAV. Compared with a conventional diaphragm-NAV, Heart-NAV achieves similar image quality in a slightly shorter scan time and eliminates inflow artifact. Magn Reson Med 77:759-765, 2017. © 2016 International Society for Magnetic Resonance in Medicine. © 2016 International Society for Magnetic Resonance in Medicine.

  20. CT-Guided Biopsy of Small Liver Lesions: Visibility, Artifacts, and Corresponding Diagnostic Accuracy

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Stattaus, Joerg, E-mail: joerg.stattaus@uni-due.de; Kuehl, Hilmar; Ladd, Susanne

    2007-09-15

    Purpose. Our study aimed to determine the visibility of small liver lesions during CT-guided biopsy and to assess the influence of lesion visibility on biopsy results. Material and Methods. Fifty patients underwent CT-guided core biopsy of small focal liver lesions (maximum diameter, 3 cm); 38 biopsies were performed using noncontrast CT, and the remaining 12 were contrast-enhanced. Visibility of all lesions was graded on a 4-point-scale (0 = not visible, 1 = poorly visible, 2 = sufficiently visible, 3 = excellently visible) before and during biopsy (with the needle placed adjacent to and within the target lesion). Results. Forty-three biopsiesmore » (86%) yielded diagnostic results, and seven biopsies were false-negative. In noncontrast biopsies, the rate of insufficiently visualized lesions (grades 0-1) increased significantly during the procedure, from 10.5% to 44.7%, due to needle artifacts. This resulted in more (17.6%) false-negative biopsy results compared to lesions with good visualization (4.8%), although this difference lacks statistical significance. Visualization impairment appeared more often with an intercostal or subcostal vs. an epigastric access and with a subcapsular vs. a central lesion location, respectively. With contrast-enhanced biopsy the visibility of hepatic lesions was only temporarily improved, with a risk of complete obscuration in the late phase. Conclusion. In conclusion, visibility of small liver lesions diminished significantly during CT-guided biopsy due to needle artifacts, with a fourfold increased rate of insufficiently visualized lesions and of false-negative histological results. Contrast enhancement did not reveal better results.« less

  1. Frequency compounding in multifrequency vibroacoustography

    NASA Astrophysics Data System (ADS)

    Urban, Matthew W.; Alizad, Azra; Fatemi, Mostafa

    2009-02-01

    Vibro-acoustography is a speckle-free ultrasound based imaging modality that can visualize normal and abnormal soft tissue through mapping stimulated acoustic emission. The acoustic emission is generated by focusing two ultrasound beams of slightly different frequencies (Δf = f1-f2) to the same spatial location and vibrating the tissue as a result of ultrasound radiation force. Reverberation of the acoustic emission can create dark and bright areas in the image that affect overall image contrast and detectability of abnormal tissue. Using finite length tonebursts yields acoustic emission at Δf and at sidebands centered about Δf that originate from the temporal toneburst gating. Separate images are formed by bandpass filtering the acoustic emission at Δf and the associated sidebands. The data at these multiple frequencies are compounded through coherent or incoherent processes to reduce the artifacts associated with reverberation of the acoustic emission. Experimental results from a urethane breast phantom and in vivo human breast scans are shown. The reduction in reverberation artifacts are analyzed using a smoothness metric which uses the variances of the gray levels of the original images and those formed through coherent and incoherent compounding of image data. This smoothness metric is minimized when the overall image background is smooth while image features are still preserved. The smoothness metric indicates that the images improved by factors from 1.23-4.33 and 1.09-2.68 in phantom and in vivo studies, respectively. The coherent and incoherent compounding of multifrequency data demonstrate, both qualitatively and quantitatively, the efficacy of this method for reduction of reverberation artifacts.

  2. Sparsity-based acoustic inversion in cross-sectional multiscale optoacoustic imaging.

    PubMed

    Han, Yiyong; Tzoumas, Stratis; Nunes, Antonio; Ntziachristos, Vasilis; Rosenthal, Amir

    2015-09-01

    With recent advancement in hardware of optoacoustic imaging systems, highly detailed cross-sectional images may be acquired at a single laser shot, thus eliminating motion artifacts. Nonetheless, other sources of artifacts remain due to signal distortion or out-of-plane signals. The purpose of image reconstruction algorithms is to obtain the most accurate images from noisy, distorted projection data. In this paper, the authors use the model-based approach for acoustic inversion, combined with a sparsity-based inversion procedure. Specifically, a cost function is used that includes the L1 norm of the image in sparse representation and a total variation (TV) term. The optimization problem is solved by a numerically efficient implementation of a nonlinear gradient descent algorithm. TV-L1 model-based inversion is tested in the cross section geometry for numerically generated data as well as for in vivo experimental data from an adult mouse. In all cases, model-based TV-L1 inversion showed a better performance over the conventional Tikhonov regularization, TV inversion, and L1 inversion. In the numerical examples, the images reconstructed with TV-L1 inversion were quantitatively more similar to the originating images. In the experimental examples, TV-L1 inversion yielded sharper images and weaker streak artifact. The results herein show that TV-L1 inversion is capable of improving the quality of highly detailed, multiscale optoacoustic images obtained in vivo using cross-sectional imaging systems. As a result of its high fidelity, model-based TV-L1 inversion may be considered as the new standard for image reconstruction in cross-sectional imaging.

  3. Automatic removal of eye-movement and blink artifacts from EEG signals.

    PubMed

    Gao, Jun Feng; Yang, Yong; Lin, Pan; Wang, Pei; Zheng, Chong Xun

    2010-03-01

    Frequent occurrence of electrooculography (EOG) artifacts leads to serious problems in interpreting and analyzing the electroencephalogram (EEG). In this paper, a robust method is presented to automatically eliminate eye-movement and eye-blink artifacts from EEG signals. Independent Component Analysis (ICA) is used to decompose EEG signals into independent components. Moreover, the features of topographies and power spectral densities of those components are extracted to identify eye-movement artifact components, and a support vector machine (SVM) classifier is adopted because it has higher performance than several other classifiers. The classification results show that feature-extraction methods are unsuitable for identifying eye-blink artifact components, and then a novel peak detection algorithm of independent component (PDAIC) is proposed to identify eye-blink artifact components. Finally, the artifact removal method proposed here is evaluated by the comparisons of EEG data before and after artifact removal. The results indicate that the method proposed could remove EOG artifacts effectively from EEG signals with little distortion of the underlying brain signals.

  4. A platform-independent method to reduce CT truncation artifacts using discriminative dictionary representations.

    PubMed

    Chen, Yang; Budde, Adam; Li, Ke; Li, Yinsheng; Hsieh, Jiang; Chen, Guang-Hong

    2017-01-01

    When the scan field of view (SFOV) of a CT system is not large enough to enclose the entire cross-section of the patient, or the patient needs to be positioned partially outside the SFOV for certain clinical applications, truncation artifacts often appear in the reconstructed CT images. Many truncation artifact correction methods perform extrapolations of the truncated projection data based on certain a priori assumptions. The purpose of this work was to develop a novel CT truncation artifact reduction method that directly operates on DICOM images. The blooming of pixel values associated with truncation was modeled using exponential decay functions, and based on this model, a discriminative dictionary was constructed to represent truncation artifacts and nonartifact image information in a mutually exclusive way. The discriminative dictionary consists of a truncation artifact subdictionary and a nonartifact subdictionary. The truncation artifact subdictionary contains 1000 atoms with different decay parameters, while the nonartifact subdictionary contains 1000 independent realizations of Gaussian white noise that are exclusive with the artifact features. By sparsely representing an artifact-contaminated CT image with this discriminative dictionary, the image was separated into a truncation artifact-dominated image and a complementary image with reduced truncation artifacts. The artifact-dominated image was then subtracted from the original image with an appropriate weighting coefficient to generate the final image with reduced artifacts. This proposed method was validated via physical phantom studies and retrospective human subject studies. Quantitative image evaluation metrics including the relative root-mean-square error (rRMSE) and the universal image quality index (UQI) were used to quantify the performance of the algorithm. For both phantom and human subject studies, truncation artifacts at the peripheral region of the SFOV were effectively reduced, revealing soft tissue and bony structure once buried in the truncation artifacts. For the phantom study, the proposed method reduced the relative RMSE from 15% (original images) to 11%, and improved the UQI from 0.34 to 0.80. A discriminative dictionary representation method was developed to mitigate CT truncation artifacts directly in the DICOM image domain. Both phantom and human subject studies demonstrated that the proposed method can effectively reduce truncation artifacts without access to projection data. © 2016 American Association of Physicists in Medicine.

  5. Voting strategy for artifact reduction in digital breast tomosynthesis.

    PubMed

    Wu, Tao; Moore, Richard H; Kopans, Daniel B

    2006-07-01

    Artifacts are observed in digital breast tomosynthesis (DBT) reconstructions due to the small number of projections and the narrow angular range that are typically employed in tomosynthesis imaging. In this work, we investigate the reconstruction artifacts that are caused by high-attenuation features in breast and develop several artifact reduction methods based on a "voting strategy." The voting strategy identifies the projection(s) that would introduce artifacts to a voxel and rejects the projection(s) when reconstructing the voxel. Four approaches to the voting strategy were compared, including projection segmentation, maximum contribution deduction, one-step classification, and iterative classification. The projection segmentation method, based on segmentation of high-attenuation features from the projections, effectively reduces artifacts caused by metal and large calcifications that can be reliably detected and segmented from projections. The other three methods are based on the observation that contributions from artifact-inducing projections have higher value than those from normal projections. These methods attempt to identify the projection(s) that would cause artifacts by comparing contributions from different projections. Among the three methods, the iterative classification method provides the best artifact reduction; however, it can generate many false positive classifications that degrade the image quality. The maximum contribution deduction method and one-step classification method both reduce artifacts well from small calcifications, although the performance of artifact reduction is slightly better with the one-step classification. The combination of one-step classification and projection segmentation removes artifacts from both large and small calcifications.

  6. Detection of artifacts from high energy bursts in neonatal EEG.

    PubMed

    Bhattacharyya, Sourya; Biswas, Arunava; Mukherjee, Jayanta; Majumdar, Arun Kumar; Majumdar, Bandana; Mukherjee, Suchandra; Singh, Arun Kumar

    2013-11-01

    Detection of non-cerebral activities or artifacts, intermixed within the background EEG, is essential to discard them from subsequent pattern analysis. The problem is much harder in neonatal EEG, where the background EEG contains spikes, waves, and rapid fluctuations in amplitude and frequency. Existing artifact detection methods are mostly limited to detect only a subset of artifacts such as ocular, muscle or power line artifacts. Few methods integrate different modules, each for detection of one specific category of artifact. Furthermore, most of the reference approaches are implemented and tested on adult EEG recordings. Direct application of those methods on neonatal EEG causes performance deterioration, due to greater pattern variation and inherent complexity. A method for detection of a wide range of artifact categories in neonatal EEG is thus required. At the same time, the method should be specific enough to preserve the background EEG information. The current study describes a feature based classification approach to detect both repetitive (generated from ECG, EMG, pulse, respiration, etc.) and transient (generated from eye blinking, eye movement, patient movement, etc.) artifacts. It focuses on artifact detection within high energy burst patterns, instead of detecting artifacts within the complete background EEG with wide pattern variation. The objective is to find true burst patterns, which can later be used to identify the Burst-Suppression (BS) pattern, which is commonly observed during newborn seizure. Such selective artifact detection is proven to be more sensitive to artifacts and specific to bursts, compared to the existing artifact detection approaches applied on the complete background EEG. Several time domain, frequency domain, statistical features, and features generated by wavelet decomposition are analyzed to model the proposed bi-classification between burst and artifact segments. A feature selection method is also applied to select the feature subset producing highest classification accuracy. The suggested feature based classification method is executed using our recorded neonatal EEG dataset, consisting of burst and artifact segments. We obtain 78% sensitivity and 72% specificity as the accuracy measures. The accuracy obtained using the proposed method is found to be about 20% higher than that of the reference approaches. Joint use of the proposed method with our previous work on burst detection outperforms reference methods on simultaneous burst and artifact detection. As the proposed method supports detection of a wide range of artifact patterns, it can be improved to incorporate the detection of artifacts within other seizure patterns and background EEG information as well. © 2013 Elsevier Ltd. All rights reserved.

  7. High-Resolution C-Arm CT and Metal Artifact Reduction Software: A Novel Imaging Modality for Analyzing Aneurysms Treated with Stent-Assisted Coil Embolization.

    PubMed

    Yuki, I; Kambayashi, Y; Ikemura, A; Abe, Y; Kan, I; Mohamed, A; Dahmani, C; Suzuki, T; Ishibashi, T; Takao, H; Urashima, M; Murayama, Y

    2016-02-01

    Combination of high-resolution C-arm CT and novel metal artifact reduction software may contribute to the assessment of aneurysms treated with stent-assisted coil embolization. This study aimed to evaluate the efficacy of a novel Metal Artifact Reduction prototype software combined with the currently available high spatial-resolution C-arm CT prototype implementation by using an experimental aneurysm model treated with stent-assisted coil embolization. Eight experimental aneurysms were created in 6 swine. Coil embolization of each aneurysm was performed by using a stent-assisted technique. High-resolution C-arm CT with intra-arterial contrast injection was performed immediately after the treatment. The obtained images were processed with Metal Artifact Reduction. Five neurointerventional specialists reviewed the image quality before and after Metal Artifact Reduction. Observational and quantitative analyses (via image analysis software) were performed. Every aneurysm was successfully created and treated with stent-assisted coil embolization. Before Metal Artifact Reduction, coil loops protruding through the stent lumen were not visualized due to the prominent metal artifacts produced by the coils. These became visible after Metal Artifact Reduction processing. Contrast filling in the residual aneurysm was also visualized after Metal Artifact Reduction in every aneurysm. Both the observational (P < .0001) and quantitative (P < .001) analyses showed significant reduction of the metal artifacts after application of the Metal Artifact Reduction prototype software. The combination of high-resolution C-arm CT and Metal Artifact Reduction enables differentiation of the coil mass, stent, and contrast material on the same image by significantly reducing the metal artifacts produced by the platinum coils. This novel image technique may improve the assessment of aneurysms treated with stent-assisted coil embolization. © 2016 by American Journal of Neuroradiology.

  8. Joint correction of Nyquist artifact and minuscule motion-induced aliasing artifact in interleaved diffusion weighted EPI data using a composite two-dimensional phase correction procedure

    PubMed Central

    Chang, Hing-Chiu; Chen, Nan-kuei

    2016-01-01

    Diffusion-weighted imaging (DWI) obtained with interleaved echo-planar imaging (EPI) pulse sequence has great potential of characterizing brain tissue properties at high spatial-resolution. However, interleaved EPI based DWI data may be corrupted by various types of aliasing artifacts. First, inconsistencies in k-space data obtained with opposite readout gradient polarities result in Nyquist artifact, which is usually reduced with 1D phase correction in post-processing. When there exist eddy current cross terms (e.g., in oblique-plane EPI), 2D phase correction is needed to effectively reduce Nyquist artifact. Second, minuscule motion induced phase inconsistencies in interleaved DWI scans result in image-domain aliasing artifact, which can be removed with reconstruction procedures that take shot-to-shot phase variations into consideration. In existing interleaved DWI reconstruction procedures, Nyquist artifact and minuscule motion-induced aliasing artifact are typically removed subsequently in two stages. Although the two-stage phase correction generally performs well for non-oblique plane EPI data obtained from well-calibrated system, the residual artifacts may still be pronounced in oblique-plane EPI data or when there exist eddy current cross terms. To address this challenge, here we report a new composite 2D phase correction procedure, which effective removes Nyquist artifact and minuscule motion induced aliasing artifact jointly in a single step. Our experimental results demonstrate that the new 2D phase correction method can much more effectively reduce artifacts in interleaved EPI based DWI data as compared with the existing two-stage artifact correction procedures. The new method robustly enables high-resolution DWI, and should prove highly valuable for clinical uses and research studies of DWI. PMID:27114342

  9. PlateRunner: A Search Engine to Identify EMR Boilerplates.

    PubMed

    Divita, Guy; Workman, T Elizabeth; Carter, Marjorie E; Redd, Andrew; Samore, Matthew H; Gundlapalli, Adi V

    2016-01-01

    Medical text contains boilerplated content, an artifact of pull-down forms from EMRs. Boilerplated content is the source of challenges for concept extraction on clinical text. This paper introduces PlateRunner, a search engine on boilerplates from the US Department of Veterans Affairs (VA) EMR. Boilerplates containing concepts should be identified and reviewed to recognize challenging formats, identify high yield document titles, and fine tune section zoning. This search engine has the capability to filter negated and asserted concepts, save and search query results. This tool can save queries, search results, and documents found for later analysis.

  10. Thoracolumbar spinal deformity: Part I. A historical passage to 1990: historical vignette.

    PubMed

    Kanter, Adam S; Bradford, David S; Okonkwo, David O; Rengachary, Setti S; Mummaneni, Praveen V

    2009-12-01

    Seven millennia of anthropological artifacts and historical tales reference human spinal deformity, its diagnosis, and treatment-many of the latter of which turned out to be worse than the deformity itself. From Hippocrates to Harrington to the 21st century, the literature base has expanded in exponential fashion to yield an imperfect but constantly improving body of evidence, experience, and understanding of this challenging disease phenomenon. This review details the pre-1990 innovations, whose failures and successes have equally contributed to the advancement and dissemination of the increasingly evidence-based field of spinal deformity.

  11. Application of up-sampling and resolution scaling to Fresnel reconstruction of digital holograms.

    PubMed

    Williams, Logan A; Nehmetallah, Georges; Aylo, Rola; Banerjee, Partha P

    2015-02-20

    Fresnel transform implementation methods using numerical preprocessing techniques are investigated in this paper. First, it is shown that up-sampling dramatically reduces the minimum reconstruction distance requirements and allows maximal signal recovery by eliminating aliasing artifacts which typically occur at distances much less than the Rayleigh range of the object. Second, zero-padding is employed to arbitrarily scale numerical resolution for the purpose of resolution matching multiple holograms, where each hologram is recorded using dissimilar geometric or illumination parameters. Such preprocessing yields numerical resolution scaling at any distance. Both techniques are extensively illustrated using experimental results.

  12. TH-C-BRD-06: A Novel MRI Based CT Artifact Correction Method for Improving Proton Range Calculation in the Presence of Severe CT Artifacts

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Park, P; Schreibmann, E; Fox, T

    2014-06-15

    Purpose: Severe CT artifacts can impair our ability to accurately calculate proton range thereby resulting in a clinically unacceptable treatment plan. In this work, we investigated a novel CT artifact correction method based on a coregistered MRI and investigated its ability to estimate CT HU and proton range in the presence of severe CT artifacts. Methods: The proposed method corrects corrupted CT data using a coregistered MRI to guide the mapping of CT values from a nearby artifact-free region. First patient MRI and CT images were registered using 3D deformable image registration software based on B-spline and mutual information. Themore » CT slice with severe artifacts was selected as well as a nearby slice free of artifacts (e.g. 1cm away from the artifact). The two sets of paired MRI and CT images at different slice locations were further registered by applying 2D deformable image registration. Based on the artifact free paired MRI and CT images, a comprehensive geospatial analysis was performed to predict the correct CT HU of the CT image with severe artifact. For a proof of concept, a known artifact was introduced that changed the ground truth CT HU value up to 30% and up to 5cm error in proton range. The ability of the proposed method to recover the ground truth was quantified using a selected head and neck case. Results: A significant improvement in image quality was observed visually. Our proof of concept study showed that 90% of area that had 30% errors in CT HU was corrected to 3% of its ground truth value. Furthermore, the maximum proton range error up to 5cm was reduced to 4mm error. Conclusion: MRI based CT artifact correction method can improve CT image quality and proton range calculation for patients with severe CT artifacts.« less

  13. Metal implants on CT: comparison of iterative reconstruction algorithms for reduction of metal artifacts with single energy and spectral CT scanning in a phantom model.

    PubMed

    Fang, Jieming; Zhang, Da; Wilcox, Carol; Heidinger, Benedikt; Raptopoulos, Vassilios; Brook, Alexander; Brook, Olga R

    2017-03-01

    To assess single energy metal artifact reduction (SEMAR) and spectral energy metal artifact reduction (MARS) algorithms in reducing artifacts generated by different metal implants. Phantom was scanned with and without SEMAR (Aquilion One, Toshiba) and MARS (Discovery CT750 HD, GE), with various metal implants. Images were evaluated objectively by measuring standard deviation in regions of interests and subjectively by two independent reviewers grading on a scale of 0 (no artifact) to 4 (severe artifact). Reviewers also graded new artifacts introduced by metal artifact reduction algorithms. SEMAR and MARS significantly decreased variability of the density measurement adjacent to the metal implant, with median SD (standard deviation of density measurement) of 52.1 HU without SEMAR, vs. 12.3 HU with SEMAR, p < 0.001. Median SD without MARS of 63.1 HU decreased to 25.9 HU with MARS, p < 0.001. Median SD with SEMAR is significantly lower than median SD with MARS (p = 0.0011). SEMAR improved subjective image quality with reduction in overall artifacts grading from 3.2 ± 0.7 to 1.4 ± 0.9, p < 0.001. Improvement of overall image quality by MARS has not reached statistical significance (3.2 ± 0.6 to 2.6 ± 0.8, p = 0.088). There was a significant introduction of artifacts introduced by metal artifact reduction algorithm for MARS with 2.4 ± 1.0, but minimal with SEMAR 0.4 ± 0.7, p < 0.001. CT iterative reconstruction algorithms with single and spectral energy are both effective in reduction of metal artifacts. Single energy-based algorithm provides better overall image quality than spectral CT-based algorithm. Spectral metal artifact reduction algorithm introduces mild to moderate artifacts in the far field.

  14. Reference-Free Removal of EEG-fMRI Ballistocardiogram Artifacts with Harmonic Regression

    PubMed Central

    Krishnaswamy, Pavitra; Bonmassar, Giorgio; Poulsen, Catherine; Pierce, Eric T; Purdon, Patrick L.; Brown, Emery N.

    2016-01-01

    Combining electroencephalogram (EEG) recording and functional magnetic resonance imaging (fMRI) offers the potential for imaging brain activity with high spatial and temporal resolution. This potential remains limited by the significant ballistocardiogram (BCG) artifacts induced in the EEG by cardiac pulsation-related head movement within the magnetic field. We model the BCG artifact using a harmonic basis, pose the artifact removal problem as a local harmonic regression analysis, and develop an efficient maximum likelihood algorithm to estimate and remove BCG artifacts. Our analysis paradigm accounts for time-frequency overlap between the BCG artifacts and neurophysiologic EEG signals, and tracks the spatiotemporal variations in both the artifact and the signal. We evaluate performance on: simulated oscillatory and evoked responses constructed with realistic artifacts; actual anesthesia-induced oscillatory recordings; and actual visual evoked potential recordings. In each case, the local harmonic regression analysis effectively removes the BCG artifacts, and recovers the neurophysiologic EEG signals. We further show that our algorithm outperforms commonly used reference-based and component analysis techniques, particularly in low SNR conditions, the presence of significant time-frequency overlap between the artifact and the signal, and/or large spatiotemporal variations in the BCG. Because our algorithm does not require reference signals and has low computational complexity, it offers a practical tool for removing BCG artifacts from EEG data recorded in combination with fMRI. PMID:26151100

  15. Evaluation of Denoising Strategies to Address Motion-Correlated Artifacts in Resting-State Functional Magnetic Resonance Imaging Data from the Human Connectome Project

    PubMed Central

    Kandala, Sridhar; Nolan, Dan; Laumann, Timothy O.; Power, Jonathan D.; Adeyemo, Babatunde; Harms, Michael P.; Petersen, Steven E.; Barch, Deanna M.

    2016-01-01

    Abstract Like all resting-state functional connectivity data, the data from the Human Connectome Project (HCP) are adversely affected by structured noise artifacts arising from head motion and physiological processes. Functional connectivity estimates (Pearson's correlation coefficients) were inflated for high-motion time points and for high-motion participants. This inflation occurred across the brain, suggesting the presence of globally distributed artifacts. The degree of inflation was further increased for connections between nearby regions compared with distant regions, suggesting the presence of distance-dependent spatially specific artifacts. We evaluated several denoising methods: censoring high-motion time points, motion regression, the FMRIB independent component analysis-based X-noiseifier (FIX), and mean grayordinate time series regression (MGTR; as a proxy for global signal regression). The results suggest that FIX denoising reduced both types of artifacts, but left substantial global artifacts behind. MGTR significantly reduced global artifacts, but left substantial spatially specific artifacts behind. Censoring high-motion time points resulted in a small reduction of distance-dependent and global artifacts, eliminating neither type. All denoising strategies left differences between high- and low-motion participants, but only MGTR substantially reduced those differences. Ultimately, functional connectivity estimates from HCP data showed spatially specific and globally distributed artifacts, and the most effective approach to address both types of motion-correlated artifacts was a combination of FIX and MGTR. PMID:27571276

  16. Reflection-artifact-free photoacoustic imaging using PAFUSion (photoacoustic-guided focused ultrasound)

    NASA Astrophysics Data System (ADS)

    Kuniyil Ajith Singh, Mithun; Jaeger, Michael; Frenz, Martin; Steenbergen, Wiendelt

    2016-03-01

    Reflection artifacts caused by acoustic inhomogeneities are a main challenge to deep-tissue photoacoustic imaging. Photoacoustic transients generated by the skin surface and superficial vasculature will propagate into the tissue and reflect back from echogenic structures to generate reflection artifacts. These artifacts can cause problems in image interpretation and limit imaging depth. In its basic version, PAFUSion mimics the inward travelling wave-field from blood vessel-like PA sources by applying focused ultrasound pulses, and thus provides a way to identify reflection artifacts. In this work, we demonstrate reflection artifact correction in addition to identification, towards obtaining an artifact-free photoacoustic image. In view of clinical applications, we implemented an improved version of PAFUSion in which photoacoustic data is backpropagated to imitate the inward travelling wave-field and thus the reflection artifacts of a more arbitrary distribution of PA sources that also includes the skin melanin layer. The backpropagation is performed in a synthetic way based on the pulse-echo acquisitions after transmission on each single element of the transducer array. We present a phantom experiment and initial in vivo measurements on human volunteers where we demonstrate significant reflection artifact reduction using our technique. The results provide a direct confirmation that reflection artifacts are prominent in clinical epi-photoacoustic imaging, and that PAFUSion can reduce these artifacts significantly to improve the deep-tissue photoacoustic imaging.

  17. Removal of ring artifacts in microtomography by characterization of scintillator variations.

    PubMed

    Vågberg, William; Larsson, Jakob C; Hertz, Hans M

    2017-09-18

    Ring artifacts reduce image quality in tomography, and arise from faulty detector calibration. In microtomography, we have identified that ring artifacts can arise due to high-spatial frequency variations in the scintillator thickness. Such variations are normally removed by a flat-field correction. However, as the spectrum changes, e.g. due to beam hardening, the detector response varies non-uniformly introducing ring artifacts that persist after flat-field correction. In this paper, we present a method to correct for ring artifacts from variations in scintillator thickness by using a simple method to characterize the local scintillator response. The method addresses the actual physical cause of the ring artifacts, in contrary to many other ring artifact removal methods which rely only on image post-processing. By applying the technique to an experimental phantom tomography, we show that ring artifacts are strongly reduced compared to only making a flat-field correction.

  18. Metal Artifact Suppression in Dental Cone Beam Computed Tomography Images Using Image Processing Techniques.

    PubMed

    Johari, Masoumeh; Abdollahzadeh, Milad; Esmaeili, Farzad; Sakhamanesh, Vahideh

    2018-01-01

    Dental cone beam computed tomography (CBCT) images suffer from severe metal artifacts. These artifacts degrade the quality of acquired image and in some cases make it unsuitable to use. Streaking artifacts and cavities around teeth are the main reason of degradation. In this article, we have proposed a new artifact reduction algorithm which has three parallel components. The first component extracts teeth based on the modeling of image histogram with a Gaussian mixture model. Striking artifact reduction component reduces artifacts using converting image into the polar domain and applying morphological filtering. The third component fills cavities through a simple but effective morphological filtering operation. Finally, results of these three components are combined into a fusion step to create a visually good image which is more compatible to human visual system. Results show that the proposed algorithm reduces artifacts of dental CBCT images and produces clean images.

  19. Detection and classification of subject-generated artifacts in EEG signals using autoregressive models.

    PubMed

    Lawhern, Vernon; Hairston, W David; McDowell, Kaleb; Westerfield, Marissa; Robbins, Kay

    2012-07-15

    We examine the problem of accurate detection and classification of artifacts in continuous EEG recordings. Manual identification of artifacts, by means of an expert or panel of experts, can be tedious, time-consuming and infeasible for large datasets. We use autoregressive (AR) models for feature extraction and characterization of EEG signals containing several kinds of subject-generated artifacts. AR model parameters are scale-invariant features that can be used to develop models of artifacts across a population. We use a support vector machine (SVM) classifier to discriminate among artifact conditions using the AR model parameters as features. Results indicate reliable classification among several different artifact conditions across subjects (approximately 94%). These results suggest that AR modeling can be a useful tool for discriminating among artifact signals both within and across individuals. Copyright © 2012 Elsevier B.V. All rights reserved.

  20. Metal Artifact Suppression in Dental Cone Beam Computed Tomography Images Using Image Processing Techniques

    PubMed Central

    Johari, Masoumeh; Abdollahzadeh, Milad; Esmaeili, Farzad; Sakhamanesh, Vahideh

    2018-01-01

    Background: Dental cone beam computed tomography (CBCT) images suffer from severe metal artifacts. These artifacts degrade the quality of acquired image and in some cases make it unsuitable to use. Streaking artifacts and cavities around teeth are the main reason of degradation. Methods: In this article, we have proposed a new artifact reduction algorithm which has three parallel components. The first component extracts teeth based on the modeling of image histogram with a Gaussian mixture model. Striking artifact reduction component reduces artifacts using converting image into the polar domain and applying morphological filtering. The third component fills cavities through a simple but effective morphological filtering operation. Results: Finally, results of these three components are combined into a fusion step to create a visually good image which is more compatible to human visual system. Conclusions: Results show that the proposed algorithm reduces artifacts of dental CBCT images and produces clean images. PMID:29535920

  1. Simulation of FIB-SEM images for analysis of porous microstructures.

    PubMed

    Prill, Torben; Schladitz, Katja

    2013-01-01

    Focused ion beam nanotomography-scanning electron microscopy tomography yields high-quality three-dimensional images of materials microstructures at the nanometer scale combining serial sectioning using a focused ion beam with SEM. However, FIB-SEM tomography of highly porous media leads to shine-through artifacts preventing automatic segmentation of the solid component. We simulate the SEM process in order to generate synthetic FIB-SEM image data for developing and validating segmentation methods. Monte-Carlo techniques yield accurate results, but are too slow for the simulation of FIB-SEM tomography requiring hundreds of SEM images for one dataset alone. Nevertheless, a quasi-analytic description of the specimen and various acceleration techniques, including a track compression algorithm and an acceleration for the simulation of secondary electrons, cut down the computing time by orders of magnitude, allowing for the first time to simulate FIB-SEM tomography. © Wiley Periodicals, Inc.

  2. Sensitivity or artifact? -- IQ Toxicity Test -- effluent values

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Hayes, K.R.; Novotny, A.N.; Batista, N.

    1995-12-31

    Several complex effluents were DAPHNIA MAGNA IQ TOXICITY TESTED -- (1.25 hours) and conventionally tested with Daphnia magna (48 hours). In many samples the IQ Technology yielded low EC50 values while the 48 hour exposures yielded no acute toxicity. Possible explanations have been suggested for this occurrence such as: genotoxicity, mutagenicity, substrate interference, and enzyme satiation. To identify the causative agent(s) of this response a Toxicity Identification Evaluation was performed on one of the samples. To define the nature of the response, THE SOS-CHROMOTEST KIT and THE MUTA-CHROMOPLATE KIT were utilized to characterize genotoxicity and mutagenicity respectively. The sample didmore » not test positive for genotoxicity but tested positive for mutagenicity only after activation with S9 enzymes, suggesting the presence of promutagens. Additional work needs to be performed to correlate IQ TOXICITY TEST sensitivity with positive MUTA-CHROMOPLATE response.« less

  3. Effect of pressure and padding on motion artifact of textile electrodes.

    PubMed

    Cömert, Alper; Honkala, Markku; Hyttinen, Jari

    2013-04-08

    With the aging population and rising healthcare costs, wearable monitoring is gaining importance. The motion artifact affecting dry electrodes is one of the main challenges preventing the widespread use of wearable monitoring systems. In this paper we investigate the motion artifact and ways of making a textile electrode more resilient against motion artifact. Our aim is to study the effects of the pressure exerted onto the electrode, and the effects of inserting padding between the applied pressure and the electrode. We measure real time electrode-skin interface impedance, ECG from two channels, the motion artifact related surface potential, and exerted pressure during controlled motion by a measurement setup designed to estimate the relation of motion artifact to the signals. We use different foam padding materials with various mechanical properties and apply electrode pressures between 5 and 25 mmHg to understand their effect. A QRS and noise detection algorithm based on a modified Pan-Tompkins QRS detection algorithm estimates the electrode behaviour in respect to the motion artifact from two channels; one dominated by the motion artifact and one containing both the motion artifact and the ECG. This procedure enables us to quantify a given setup's susceptibility to the motion artifact. Pressure is found to strongly affect signal quality as is the use of padding. In general, the paddings reduce the motion artifact. However the shape and frequency components of the motion artifact vary for different paddings, and their material and physical properties. Electrode impedance at 100 kHz correlates in some cases with the motion artifact but it is not a good predictor of the motion artifact. From the results of this study, guidelines for improving electrode design regarding padding and pressure can be formulated as paddings are a necessary part of the system for reducing the motion artifact, and further, their effect maximises between 15 mmHg and 20 mmHg of exerted pressure. In addition, we present new methods for evaluating electrode sensitivity to motion, utilizing the detection of noise peaks that fall into the same frequency band as R-peaks.

  4. TU-F-CAMPUS-J-04: Evaluation of Metal Artifact Reduction Technique for the Radiation Therapy Planning

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Jeong, K; Kuo, H; Ritter, J

    Purpose: To evaluate the feasibility of using a metal artifact reduction technique in depleting metal artifact and its application in improving dose calculation in External Radiation Therapy Planning. Methods: CIRS electron density phantom was scanned with and without steel drill bits placed in some plug holes. Meta artifact reduction software with Metal Deletion Technique (MDT) was used to remove metal artifacts for scanned image with metal. Hounsfield units of electron density plugs from artifact free reference image and MDT processed images were compared. To test the dose calculation improvement after the MDT processed images, clinically approved head and neck planmore » with manual dental artifact correction was tested. Patient images were exported and processed with MDT and plan was recalculated with new MDT image without manual correction. Dose profiles near the metal artifacts were compared. Results: The MDT used in this study effectively reduced the metal artifact caused by beam hardening and scatter. The windmill around the metal drill was greatly improved with smooth rounded view. Difference of the mean HU in each density plug between reference and MDT images were less than 10 HU in most of the plugs. Dose difference between original plan and MDT images were minimal. Conclusion: Most metal artifact reduction methods were developed for diagnostic improvement purpose. Hence Hounsfield unit accuracy was not rigorously tested before. In our test, MDT effectively eliminated metal artifacts with good HU reproduciblity. However, it can introduce new mild artifacts so the MDT images should be checked with original images.« less

  5. Psycho-physiological effects of visual artifacts by stereoscopic display systems

    NASA Astrophysics Data System (ADS)

    Kim, Sanghyun; Yoshitake, Junki; Morikawa, Hiroyuki; Kawai, Takashi; Yamada, Osamu; Iguchi, Akihiko

    2011-03-01

    The methods available for delivering stereoscopic (3D) display using glasses can be classified as time-multiplexing and spatial-multiplexing. With both methods, intrinsic visual artifacts result from the generation of the 3D image pair on a flat panel display device. In the case of the time-multiplexing method, an observer perceives three artifacts: flicker, the Mach-Dvorak effect, and a phantom array. These only occur under certain conditions, with flicker appearing in any conditions, the Mach-Dvorak effect during smooth pursuit eye movements (SPM), and a phantom array during saccadic eye movements (saccade). With spatial-multiplexing, the artifacts are temporal-parallax (due to the interlaced video signal), binocular rivalry, and reduced spatial resolution. These artifacts are considered one of the major impediments to the safety and comfort of 3D display users. In this study, the implications of the artifacts for the safety and comfort are evaluated by examining the psychological changes they cause through subjective symptoms of fatigue and the depth sensation. Physiological changes are also measured as objective responses based on analysis of heart and brain activation by visual artifacts. Further, to understand the characteristics of each artifact and the combined effects of the artifacts, four experimental conditions are developed and tested. The results show that perception of artifacts differs according to the visual environment and the display method. Furthermore visual fatigue and the depth sensation are influenced by the individual characteristics of each artifact. Similarly, heart rate variability and regional cerebral oxygenation changes by perception of artifacts in conditions.

  6. [Quantitative Evaluation of Metal Artifacts on CT Images on the Basis of Statistics of Extremes].

    PubMed

    Kitaguchi, Shigetoshi; Imai, Kuniharu; Ueda, Suguru; Hashimoto, Naomi; Hattori, Shouta; Saika, Takahiro; Ono, Yoshifumi

    2016-05-01

    It is well-known that metal artifacts have a harmful effect on the image quality of computed tomography (CT) images. However, the physical property remains still unknown. In this study, we investigated the relationship between metal artifacts and tube currents using statistics of extremes. A commercially available phantom for measuring CT dose index 160 mm in diameter was prepared and a brass rod 13 mm in diameter was placed at the centerline of the phantom. This phantom was used as a target object to evaluate metal artifacts and was scanned using an area detector CT scanner with various tube currents under a constant tube voltage of 120 kV. Sixty parallel line segments with a length of 100 pixels were placed to cross metal artifacts on CT images and the largest difference between two adjacent CT values in each of 60 CT value profiles of these line segments was employed as a feature variable for measuring metal artifacts; these feature variables were analyzed on the basis of extreme value theory. The CT value variation induced by metal artifacts was statistically characterized by Gumbel distribution, which was one of the extreme value distributions; namely, metal artifacts have the same statistical characteristic as streak artifacts. Therefore, Gumbel evaluation method makes it possible to analyze not only streak artifacts but also metal artifacts. Furthermore, the location parameter in Gumbel distribution was shown to be in inverse proportion to the square root of a tube current. This result suggested that metal artifacts have the same dose dependence as image noises.

  7. An extension to artifact-free projection overlaps

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Lin, Jianyu, E-mail: jianyulin@hotmail.com

    2015-05-15

    Purpose: In multipinhole single photon emission computed tomography, the overlapping of projections has been used to increase sensitivity. Avoiding artifacts in the reconstructed image associated with projection overlaps (multiplexing) is a critical issue. In our previous report, two types of artifact-free projection overlaps, i.e., projection overlaps that do not lead to artifacts in the reconstructed image, were formally defined and proved, and were validated via simulations. In this work, a new proposition is introduced to extend the previously defined type-II artifact-free projection overlaps so that a broader range of artifact-free overlaps is accommodated. One practical purpose of the new extensionmore » is to design a baffle window multipinhole system with artifact-free projection overlaps. Methods: First, the extended type-II artifact-free overlap was theoretically defined and proved. The new proposition accommodates the situation where the extended type-II artifact-free projection overlaps can be produced with incorrectly reconstructed portions in the reconstructed image. Next, to validate the theory, the extended-type-II artifact-free overlaps were employed in designing the multiplexing multipinhole spiral orbit imaging systems with a baffle window. Numerical validations were performed via simulations, where the corresponding 1-pinhole nonmultiplexing reconstruction results were used as the benchmark for artifact-free reconstructions. The mean square error (MSE) was the metric used for comparisons of noise-free reconstructed images. Noisy reconstructions were also performed as part of the validations. Results: Simulation results show that for noise-free reconstructions, the MSEs of the reconstructed images of the artifact-free multiplexing systems are very similar to those of the corresponding 1-pinhole systems. No artifacts were observed in the reconstructed images. Therefore, the testing results for artifact-free multiplexing systems designed using the extended type-II artifact-free overlaps numerically validated the developed theory. Conclusions: First, the extension itself is of theoretical importance because it broadens the selection range for optimizing multiplexing multipinhole designs. Second, the extension has an immediate application: using a baffle window to design a special spiral orbit multipinhole imaging system with projection overlaps in the orbit axial direction. Such an artifact-free baffle window design makes it possible for us to image any axial portion of interest of a long object with projection overlaps to increase sensitivity.« less

  8. Physiological processes non-linearly affect electrophysiological recordings during transcranial electric stimulation.

    PubMed

    Noury, Nima; Hipp, Joerg F; Siegel, Markus

    2016-10-15

    Transcranial electric stimulation (tES) is a promising tool to non-invasively manipulate neuronal activity in the human brain. Several studies have shown behavioral effects of tES, but stimulation artifacts complicate the simultaneous investigation of neural activity with EEG or MEG. Here, we first show for EEG and MEG, that contrary to previous assumptions, artifacts do not simply reflect stimulation currents, but that heartbeat and respiration non-linearly modulate stimulation artifacts. These modulations occur irrespective of the stimulation frequency, i.e. during both transcranial alternating and direct current stimulations (tACS and tDCS). Second, we show that, although at first sight previously employed artifact rejection methods may seem to remove artifacts, data are still contaminated by non-linear stimulation artifacts. Because of their complex nature and dependence on the subjects' physiological state, these artifacts are prone to be mistaken as neural entrainment. In sum, our results uncover non-linear tES artifacts, show that current techniques fail to fully remove them, and pave the way for new artifact rejection methods. Copyright © 2016 Elsevier Inc. All rights reserved.

  9. WE-G-209-00: Identifying Image Artifacts, Their Causes, and How to Fix Them

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    NONE

    Digital radiography, CT, PET, and MR are complicated imaging modalities which are composed of many hardware and software components. These components work together in a highly coordinated chain of events with the intent to produce high quality images. Acquisition, processing and reconstruction of data must occur in a precise way for optimum image quality to be achieved. Any error or unexpected event in the entire process can produce unwanted pixel intensities in the final images which may contribute to visible image artifacts. The diagnostic imaging physicist is uniquely qualified to investigate and contribute to resolution of image artifacts. This coursemore » will teach the participant to identify common artifacts found clinically in digital radiography, CT, PET, and MR, to determine the causes of artifacts, and to make recommendations for how to resolve artifacts. Learning Objectives: Identify common artifacts found clinically in digital radiography, CT, PET and MR. Determine causes of various clinical artifacts from digital radiography, CT, PET and MR. Describe how to resolve various clinical artifacts from digital radiography, CT, PET and MR.« less

  10. Pictorial Review of Digital Radiography Artifacts.

    PubMed

    Walz-Flannigan, Alisa I; Brossoit, Kimberly J; Magnuson, Dayne J; Schueler, Beth A

    2018-01-01

    Visual familiarity with the variety of digital radiographic artifacts is needed to identify, resolve, or prevent image artifacts from creating issues with patient imaging. Because the mechanism for image creation is different between flat-panel detectors and computed radiography, the causes and appearances of some artifacts can be unique to these different modalities. Examples are provided of artifacts that were found on clinical images or during quality control testing with flat-panel detectors. The examples are meant to serve as learning tools for future identification and troubleshooting of artifacts and as a reminder for steps that can be taken for prevention. The examples of artifacts provided are classified according to their causal connection in the imaging chain, including an equipment defect as a result of an accident or mishandling, debris or gain calibration flaws, a problematic acquisition technique, signal transmission failures, and image processing issues. Specific artifacts include those that are due to flat-panel detector drops, backscatter, debris in the x-ray field during calibration, detector saturation or underexposure, or collimation detection errors, as well as a variety of artifacts that are processing induced. © RSNA, 2018.

  11. Reduction of metal artifacts from alloy hip prostheses in computer tomography.

    PubMed

    Wang, Fengdan; Xue, Huadan; Yang, Xianda; Han, Wei; Qi, Bing; Fan, Yu; Qian, Wenwei; Wu, Zhihong; Zhang, Yan; Jin, Zhengyu

    2014-01-01

    The objective of this study was to evaluate the feasibility of reducing artifacts from large metal implants with gemstone spectral imaging (GSI) and metal artifact reduction software (MARS). Twenty-three in-vivo cobalt-chromium-molybdenum alloy total hip prostheses were prospectively scanned by fast kV-switching GSI between 80 and 140 kVp. The computed tomography images were reconstructed with monochromatic energy and with/without MARS. Both subjective and objective measurements were performed to assess the severity of metal artifacts. Increasing photon energy was associated with reduced metal artifacts in GSI images (P < 0.001). Combination of GSI with MARS further diminished the metal artifacts (P < 0.001). Artifact reduction at 3 anatomical levels (femoral head, neck, and shaft) were evaluated, with data showing that GSI and MARS could reduce metal artifacts at all 3 levels (P = 0.011, P < 0.001, and P = 0.003, respectively). Nevertheless, in certain cases, GSI without MARS produced more realistic images for the clinical situation. Proper usage of GSI with/without MARS could reduce the computed tomography artifacts of large metal parts and improve the radiological evaluation of postarthroplasty patients.

  12. Reduction of irregular breathing artifacts in respiration-correlated CT images using a respiratory motion model.

    PubMed

    Hertanto, Agung; Zhang, Qinghui; Hu, Yu-Chi; Dzyubak, Oleksandr; Rimner, Andreas; Mageras, Gig S

    2012-06-01

    Respiration-correlated CT (RCCT) images produced with commonly used phase-based sorting of CT slices often exhibit discontinuity artifacts between CT slices, caused by cycle-to-cycle amplitude variations in respiration. Sorting based on the displacement of the respiratory signal yields slices at more consistent respiratory motion states and hence reduces artifacts, but missing image data (gaps) may occur. The authors report on the application of a respiratory motion model to produce an RCCT image set with reduced artifacts and without missing data. Input data consist of CT slices from a cine CT scan acquired while recording respiration by monitoring abdominal displacement. The model-based generation of RCCT images consists of four processing steps: (1) displacement-based sorting of CT slices to form volume images at 10 motion states over the cycle; (2) selection of a reference image without gaps and deformable registration between the reference image and each of the remaining images; (3) generation of the motion model by applying a principal component analysis to establish a relationship between displacement field and respiration signal at each motion state; (4) application of the motion model to deform the reference image into images at the 9 other motion states. Deformable image registration uses a modified fast free-form algorithm that excludes zero-intensity voxels, caused by missing data, from the image similarity term in the minimization function. In each iteration of the minimization, the displacement field in the gap regions is linearly interpolated from nearest neighbor nonzero intensity slices. Evaluation of the model-based RCCT examines three types of image sets: cine scans of a physical phantom programmed to move according to a patient respiratory signal, NURBS-based cardiac torso (NCAT) software phantom, and patient thoracic scans. Comparison in physical motion phantom shows that object distortion caused by variable motion amplitude in phase-based sorting is visibly reduced with model-based RCCT. Comparison of model-based RCCT to original NCAT images as ground truth shows best agreement at motion states whose displacement-sorted images have no missing slices, with mean and maximum discrepancies in lung of 1 and 3 mm, respectively. Larger discrepancies correlate with motion states having a larger number of missing slices in the displacement-sorted images. Artifacts in patient images at different motion states are also reduced. Comparison with displacement-sorted patient images as a ground truth shows that the model-based images closely reproduce the ground truth geometry at different motion states. Results in phantom and patient images indicate that the proposed method can produce RCCT image sets with reduced artifacts relative to phase-sorted images, without the gaps inherent in displacement-sorted images. The method requires a reference image at one motion state that has no missing data. Highly irregular breathing patterns can affect the method's performance, by introducing artifacts in the reference image (although reduced relative to phase-sorted images), or in decreased accuracy in the image prediction of motion states containing large regions of missing data. © 2012 American Association of Physicists in Medicine.

  13. POCS-based reconstruction of multiplexed sensitivity encoded MRI (POCSMUSE): a general algorithm for reducing motion-related artifacts

    PubMed Central

    Chu, Mei-Lan; Chang, Hing-Chiu; Chung, Hsiao-Wen; Truong, Trong-Kha; Bashir, Mustafa R.; Chen, Nan-kuei

    2014-01-01

    Purpose A projection onto convex sets reconstruction of multiplexed sensitivity encoded MRI (POCSMUSE) is developed to reduce motion-related artifacts, including respiration artifacts in abdominal imaging and aliasing artifacts in interleaved diffusion weighted imaging (DWI). Theory Images with reduced artifacts are reconstructed with an iterative POCS procedure that uses the coil sensitivity profile as a constraint. This method can be applied to data obtained with different pulse sequences and k-space trajectories. In addition, various constraints can be incorporated to stabilize the reconstruction of ill-conditioned matrices. Methods The POCSMUSE technique was applied to abdominal fast spin-echo imaging data, and its effectiveness in respiratory-triggered scans was evaluated. The POCSMUSE method was also applied to reduce aliasing artifacts due to shot-to-shot phase variations in interleaved DWI data corresponding to different k-space trajectories and matrix condition numbers. Results Experimental results show that the POCSMUSE technique can effectively reduce motion-related artifacts in data obtained with different pulse sequences, k-space trajectories and contrasts. Conclusion POCSMUSE is a general post-processing algorithm for reduction of motion-related artifacts. It is compatible with different pulse sequences, and can also be used to further reduce residual artifacts in data produced by existing motion artifact reduction methods. PMID:25394325

  14. Image quality analysis to reduce dental artifacts in head and neck imaging with dual-source computed tomography.

    PubMed

    Ketelsen, D; Werner, M K; Thomas, C; Tsiflikas, I; Koitschev, A; Reimann, A; Claussen, C D; Heuschmid, M

    2009-01-01

    Important oropharyngeal structures can be superimposed by metallic artifacts due to dental implants. The aim of this study was to compare the image quality of multiplanar reconstructions and an angulated spiral in dual-source computed tomography (DSCT) of the neck. Sixty-two patients were included for neck imaging with DSCT. MPRs from an axial dataset and an additional short spiral parallel to the mouth floor were acquired. Leading anatomical structures were then evaluated with respect to the extent to which they were affected by dental artifacts using a visual scale, ranging from 1 (least artifacts) to 4 (most artifacts). In MPR, 87.1 % of anatomical structures had significant artifacts (3.12 +/- 0.86), while in angulated slices leading anatomical structures of the oropharynx showed negligible artifacts (1.28 +/- 0.46). The diagnostic growth due to primarily angulated slices concerning artifact severity was significant (p < 0.01). MPRs are not capable of reducing dental artifacts sufficiently. In patients with dental artifacts overlying the anatomical structures of the oropharynx, an additional short angulated spiral parallel to the floor of the mouth is recommended and should be applied for daily routine. As a result of the static gantry design of DSCT, the use of a flexible head holder is essential.

  15. Discriminative Ocular Artifact Correction for Feature Learning in EEG Analysis.

    PubMed

    Xinyang Li; Cuntai Guan; Haihong Zhang; Kai Keng Ang

    2017-08-01

    Electrooculogram (EOG) artifact contamination is a common critical issue in general electroencephalogram (EEG) studies as well as in brain-computer interface (BCI) research. It is especially challenging when dedicated EOG channels are unavailable or when there are very few EEG channels available for independent component analysis based ocular artifact removal. It is even more challenging to avoid loss of the signal of interest during the artifact correction process, where the signal of interest can be multiple magnitudes weaker than the artifact. To address these issues, we propose a novel discriminative ocular artifact correction approach for feature learning in EEG analysis. Without extra ocular movement measurements, the artifact is extracted from raw EEG data, which is totally automatic and requires no visual inspection of artifacts. Then, artifact correction is optimized jointly with feature extraction by maximizing oscillatory correlations between trials from the same class and minimizing them between trials from different classes. We evaluate this approach on a real-world EEG dataset comprising 68 subjects performing cognitive tasks. The results showed that the approach is capable of not only suppressing the artifact components but also improving the discriminative power of a classifier with statistical significance. We also demonstrate that the proposed method addresses the confounding issues induced by ocular movements in cognitive EEG study.

  16. Production of haploid plantlets in anther cultures of Albizzia lebbeck L.

    PubMed

    Gharyal, P K; Rashid, A; Maheshwari, S C

    1983-12-01

    Anthers of Albizzia lebbeck on B5 medium (BM) supplemented with kinetin (2 mg/l) and 2, 4-D (0.5 mg/l) showed callus initiation from microspores. Differentiation of embryoids and shoots was obtained on BM + BAP (1 mg/l) + IAA (0.5 mg/l) and of roots on BM. Root tip squashes of the regenerated plantlets showed the haploid chromosome number (n=13), confirming the microspore origin of the regenerants.

  17. Lectures in Complex Systems (1991)

    DTIC Science & Technology

    1992-08-05

    momentum term and the line required to reach termination criterion. Fig- ture 2 shows this function for the case where Lcarninglate = 1.0. Peeling and...Soc. Am., in press. 17. Peeling , S. M., and R. K. Moore. "Isolated Digit Recognition Experiments using the Multi-Layer Perceptron." Speech Comm. 7...surfaces which form the focal conic defects seen in Figure 1. These are the cyclides of Dupin. The surfaces go from banana -shaped to squashed doughnuts to

  18. Metabolizable Energy Intakes and Nitrogen Balance During Saturation Diving

    DTIC Science & Technology

    1993-02-01

    TURKEY BREAST-NO SKIN-ROAST 136.1 GMS GRAVY-CHICKEN 119.0 GMS NOODLES -EGG 160.0 GMS ZUCCHINI SQUASH-FROZEN-BOIL 223.0 GMS CRANBERRY SAUCE 277.0 GMS TEA... INSTANT 474.0 GMS EVENING SNACK ICE CREAM 222.0 GMS 12 0v WIRT otZ" O’ -WIRT J5, V ~6 6 d4 C o :_ C’s) W sC N0 %W Wr W Ch V

  19. Parasitism and predation on sentinel egg masses of the brown marmorated stink bug (Hemiptera: Pentatomidae) in three vegetable crops: Importance of dissections for evaluating the impact of native parasitoids on an exotic pest

    USDA-ARS?s Scientific Manuscript database

    We conducted a survey to examine parasitism, predation and the species composition of native parasitoids attacking sentinel egg masses of the invasive pest, the brown marmorated stink bug (BMSB), Halyomorpha halys (Stål), in bell pepper, squash, and tomato. A two-year survey was conducted for each c...

  20. Metallic artifact in MRI after removal of orthopedic implants.

    PubMed

    Bagheri, Mohammad Hadi; Hosseini, Mehrdad Mohammad; Emami, Mohammad Jafar; Foroughi, Amin Aiboulhassani

    2012-03-01

    The aim of the present study was to evaluate the metallic artifacts in MRI of the orthopedic patients after removal of metallic implants. From March to August 2009, 40 orthopedic patients operated for removal of orthopedic metallic implants were studied by post-operative MRI from the site of removal of implants. A grading scale of 0-3 was assigned for artifact in MR images whereby 0 was considered no artifact; and I-III were considered mild, moderate, and severe metallic artifacts, respectively. These grading records were correlated with other variables including the type, size, number, and composition of metallic devices; and the site and duration of orthopedic devices stay in the body. Metallic susceptibly artifacts were detected in MRI of 18 of 40 cases (45%). Screws and pins in removed hardware were the most important factors for causing artifacts in MRI. The artifacts were found more frequently in the patients who had more screws and pins in the removed implants. Gender, age, site of implantation of the device, length of the hardware, composition of the metallic implants (stainless steel versus titanium), and duration of implantation of the hardware exerted no effect in producing metallic artifacts after removal of implants. Short TE sequences of MRI (such as T1 weighted) showed fewer artifacts. Susceptibility of metallic artifacts is a frequent phenomenon in MRI of patients upon removal of metallic orthopedic implants. Copyright © 2010 Elsevier Ireland Ltd. All rights reserved.

  1. [Joint correction for motion artifacts and off-resonance artifacts in multi-shot diffusion magnetic resonance imaging].

    PubMed

    Wu, Wenchuan; Fang, Sheng; Guo, Hua

    2014-06-01

    Aiming at motion artifacts and off-resonance artifacts in multi-shot diffusion magnetic resonance imaging (MRI), we proposed a joint correction method in this paper to correct the two kinds of artifacts simultaneously without additional acquisition of navigation data and field map. We utilized the proposed method using multi-shot variable density spiral sequence to acquire MRI data and used auto-focusing technique for image deblurring. We also used direct method or iterative method to correct motion induced phase errors in the process of deblurring. In vivo MRI experiments demonstrated that the proposed method could effectively suppress motion artifacts and off-resonance artifacts and achieve images with fine structures. In addition, the scan time was not increased in applying the proposed method.

  2. Landsat TM memory effect characterization and correction

    USGS Publications Warehouse

    Helder, D.; Boncyk, W.; Morfitt, R.

    1997-01-01

    Before radiometric calibration of Landsat Thematic Mapper (TM) data can be done accurately, it is necessary to minimize the effects of artifacts present in the data that originate in the instrument's signal processing path. These artifacts have been observed in downlinked image data since shortly after launch of Landsat 4 and 5. However, no comprehensive work has been done to characterize all the artifacts and develop methods for their correction. In this paper, the most problematic artifact is discussed: memory effect (ME). Characterization of this artifact is presented, including the parameters necessary for its correction. In addition, a correction algorithm is described that removes the artifact from TM imagery. It will be shown that this artifact causes significant radiometry errors, but the effect can be removed in a straightforward manner.

  3. Independent component analysis for cochlear implant artifacts attenuation from electrically evoked auditory steady-state response measurements

    NASA Astrophysics Data System (ADS)

    Deprez, Hanne; Gransier, Robin; Hofmann, Michael; van Wieringen, Astrid; Wouters, Jan; Moonen, Marc

    2018-02-01

    Objective. Electrically evoked auditory steady-state responses (EASSRs) are potentially useful for objective cochlear implant (CI) fitting and follow-up of the auditory maturation in infants and children with a CI. EASSRs are recorded in the electro-encephalogram (EEG) in response to electrical stimulation with continuous pulse trains, and are distorted by significant CI artifacts related to this electrical stimulation. The aim of this study is to evaluate a CI artifacts attenuation method based on independent component analysis (ICA) for three EASSR datasets. Approach. ICA has often been used to remove CI artifacts from the EEG to record transient auditory responses, such as cortical evoked auditory potentials. Independent components (ICs) corresponding to CI artifacts are then often manually identified. In this study, an ICA based CI artifacts attenuation method was developed and evaluated for EASSR measurements with varying CI artifacts and EASSR characteristics. Artifactual ICs were automatically identified based on their spectrum. Main results. For 40 Hz amplitude modulation (AM) stimulation at comfort level, in high SNR recordings, ICA succeeded in removing CI artifacts from all recording channels, without distorting the EASSR. For lower SNR recordings, with 40 Hz AM stimulation at lower levels, or 90 Hz AM stimulation, ICA either distorted the EASSR or could not remove all CI artifacts in most subjects, except for two of the seven subjects tested with low level 40 Hz AM stimulation. Noise levels were reduced after ICA was applied, and up to 29 ICs were rejected, suggesting poor ICA separation quality. Significance. We hypothesize that ICA is capable of separating CI artifacts and EASSR in case the contralateral hemisphere is EASSR dominated. For small EASSRs or large CI artifact amplitudes, ICA separation quality is insufficient to ensure complete CI artifacts attenuation without EASSR distortion.

  4. Reconstruction artifacts in VRX CT scanner images

    NASA Astrophysics Data System (ADS)

    Rendon, David A.; DiBianca, Frank A.; Keyes, Gary S.

    2008-03-01

    Variable Resolution X-ray (VRX) CT scanners allow imaging of different sized anatomy at the same level of detail using the same device. This is achieved by tilting the x-ray detectors so that the projected size of the detecting elements is varied to produce reconstructions of smaller fields of view with higher spatial resolution. As with regular CT scanners, the images obtained with VRX scanners are affected by different kinds of artifacts of various origins. This work studies some of these artifacts and the impact that the VRX effect has on them. For this, computational models of single-arm single-slice VRX scanners are used to produce images with artifacts commonly found in routine use. These images and artifacts are produced using our VRX CT scanner simulator, which allows us to isolate the system parameters that have a greater effect on the artifacts. A study of the behavior of the artifacts at varying VRX opening angles is presented for scanners implemented using two different detectors. The results show that, although varying the VRX angle will have an effect on the severity of each of the artifacts studied, for some of these artifacts the effect of other factors (such as the distribution of the detector cells and the position of the phantom in the reconstruction grid) is overwhelmingly more significant. This is shown to be the case for streak artifacts produced by thin metallic objects. For some artifacts related to beam hardening, their severity was found to decrease along with the VRX angle. These observations allow us to infer that in regular use the effect of the VRX angle artifacts similar to the ones studied here will not be noticeable as it will be overshadowed by parameters that cannot be easily controlled outside of a computational model.

  5. Understanding and improving optical coherence tomography imaging depth in selective laser sintering nylon 12 parts and powder

    NASA Astrophysics Data System (ADS)

    Lewis, Adam D.; Katta, Nitesh; McElroy, Austin; Milner, Thomas; Fish, Scott; Beaman, Joseph

    2018-04-01

    Optical coherence tomography (OCT) has shown promise as a process sensor in selective laser sintering (SLS) due to its ability to yield depth-resolved data not attainable with conventional sensors. However, OCT images of nylon 12 powder and nylon 12 components fabricated via SLS contain artifacts that have not been previously investigated in the literature. A better understanding of light interactions with SLS powder and components is foundational for further research expanding the utility of OCT imaging in SLS and other additive manufacturing (AM) sensing applications. Specifically, in this work, nylon powder and sintered parts were imaged in air and in an index matching liquid. Subsequent image analysis revealed the cause of "signal-tail" OCT image artifacts to be a combination of both inter and intraparticle multiple-scattering and reflections. Then, the OCT imaging depth of nylon 12 powder and the contrast-to-noise ratio of a sintered part were improved through the use of an index matching liquid. Finally, polymer crystals were identified as the main source of intraparticle scattering in nylon 12 powder. Implications of these results on future research utilizing OCT in SLS are also given.

  6. Compensation of optical heterogeneity-induced artifacts in fluorescence molecular tomography: theory and in vivo validation

    NASA Astrophysics Data System (ADS)

    Mohajerani, Pouyan; Adibi, Ali; Kempner, Joshua; Yared, Wael

    2009-05-01

    We present a method for reduction of image artifacts induced by the optical heterogeneities of tissue in fluorescence molecular tomography (FMT) through identification and compensation of image regions that evidence propagation of emission light through thin or low-absorption tunnels in tissue. The light tunneled as such contributes to the emission image as spurious components that might substantially overwhelm the desirable fluorescence emanating from the targeted lesions. The proposed method makes use of the strong spatial correlation between the emission and excitation images to estimate the tunneled components and yield a residual image that mainly consists of the signal due to the desirable fluorescence. This residual image is further refined using a coincidence mask constructed for each excitation-emission image pair. The coincidence mask is essentially a map of the ``hot spots'' that occur in both excitation and emission images, as such areas are often associated with tunneled emission. In vivo studies are performed on a human colon adenocarcinoma xenograft tumor model with subcutaneous tumors and a murine breast adenocarcinoma model with aggressive tumor cell metastasis and growth in the lungs. Results demonstrate significant improvements in the reconstructions achieved by the proposed method.

  7. IQ variations across time, race, and nationality: an artifact of differences in literacy skills.

    PubMed

    Marks, David F

    2010-06-01

    A body of data on IQ collected over 50 years has revealed that average population IQ varies across time, race, and nationality. An explanation for these differences may be that intelligence test performance requires literacy skills not present in all people to the same extent. In eight analyses, population mean full scale IQ and literacy scores yielded correlations ranging from .79 to .99. In cohort studies, significantly larger improvements in IQ occurred in the lower half of the IQ distribution, affecting the distribution variance and skewness in the predicted manner. In addition, three Verbal subscales on the WAIS show the largest Flynn effect sizes and all four Verbal subscales are among those showing the highest racial IQ differences. This pattern of findings supports the hypothesis that both secular and racial differences in intelligence test scores have an environmental explanation: secular and racial differences in IQ are an artifact of variation in literacy skills. These findings suggest that racial IQ distributions will converge if opportunities are equalized for different population groups to achieve the same high level of literacy skills. Social justice requires more effective implementation of policies and programs designed to eliminate inequities in IQ and literacy.

  8. The Persistence of Mode 1 Technology in the Korean Late Paleolithic

    PubMed Central

    Lee, Hyeong Woo

    2013-01-01

    Ssangjungri (SJ), an open-air site with several Paleolithic horizons, was recently discovered in South Korea. Most of the identified artifacts are simple core and flake tools that indicate an expedient knapping strategy. Bifacially worked core tools, which might be considered non-classic bifaces, also have been found. The prolific horizons at the site were dated by accelerator mass spectrometry (AMS) to about 30 kya. Another newly discovered Paleolithic open-air site, Jeungsan (JS), shows a homogeneous lithic pattern during this period. The dominated artifact types and usage of raw materials are similar in character to those from SJ, although JS yielded a larger number of simple core and flake tools with non-classic bifaces. Chronometric analysis by AMS and optically stimulated luminescence (OSL) indicate that the prime stratigraphic levels at JS also date to approximately 30 kya, and the numerous conjoining pieces indicate that the layers were not seriously affected by post-depositional processes. Thus, it can be confirmed that simple core and flake tools were produced at temporally and culturally independent sites until after 30 kya, supporting the hypothesis of a wide and persistent use of simple technology into the Late Pleistocene. PMID:23724113

  9. Wavelet-based edge correlation incorporated iterative reconstruction for undersampled MRI.

    PubMed

    Hu, Changwei; Qu, Xiaobo; Guo, Di; Bao, Lijun; Chen, Zhong

    2011-09-01

    Undersampling k-space is an effective way to decrease acquisition time for MRI. However, aliasing artifacts introduced by undersampling may blur the edges of magnetic resonance images, which often contain important information for clinical diagnosis. Moreover, k-space data is often contaminated by the noise signals of unknown intensity. To better preserve the edge features while suppressing the aliasing artifacts and noises, we present a new wavelet-based algorithm for undersampled MRI reconstruction. The algorithm solves the image reconstruction as a standard optimization problem including a ℓ(2) data fidelity term and ℓ(1) sparsity regularization term. Rather than manually setting the regularization parameter for the ℓ(1) term, which is directly related to the threshold, an automatic estimated threshold adaptive to noise intensity is introduced in our proposed algorithm. In addition, a prior matrix based on edge correlation in wavelet domain is incorporated into the regularization term. Compared with nonlinear conjugate gradient descent algorithm, iterative shrinkage/thresholding algorithm, fast iterative soft-thresholding algorithm and the iterative thresholding algorithm using exponentially decreasing threshold, the proposed algorithm yields reconstructions with better edge recovery and noise suppression. Copyright © 2011 Elsevier Inc. All rights reserved.

  10. A Novel Method for Characterizing Beam Hardening Artifacts in Cone-beam Computed Tomographic Images.

    PubMed

    Fox, Aaron; Basrani, Bettina; Kishen, Anil; Lam, Ernest W N

    2018-05-01

    The beam hardening (BH) artifact produced by root filling materials in cone-beam computed tomographic (CBCT) images is influenced by their radiologic K absorption edge values. The purpose of this study was to describe a novel technique to characterize BH artifacts in CBCT images produced by 3 root canal filling materials and to evaluate the effects of a zirconium (Zr)-based root filling material with a lower K edge (17.99 keV) on the production of BH artifacts. The palatal root canals of 3 phantom model teeth were prepared and root filled with gutta-percha (GP), a Zr root filling material, and calcium hydroxide paste. Each phantom tooth was individually imaged using the CS 9000 CBCT unit (Carestream, Atlanta, GA). The "light" and "dark" components of the BH artifacts were quantified separately using ImageJ software (National Institutes of Health, Bethesda, MD) in 3 regions of the root. Mixed-design analysis of variance was used to evaluate differences in the artifact area for the light and dark elements of the BH artifacts. A statistically significant difference in the area of the dark portion of the BH artifact was found between all fill materials and in all regions of the phantom tooth root (P < .05). GP generated a significantly greater dark but not light artifact area compared with Zr (P < .05). Moreover, statistically significant differences between the areas of both the light and dark artifacts were observed within all regions of the tooth root, with the greatest artifact being generated in the coronal third of the root (P < .001). Root canal filling materials with lower K edge material properties reduce BH artifacts along the entire length of the root canal and reduce the contribution of the dark artifact. Copyright © 2018 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  11. Artifacts as Authoritative Actors in Educational Reform

    ERIC Educational Resources Information Center

    März, Virginie; Kelchtermans, Geert; Vermeir, Karen

    2017-01-01

    Educational reforms are often translated in and implemented through artifacts. Although research has frequently treated artifacts as merely functional, more recent work acknowledges the complex relationship between material artifacts and human/organizational behavior. This article aims at disentangling this relationship in order to deepen our…

  12. Radiographic artifacts.

    PubMed

    Kirberger, R M; Roos, C J

    1995-06-01

    Radiographic artifacts commonly occur, particularly with hand processing. The artifacts may originate between the X-ray tube and the cassette as extraneous material on the patient or contamination of positioning aids, or result from debris within the cassette, or damage to, or staining of the screens. These artifacts are white to grey, may have a constant or different position on follow-up radiographs, and their size and shape are reflective of the inciting cause. A number of artifacts may occur in the darkroom during handling, developing, fixing and drying of the film. White to shiny artifacts are caused by the contamination of films with fixer, inability of developer to reach parts of the film or loss of emulsion from the developed film. Black artifacts result from improper handling or storage of films, resulting in exposure to light, or from pressure marks or static electricity discharges. Dropped levels of hand-processing chemicals may result in a variety of tide-marks on films. Most radiographic artifacts can be prevented by proper storage and handling of films and by optimal darkroom technique.

  13. A Novel Stimulus Artifact Removal Technique for High-Rate Electrical Stimulation

    PubMed Central

    Heffer, Leon F; Fallon, James B

    2008-01-01

    Electrical stimulus artifact corrupting electrophysiological recordings often make the subsequent analysis of the underlying neural response difficult. This is particularly evident when investigating short-latency neural activity in response to high-rate electrical stimulation. We developed and evaluated an off-line technique for the removal of stimulus artifact from electrophysiological recordings. Pulsatile electrical stimulation was presented at rates of up to 5000 pulses/s during extracellular recordings of guinea pig auditory nerve fibers. Stimulus artifact was removed by replacing the sample points at each stimulus artifact event with values interpolated along a straight line, computed from neighbouring sample points. This technique required only that artifact events be identifiable and that the artifact duration remained less than both the inter-stimulus interval and the time course of the action potential. We have demonstrated that this computationally efficient sample-and-interpolate technique removes the stimulus artifact with minimal distortion of the action potential waveform. We suggest that this technique may have potential applications in a range of electrophysiological recording systems. PMID:18339428

  14. WE-G-209-03: PET

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Kemp, B.

    2016-06-15

    Digital radiography, CT, PET, and MR are complicated imaging modalities which are composed of many hardware and software components. These components work together in a highly coordinated chain of events with the intent to produce high quality images. Acquisition, processing and reconstruction of data must occur in a precise way for optimum image quality to be achieved. Any error or unexpected event in the entire process can produce unwanted pixel intensities in the final images which may contribute to visible image artifacts. The diagnostic imaging physicist is uniquely qualified to investigate and contribute to resolution of image artifacts. This coursemore » will teach the participant to identify common artifacts found clinically in digital radiography, CT, PET, and MR, to determine the causes of artifacts, and to make recommendations for how to resolve artifacts. Learning Objectives: Identify common artifacts found clinically in digital radiography, CT, PET and MR. Determine causes of various clinical artifacts from digital radiography, CT, PET and MR. Describe how to resolve various clinical artifacts from digital radiography, CT, PET and MR.« less

  15. WE-G-209-02: CT

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Kofler, J.

    2016-06-15

    Digital radiography, CT, PET, and MR are complicated imaging modalities which are composed of many hardware and software components. These components work together in a highly coordinated chain of events with the intent to produce high quality images. Acquisition, processing and reconstruction of data must occur in a precise way for optimum image quality to be achieved. Any error or unexpected event in the entire process can produce unwanted pixel intensities in the final images which may contribute to visible image artifacts. The diagnostic imaging physicist is uniquely qualified to investigate and contribute to resolution of image artifacts. This coursemore » will teach the participant to identify common artifacts found clinically in digital radiography, CT, PET, and MR, to determine the causes of artifacts, and to make recommendations for how to resolve artifacts. Learning Objectives: Identify common artifacts found clinically in digital radiography, CT, PET and MR. Determine causes of various clinical artifacts from digital radiography, CT, PET and MR. Describe how to resolve various clinical artifacts from digital radiography, CT, PET and MR.« less

  16. WE-G-209-04: MRI

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Pooley, R.

    2016-06-15

    Digital radiography, CT, PET, and MR are complicated imaging modalities which are composed of many hardware and software components. These components work together in a highly coordinated chain of events with the intent to produce high quality images. Acquisition, processing and reconstruction of data must occur in a precise way for optimum image quality to be achieved. Any error or unexpected event in the entire process can produce unwanted pixel intensities in the final images which may contribute to visible image artifacts. The diagnostic imaging physicist is uniquely qualified to investigate and contribute to resolution of image artifacts. This coursemore » will teach the participant to identify common artifacts found clinically in digital radiography, CT, PET, and MR, to determine the causes of artifacts, and to make recommendations for how to resolve artifacts. Learning Objectives: Identify common artifacts found clinically in digital radiography, CT, PET and MR. Determine causes of various clinical artifacts from digital radiography, CT, PET and MR. Describe how to resolve various clinical artifacts from digital radiography, CT, PET and MR.« less

  17. Signal processing methods for reducing artifacts in microelectrode brain recordings caused by functional electrical stimulation

    NASA Astrophysics Data System (ADS)

    Young, D.; Willett, F.; Memberg, W. D.; Murphy, B.; Walter, B.; Sweet, J.; Miller, J.; Hochberg, L. R.; Kirsch, R. F.; Ajiboye, A. B.

    2018-04-01

    Objective. Functional electrical stimulation (FES) is a promising technology for restoring movement to paralyzed limbs. Intracortical brain-computer interfaces (iBCIs) have enabled intuitive control over virtual and robotic movements, and more recently over upper extremity FES neuroprostheses. However, electrical stimulation of muscles creates artifacts in intracortical microelectrode recordings that could degrade iBCI performance. Here, we investigate methods for reducing the cortically recorded artifacts that result from peripheral electrical stimulation. Approach. One participant in the BrainGate2 pilot clinical trial had two intracortical microelectrode arrays placed in the motor cortex, and thirty-six stimulating intramuscular electrodes placed in the muscles of the contralateral limb. We characterized intracortically recorded electrical artifacts during both intramuscular and surface stimulation. We compared the performance of three artifact reduction methods: blanking, common average reference (CAR) and linear regression reference (LRR), which creates channel-specific reference signals, composed of weighted sums of other channels. Main results. Electrical artifacts resulting from surface stimulation were 175  ×  larger than baseline neural recordings (which were 110 µV peak-to-peak), while intramuscular stimulation artifacts were only 4  ×  larger. The artifact waveforms were highly consistent across electrodes within each array. Application of LRR reduced artifact magnitudes to less than 10 µV and largely preserved the original neural feature values used for decoding. Unmitigated stimulation artifacts decreased iBCI decoding performance, but performance was almost completely recovered using LRR, which outperformed CAR and blanking and extracted useful neural information during stimulation artifact periods. Significance. The LRR method was effective at reducing electrical artifacts resulting from both intramuscular and surface FES, and almost completely restored iBCI decoding performance (>90% recovery for surface stimulation and full recovery for intramuscular stimulation). The results demonstrate that FES-induced artifacts can be easily mitigated in FES  +  iBCI systems by using LRR for artifact reduction, and suggest that the LRR method may also be useful in other noise reduction applications.

  18. Fluoroscopy-Guided Percutaneous Vertebral Body Biopsy Using a Novel Drill-Powered Device: Technical Case Series

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Wallace, Adam N., E-mail: wallacea@mir.wustl.edu; Pacheco, Rafael A., E-mail: pachecor@mir.wustl.edu; Tomasian, Anderanik, E-mail: tomasiana@mir.wustl.edu

    2016-02-15

    BackgroundA novel coaxial biopsy system powered by a handheld drill has recently been introduced for percutaneous bone biopsy. This technical note describes our initial experience performing fluoroscopy-guided vertebral body biopsies with this system, compares the yield of drill-assisted biopsy specimens with those obtained using a manual technique, and assesses the histologic adequacy of specimens obtained with drill assistance.MethodsMedical records of all single-level, fluoroscopy-guided vertebral body biopsies were reviewed. Procedural complications were documented according to the Society of Interventional Radiology classification. The total length of bone core obtained from drill-assisted biopsies was compared with that of matched manual biopsies. Pathology reportsmore » were reviewed to determine the histologic adequacy of specimens obtained with drill assistance.ResultsTwenty eight drill-assisted percutaneous vertebral body biopsies met study inclusion criteria. No acute complications were reported. Of the 86 % (24/28) of patients with clinical follow-up, no delayed complications were reported (median follow-up, 28 weeks; range 5–115 weeks). The median total length of bone core obtained from drill-assisted biopsies was 28 mm (range 8–120 mm). This was longer than that obtained from manual biopsies (median, 20 mm; range 5–45 mm; P = 0.03). Crush artifact was present in 11 % (3/28) of drill-assisted biopsy specimens, which in one case (3.6 %; 1/28) precluded definitive diagnosis.ConclusionsA drill-assisted, coaxial biopsy system can be used to safely obtain vertebral body core specimens under fluoroscopic guidance. The higher bone core yield obtained with drill assistance may be offset by the presence of crush artifact.« less

  19. Direct dating of Neanderthal remains from the site of Vindija Cave and implications for the Middle to Upper Paleolithic transition.

    PubMed

    Devièse, Thibaut; Karavanić, Ivor; Comeskey, Daniel; Kubiak, Cara; Korlević, Petra; Hajdinjak, Mateja; Radović, Siniša; Procopio, Noemi; Buckley, Michael; Pääbo, Svante; Higham, Tom

    2017-10-03

    Previous dating of the Vi-207 and Vi-208 Neanderthal remains from Vindija Cave (Croatia) led to the suggestion that Neanderthals survived there as recently as 28,000-29,000 B.P. Subsequent dating yielded older dates, interpreted as ages of at least ∼32,500 B.P. We have redated these same specimens using an approach based on the extraction of the amino acid hydroxyproline, using preparative high-performance liquid chromatography (Prep-HPLC). This method is more efficient in eliminating modern contamination in the bone collagen. The revised dates are older than 40,000 B.P., suggesting the Vindija Neanderthals did not live more recently than others across Europe, and probably predate the arrival of anatomically modern humans in Eastern Europe. We applied zooarchaeology by mass spectrometry (ZooMS) to find additional hominin remains. We identified one bone that is Neanderthal, based on its mitochondrial DNA, and dated it directly to 46,200 ± 1,500 B.P. We also attempted to date six early Upper Paleolithic bone points from stratigraphic units G 1 , Fd/d+G 1 and Fd/d, Fd. One bone artifact gave a date of 29,500 ± 400 B.P., while the remainder yielded no collagen. We additionally dated animal bone samples from units G 1 and G 1 -G 3 These dates suggest a co-occurrence of early Upper Paleolithic osseous artifacts, particularly split-based points, alongside the remains of Neanderthals is a result of postdepositional mixing, rather than an association between the two groups, although more work is required to show this definitively.

  20. Space-time encoding for high frame rate ultrasound imaging.

    PubMed

    Misaridis, Thanassis X; Jensen, Jørgen A

    2002-05-01

    Frame rate in ultrasound imaging can be dramatically increased by using sparse synthetic transmit aperture (STA) beamforming techniques. The two main drawbacks of the method are the low signal-to-noise ratio (SNR) and the motion artifacts, that degrade the image quality. In this paper we propose a spatio-temporal encoding for STA imaging based on simultaneous transmission of two quasi-orthogonal tapered linear FM signals. The excitation signals are an up- and a down-chirp with frequency division and a cross-talk of -55 dB. The received signals are first cross-correlated with the appropriate code, then spatially decoded and finally beamformed for each code, yielding two images per emission. The spatial encoding is a Hadamard encoding previously suggested by Chiao et al. [in: Proceedings of the IEEE Ultrasonics Symposium, 1997, p. 1679]. The Hadamard matrix has half the size of the transmit element groups, due to the orthogonality of the temporal encoded wavefronts. Thus, with this method, the frame rate is doubled compared to previous systems. Another advantage is the utilization of temporal codes which are more robust to attenuation. With the proposed technique it is possible to obtain images dynamically focused in both transmit and receive with only two firings. This reduces the problem of motion artifacts. The method has been tested with extensive simulations using Field II. Resolution and SNR are compared with uncoded STA imaging and conventional phased-array imaging. The range resolution remains the same for coded STA imaging with four emissions and is slightly degraded for STA imaging with two emissions due to the -55 dB cross-talk between the signals. The additional proposed temporal encoding adds more than 15 dB on the SNR gain, yielding a SNR at the same order as in phased-array imaging.

  1. High Efficiency Multi-shot Interleaved Spiral-In/Out Acquisition for High Resolution BOLD fMRI

    PubMed Central

    Jung, Youngkyoo; Samsonov, Alexey A.; Liu, Thomas T.; Buracas, Giedrius T.

    2012-01-01

    Growing demand for high spatial resolution BOLD functional MRI faces a challenge of the spatial resolution vs. coverage or temporal resolution tradeoff, which can be addressed by methods that afford increased acquisition efficiency. Spiral acquisition trajectories have been shown to be superior to currently prevalent echo-planar imaging in terms of acquisition efficiency, and high spatial resolution can be achieved by employing multiple-shot spiral acquisition. The interleaved spiral in-out trajectory is preferred over spiral-in due to increased BOLD signal CNR and higher acquisition efficiency than that of spiral-out or non-interleaved spiral in/out trajectories (1), but to date applicability of the multi-shot interleaved spiral in-out for high spatial resolution imaging has not been studied. Herein we propose multi-shot interleaved spiral in-out acquisition and investigate its applicability for high spatial resolution BOLD fMRI. Images reconstructed from interleaved spiral-in and -out trajectories possess artifacts caused by differences in T2* decay, off-resonance and k-space errors associated with the two trajectories. We analyze the associated errors and demonstrate that application of conjugate phase reconstruction and spectral filtering can substantially mitigate these image artifacts. After applying these processing steps, the multishot interleaved spiral in-out pulse sequence yields high BOLD CNR images at in-plane resolution below 1x1 mm while preserving acceptable temporal resolution (4 s) and brain coverage (15 slices of 2 mm thickness). Moreover, this method yields sufficient BOLD CNR at 1.5 mm isotropic resolution for detection of activation in hippocampus associated with cognitive tasks (Stern memory task). The multi-shot interleaved spiral in-out acquisition is a promising technique for high spatial resolution BOLD fMRI applications. PMID:23023395

  2. Potential artifacts associated with historical preparation of joint compound samples and reported airborne asbestos concentrations.

    PubMed

    Brorby, G P; Sheehan, P J; Berman, D W; Bogen, K T; Holm, S E

    2011-05-01

    Airborne samples collected in the 1970s for drywall workers using asbestos-containing joint compounds were likely prepared and analyzed according to National Institute of Occupational Safety and Health Method P&CAM 239, the historical precursor to current Method 7400. Experimentation with a re-created, chrysotile-containing, carbonate-based joint compound suggested that analysis following sample preparation by the historical vs. current method produces different fiber counts, likely because of an interaction between the different clearing and mounting chemicals used and the carbonate-based joint compound matrix. Differences were also observed during analysis using Method 7402, depending on whether acetic acid/dimethylformamide or acetone was used during preparation to collapse the filter. Specifically, air samples of sanded chrysotile-containing joint compound prepared by the historical method yielded fiber counts significantly greater (average of 1.7-fold, 95% confidence interval: 1.5- to 2.0-fold) than those obtained by the current method. In addition, air samples prepared by Method 7402 using acetic acid/dimethylformamide yielded fiber counts that were greater (2.8-fold, 95% confidence interval: 2.5- to 3.2-fold) than those prepared by this method using acetone. These results indicated (1) there is an interaction between Method P&CAM 239 preparation chemicals and the carbonate-based joint compound matrix that reveals fibers that were previously bound in the matrix, and (2) the same appeared to be true for Method 7402 preparation chemicals acetic acid/dimethylformamide. This difference in fiber counts is the opposite of what has been reported historically for samples of relatively pure chrysotile dusts prepared using the same chemicals. This preparation artifact should be considered when interpreting historical air samples for drywall workers prepared by Method P&CAM 239. Copyright © 2011 JOEH, LLC

  3. Direct dating of Neanderthal remains from the site of Vindija Cave and implications for the Middle to Upper Paleolithic transition

    PubMed Central

    Karavanić, Ivor; Comeskey, Daniel; Kubiak, Cara; Korlević, Petra; Hajdinjak, Mateja; Radović, Siniša; Procopio, Noemi; Buckley, Michael; Pääbo, Svante; Higham, Tom

    2017-01-01

    Previous dating of the Vi-207 and Vi-208 Neanderthal remains from Vindija Cave (Croatia) led to the suggestion that Neanderthals survived there as recently as 28,000–29,000 B.P. Subsequent dating yielded older dates, interpreted as ages of at least ∼32,500 B.P. We have redated these same specimens using an approach based on the extraction of the amino acid hydroxyproline, using preparative high-performance liquid chromatography (Prep-HPLC). This method is more efficient in eliminating modern contamination in the bone collagen. The revised dates are older than 40,000 B.P., suggesting the Vindija Neanderthals did not live more recently than others across Europe, and probably predate the arrival of anatomically modern humans in Eastern Europe. We applied zooarchaeology by mass spectrometry (ZooMS) to find additional hominin remains. We identified one bone that is Neanderthal, based on its mitochondrial DNA, and dated it directly to 46,200 ± 1,500 B.P. We also attempted to date six early Upper Paleolithic bone points from stratigraphic units G1, Fd/d+G1 and Fd/d, Fd. One bone artifact gave a date of 29,500 ± 400 B.P., while the remainder yielded no collagen. We additionally dated animal bone samples from units G1 and G1–G3. These dates suggest a co-occurrence of early Upper Paleolithic osseous artifacts, particularly split-based points, alongside the remains of Neanderthals is a result of postdepositional mixing, rather than an association between the two groups, although more work is required to show this definitively. PMID:28874524

  4. Ultrasound artifacts: classification, applied physics with illustrations, and imaging appearances.

    PubMed

    Prabhu, Somnath J; Kanal, Kalpana; Bhargava, Puneet; Vaidya, Sandeep; Dighe, Manjiri K

    2014-06-01

    Ultrasound has become a widely used diagnostic imaging modality in medicine because of its safety and portability. Because of rapid advances in technology, in recent years, sonographic imaging quality has significantly increased. Despite these advances, the potential to encounter artifacts while imaging remains.This article classifies both common and uncommon gray-scale and Doppler ultrasound artifacts into those resulting from physiology and those caused by hardware. A brief applied-physics explanation for each artifact is listed along with an illustrated diagram. The imaging appearance of artifacts is presented in case examples, along with strategies to minimize the artifacts in real time or use them for clinical advantage where applicable.

  5. Reduction hybrid artifacts of EMG-EOG in electroencephalography evoked by prefrontal transcranial magnetic stimulation

    NASA Astrophysics Data System (ADS)

    Bai, Yang; Wan, Xiaohong; Zeng, Ke; Ni, Yinmei; Qiu, Lirong; Li, Xiaoli

    2016-12-01

    Objective. When prefrontal-transcranial magnetic stimulation (p-TMS) performed, it may evoke hybrid artifact mixed with muscle activity and blink activity in EEG recordings. Reducing this kind of hybrid artifact challenges the traditional preprocessing methods. We aim to explore method for the p-TMS evoked hybrid artifact removal. Approach. We propose a novel method used as independent component analysis (ICA) post processing to reduce the p-TMS evoked hybrid artifact. Ensemble empirical mode decomposition (EEMD) was used to decompose signal into multi-components, then the components were separated with artifact reduced by blind source separation (BSS) method. Three standard BSS methods, ICA, independent vector analysis, and canonical correlation analysis (CCA) were tested. Main results. Synthetic results showed that EEMD-CCA outperformed others as ICA post processing step in hybrid artifacts reduction. Its superiority was clearer when signal to noise ratio (SNR) was lower. In application to real experiment, SNR can be significantly increased and the p-TMS evoked potential could be recovered from hybrid artifact contaminated signal. Our proposed method can effectively reduce the p-TMS evoked hybrid artifacts. Significance. Our proposed method may facilitate future prefrontal TMS-EEG researches.

  6. Radial Ultrashort TE Imaging Removes the Need for Breath-Holding in Hepatic Iron Overload Quantification by R2* MRI.

    PubMed

    Tipirneni-Sajja, Aaryani; Krafft, Axel J; McCarville, M Beth; Loeffler, Ralf B; Song, Ruitian; Hankins, Jane S; Hillenbrand, Claudia M

    2017-07-01

    The objective of this study is to evaluate radial free-breathing (FB) multiecho ultrashort TE (UTE) imaging as an alternative to Cartesian FB multiecho gradient-recalled echo (GRE) imaging for quantitative assessment of hepatic iron content (HIC) in sedated patients and subjects unable to perform breath-hold (BH) maneuvers. FB multiecho GRE imaging and FB multiecho UTE imaging were conducted for 46 test group patients with iron overload who could not complete BH maneuvers (38 patients were sedated, and eight were not sedated) and 16 control patients who could complete BH maneuvers. Control patients also underwent standard BH multiecho GRE imaging. Quantitative R2* maps were calculated, and mean liver R2* values and coefficients of variation (CVs) for different acquisitions and patient groups were compared using statistical analysis. FB multiecho GRE images displayed motion artifacts and significantly lower R2* values, compared with standard BH multiecho GRE images and FB multiecho UTE images in the control cohort and FB multiecho UTE images in the test cohort. In contrast, FB multiecho UTE images produced artifact-free R2* maps, and mean R2* values were not significantly different from those measured by BH multiecho GRE imaging. Motion artifacts on FB multiecho GRE images resulted in an R2* CV that was approximately twofold higher than the R2* CV from BH multiecho GRE imaging and FB multiecho UTE imaging. The R2* CV was relatively constant over the range of R2* values for FB multiecho UTE, but it increased with increases in R2* for FB multiecho GRE imaging, reflecting that motion artifacts had a stronger impact on R2* estimation with increasing iron burden. FB multiecho UTE imaging was less motion sensitive because of radial sampling, produced excellent image quality, and yielded accurate R2* estimates within the same acquisition time used for multiaveraged FB multiecho GRE imaging. Thus, FB multiecho UTE imaging is a viable alternative for accurate HIC assessment in sedated children and patients who cannot complete BH maneuvers.

  7. Reducing Artifacts in TMS-Evoked EEG

    NASA Astrophysics Data System (ADS)

    Fuertes, Juan José; Travieso, Carlos M.; Álvarez, A.; Ferrer, M. A.; Alonso, J. B.

    Transcranial magnetic stimulation induces weak currents within the cranium to activate neuronal firing and its response is recorded using electroencephalography in order to study the brain directly. However, different artifacts contaminate the results. The goal of this study is to process these artifacts and reduce them digitally. Electromagnetic, blink and auditory artifacts are considered, and Signal-Space Projection, Independent Component Analysis and Wiener Filtering methods are used to reduce them. These last two produce a successful solution for electromagnetic artifacts. Regarding the other artifacts, processed with Signal-Space Projection, the method reduces the artifact but modifies the signal as well. Nonetheless, they are modified in an exactly known way and the vector used for the projection is conserved to be taken into account when analyzing the resulting signals. A system which combines the proposed methods would improve the quality of the information presented to physicians.

  8. Metal artifact reduction in MRI-based cervical cancer intracavitary brachytherapy

    NASA Astrophysics Data System (ADS)

    Rao, Yuan James; Zoberi, Jacqueline E.; Kadbi, Mo; Grigsby, Perry W.; Cammin, Jochen; Mackey, Stacie L.; Garcia-Ramirez, Jose; Goddu, S. Murty; Schwarz, Julie K.; Gach, H. Michael

    2017-04-01

    Magnetic resonance imaging (MRI) plays an increasingly important role in brachytherapy planning for cervical cancer. Yet, metal tandem, ovoid intracavitary applicators, and fiducial markers used in brachytherapy cause magnetic susceptibility artifacts in standard MRI. These artifacts may impact the accuracy of brachytherapy treatment and the evaluation of tumor response by misrepresenting the size and location of the metal implant, and distorting the surrounding anatomy and tissue. Metal artifact reduction sequences (MARS) with high bandwidth RF selective excitations and turbo spin-echo readouts were developed for MRI of orthopedic implants. In this study, metal artifact reduction was applied to brachytherapy of cervical cancer using the orthopedic metal artifact reduction (O-MAR) sequence. O-MAR combined MARS features with view angle tilting and slice encoding for metal artifact correction (SEMAC) to minimize in-plane and through-plane susceptibility artifacts. O-MAR improved visualization of the tandem tip on T2 and proton density weighted (PDW) imaging in phantoms and accurately represented the diameter of the tandem. In a pilot group of cervical cancer patients (N  =  7), O-MAR significantly minimized the blooming artifact at the tip of the tandem in PDW MRI. There was no significant difference observed in artifact reduction between the weak (5 kHz, 7 z-phase encodes) and medium (10 kHz, 13 z-phase encodes) SEMAC settings. However, the weak setting allowed a significantly shorter acquisition time than the medium setting. O-MAR also reduced susceptibility artifacts associated with metal fiducial markers so that they appeared on MRI at their true dimensions.

  9. Analysis of metal artifact reduction tools for dental hardware in CT scans of the oral cavity: kVp, iterative reconstruction, dual-energy CT, metal artifact reduction software: does it make a difference?

    PubMed

    De Crop, An; Casselman, Jan; Van Hoof, Tom; Dierens, Melissa; Vereecke, Elke; Bossu, Nicolas; Pamplona, Jaime; D'Herde, Katharina; Thierens, Hubert; Bacher, Klaus

    2015-08-01

    Metal artifacts may negatively affect radiologic assessment in the oral cavity. The aim of this study was to evaluate different metal artifact reduction techniques for metal artifacts induced by dental hardware in CT scans of the oral cavity. Clinical image quality was assessed using a Thiel-embalmed cadaver. A Catphan phantom and a polymethylmethacrylate (PMMA) phantom were used to evaluate physical-technical image quality parameters such as artifact area, artifact index (AI), and contrast detail (IQFinv). Metal cylinders were inserted in each phantom to create metal artifacts. CT images of both phantoms and the Thiel-embalmed cadaver were acquired on a multislice CT scanner using 80, 100, 120, and 140 kVp; model-based iterative reconstruction (Veo); and synthesized monochromatic keV images with and without metal artifact reduction software (MARs). Four radiologists assessed the clinical image quality, using an image criteria score (ICS). Significant influence of increasing kVp and the use of Veo was found on clinical image quality (p = 0.007 and p = 0.014, respectively). Application of MARs resulted in a smaller artifact area (p < 0.05). However, MARs reconstructed images resulted in lower ICS. Of all investigated techniques, Veo shows to be most promising, with a significant improvement of both the clinical and physical-technical image quality without adversely affecting contrast detail. MARs reconstruction in CT images of the oral cavity to reduce dental hardware metallic artifacts is not sufficient and may even adversely influence the image quality.

  10. Lithic Scatters that Blow: Wind as an Agent of Secondary Deposition of Lithic Artifacts

    USDA-ARS?s Scientific Manuscript database

    Artifact presence or absence is frequently the only criteria used to define the horizontal extent of archaeological sites. Artifact transport by natural agents such as water and gravity is known to move artifacts from their primary context, though experimental simulated wind conditions demonstrate t...

  11. Morphological and molecular characterization of a marine fish trypanosome from South Africa, including its development in a leech vector

    PubMed Central

    2014-01-01

    Background Trypanosomes are ubiquitous blood parasites of marine and freshwater fishes, typically transmitted by aquatic leeches. Phylogenetic studies have been dominated by examples derived from freshwater fishes, with few marine representatives. Furthermore, life cycle studies on marine fish trypanosomes have focused on those of the northern hemisphere. In this investigation, we have examined the life cycle and molecular taxonomy of a marine fish trypanosome from South Africa. Methods To locate trypanosome stages, leeches were removed from fishes captured on the west and south coasts of South Africa, and fish blood films and leech squashes were Giemsa-stained and screened; leeches were also examined histologically. To determine whether trypanosome stages in fishes and leeches were of the same genotype, DNA was extracted from Giemsa-stained fish blood films and leech squashes, and from fish whole blood. Fragments of the 18S rRNA gene were amplified by PCR using trypanosome-specific primers and sequenced. Resulting sequence data were compared with each other and with published trypanosome 18S rDNA sequences, and used for phylogenetic analysis. Results Trypanosomes were detected in blood films from fishes of the families Clinidae, Blenniidae and Gobiidae. The flagellates ranged in size and staining properties within the films and across fish hosts. In squashes and histological sections of adult and juvenile leeches, identified as Zeylanicobdella arugamensis, trypanosome developmental stages were predominantly slender epimastigotes. Sequence data showed that trypanosomes derived from fishes were identical, irrespective of whether they were small or large forms; sequences derived largely from leech epimastigotes were also identical to those obtained from fish trypanosomes. Fish and leech trypanosome sequences fell into a marine fish aquatic clade, and aligned most closely with two trypanosome sequences from marine fishes off Norway. Conclusions Combined morphological and molecular methods indicate that the trypanosomes examined here represent a single pleomorphic species, rather than the three species described originally. This species is identified as Trypanosoma nudigobii Fantham, 1919 with the leech Z. arugamensis as its vector, and T. capigobii Fantham, 1919 and T. blenniclini Fantham, 1930 are regarded as junior synonyms of the species. Phylogenetic analysis establishes its affinity with marine fish trypanosomes off Norway. PMID:24460725

  12. High-throughput SNP genotyping in Cucurbita pepo for map construction and quantitative trait loci mapping

    PubMed Central

    2012-01-01

    Background Cucurbita pepo is a member of the Cucurbitaceae family, the second- most important horticultural family in terms of economic importance after Solanaceae. The "summer squash" types, including Zucchini and Scallop, rank among the highest-valued vegetables worldwide. There are few genomic tools available for this species. The first Cucurbita transcriptome, along with a large collection of Single Nucleotide Polymorphisms (SNP), was recently generated using massive sequencing. A set of 384 SNP was selected to generate an Illumina GoldenGate assay in order to construct the first SNP-based genetic map of Cucurbita and map quantitative trait loci (QTL). Results We herein present the construction of the first SNP-based genetic map of Cucurbita pepo using a population derived from the cross of two varieties with contrasting phenotypes, representing the main cultivar groups of the species' two subspecies: Zucchini (subsp. pepo) × Scallop (subsp. ovifera). The mapping population was genotyped with 384 SNP, a set of selected EST-SNP identified in silico after massive sequencing of the transcriptomes of both parents, using the Illumina GoldenGate platform. The global success rate of the assay was higher than 85%. In total, 304 SNP were mapped, along with 11 SSR from a previous map, giving a map density of 5.56 cM/marker. This map was used to infer syntenic relationships between C. pepo and cucumber and to successfully map QTL that control plant, flowering and fruit traits that are of benefit to squash breeding. The QTL effects were validated in backcross populations. Conclusion Our results show that massive sequencing in different genotypes is an excellent tool for SNP discovery, and that the Illumina GoldenGate platform can be successfully applied to constructing genetic maps and performing QTL analysis in Cucurbita. This is the first SNP-based genetic map in the Cucurbita genus and is an invaluable new tool for biological research, especially considering that most of these markers are located in the coding regions of genes involved in different physiological processes. The platform will also be useful for future mapping and diversity studies, and will be essential in order to accelerate the process of breeding new and better-adapted squash varieties. PMID:22356647

  13. Cryobiopsy: Should This Be Used in Place of Endobronchial Forceps Biopsies?

    PubMed Central

    Rubio, Edmundo R.; le, Susanti R.; Whatley, Ralph E.; Boyd, Michael B.

    2013-01-01

    Forceps biopsies of airway lesions have variable yields. The yield increases when combining techniques in order to collect more material. With the use of cryotherapy probes (cryobiopsy) larger specimens can be obtained, resulting in an increase in the diagnostic yield. However, the utility and safety of cryobiopsy with all types of lesions, including flat mucosal lesions, is not established. Aims. Demonstrate the utility/safety of cryobiopsy versus forceps biopsy to sample exophytic and flat airway lesions. Settings and Design. Teaching hospital-based retrospective analysis. Methods. Retrospective analysis of patients undergoing cryobiopsies (singly or combined with forceps biopsies) from August 2008 through August 2010. Statistical Analysis. Wilcoxon signed-rank test. Results. The comparative analysis of 22 patients with cryobiopsy and forceps biopsy of the same lesion showed the mean volumes of material obtained with cryobiopsy were significantly larger (0.696 cm3 versus 0.0373 cm3, P = 0.0014). Of 31 cryobiopsies performed, one had minor bleeding. Cryopbiopsy allowed sampling of exophytic and flat lesions that were located centrally or distally. Cryobiopsies were shown to be safe, free of artifact, and provided a diagnostic yield of 96.77%. Conclusions. Cryobiopsy allows safe sampling of exophytic and flat airway lesions, with larger specimens, excellent tissue preservation and high diagnostic accuracy. PMID:24066296

  14. Simultaneous Analysis and Quality Assurance for Diffusion Tensor Imaging

    PubMed Central

    Lauzon, Carolyn B.; Asman, Andrew J.; Esparza, Michael L.; Burns, Scott S.; Fan, Qiuyun; Gao, Yurui; Anderson, Adam W.; Davis, Nicole; Cutting, Laurie E.; Landman, Bennett A.

    2013-01-01

    Diffusion tensor imaging (DTI) enables non-invasive, cyto-architectural mapping of in vivo tissue microarchitecture through voxel-wise mathematical modeling of multiple magnetic resonance imaging (MRI) acquisitions, each differently sensitized to water diffusion. DTI computations are fundamentally estimation processes and are sensitive to noise and artifacts. Despite widespread adoption in the neuroimaging community, maintaining consistent DTI data quality remains challenging given the propensity for patient motion, artifacts associated with fast imaging techniques, and the possibility of hardware changes/failures. Furthermore, the quantity of data acquired per voxel, the non-linear estimation process, and numerous potential use cases complicate traditional visual data inspection approaches. Currently, quality inspection of DTI data has relied on visual inspection and individual processing in DTI analysis software programs (e.g. DTIPrep, DTI-studio). However, recent advances in applied statistical methods have yielded several different metrics to assess noise level, artifact propensity, quality of tensor fit, variance of estimated measures, and bias in estimated measures. To date, these metrics have been largely studied in isolation. Herein, we select complementary metrics for integration into an automatic DTI analysis and quality assurance pipeline. The pipeline completes in 24 hours, stores statistical outputs, and produces a graphical summary quality analysis (QA) report. We assess the utility of this streamlined approach for empirical quality assessment on 608 DTI datasets from pediatric neuroimaging studies. The efficiency and accuracy of quality analysis using the proposed pipeline is compared with quality analysis based on visual inspection. The unified pipeline is found to save a statistically significant amount of time (over 70%) while improving the consistency of QA between a DTI expert and a pool of research associates. Projection of QA metrics to a low dimensional manifold reveal qualitative, but clear, QA-study associations and suggest that automated outlier/anomaly detection would be feasible. PMID:23637895

  15. Sparsity-based acoustic inversion in cross-sectional multiscale optoacoustic imaging

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Han, Yiyong; Tzoumas, Stratis; Nunes, Antonio

    2015-09-15

    Purpose: With recent advancement in hardware of optoacoustic imaging systems, highly detailed cross-sectional images may be acquired at a single laser shot, thus eliminating motion artifacts. Nonetheless, other sources of artifacts remain due to signal distortion or out-of-plane signals. The purpose of image reconstruction algorithms is to obtain the most accurate images from noisy, distorted projection data. Methods: In this paper, the authors use the model-based approach for acoustic inversion, combined with a sparsity-based inversion procedure. Specifically, a cost function is used that includes the L1 norm of the image in sparse representation and a total variation (TV) term. Themore » optimization problem is solved by a numerically efficient implementation of a nonlinear gradient descent algorithm. TV–L1 model-based inversion is tested in the cross section geometry for numerically generated data as well as for in vivo experimental data from an adult mouse. Results: In all cases, model-based TV–L1 inversion showed a better performance over the conventional Tikhonov regularization, TV inversion, and L1 inversion. In the numerical examples, the images reconstructed with TV–L1 inversion were quantitatively more similar to the originating images. In the experimental examples, TV–L1 inversion yielded sharper images and weaker streak artifact. Conclusions: The results herein show that TV–L1 inversion is capable of improving the quality of highly detailed, multiscale optoacoustic images obtained in vivo using cross-sectional imaging systems. As a result of its high fidelity, model-based TV–L1 inversion may be considered as the new standard for image reconstruction in cross-sectional imaging.« less

  16. Simultaneous analysis and quality assurance for diffusion tensor imaging.

    PubMed

    Lauzon, Carolyn B; Asman, Andrew J; Esparza, Michael L; Burns, Scott S; Fan, Qiuyun; Gao, Yurui; Anderson, Adam W; Davis, Nicole; Cutting, Laurie E; Landman, Bennett A

    2013-01-01

    Diffusion tensor imaging (DTI) enables non-invasive, cyto-architectural mapping of in vivo tissue microarchitecture through voxel-wise mathematical modeling of multiple magnetic resonance imaging (MRI) acquisitions, each differently sensitized to water diffusion. DTI computations are fundamentally estimation processes and are sensitive to noise and artifacts. Despite widespread adoption in the neuroimaging community, maintaining consistent DTI data quality remains challenging given the propensity for patient motion, artifacts associated with fast imaging techniques, and the possibility of hardware changes/failures. Furthermore, the quantity of data acquired per voxel, the non-linear estimation process, and numerous potential use cases complicate traditional visual data inspection approaches. Currently, quality inspection of DTI data has relied on visual inspection and individual processing in DTI analysis software programs (e.g. DTIPrep, DTI-studio). However, recent advances in applied statistical methods have yielded several different metrics to assess noise level, artifact propensity, quality of tensor fit, variance of estimated measures, and bias in estimated measures. To date, these metrics have been largely studied in isolation. Herein, we select complementary metrics for integration into an automatic DTI analysis and quality assurance pipeline. The pipeline completes in 24 hours, stores statistical outputs, and produces a graphical summary quality analysis (QA) report. We assess the utility of this streamlined approach for empirical quality assessment on 608 DTI datasets from pediatric neuroimaging studies. The efficiency and accuracy of quality analysis using the proposed pipeline is compared with quality analysis based on visual inspection. The unified pipeline is found to save a statistically significant amount of time (over 70%) while improving the consistency of QA between a DTI expert and a pool of research associates. Projection of QA metrics to a low dimensional manifold reveal qualitative, but clear, QA-study associations and suggest that automated outlier/anomaly detection would be feasible.

  17. A radial sampling strategy for uniform k-space coverage with retrospective respiratory gating in 3D ultrashort-echo-time lung imaging.

    PubMed

    Park, Jinil; Shin, Taehoon; Yoon, Soon Ho; Goo, Jin Mo; Park, Jang-Yeon

    2016-05-01

    The purpose of this work was to develop a 3D radial-sampling strategy which maintains uniform k-space sample density after retrospective respiratory gating, and demonstrate its feasibility in free-breathing ultrashort-echo-time lung MRI. A multi-shot, interleaved 3D radial sampling function was designed by segmenting a single-shot trajectory of projection views such that each interleaf samples k-space in an incoherent fashion. An optimal segmentation factor for the interleaved acquisition was derived based on an approximate model of respiratory patterns such that radial interleaves are evenly accepted during the retrospective gating. The optimality of the proposed sampling scheme was tested by numerical simulations and phantom experiments using human respiratory waveforms. Retrospectively, respiratory-gated, free-breathing lung MRI with the proposed sampling strategy was performed in healthy subjects. The simulation yielded the most uniform k-space sample density with the optimal segmentation factor, as evidenced by the smallest standard deviation of the number of neighboring samples as well as minimal side-lobe energy in the point spread function. The optimality of the proposed scheme was also confirmed by minimal image artifacts in phantom images. Human lung images showed that the proposed sampling scheme significantly reduced streak and ring artifacts compared with the conventional retrospective respiratory gating while suppressing motion-related blurring compared with full sampling without respiratory gating. In conclusion, the proposed 3D radial-sampling scheme can effectively suppress the image artifacts due to non-uniform k-space sample density in retrospectively respiratory-gated lung MRI by uniformly distributing gated radial views across the k-space. Copyright © 2016 John Wiley & Sons, Ltd.

  18. Automatic identification of artifacts in electrodermal activity data.

    PubMed

    Taylor, Sara; Jaques, Natasha; Chen, Weixuan; Fedor, Szymon; Sano, Akane; Picard, Rosalind

    2015-01-01

    Recently, wearable devices have allowed for long term, ambulatory measurement of electrodermal activity (EDA). Despite the fact that ambulatory recording can be noisy, and recording artifacts can easily be mistaken for a physiological response during analysis, to date there is no automatic method for detecting artifacts. This paper describes the development of a machine learning algorithm for automatically detecting EDA artifacts, and provides an empirical evaluation of classification performance. We have encoded our results into a freely available web-based tool for artifact and peak detection.

  19. ADJUST: An automatic EEG artifact detector based on the joint use of spatial and temporal features.

    PubMed

    Mognon, Andrea; Jovicich, Jorge; Bruzzone, Lorenzo; Buiatti, Marco

    2011-02-01

    A successful method for removing artifacts from electroencephalogram (EEG) recordings is Independent Component Analysis (ICA), but its implementation remains largely user-dependent. Here, we propose a completely automatic algorithm (ADJUST) that identifies artifacted independent components by combining stereotyped artifact-specific spatial and temporal features. Features were optimized to capture blinks, eye movements, and generic discontinuities on a feature selection dataset. Validation on a totally different EEG dataset shows that (1) ADJUST's classification of independent components largely matches a manual one by experts (agreement on 95.2% of the data variance), and (2) Removal of the artifacted components detected by ADJUST leads to neat reconstruction of visual and auditory event-related potentials from heavily artifacted data. These results demonstrate that ADJUST provides a fast, efficient, and automatic way to use ICA for artifact removal. Copyright © 2010 Society for Psychophysiological Research.

  20. Analysis of Human Osteological Remains Multi-County Areas, North Dakota.

    DTIC Science & Technology

    1983-03-01

    squash knife (XH 310). Plate 48: Trailed body sherd (XH 312). Plate 49: Plain rim sherd, serated lip (XH 317). Plate 50: Plain rim sherd (XH 318). Plate...51: Smoothed overtrailed rim sherd, raized lip on interior (XH 319). Plate 52: Rim sherd, horizontal cord wrapped stick impressed (XH 320). Plate 53...Rim sherd, horizontal cord impressed (XH 321). Plate 54: Rim sherd, vertical linear incised lip (XH 322). Plate 55: Rim sherd, vertical fingernail

Top