Science.gov

Sample records for stabilized zirconia based

  1. Fabrication and microstructure characterization of inert matrix fuel based on yttria stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Hellwig, Ch.; Pouchon, M.; Restani, R.; Ingold, F.; Bart, G.

    2005-04-01

    The deployment of a suitable, Pu-bearing inert matrix fuel (IMF) could offer an attractive option as a single-recycling LWR strategy aimed at reducing the currently growing plutonium stockpiles. A development programme focusing on yttria stabilized zirconia (YSZ)-based IMF is conducted at PSI. YSZ-based IMF has so far been irradiated in two test reactors. The fabrication routes as well as the characterization of the irradiated material by ceramography, electronprobe microanalysis, and X-ray diffraction are presented. IMF fabrication by attrition milling of the oxide constituents is possible, but high sintering temperatures are required to achieve homogeneity. X-ray diffraction is a suitable tool to monitor the homogeneity. Extra efforts are needed to increase the density.

  2. Brazing of Stainless Steels to Yttria Stabilized Zirconia (YSZ) Using Silver -Base Brazes

    NASA Technical Reports Server (NTRS)

    Singh, Mrityunjay; Shpargel, Tarah P.; Asthana, Rajiv

    2005-01-01

    Three silver-base brazes containing either noble metal palladium (Palcusil-10 and Palcusil-15) or active metal titanium (Ticusil) were evaluated for high-temperature oxidation resistance, and their effectiveness in joining yttria stabilized zirconia (YSZ) to a corrosion-resistant ferritic stainless steel. Thermogravimetric analysis (TGA), and optical- and scanning electron microscopy (SEM) coupled with energy dispersive spectrometry (EDS) were used to evaluate the braze oxidation behavior and the structure and chemistry of the YSZ/braze/steel joints. The effect of the braze type and processing conditions on the interfacial microstructure and composition of the joint regions is discussed with reference to the chemical changes that occur at the interface. It was found that chemical interdiffusion of the constituents of YSZ, steel and the brazes led to compositional changes and/or interface reconstruction, and metallurgically sound joints.

  3. Determining europium compositional fluctuations in partially stabilized zirconia nanopowders: a non-line-broadening-based method.

    PubMed

    Marin, Riccardo; Sponchia, Gabriele; Back, Michele; Riello, Pietro

    2016-02-01

    A method is reported for assessing the compositional fluctuations in a ceramic sample, based only on the determination of the crystalline lattice parameters. Pure tetragonal phase partially stabilized zirconia powders are synthesized through the co-precipitation method by incorporating 4% Eu(3+). The powder is subjected to compression cycles to promote the tetragonal-to-monoclinic transformation. The Rietveld analysis of the X-ray powder diffraction patterns, recorded after each compression cycle, gives information about the lattice parameters and monoclinic phase content. The determination of europium content in the residual tetragonal phase is accomplished considering the unit cell volume of t-ZrO2 using Vegard's law. Using this information the compositional fluctuations over the sample were determined by considering two possible distributions of lanthanide ion content in the powders: a Gaussian and a Log-normal one. It was found that the Gaussian distribution better fits the experimental data. It was eventually demonstrated that these results are physically meaningful.

  4. Brazing of Stainless Steels to Yttria Stabilized Zirconia (YSZ) Using Silver -Base Brazes

    NASA Technical Reports Server (NTRS)

    Singh, Mrityunjay; Shpargel, Tarah P.; Asthana, Rajiv

    2005-01-01

    Three silver-base brazes containing either noble metal palladium (Palcusil-10 and Palcusil-15) or active metal titanium (Ticusil) were evaluated for high-temperature oxidation resistance, and their effectiveness in joining yttria stabilized zirconia (YSZ) to a corrosion-resistant ferritic stainless steel. Thermogravimetric analysis (TGA), and optical- and scanning electron microscopy (SEM) coupled with energy dispersive spectrometry (EDS) were used to evaluate the braze oxidation behavior and the structure and chemistry of the YSZ/braze/steel joints. The effect of the braze type and processing conditions on the interfacial microstructure and composition of the joint regions is discussed with reference to the chemical changes that occur at the interface. It was found that chemical interdiffusion of the constituents of YSZ, steel and the brazes led to compositional changes and/or interface reconstruction, and metallurgically sound joints.

  5. Phase stability of thermal barrier oxides based on t'-zirconia with trivalent oxide additions

    NASA Astrophysics Data System (ADS)

    Rebollo Franco, Noemi Rosa

    Zirconia stabilized with 7+/-1 wt.% addition of yttria (7YSZ) is widely used for thermal barrier coatings (TBC's) on actively cooled gas turbine components, selected partly because of its superior durability under thermal cyclic conditions. As deposited, 7YSZ occurs as a metastable single-phase tetragonal solid solution (t') that is thermodynamically stable against the deleterious transformation to monoclinic upon cooling. However, at high temperatures t' is driven to decompose diffusionally into an equilibrium mixture of high-Y cubic and low-Y tetragonal; the latter becomes transformable to monoclinic compromising the mechanical integrity of the system. This dissertation explores the effects of trivalent stabilizers, including Y, Sc and selected rare-earth oxides (REO's), on the phase stability of the resulting solid solutions in zirconia. The REO additions are of interest because they can potentially enhance the insulation efficiency on the coating allowing higher operating temperatures. However, understanding of their effects on phase stability and potentially on cyclic durability at the projected use temperature in next generation engines (1200-1400°C) is insufficient to guide the design of coatings with the desirable combination of lower thermal conductivity and acceptable durability. Sc was also investigated because of previous reports on the higher phase stability of materials doped with Sc, and Y served as the baseline. The experimental approach is based on powders synthesized by reverse co-precipitation of precursor solutions, usually compacted and then subjected to a variety of heat treatments, following their evolution by means of X-ray diffractometry, dilatometry, transmission electron microscopy and Raman spectroscopy. The use of powders facilitated the synthesis of a wider range of compositions that would not have been possible by coating deposition approaches, and because the synthesis occurs at low temperature, it also enabled the starting

  6. Nitrogen-doped zirconia: A comparison with cation stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Lee, Jong-Sook; Lerch, Martin; Maier, Joachim

    2006-01-01

    The conductivity behavior of nitrogen-doped zirconia is compared with that of zirconia doped with lower-valent cations and discussed in the framework of defect-defect interactions. While nominally introducing the same number of vacancies as yttrium, nitrogen dopants introduced in the anion sublattice of zirconia lead to substantially different defect kinetics and energetics. Compared to the equivalent yttrium doping nitrogen doping in the Y-Zr-O-N system substantially increases the activation energy and correspondingly decreases the conductivity at temperatures below 500C in the vacancy range below 4 mol%. The comparison of N-doped zirconia and zirconia systems doped with size-matched cation stabilizers, such as Sc, Yb and Y, shows that elastically driven vacancy-vacancy ordering interactions can phenomenologically account for the temperature- and composition-dependence. It is striking that materials with superior high-temperature conductivities due to weak dopant-vacancy interactions undergo severe deterioration at low temperature due to the strong vacancy-ordering. The analysis also explains qualitatively similar effects of Y co-doping in Yb-, Sc-, and N-doped zirconia. Small amount of Y in N-doped zirconia as well as in Sc-doped zirconia appears to hinder the formation of the long-range ordered phase and thus enhance the conductivity substantially.

  7. Nitrogen-doped zirconia: A comparison with cation stabilized zirconia

    SciTech Connect

    Lee, Jong-Sook . E-mail: jong-sook.lee@fkf.mpg.de; Lerch, Martin; Maier, Joachim

    2006-01-15

    The conductivity behavior of nitrogen-doped zirconia is compared with that of zirconia doped with lower-valent cations and discussed in the framework of defect-defect interactions. While nominally introducing the same number of vacancies as yttrium, nitrogen dopants introduced in the anion sublattice of zirconia lead to substantially different defect kinetics and energetics. Compared to the equivalent yttrium doping nitrogen doping in the Y-Zr-O-N system substantially increases the activation energy and correspondingly decreases the conductivity at temperatures below 500{sup -}bar C in the vacancy range below 4mol%. The comparison of N-doped zirconia and zirconia systems doped with size-matched cation stabilizers, such as Sc, Yb and Y, shows that elastically driven vacancy-vacancy ordering interactions can phenomenologically account for the temperature- and composition-dependence. It is striking that materials with superior high-temperature conductivities due to weak dopant-vacancy interactions undergo severe deterioration at low temperature due to the strong vacancy-ordering. The analysis also explains qualitatively similar effects of Y co-doping in Yb-, Sc-, and N-doped zirconia. Small amount of Y in N-doped zirconia as well as in Sc-doped zirconia appears to hinder the formation of the long-range ordered phase and thus enhance the conductivity substantially.

  8. Phonon anharmonicity of monoclinic zirconia and yttrium-stabilized zirconia

    DOE PAGES

    Li, Chen W.; Smith, Hillary L.; Lan, Tian; ...

    2015-04-13

    Inelastic neutron scattering measurements on monoclinic zirconia (ZrO2) and 8 mol% yttrium-stabilized zirconia were performed at temperatures from 300 to 1373 ωK. We reported temperature-dependent phonon densities of states (DOS) and Raman spectra obtained at elevated temperatures. First-principles lattice dynamics calculations with density functional theory gave total and partial phonon DOS curves and mode Grüneisen parameters. These mode Grüneisen parameters were used to predict the experimental temperature dependence of the phonon DOS with partial success. However, substantial anharmonicity was found at elevated temperatures, especially for phonon modes dominated by the motions of oxygen atoms. Yttrium-stabilized zirconia (YSZ) was somewhat moremore » anharmonic and had a broader phonon spectrum at low temperatures, owing in part to defects in its structure. YSZ also has a larger vibrational entropy than monoclinic zirconia.« less

  9. Phonon anharmonicity of monoclinic zirconia and yttrium-stabilized zirconia

    SciTech Connect

    Li, Chen W.; Smith, Hillary L.; Lan, Tian; Niedziela, Jennifer L.; Munoz, Jorge A.; Keith, J. Brian; Mauger, L.; Abernathy, Douglas L; Fultz, B.

    2015-04-13

    Inelastic neutron scattering measurements on monoclinic zirconia (ZrO2) and 8 mol% yttrium-stabilized zirconia were performed at temperatures from 300 to 1373 ωK. We reported temperature-dependent phonon densities of states (DOS) and Raman spectra obtained at elevated temperatures. First-principles lattice dynamics calculations with density functional theory gave total and partial phonon DOS curves and mode Grüneisen parameters. These mode Grüneisen parameters were used to predict the experimental temperature dependence of the phonon DOS with partial success. However, substantial anharmonicity was found at elevated temperatures, especially for phonon modes dominated by the motions of oxygen atoms. Yttrium-stabilized zirconia (YSZ) was somewhat more anharmonic and had a broader phonon spectrum at low temperatures, owing in part to defects in its structure. YSZ also has a larger vibrational entropy than monoclinic zirconia.

  10. Micro-tubular solid oxide fuel cell based on a porous yttria-stabilized zirconia support

    PubMed Central

    Panthi, Dhruba; Tsutsumi, Atsushi

    2014-01-01

    Solid oxide fuel cells (SOFCs) are promising electrochemical energy conversion devices owing to their high power generation efficiency and environmentally benign operation. Micro-tubular SOFCs, which have diameters ranging from a few millimeters to the sub-millimeter scale, offer several advantages over competing SOFCs such as high volumetric power density, good endurance against thermal cycling, and flexible sealing between fuel and oxidant streams. Herein, we successfully realized a novel micro-tubular SOFC design based on a porous yttria-stabilized zirconia (YSZ) support using multi-step dip coating and co-sintering methods. The micro-tubular SOFC consisted of Ni-YSZ, YSZ, and strontium-doped lanthanum manganite (LSM)–YSZ as the anode, electrolyte, and cathode, respectively. In addition, to facilitate current collection from the anode and cathode, Ni and LSM were applied as an anode current collector and cathode current collector, respectively. Micro-crystalline cellulose was selected as a pore former to achieve better shrinkage behavior of the YSZ support so that the electrolyte layer could be densified at a co-sintering temperature of 1300°C. The developed micro-tubular design showed a promising electrochemical performance with maximum power densities of 525, 442, and 354 mW cm−2 at 850, 800, and 750°C, respectively. PMID:25169166

  11. Micro-tubular solid oxide fuel cell based on a porous yttria-stabilized zirconia support.

    PubMed

    Panthi, Dhruba; Tsutsumi, Atsushi

    2014-08-29

    Solid oxide fuel cells (SOFCs) are promising electrochemical energy conversion devices owing to their high power generation efficiency and environmentally benign operation. Micro-tubular SOFCs, which have diameters ranging from a few millimeters to the sub-millimeter scale, offer several advantages over competing SOFCs such as high volumetric power density, good endurance against thermal cycling, and flexible sealing between fuel and oxidant streams. Herein, we successfully realized a novel micro-tubular SOFC design based on a porous yttria-stabilized zirconia (YSZ) support using multi-step dip coating and co-sintering methods. The micro-tubular SOFC consisted of Ni-YSZ, YSZ, and strontium-doped lanthanum manganite (LSM)-YSZ as the anode, electrolyte, and cathode, respectively. In addition, to facilitate current collection from the anode and cathode, Ni and LSM were applied as an anode current collector and cathode current collector, respectively. Micro-crystalline cellulose was selected as a pore former to achieve better shrinkage behavior of the YSZ support so that the electrolyte layer could be densified at a co-sintering temperature of 1300 °C. The developed micro-tubular design showed a promising electrochemical performance with maximum power densities of 525, 442, and 354 mW cm(-2) at 850, 800, and 750 °C, respectively.

  12. Silver-Copper Oxide Based Reactive Air Braze (RAB) for Joining Yttria-Stabilized Zirconia

    SciTech Connect

    Kim, Jin Yong Y.; Hardy, John S.; Weil, K. Scott

    2005-03-01

    We are investigating a new method of ceramic-to-metal joining, referred to as reactive air brazing (RAB), as a potential method of sealing ceramic components in high-temperature electrochemical devices. Sessile drop wetting experiments and joint strength testing were conducted using yttria stabilized zirconia (YSZ) substrates and CuO-Ag based air brazes. Results from our studies indicate that the wettability of the braze improves substantially with increasing CuO content, over a compositional range of 1 - 8 mol% CuO, which is accompanied by an increase in the bend strength of the corresponding brazed YSZ joint. The addition of a small amount of TiO2 (0.5 mol%) to the CuO-Ag braze further improves wettability due to the formation of a titanium zirconate reaction product along the braze/substrate interface. However, with one notable exception, the bend strength of these ternary braze joints remained nearly identical to those measured in comparable binary braze joints. SEM analysis conducted on the corresponding fracture surfaces indicated that in the binary braze joints the failure occurs primarily at the braze/YSZ interface. Similarly in the case of the the ternary, TiO2-doped brazes joint failure occurs predominantly along the interface between the braze filler metal and the underlying titanium zirconate reaction layer.

  13. Stability of Ni-yttria stabilized zirconia anodes based on Ni-impregnation

    NASA Astrophysics Data System (ADS)

    Klemensø, Trine; Thydén, Karl; Chen, Ming; Wang, Hsiang-Jen

    Sintering of Ni is a key stability issue for Ni-YSZ anodes, and especially infiltration based electrodes. The potential of MgO, Al 2O 3, TiO 2, CeO 2 and Ce 0.90Gd 0.10O 1.95 (CGO10) as sintering inhibitors was investigated for infiltrated Ni based anode structures. The structures were prepared from tape cast porous YSZ layers that were impregnated with Ni to form an electronic percolating phase. The Ni-YSZ structure was subsequently impregnated with the inhibitor candidate, and the stability of the structure was evaluated from conductivity measurements. Lower conductivity degradation rates were observed for samples infiltrated with the inhibitor candidates, and the best inhibitor effect was seen with higher loadings of CGO10, and CeO 2 showed similar potential. The degradation in conductivity was not visibly reflected in the microstructure as Ni coarsening in any of the cases. An adverse effect of MgO, TiO 2 and Al 2O 3 was reduced conductivity, possibly due to reaction with Ni and the formation of higher resistive phases. The Ni-infiltrated anodes were shown to have better initial electrochemical performance at 650 °C than conventionally produced Ni-YSZ anodes, but still very poor stability, and further improvement of the inhibitor approach is necessary before applying the Ni-infiltrated anodes in SOFCs.

  14. Towards long lasting zirconia-based composites for dental implants. Part I: innovative synthesis, microstructural characterization and in vitro stability.

    PubMed

    Palmero, Paola; Fornabaio, Marta; Montanaro, Laura; Reveron, Helen; Esnouf, Claude; Chevalier, Jérôme

    2015-05-01

    In order to fulfill the clinical requirements for strong, tough and stable ceramics used in dental applications, we designed and developed innovative zirconia-based composites, in which equiaxial α-Al2O3 and elongated SrAl12O19 phases are dispersed in a ceria-stabilized zirconia matrix. The composite powders were prepared by an innovative surface coating route, in which commercial zirconia powders were coated by inorganic precursors of the second phases, which crystallize on the zirconia particles surface under proper thermal treatment. Samples containing four different ceria contents (in the range 10.0-11.5 mol%) were prepared by carefully tailoring the amount of the cerium precursor during the elaboration process. Slip cast green bodies were sintered at 1450 °C for 1 h, leading to fully dense materials. Characterization of composites by SEM and TEM analyses showed highly homogeneous microstructures with an even distribution of both equiaxial and elongated-shape grains inside a very fine zirconia matrix. Ce content plays a major role on aging kinetics, and should be carefully controlled: sample with 10 mol% of ceria were transformable, whereas above 10.5 mol% there is negligible or no transformation during autoclave treatment. Thus, in this paper we show the potential of the innovative surface coating route, which allows a perfect tailoring of the microstructural, morphological and compositional features of the composites; moreover, its processing costs and environmental impacts are limited, which is beneficial for further scale-up and real use in the biomedical field.

  15. Phase Stability of t;#8242;-Zirconia-Based Thermal Barrier Coatings: Mechanistic Insights

    SciTech Connect

    Krogstad, Jessica A.; Krämer, Stephan; Lipkin, Don M.; Johnson, Curtis A.; Mitchell, David R.G.; Cairney, Julie M.; Levi, Carlos G.

    2011-11-07

    The temperature capability of yttria-stabilized zirconia thermal barrier coatings (TBCs) is ultimately tied to the rate of evolution of the 'nontransformable' t' phase into a depleted tetragonal form predisposed to the monoclinic transformation on cooling. The t' phase, however, has been shown to decompose in a small fraction of the time necessary to form the monoclinic phase. Instead, a modulated microstructure consisting of a coherent array of Y-rich and Y-lean lamellar phases develops early in the process, with mechanistic features suggestive of spinodal decomposition. Coarsening of this microstructure leads to loss of coherency and ultimately transformation into the monoclinic form, making the kinetics of this process, and not the initial decomposition, the critical factor in determining the phase stability of TBCs. Transmission electron microscopy is shown to be essential not only for characterizing the microstructure but also for proper interpretation of X-ray diffraction analysis.

  16. In vivo wear performance of highly cross-linked polyethylene vs. yttria stabilized zirconia and alumina stabilized zirconia at a mean seven-year follow-up

    PubMed Central

    2013-01-01

    Background Zirconia was introduced as an alternative to alumina for use in the femoral head. The yttria stabilized zirconia material was improved by adding alumina. We evaluated highly cross-linked polyethylene wear performance of zirconia in total hip arthroplasty. The hypothesis was that alumina stabilized zirconia could decrease highly cross-linked polyethylene wear. Methods Highly cross-linked polyethylene wear was measured with a computerized method (PolyWare) in 91 hips. The steady-state wear rates were measured based on the radiographs from the first year postoperatively to the final follow-up and were compared between hips with yttria stabilized zirconia and alumina stabilized zirconia. Results The steady-state wear rate of highly cross-linked polyethylene against zirconia was 0.02 mm/year at a mean follow-up of 7 years. No significant difference was observed between groups with yttria stabilized zirconia and alumina stabilized zirconia. Conclusions Addition of alumina to the zirconia material failed to show further reduction of highly cross-linked polyethylene wear and our hypothesis was not verified. PMID:23634809

  17. Phase stability of zirconia at nanoscale.

    NASA Astrophysics Data System (ADS)

    Sabiryanov, Renat; Mei, W. N.

    2004-03-01

    There are three phases of ZrO2, namely cubic, tetragonal and monoclinic. Cubic phase of zirconia is usually stabilized by various dopants such as yttria and magnesia. However, it has been observed that these stablizers are indeed the source failure of doped ZrO2 in both orthopaedics and in ZrO2 used in high temperature applications. Recently, the cubic zirconia was fabricated as granular media with the grain sizes less than 17nm. We examine the phase stability in zirconia nanoparticles using first principle electronic structure method. We observe considerable relaxation of lattice in the monoclinic phase near the surface. This effect combined with surface tension and possibly vacancies in nanostructures are sources of stability of cubic zirconia at nanoscale. We performed calculation of the surface tension calculations for the pure (001) surface. The uniform compressive strain is applied in the plane of the slab to find the elastic response of the system. The slab is allowed to relax in the perpendicular direction. Uniform compressive strain in the plane of the slab causes increase in the distance between Zr and O layers for (001) surface (as a solid tends to preserve the volume). For cubic it gives -0.65N/m, while for monoclinic -0.48N/m. Furthermore, the solid-gas surface tension is a fundamental physical/chemical property of a solid, which affects its wetting properties. Therefore, cubic zirconia is more suitable to design the material combining wettability, ductility and hardness.

  18. Hot Corrosion of Yttrium Stabilized Zirconia Coatings Deposited by Air Plasma Spray on a Nickel-Based Superalloy

    NASA Astrophysics Data System (ADS)

    Vallejo, N. Diaz; Sanchez, O.; Caicedo, J. C.; Aperador, W.; Zambrano, G.

    In this research, the electrochemical impedance spectroscopy (EIS) and Tafel analysis were utilized to study the hot corrosion performance at 700∘C of air plasma-sprayed (APS) yttria-stabilized zirconia (YSZ) coatings with a NiCrAlY bond coat grown by high velocity oxygen fuel spraying (HVOF), deposited on an INCONEL 625 substrate, in contact with corrosive solids salts as vanadium pentoxide V2O5 and sodium sulfate Na2SO4. The EIS data were interpreted based on proposed equivalent electrical circuits using a suitable fitting procedure performed with Echem AnalystTM Software. Phase transformations and microstructural development were examined using X-ray diffraction (XRD), with Rietveld refinement for quantitative phase analysis, scanning electron microscopy (SEM) was used to determinate the coating morphology and corrosion products. The XRD analysis indicated that the reaction between sodium vanadate (NaVO3) and yttrium oxide (Y2O3) produces yttrium vanadate (YVO4) and leads to the transformation from tetragonal to monoclinic zirconia phase.

  19. Brazing of Stainless Steel to Yttria-Stabilized Zirconia Using Gold-Based Brazes for Solid Oxide Fuel Cell Applications

    NASA Technical Reports Server (NTRS)

    Singh, M.; Shpargel, T. P.; Asthana, R.

    2007-01-01

    Two gold-base active metal brazes (gold-ABA and gold-ABA-V) were evaluated for oxidation resistance to 850 C, and used to join yttria-stabilized zirconia (YSZ) to a corrosion-resistant ferritic stainless steel for possible use in solid oxide fuel cells. Thermogravimetric analysis and optical microscopy and scanning electron microscopy coupled with energy-dispersive spectroscopy were used to evaluate the braze oxidation behavior, and microstructure and composition of the YSZ/braze/steel joints. Both gold-ABA and gold-ABA-V exhibited nearly linear oxidation kinetics at 850 C, with gold-ABA-V showing faster oxidation than gold-ABA. Both brazes produced metallurgically sound YSZ/steel joints due to chemical interactions of Ti and V with the YSZ and steel substrates.

  20. Brazing of Stainless Steel to Yttria-Stabilized Zirconia Using Gold-Based Brazes for Solid Oxide Fuel Cell Applications

    NASA Technical Reports Server (NTRS)

    Singh, M.; Shpargel, T. P.; Asthana, R.

    2007-01-01

    Two gold-base active metal brazes (gold-ABA and gold-ABA-V) were evaluated for oxidation resistance to 850 C, and used to join yttria-stabilized zirconia (YSZ) to a corrosion-resistant ferritic stainless steel for possible use in solid oxide fuel cells. Thermogravimetric analysis and optical microscopy and scanning electron microscopy coupled with energy-dispersive spectroscopy were used to evaluate the braze oxidation behavior, and microstructure and composition of the YSZ/braze/steel joints. Both gold-ABA and gold-ABA-V exhibited nearly linear oxidation kinetics at 850 C, with gold-ABA-V showing faster oxidation than gold-ABA. Both brazes produced metallurgically sound YSZ/steel joints due to chemical interactions of Ti and V with the YSZ and steel substrates.

  1. Partially stabilized zirconia piston bowl reliability

    SciTech Connect

    Hartsock, D.L.

    1987-10-01

    The Weibull based ''Simplified Structural Ceramic Design Technique'' was used to calculate the reliability of a partially stabilized zirconia (PSZ) piston bowl design. The details of the method and a set of sample calculations are presented. Test results of the piston bowl showed cracks in regions which had a high calculated probability of failure. In addition cracks developed in a region of high compressive/shear stress. Since Weibull reliability analysis only uses tensile stresses this area did not have a high calculated probability of failure. Several hypotheses are presented for the mode of failure in this region. The simplified technique was used to predict what the necessary material properties would have to be for successful PSZ insert of the design shown.

  2. High performance solid oxide fuel cells based on tri-layer yttria-stabilized zirconia by low temperature sintering process

    NASA Astrophysics Data System (ADS)

    Liu, Ze; Zheng, Zi-wei; Han, Min-fang; Liu, Mei-lin

    Performance of solid oxide fuel cells (SOFCs) depends critically on the composition and microstructure of the electrodes. It is fabricated a dense yttria-stabilized zirconia (YSZ) electrolyte layer sandwiched between two porous YSZ layers at low temperature. The advantages of this structure include excellent structural stability and unique flexibility for evaluation of new electrode materials for SOFC applications, which would be difficult or impossible to be evaluated using conventional cell fabrication techniques because of incompatibility with YSZ under processing conditions. The porosity of porous YSZ increases from 65.8% to 68.6% as the firing temperature decreased from 1350 to 1200 °C. The open cell voltages of the cells based on the tri-layers of YSZ, co-fired using a two-step sintering at 1200 °C, are above 1.0 V at 700-800 °C, and the peak power densities of cells infiltrated LSCF and Pd-SDC electrodes are about 525, 733, and 935 mW cm -2 at 700, 750, and 800 °C, respectively.

  3. Adopting the principles of collagen biomineralization for intrafibrillar infiltration of yttria-stabilized zirconia into three-dimensional collagen scaffolds.

    PubMed

    Zhou, Bin; Niu, Li-Na; Shi, Wei; Zhang, Wei; Arola, Dwayne D; Breschi, Lorenzo; Mao, Jing; Chen, Ji-Hua; Pashley, David H; Tay, Franklin R

    2014-04-02

    In this paper, we report a process for generating collagen-yttria-stabilized amorphous zirconia hybrid scaffolds by introducing acetylacetone-inhibited zirconia precursor nanodroplets into a poly(allylamine)-coated collagen matrix. This polyelectrolyte coating triggers intrafibrillar condensation of the precursors into amorphous zirconia, which is subsequently transformed into tetragonal yttria-stabilized zirconia after calcination. Our findings represent a new paradigm in the synthesis of non-naturally occurring collagen-based hybrid scaffolds under alcoholic mineralizing conditions.

  4. Adopting the principles of collagen biomineralization for intrafibrillar infiltration of yttria-stabilized zirconia into three-dimensional collagen scaffolds

    PubMed Central

    Zhou, Bin; Niu, Li-na; Shi, Wei; Zhang, Wei; Arola, Dwayne D.; Breschi, Lorenzo; Mao, Jing; Pashley, David H.

    2014-01-01

    In this paper, we report a process for generating collagen-yttria-stabilized amorphous zirconia hybrid scaffolds by introducing acetylacetone-inhibited zirconia precursor nanodroplets into a poly(allylamine)-coated collagen matrix. This polyelectrolyte coating triggers intrafibrillar condensation of the precursors into amorphous zirconia, which is subsequently transformed into tetragonal yttria-stabilized zirconia after calcination. Our findings represent a new paradigm in the synthesis of non-naturally occurring collagen-based hybrid scaffolds under alcoholic mineralizing conditions. PMID:25477773

  5. Effects of radiation and fission product incorporation in a yttria-stabilized zirconia based inert matrix fuel

    NASA Astrophysics Data System (ADS)

    Zhu, Sha

    This work has investigated the irradiation and incorporation effects of fission products in a yttria-stabilized zirconia (YSZ) based inert matrix fuel (IMF). The concept of inert matrix fuel is based on a new strategy for disposition of plutonium generated from the reprocessing of commercial nuclear fuel and the dismantling of nuclear weapons, i.e. using uranium-free oxides to "burn" plutonium and other actinides (Np, Cm, and Am) in reactors. This approach allows direct disposal, without reprocessing, after once-through burn-up. YSZ and MgAl2O4-YSZ composites are among the potential ceramics for IMF due to their high chemical durability and radiation resistance. The research involved investigating the production, nature, and accumulation of irradiation-induced defects, the behavior of the fission products in the ceramics, the structural stability and amorphization resistance of the YSZ during implantation. Ion implantations were conducted with 200--400 keV Cs+, Sr+, I+, Xe+ and Ti+ up to fluences of 1 x 1017/cm 2 at both room temperature and temperatures of 600--700°C. Thermal annealing was subsequently completed after room temperature ion implantations. In situ and ex situ transmission electron microscopy (TEM), optical absorption spectroscopy, photo-luminescence spectroscopy, and electron paramagnetic resonance (EPR) spectroscopy were employed to characterize the irradiation induced defect evolution and analyze the defect structures. Various irradiation effects were observed and determined in the experiments, such as point defects (F type and V type color centers), defect clusters (dislocation loops), cavities (voids and bubbles), the crystalline-to-amorphous transition, and the phase transformation from fluorite to pyrochlore structure. The ion irradiation-induced amorphization mechanism, the retention ability of the fission products, and structural stability of YSZ are discussed in terms of ion incorporation effects, implanted ion radii, and the solubility

  6. Making yttria-stabilized tetragonal zirconia translucent

    PubMed Central

    Zhang, Yu

    2014-01-01

    Objective The aim of this study was to provide a design guideline for developing tetragonal yttria-stabilized zirconia with improved translucency. Methods The translucency, the in-line transmission in particular, of 3 mol.% yttria-stabilized tetragonal zirconia (3Y-TZP) has been examined using the Rayleigh scattering model. The theory predicts that the in-line transmission of 3Y-TZP can be related to its thickness with grain size and birefringence the governing parameters. To achieve a threshold value of translucency, the critical grain size of 3Y-TZP was predicted for various thicknesses (0.3 – 2.0 mm). The threshold value was defined by a measured average in-line transmission value of a suite of dental porcelains with a common thickness of 1 mm. Our theoretical predictions were calibrated with one of the very few experimental data available in the literature. Results For a dense, high-purity zirconia, its in-line transmission increased with decreasing grain size and thickness. To achieve a translucency similar to that of dental porcelains, a nanocyrstalline 3Y-TZP structure was necessitated, due primarily to its large birefringence and high refractive index. Such a grain size dependence became more pronounced as the 3Y-TZP thickness increased. For example, at a thickness of 1.3 mm, the mean grain size of a translucent 3Y-TZP should be 82 nm. At 1.5 mm and 2 mm thicknesses, the mean grain size needed to be 77 nm and 70 nm, respectively. Significance A promising future for zirconia restorations, with combined translucency and mechanical properties, can be realized by reducing its grain size. PMID:25193781

  7. Transparent and hard zirconia-based hybrid coatings with excellent dynamic/thermoresponsive oleophobicity, thermal durability, and hydrolytic stability.

    PubMed

    Masheder, Benjamin; Urata, Chihiro; Hozumi, Atsushi

    2013-08-28

    Smooth, transparent, and extremely hard zirconia (ZrO2)-based inorganic-organic hybrid films showing excellent dynamic oleophobicity, thermal durability, and hydrolytic stability were successfully prepared through a simple combination of zirconium tetrapropoxide (Zr(O(CH2)2CH3)4) with stearic acids. In this study, we have particularly focused on the effects of stearic acid molecular architecture (linear-stearic acid (LSA) and branched-stearic acid (BSA)) on surface physical/chemical properties. Although, in each case, the resulting hybrid (Zr:LSA and Zr:BSA) films achieved by a simple spin-coating method were highly smooth and transparent, the final surface properties were markedly dependent on their molecular architectures. Thanks to the thermal stability of BSA, our Zr:BSA hybrid films displayed a greatly improved thermal effective range (maximum of 200 °C), while for Zr:LSA hybrid films, serious thermal damage to surface dewetting behavior was observed at less than 150 °C. The hardness of the Zr:BSA hybrid films were markedly increased by curing at 200 °C for 1 h (from 1.95 GPa to 3.03 GPa), while maintaining their dynamic dewettability toward n-hexadecane, when compared with Zr:LSA hybrid films (0.95-1.19 GPa). Small volume n-hexadecane droplets (5 μL) were easily set in motion, sliding across and off our best Zr:BSA hybrid film surfaces at low substrate tilt angles (<10°) without pinning. Moreover, they also showed thermoresponsive dynamic dewetting behavior, reasonable resistance to hydrolysis in an aqueous environment, and antifingerprint properties.

  8. Mechanical properties of yttria-stabilized zirconia ceramics

    NASA Astrophysics Data System (ADS)

    Shirooyeh A, Mahmood R.

    Superplasticity is a well-known characteristic of Y2O 3-stabilized tetragonal zirconia (3Y-TZP) ceramic composites at elevated temperatures. The present investigation was originated to evaluate the potential of producing zirconia ceramics suitable for achieving superplasticity. High purity 3 mol% Y2O3-stabilized tetragonal zirconia (3Y-TZP) ceramic composites containing 20 wt% alumina were successfully consolidated by application of Cold Isostatic Pressing (CIP) followed by a subsequent sintering process. Constant-stress tensile creep experiments at elevated temperatures were conducted in order to examine plastic deformation behavior of the material. In addition to mechanical testing data, the microstructure observations confirmed superplastic properties of the ceramic composite. It is also known that in order to attain High Strain Rate Superplasticity (HSRS) in zirconia ceramics, it is essential to retain a stable fine-grained microstructure at high temperatures. Experiments have confirmed that adding a second soft phase such as spinel can facilitate to reach high strain-rate superplasticity in zirconia ceramics by suppressing grain growth during sintering process and enhancing cation diffusion. In the present investigation, homogenous 3Y-TZP ceramic composite powders containing 30 vol% MgAl2O4 spinel were successfully prepared through both physical-based and chemical-based methods. An electric current-activated method known as Spark Plasma Sintering (SPS) was employed for powder consolidation process. This is a very rapid electric current-activated sintering technique having a heating rate of 300 K/min. The powder preparation and consolidation steps were carried out over a wide range of conditions to ensure a homogenous nanocomposite. The experiments showed that fully-dense zirconia ceramics with an average initial grain size of the order of ˜100 nm can be sintered at the relatively low processing temperature of 1373 K in 10 min. In order to study the

  9. Stability of yttria-stabilized zirconia during pyroprocessing tests

    NASA Astrophysics Data System (ADS)

    Choi, Eun-Young; Lee, Jeong; Lee, Sung-Jai; Kim, Sung-Wook; Jeon, Sang-Chae; Cho, Soo Haeng; Oh, Seung Chul; Jeon, Min Ku; Lee, Sang Kwon; Kang, Hyun Woo; Hur, Jin-Mok

    2016-07-01

    In this study, the feasibility of yttria-stabilized zirconia (YSZ) was investigated for use as a ceramic material, which can be commonly used for both electrolytic reduction and electrorefining. First, the stability of YSZ in salts for electrolytic reduction and electrorefining was examined. Then, its stability was demonstrated by a series of pyroprocessing tests, such as electrolytic reduction, LiCl distillation, electrorefining, and LiClsbnd KCl distillation, using a single stainless steel wire mesh basket containing fuel and YSZ. A single basket was used by its transportation from one test to subsequent tests without the requirements for unloading.

  10. Radiation damage in cubic-stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Costantini, Jean-Marc; Beuneu, François; Weber, William J.

    2013-09-01

    Cubic yttria-stabilized zirconia (YSZ) can be used for nuclear applications as an inert matrix for actinide immobilization or transmutation. Indeed, the large amount of native oxygen vacancies leads to a high radiation tolerance of this material owing to defect recombination occurring in the atomic displacement cascades induced by fast neutron irradiation or ion implantations, as showed by molecular dynamics (MD) simulations. Amorphization cannot be obtained in YSZ either by nuclear-collision or electronic-excitation damage, just like in urania. A kind of polygonization structure with slightly disoriented crystalline domains is obtained in both cases. In the first steps of damage, specific isolated point defects (like F+-type color centers) and point-defect clusters are produced by nuclear collisions with charged particles or neutrons. Further increase of damage leads to dislocation-loop formation then to collapse of the dislocation network into a polygonization structure. For swift heavy ion irradiations, a similar polygonization structure is obtained above a threshold stopping power value of about 20-30 keV nm-1.

  11. Radiation damage in cubic-stabilized zirconia

    SciTech Connect

    Costantini, Jean-Marc; Beuneu, Francois; Weber, William J

    2013-01-01

    Cubic yttria-stabilized zirconia (YSZ) can be used for nuclear applications as an inert matrix for actinide immobilization or transmutation. Indeed, the large amount of native oxygen vacancies leads to a high radiation tolerance of this material owing to defect recombination occurring in the atomic displacements cascades induced by fast neutron irradiation or ion implantations, as showed by Molecular dynamics (MD) simulations. Amorphization cannot be obtained in YSZ either by nuclear-collision or electronic-excitation damage, just like in urania. A kind of polygonization structure with slightly disoriented crystalline domains is obtained in both cases. In the first steps of damage, specific isolated point defects (like F+-type color centers) and point-defect clusters are produced by nuclear collisions with charged particles or neutrons. Further increase of damage leads to dislocation-loop formation, then to collapse of the dislocation network into a polygonization structure. For swift heavy ion irradiations, a similar polygonization structure is obtained above a threshold stopping power value of about 20-30 keV nm-1.

  12. Enhanced structural stability of nanoporous zirconia under irradiation of He

    SciTech Connect

    Yang, Tengfei; Huang, Xuejun; Wang, Chenxu; Zhang, Yanwen; Xue, Jianming; Yan, Sha; Wang, Yuguang

    2012-01-01

    This work reports a greatly enhanced tolerance for He irradiation-induced swelling in nanocrystalline zirconia film with interconnected nanoporous structure (hereinafter referred as to NC-C). Compared to bulk yttria-stabilized zirconia (YSZ) and another nanocrystalline zirconia film only with discrete nano voids (hereinafter referred as to NC-V), the NC-C film reveals good tolerance for irradiation of high-fluence He. No appreciable surface blistering can be found even at the highest fluence of 6 1017 cm2 in NCC film. From TEM analysis of as-irradiated samples, the enhanced tolerance for volume swelling in NCC film is attributed to the enhanced diffusion mechanism of deposited He via widely distributed nano channels. Furthermore, the growth of grain size is quite small for both nanocrystalline zirconia films after irradiation, which is ascribed to the decreasing of area of grain boundary due to loose structure and low energy of primary knock-on atoms for He ions.

  13. Study of Laser Drilled Hole Quality of Yttria Stabilized Zirconia

    NASA Astrophysics Data System (ADS)

    Saini, Surendra K.; Dubey, Avanish K.; Pant, Piyush; Upadhyay, B. N.; Choubey, A.

    2017-09-01

    The Yttria Stabilized Zirconia ceramic is extensively used in aerospace, automotives, medical and microelectronics industries. These applications demand manufacturing of different macro and micro features with close tolerances in this material. To make miniature holes with accurate dimensions in advanced ceramics such as Yttria Stabilized Zirconia is very difficult due to its tailored attributes such as high toughness, hardness, strength, resistance to wear, corrosion and temperature. Due to inherent characteristics of laser drilling, researchers are working to fulfill the requirement of creation of micro holes in advanced ceramics. The present research investigates the laser drilling of 2 mm thick Yttria Stabilized Zirconia with the aim to achieve good micro holes with reduced geometrical inaccuracies and improved hole quality. The results show that multiple quality response comprising hole circularity, hole taper and recast layer thickness has been improved at optimally selected process parameters.

  14. Defect Interactions and Ionic Transport in Scandia Stabilized Zirconia

    SciTech Connect

    Devanathan, Ramaswami; Thevuthasan, Suntharampillai; Gale, Julian D.

    2009-06-24

    Atomistic simulation has been used to study ionic transport in scandia-stabilized zirconia, as well as scandia and yttria-co-doped zirconia, as a function of temperature and composition. The oxygen diffusion coefficient shows a peak at a composition of 6 mole % Sc2O3. Oxygen vacancies prefer to be second nearest neighbours to yttrium ions, but have little preference between first and second neighbour positions with respect to scandium ions. The Sc-O bond length is about 2.17 Å compared to 2.28 Å for the Y-O bond. Oxygen migration between cation tetrahedra is impeded less effectively by Sc-Sc edges than by Y-Y edges. A neutral cluster of two scandium ions with an oxygen vacancy in the common first neighbour position has a binding energy of -0.56 eV. The formation of such clusters may contribute to conductivity degradation of stabilized zirconia at elevated temperature.

  15. Scandia-and-Yttria-Stabilized Zirconia for Thermal Barriers

    NASA Technical Reports Server (NTRS)

    Mess, Derek

    2003-01-01

    yttria in suitable proportions has shown promise of being a superior thermal- barrier coating (TBC) material, relative to zirconia stabilized with yttria only. More specifically, a range of compositions in the zirconia/scandia/yttria material system has been found to afford increased resistance to deleterious phase transformations at temperatures high enough to cause deterioration of yttria-stabilized zirconia. Yttria-stabilized zirconia TBCs have been applied to metallic substrates in gas turbine and jet engines to protect the substrates against high operating temperatures. These coatings have porous and microcracked structures, which can accommodate strains induced by thermal-expansion mismatch and thermal shock. The longevity of such a coating depends upon yttria as a stabilizing additive that helps to maintain the zirconia in an yttria-rich, socalled non-transformable tetragonal crystallographic phase, thus preventing transformation to the monoclinic phase with an associated deleterious volume change. However, at a temperature greater than about 1,200 C, there is sufficient atomic mobility that the equilibrium, transformable zirconia phase is formed. Upon subsequent cooling, this phase transforms to the monoclinic phase, with an associated volume change that adversely affects the integrity of the coating. Recently, scandia was identified as a stabilizer that could be used instead of, or in addition to, yttria. Of particular interest are scandia-and-yttria-stabilized zirconia (SYSZ) compositions of about 6 mole percent scandia and 1 mole percent yttria, which have been found to exhibit remarkable phase stability at a temperature of 1,400 C in simple aging tests. Unfortunately, scandia is expensive, so that the problem becomes one of determining whether there are compositions with smaller proportions of scandia that afford the required high-temperature stability. In an attempt to solve this problem, experiments were performed on specimens made with reduced

  16. Zirconia coating for enhanced thermal stability of gold nanoparticles

    NASA Astrophysics Data System (ADS)

    Pastre, A.; Cristini-Robbe, O.; Bois, L.; Chassagneux, F.; Branzea, D.; Boé, A.; Kinowski, C.; Raulin, K.; Rolland, N.; Bernard, R.

    2016-01-01

    This paper describes a rapid, simple and one-step method for the preparation of 2-4 nm diameter zirconia-coated gold nanoparticles at room temperature. These nanoparticles were synthesized by two simultaneous processes: the chemical reduction of tetrachloroauric acid with sodium borohydride and the formation of zirconia sol-gel matrices. All the gold nanoparticle sols were characterized by UV-visible absorption and transmission electron microscopy to determine the nanoparticle size and shape. The synthesis method is a combination of a polymeric structure of the amorphous zirconia and the use of a strong reducing agent, and it yields to very small quasi-spherical gold nanoparticles at room temperature. The thermal stability up to 1200 °C of the coated nanoparticles was studied by x-ray diffraction. The metastable tetragonal phase of the zirconia coating was obtained at 400 °C, and a progressive transformation from tetragonal to monoclinic phases of the zirconia coating was observed up to 1100 °C. After the heat treatment at 400 °C, the crystallite size of the gold nanoparticles was about 29 nm, and it remained unchanged from 400 °C to 1200 °C. These results are promising for the development of such materials as doping elements for optical fiber applications.

  17. Effect of Time and Temperature on Transformation Toughened Zirconias.

    DTIC Science & Technology

    1987-06-01

    TTZ) and tetragonal airconia polycrystal ( TZP ), as well as sirconla toughened alumina (ZTA), among others. Zirconia based materials are of interest due... zirconia case, two ftctors that affect the analysis are the difficulty in resolving the tetragonal (101) and cubic (111) peaks when copper radiation is...The materials were magnesia stabilized transforma- tion toughened zirconia , yttria stabilized tetragonal zirconia polycrystal, and zirconia toughened

  18. Reactions of yttria-stabilized zirconia with oxides and sulfates of various elements

    NASA Technical Reports Server (NTRS)

    Zaplatynsky, I.

    1978-01-01

    The reactions between partially stabilized zirconia, containing 8 weight-percent yttria, and oxides and sulfates of various elements were studied at 1200, 1300, and 1400 C for times to 800, 400, and 200 hours, respectively. These oxides and sulfates represent impurities and additives potentially present in gas turbine fuels or impurities in the turbine combustion air as well as the elements of the substrate alloys in contact with zirconia. Based on the results, these compounds can be classified in four groups: (1) compounds which did not react with zirconia (Na2SO4, K2SO4, Cr2O3, Al2O3 and NiO); (2) compounds that reached completely with both zirconia phases (CaO, BaO, and BaSO4); (3) compounds that reacted preferentially with monoclinic zirconia (Na2O, K2O, CoO, Fe2O3, MgO, SiO2, and ZnO); and (4) compounds that reacted preferentially with cubic zirconia (V2O5, P2O5).

  19. Contact damage in an yttria stabilized zirconia: implications.

    PubMed

    Zhou, J; Mah, J; Shrotriya, P; Mercer, C; Soboyejo, W O

    2007-01-01

    This paper presents the results of a combined experimental and computational study of contact damage in a 3 mole% yttria partially stabilized zirconia (3-YSZ) that is relevant to hip implants and dental restorations. Contact-induced loading in real applications is idealized using Hertzian contact model to explain plasticity phenomena and failure mechanisms observed under monotonic and cyclic loading. Under monotonic loading, the elastic moduli increase with increasing loading levels. Under cyclic loading, the ceramic specimens fail with progressive cone cracking. X-ray analyses reveal that stress-induced phase transformation (from tetragonal to monoclinic phases) occurs under cyclic contact loading above the critical load levels (approximately 8.5 kN). Furthermore, when the cyclic loading level (5.0 kN) is less than a critical load levels (7.5 kN) that is required to induce surface cone cracks, significant plastic damage is observed in the subsurface zone underneath the contact area. These suggest that the cyclic contact loading induce both plastic damage and tetragonalto-monoclinic phase transformation in the 3-YSZ, leading to significant degradation in long-term strength. The implications of the results are discussed for the design of zirconia femoral heads in total hip replacements and zirconia crowns in dental restoration.

  20. Porous Yttria-Stabilized Zirconia Microstructures for SOFC Anode Fabrication

    NASA Astrophysics Data System (ADS)

    Palakkathodi Kammampata, Sanoop

    Solid oxide fuel cells (SOFCs) are electrochemical devices that convert fuels, such as hydrogen and natural gas, to electricity at high efficiencies, e.g., up to 90 %. SOFCs are emerging as a key technology for energy production that also minimize greenhouse gas emissions compared to conventional thermal power generation. SOFCs, which are normally based on nickel-yttria stabilized zirconia (YSZ) anodes, undergo degradation with time due to their high operating temperatures and their susceptibility to damage due to anode oxidation (redox cycling) and poisoning. Ni infiltration into porous YSZ scaffolds is considered to be a promising approach for overcoming some of these problems and enhancing their redox tolerance. However, long-term instability of the morphology of these types of anodes is an important problem. The focus of this thesis was therefore to develop methods to form porous YSZ scaffolds and attempt to construct stable Ni-YSZ anodes with reasonable electrochemical performance by infiltration. In this work, the issue of long-term instability was considered to originate from both the porous YSZ scaffold microstructure and the Ni infiltration precursor employed. To study this more closely, two different porous YSZ scaffold microstructures were developed by using tape casting, followed by Ni infiltration using a polymeric precursor, known to form a continuous Ni phase, rather than electrically separated Ni particles. Ni infiltration into porous YSZ scaffolds with large grains (0.5 microm) and large pores (two types of pores: ˜0.5 microm and 5 microm) resulted in extensive Ni particle growth that resulted in poor stability and poor electrochemical performance (0.5 Ω cm2 per electrode at 800°C). Ni infiltration into a scaffold having finer grains and pores (˜200 nm each) resulted in anodes with a much lower polarization resistance of 0.11 Ω cm2 per electrode at 800°C, increasing by ˜5 % after 108 hours at this temperature.

  1. Homogeneous precipitation synthesis and electrical properties of scandia stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Xu, Gang; Zhang, Yawen; Liao, Chunsheng; Yan, Chunhua

    2001-12-01

    Homogeneous precipitation employing urea was utilized to prepare ultrafine and weakly-agglomerated 8 mol% scandia-stabilized zirconia (8ScSZ) powders. Their crystal structure, particle and electrical properties were investigated by scanning electron microscopy, high resolution transmission electron microscopy, X-ray diffraction, thermo-gravimetry and differential thermal analysis, BET surface area analysis, and impedance spectroscopy, respectively. 8ScSZ polycrystals in a pure cubic phase were obtained after sintering at a low temperature of 600 °C. Elevating sintering temperature can increase the oxide ion conductivity, especially the grain boundary conductivity.

  2. Hydrogen Sensor Based on Yttria-Stabilized Zirconia Electrolyte and Tin-Doped Indium Oxide Sensing Electrode

    SciTech Connect

    Martin, L P; Glass, R S

    2004-03-26

    A solid state electrochemical sensor has been developed for hydrogen leak detection in ambient air. The sensor uses an yttria-stabilized electrolyte with a tin-doped indium oxide sensing electrode and a Pt reference electrode. Excellent sensitivity, and response time of one second or less, are reported for hydrogen gas over the concentration range of 0.03 to 5.5% in air. Cross-sensitivity to relative humidity and to CO{sub 2} are shown to be low. The response to methane, a potentially significant source of interference for such a sensor, is significantly less than that for hydrogen. The sensor shows good reproducibility and was unaffected by thermal cycling over the course of this investigation. The effects of sensing electrode thickness and thermal aging are also reported, and the sensing mechanism is discussed. The sensor is intended for use in vehicles powered by hydrogen fuel cells and hydrogen internal combustion engines. Those vehicles will use and/or store significant quantities of hydrogen, and will require safety sensor for monitoring potential hydrogen leakage in order to ensure passenger safety.

  3. Initial Bacterial Adhesion on Different Yttria-Stabilized Tetragonal Zirconia Implant Surfaces in Vitro.

    PubMed

    Karygianni, Lamprini; Jähnig, Andrea; Schienle, Stefanie; Bernsmann, Falk; Adolfsson, Erik; Kohal, Ralf J; Chevalier, Jérôme; Hellwig, Elmar; Al-Ahmad, Ali

    2013-12-04

    Bacterial adhesion to implant biomaterials constitutes a virulence factor leading to biofilm formation, infection and treatment failure. The aim of this study was to examine the initial bacterial adhesion on different implant materials in vitro. Four implant biomaterials were incubated with Enterococcus faecalis, Staphylococcus aureus and Candida albicans for 2 h: 3 mol % yttria-stabilized tetragonal zirconia polycrystal surface (B1a), B1a with zirconium oxide (ZrO₂) coating (B2a), B1a with zirconia-based composite coating (B1b) and B1a with zirconia-based composite and ZrO₂ coatings (B2b). Bovine enamel slabs (BES) served as control. The adherent microorganisms were quantified and visualized using scanning electron microscopy (SEM); DAPI and live/dead staining. The lowest bacterial count of E. faecalis was detected on BES and the highest on B1a. The fewest vital C. albicans strains (42.22%) were detected on B2a surfaces, while most E. faecalis and S. aureus strains (approximately 80%) were vital overall. Compared to BES; coated and uncoated zirconia substrata exhibited no anti-adhesive properties. Further improvement of the material surface characteristics is essential.

  4. Initial Bacterial Adhesion on Different Yttria-Stabilized Tetragonal Zirconia Implant Surfaces in Vitro

    PubMed Central

    Karygianni, Lamprini; Jähnig, Andrea; Schienle, Stefanie; Bernsmann, Falk; Adolfsson, Erik; Kohal, Ralf J.; Chevalier, Jérôme; Hellwig, Elmar; Al-Ahmad, Ali

    2013-01-01

    Bacterial adhesion to implant biomaterials constitutes a virulence factor leading to biofilm formation, infection and treatment failure. The aim of this study was to examine the initial bacterial adhesion on different implant materials in vitro. Four implant biomaterials were incubated with Enterococcus faecalis, Staphylococcus aureus and Candida albicans for 2 h: 3 mol % yttria-stabilized tetragonal zirconia polycrystal surface (B1a), B1a with zirconium oxide (ZrO2) coating (B2a), B1a with zirconia-based composite coating (B1b) and B1a with zirconia-based composite and ZrO2 coatings (B2b). Bovine enamel slabs (BES) served as control. The adherent microorganisms were quantified and visualized using scanning electron microscopy (SEM); DAPI and live/dead staining. The lowest bacterial count of E. faecalis was detected on BES and the highest on B1a. The fewest vital C. albicans strains (42.22%) were detected on B2a surfaces, while most E. faecalis and S. aureus strains (approximately 80%) were vital overall. Compared to BES; coated and uncoated zirconia substrata exhibited no anti-adhesive properties. Further improvement of the material surface characteristics is essential. PMID:28788415

  5. Development of a High Temperature Heater using an Yttria Stabilized Zirconia Cored Brick Matrix

    NASA Technical Reports Server (NTRS)

    Smith, K. W.; Decoursin, D. G.

    1971-01-01

    The Ames pilot heater is a ceramic regenerative heater that provides high temperature air for aerodynamic and combustion experiments. The development of this heater to provide a heat storage bed with temperature capability of about 4600 R is described. A bed was designed and installed having cored brick elements of yttria-stabilized zirconia. The bed dimensions were 14 inches in diameter by 10 feet high. The thermal stress limitations of the bed were studied and maximum air flow rates based upon these limits were established. A combustion reheat system was designed and installed to provide the necessary control over the bed temperature distribution. The revised heater system was successfully operated at a maximum bed temperature of 4600 R. The successful operation demonstrated that yttria-stabilized zirconia cored brick can satisfy the high temperature-long duration requirement for storage heater applications.

  6. Effect of Bismuth Oxide on the Microstructure and Electrical Conductivity of Yttria Stabilized Zirconia

    PubMed Central

    Liu, Liwei; Zhou, Zheng; Tian, He; Li, Jixue

    2016-01-01

    Bismuth oxide (Bi2O3)-doped yttria-stabilized zirconia (YSZ) were prepared via the solid state reaction method. X-ray diffraction and electron diffraction spectroscopy results indicate that doping with 2 mol% Bi2O3 and adding 10 mol% yttria result in a stable zirconia cubic phase. Adding Bi2O3 as a dopant increases the density of zirconia to above 96%, while reducing its normal sintering temperature by approximately 250 °C. Moreover, electrical impedance analyses show that adding Bi2O3 enhances the conductivity of zirconia, improving its capability as a solid electrolyte for intermediate or even lower temperatures. PMID:26985895

  7. Effect of Bismuth Oxide on the Microstructure and Electrical Conductivity of Yttria Stabilized Zirconia.

    PubMed

    Liu, Liwei; Zhou, Zheng; Tian, He; Li, Jixue

    2016-03-14

    Bismuth oxide (Bi2O3)-doped yttria-stabilized zirconia (YSZ) were prepared via the solid state reaction method. X-ray diffraction and electron diffraction spectroscopy results indicate that doping with 2 mol% Bi2O3 and adding 10 mol% yttria result in a stable zirconia cubic phase. Adding Bi2O3 as a dopant increases the density of zirconia to above 96%, while reducing its normal sintering temperature by approximately 250°C. Moreover, electrical impedance analyses show that adding Bi2O3 enhances the conductivity of zirconia, improving its capability as a solid electrolyte for intermediate or even lower temperatures.

  8. Microwave technique applied to the hydrothermal synthesis and sintering of calcia stabilized zirconia nanoparticles

    NASA Astrophysics Data System (ADS)

    Rizzuti, Antonino; Corradi, Anna; Leonelli, Cristina; Rosa, Roberto; Pielaszek, Roman; Lojkowski, Witold

    2010-01-01

    This study is focused on the synthesis of zirconia nanopowders stabilized by 6%mol calcia prepared under hydrothermal conditions using microwave technology. Sodium hydroxide-based hydrolysis of zirconyl chloride solution containing calcium nitrate followed by microwave irradiation at the temperature of 220 °C for 30 min was sufficient to obtain white powders of crystalline calcia stabilized zirconia. By means of X-ray diffraction and transmission electron microscopy, it was shown that tetragonal zirconia nanocrystallites with a size of ca 7 nm and diameter/standard deviation ratio of 0.10 were formed. The effects of the [Ca2+] and [NaOH] as well as temperature and time of microwave irradiation on the density and specific surface area were evaluated. Sintering test of the tetragonal nanopowders at 1,300 °C in air was performed in a monomode microwave applicator. The sample was sintered to the density of 95% and the grain size, analyzed by field emission scanning electron microscopy, was in the range from 90 to 170 nm.

  9. Increase in Strength of Partially Stabilized Zirconia After Shot Peening

    NASA Astrophysics Data System (ADS)

    Takahashi, Koji; Iwanaka, Kae; Osada, Toshio; Koike, Hitonobu

    2015-09-01

    The effects of shot peening (SP) on the strength of partially stabilized zirconia (PSZ) were studied. The compressive residual stress, apparent fracture toughness ( K C), and bending strength values of specimens subjected to SP were investigated. Results of x-ray diffraction analyses showed that SP introduced large compressive residual stress in specimens. As a result, the K C and bending strength values of specimens having semi-elliptical pre-cracks on their surfaces increased significantly. Shot-peened specimens having surface pre-cracks with lengths less than 140 µm exhibited strength comparable to that of smooth specimens and fractured outside the pre-crack zone, indicating that the pre-cracks were rendered harmless by SP. Thus, the introduction of a compressive residual stress by SP is an effective technique for increasing the strength of PSZ.

  10. Shear Bond Strength of Porcelain to a Base-Metal Compared to Zirconia Core.

    PubMed

    Abrisham, S M; Fallah Tafti, A; Kheirkhah, S; Tavakkoli, M A

    2017-03-01

    Recent clinical results for Zirconia all-ceramic restorations have revealed that the fracture rate 6-15% of the Zirconia framework is so low and the core of Zirconia has high stability. However, chipping-off fractures of porcelain are the most common reason for failures of Zirconia in the fixed partial dentures. The purpose of this study was to compare the shear bond strength (SBS) of porcelain in the porcelain fused to metal and all-ceramic crowns with Zirconia core. Two groups were selected: porcelain fused to metal (PFM) and porcelain fused to Zirconia (PFZ) (n = 30).In the PFM group, a wax model (10 × 10 × 10mm)was used to cast metal base (Ni_Cr alloy). In the PFZ group, an acrylic cubic model (10 × 10 × 10mm) was made as Zirconia model for scanning.15 cubic Zirconia samples were milled by CAD-CAM. The procedure of porcelain veneering was conducted by the conventional layering technique up to 2 mm thickness (2.5 × 2.5 × 2 mm). All specimens were stored in water for 48 hrs. Thermal cycling was conducted for 20000 cycles between 55°C and 5ºC alternatively for 30s.All samples were mounted in acrylic resin and the SBS test was performed, using a universal testing machine. The analysis of data was performed at a significance level of 0.05 using Kolmogorov-Smirnov and Mann-Whitney U-test. Mean of SBS in PFM and PFZ was 24.57 and 20.88, respectively. The results of Mann-Whitney test showed that there was no statistically significant difference between the two groups of porcelain fused to metal and Zirconia in item shear bond strength (p = 0.455). There was no significant difference between the two groups of PFM and PFZ in the item SBS.

  11. Comparison of the osteogenic potential of titanium- and modified zirconia-based bioceramics.

    PubMed

    Cho, Young-Dan; Shin, Ji-Cheol; Kim, Hye-Lee; Gerelmaa, Myagmar; Yoon, Hyung-In; Ryoo, Hyun-Mo; Kim, Dae-Joon; Han, Jung-Suk

    2014-03-13

    Zirconia is now favored over titanium for use in dental implant materials because of its superior aesthetic qualities. However, zirconia is susceptible to degradation at lower temperatures. In order to address this issue, we have developed modified zirconia implants that contain tantalum oxide or niobium oxide. Cells attached as efficiently to the zirconia implants as to titanium-based materials, irrespective of surface roughness. Cell proliferation on the polished surface was higher than that on the rough surfaces, but the converse was true for the osteogenic response. Cells on yttrium (Y)/tantalum (Ta)- and yttrium (Y)/niobium (Nb)-stabilized tetragonal zirconia polycrystals (TZP) discs ((Y, Ta)-TZP and (Y, Nb)-TZP, respectively) had a similar proliferative potential as those grown on anodized titanium. The osteogenic potential of MC3T3-E1 pre-osteoblast cells on (Y, Ta)-TZP and (Y, Nb)-TZP was similar to that of cells grown on rough-surface titanium. These data demonstrate that improved zirconia implants, which are resistant to temperature-induced degradation, retain the desirable clinical properties of structural stability and support of an osteogenic response.

  12. Current status of zirconia restoration.

    PubMed

    Miyazaki, Takashi; Nakamura, Takashi; Matsumura, Hideo; Ban, Seiji; Kobayashi, Taira

    2013-10-01

    During the past decade, zirconia-based ceramics have been successfully introduced into the clinic to fabricate fixed dental prostheses (FDPs), along with a dental computer-aided/computer-aided manufacturing (CAD/CAM) system. In this article (1) development of dental ceramics, (2) the current status of dental CAD/CAM systems, (3) CAD/CAM and zirconia restoration, (4) bond between zirconia and veneering ceramics, (5) bond of zirconia with resin-based luting agents, (6) surface finish of zirconia restoration and antagonist enamel wear, and (7) clinical evaluation of zirconia restoration are reviewed. Yttria partially stabilized tetragonal zirconia polycrystalline (Y-TZP) showed better mechanical properties and superior resistance to fracture than other conventional dental ceramics. Furthermore, ceria-stabilized tetragonal zirconia polycrystalline and alumina nanocomposites (Ce-TZP/A) had the highest fracture toughness and had resistance to low-temperature aging degradation. Both zirconia-based ceramics have been clinically available as an alternative to the metal framework for fixed dental prostheses (FDPs). Marginal adaptation of zirconia-based FDPs is acceptable for clinical application. The most frequent clinical complication with zirconia-based FDPs was chipping of the veneering porcelain that was affected by many factors. The mechanism for the bonding between zirconia and veneering ceramics remains unknown. There was no clear evidence of chemical bonding and the bond strength between zirconia and porcelain was lower than that between metal and porcelain. There were two alternatives proposed that might avoid chipping of veneering porcelains. One was hybrid-structured FDPs comprising CAD/CAM-fabricated porcelain parts adhering to a CAD/CAM fabricated zirconia framework. Another option was full-contour zirconia FDPs using high translucent zirconia. Combined application of silica coating and/or silane coupler, and 10-methacryloyloxydecyl dihydrogen phosphate is

  13. Microstructural characteristics of plasma sprayed nanostructured partially stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Lima, Rogerio Soares

    Thermal barrier coatings have been extensively applied in the aerospace industry in turbines and rocket engines as an insulation system. Partially stabilized zirconia, due to its high thermal stability and low thermal conductivity at high temperatures has been traditionally employed as the ceramic element of the thermal barrier coating system. Different approaches have been taken in order to improve the performance of these coatings. Nanostructured materials are promising an interesting future in the beginning of the 21st century. Due to its enhanced strain to failure and superplasticity new applications may be accomplished or the limits of materials utilization may be placed at higher levels. Single nanostructured particles can not be thermal sprayed by conventional thermal spray equipment. Due to its low mass, they would be deviated to the periphery of the thermal spray jet. To overcome this characteristic, single nanostructured particles were successively agglomerated into large microscopic particles, with particle size distribution similar to the conventional feedstocks for thermal spray equipment. Agglomerated nanostructured particles of partially stabilized zirconia were plasma sprayed in air with different spray parameters. According to traditional thermal spray procedure, the feedstock has to be melted in the thermal spray jet in order to achieve the necessary conditions for adhesion and cohesion on the substrate. Due to the nature of the nanostructured particles, a new step has to be taken in the thermal spray processing; particle melting has to be avoided in order to preserve the feedstock nanostructure in the coating overall microstructure. In this work, the adhesion/cohesion system of nanostructured coatings is investigated and clarified. A percentage of molten particles will retain and hold the non-molten agglomerated nanostructured particles in the coating overall microstructure. Controlling the spray parameters it was possible to produce coatings

  14. Phase stability and rapid consolidation of hydroxyapatite-zirconia nano-coprecipitates made using continuous hydrothermal flow synthesis.

    PubMed

    Chaudhry, Aqif A; Yan, Haixue; Viola, Giuseppe; Reece, Mike J; Knowles, Jonathan C; Gong, Kenan; Rehman, Ihtesham; Darr, Jawwad A

    2012-07-01

    A rapid and continuous hydrothermal route for the synthesis of nano-sized hydroxyapatite rods co-precipitated with calcium-doped zirconia nanoparticles using a superheated water flow at 450°C and 24.1 MPa as a crystallizing medium is described. Hydroxyapatite and calcium-doped zirconia phases in the powder mixtures could be clearly identified based on particle size and morphology under transmission electron microscopy. Retention of a nanostructure after sintering is crucial to load-bearing applications of hydroxyapatite-based ceramics. Therefore, rapid consolidation of the co-precipitates was investigated using a spark plasma sintering furnace under a range of processing conditions. Samples nominally containing 5 and 10 wt% calcium-doped zirconia and hydroxyapatite made with Ca:P solution molar ratio 2.5 showed excellent thermal stability (investigated using in situ variable temperature X-ray diffraction) and were sintered via spark plasma sintering to >96% sintered densities at 1000°C resulting in hydroxyapatite and calcium-doped zirconia as the only two phases. Mechanical tests of spark plasma sintering sintered samples (containing 10 wt% calcium-doped zirconia) revealed a three-pt flexural strength of 107.7 MPa and Weibull modulus of 9.9. The complementary nature of the spark plasma sintering technique and continuous hydrothermal flow synthesis (which results in retention of a nanostructure even after sintering at elevated temperatures) was hence showcased.

  15. Enhancing ionic conductivity of bulk single-crystal yttria-stabilized zirconia by tailoring dopant distribution

    SciTech Connect

    Lee, E.; Prinz, F. B.; Cai, W.

    2011-02-11

    We present an ab initio–based kinetic Monte Carlo model for ionic conductivity in single-crystal yttria-stabilized zirconia. Ionic interactions are taken into account by combining density functional theory calculations and the cluster expansion method and are found to be essential in reproducing the effective activation energy observed in experiments. The model predicts that the effective energy barrier can be reduced by 0.15–0.25 eV by arranging the dopant ions into a superlattice.

  16. Sulfated zirconia as a proton conductor for fuel cells: Stability to hydrolysis and influence on catalysts

    NASA Astrophysics Data System (ADS)

    Tominaka, Satoshi; Momma, Toshiyuki; Scrosati, Bruno; Osaka, Tetsuya

    Sulfated zirconia is an inorganic solid superacid having sulfate groups covalently bonded to its surface. In this work, sulfated zirconia is synthesized by a solvent-free method to obtain it in the nanoparticle form. This nanostructured sulfated zirconia has been evaluated in terms of (i) chemical stability to hydrolysis and to hydrogen peroxide by thermogravimetric analysis, and (ii) influences on Pt catalyst activity by cyclic voltammetry using sulfated-zirconia dispersion as a supporting electrolyte solution. The results demonstrate that our sulfated zirconia is stable almost perfectly to hydrolysis but partly decomposed by a Fenton reagent containing hydrogen peroxide and Fe 2+. In addition, we show that oxygen reduction activity of Pt catalyst in a sulfated-zirconia dispersion is comparatively high (specific activity at 0.9 V vs. RHE, i 0.9: ca. 17 μA cm -2) compared to that in a 0.5 M sulfuric acid solution (i 0.9: ca. 15 μA cm -2). Finally, we demonstrate that sulfated zirconia does not influence hydrogen oxidation reaction. These results lead us to conclude that sulfated zirconia is a promising proton conductor for fuel cells.

  17. Comparison of the Osteogenic Potential of Titanium and Modified Zirconia-Based Bioceramics

    PubMed Central

    Cho, Young-Dan; Shin, Ji-Cheol; Kim, Hye-Lee; Gerelmaa, Myagmar; Yoon, Hyung-In; Ryoo, Hyun-Mo; Kim, Dae-Joon; Han, Jung-Suk

    2014-01-01

    Zirconia is now favored over titanium for use in dental implant materials because of its superior aesthetic qualities. However, zirconia is susceptible to degradation at lower temperatures. In order to address this issue, we have developed modified zirconia implants that contain tantalum oxide or niobium oxide. Cells attached as efficiently to the zirconia implants as to titanium-based materials, irrespective of surface roughness. Cell proliferation on the polished surface was higher than that on the rough surfaces, but the converse was true for the osteogenic response. Cells on yttrium oxide (Y2O3)/tantalum oxide (Ta2O5)- and yttrium oxide (Y2O3)/niobium oxide (Nb2O5)-containing tetragonal zirconia polycrystals (TZP) discs ((Y, Ta)-TZP and (Y, Nb)-TZP, respectively) had a similar proliferative potential as those grown on anodized titanium. The osteogenic potential of MC3T3-E1 pre-osteoblast cells on (Y, Ta)-TZP and (Y, Nb)-TZP was similar to that of cells grown on rough-surface titanium. These data demonstrate that improved zirconia implants, which are resistant to temperature-induced degradation, retain the desirable clinical properties of structural stability and support of an osteogenic response. PMID:24633198

  18. Crystallization of zirconia based thin films.

    PubMed

    Stender, D; Frison, R; Conder, K; Rupp, J L M; Scherrer, B; Martynczuk, J M; Gauckler, L J; Schneider, C W; Lippert, T; Wokaun, A

    2015-07-28

    The crystallization kinetics of amorphous 3 and 8 mol% yttria stabilized zirconia (3YSZ and 8YSZ) thin films grown by pulsed laser deposition (PLD), spray pyrolysis and dc-magnetron sputtering are explored. The deposited films were heat treated up to 1000 °C ex situ and in situ in an X-ray diffractometer. A minimum temperature of 275 °C was determined at which as-deposited amorphous PLD grown 3YSZ films fully crystallize within five hours. Above 325 °C these films transform nearly instantaneously with a high degree of micro-strain when crystallized below 500 °C. In these films the t'' phase crystallizes which transforms at T > 600 °C to the t' phase upon relaxation of the micro-strain. Furthermore, the crystallization of 8YSZ thin films grown by PLD, spray pyrolysis and dc-sputtering are characterized by in situ XRD measurements. At a constant heating rate of 2.4 K min(-1) crystallization is accomplished after reaching 800 °C, while PLD grown thin films were completely crystallized already at ca. 300 °C.

  19. Radiation tolerance of nanocrystalline ceramics: Insights from yttria stabilized zirconia

    SciTech Connect

    Dey, Sanchita; Drazin, John W.; Wang, Yongqiang; Valdez, James A.; Holesinger, Terry G.; Uberuaga, Blas P.; Castro, Ricardo H. R.

    2015-01-13

    Materials for applications in hostile environments, such as nuclear reactors or radioactive waste immobilization, require extremely high resistance to radiation damage, such as resistance to amorphization or volume swelling. Nanocrystalline materials have been reported to present exceptionally high radiation-tolerance to amorphization. In principle, grain boundaries that are prevalent in nanomaterials could act as sinks for point-defects, enhancing defect recombination. In this paper we present evidence for this mechanism in nanograined Yttria Stabilized Zirconia (YSZ), associated with the observation that the concentration of defects after irradiation using heavy ions (Kr⁺, 400 keV) is inversely proportional to the grain size. HAADF images suggest the short migration distances in nanograined YSZ allow radiation induced interstitials to reach the grain boundaries on the irradiation time scale, leaving behind only vacancy clusters distributed within the grain. Because of the relatively low temperature of the irradiations and the fact that interstitials diffuse thermally more slowly than vacancies, this result indicates that the interstitials must reach the boundaries directly in the collision cascade, consistent with previous simulation results. Concomitant radiation-induced grain growth was observed which, as a consequence of the non-uniform implantation, caused cracking of the nano-samples induced by local stresses at the irradiated/non-irradiated interfaces.

  20. Graphene nanosheet-induced toughening of yttria-stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Su, Jianan; Chen, Yao; Huang, Qiqi

    2017-01-01

    Graphene nanosheet (GNS)-reinforced yttria-stabilized tetragonal zirconia polycrystals (TZP) were synthesized using spark plasma sintering (SPS), and the influences of the added GNSs on microstructure evolution and the microscopic mechanical properties of the sintered composites were investigated. Raman spectroscopy and microstructure observation corroborated that these added GNSs, which can survive the harsh SPS processing condition, homogeneously distribute in the matrix of all composites to hinder significantly the grain growth. In comparison with the monolithic TZP, the indentation fracture toughness of a GNS/TZP composite reaches maximum value and increases by up to 36% (from 4.1 to 5.6 MPa m0.5) even at 0.5% weight fraction, GNS pullout, crack bridging, crack deflection, and crack branching are responsible for the increased fracture toughness. The computed energy dissipation by GNS pullout decreases with increasing the number of graphene layers due to weak bonding between them, and therefore, graphene agglomeration would impair toughening effect. Moreover, scratch studies suggest that GNS/TZP composites exhibit improved scratch resistance due to the fact that GNSs are promising reinforcing and lubricating nanofillers in ceramic composites.

  1. Radiation tolerance of nanocrystalline ceramics: Insights from yttria stabilized zirconia

    DOE PAGES

    Dey, Sanchita; Drazin, John W.; Wang, Yongqiang; ...

    2015-01-13

    Materials for applications in hostile environments, such as nuclear reactors or radioactive waste immobilization, require extremely high resistance to radiation damage, such as resistance to amorphization or volume swelling. Nanocrystalline materials have been reported to present exceptionally high radiation-tolerance to amorphization. In principle, grain boundaries that are prevalent in nanomaterials could act as sinks for point-defects, enhancing defect recombination. In this paper we present evidence for this mechanism in nanograined Yttria Stabilized Zirconia (YSZ), associated with the observation that the concentration of defects after irradiation using heavy ions (Kr⁺, 400 keV) is inversely proportional to the grain size. HAADF imagesmore » suggest the short migration distances in nanograined YSZ allow radiation induced interstitials to reach the grain boundaries on the irradiation time scale, leaving behind only vacancy clusters distributed within the grain. Because of the relatively low temperature of the irradiations and the fact that interstitials diffuse thermally more slowly than vacancies, this result indicates that the interstitials must reach the boundaries directly in the collision cascade, consistent with previous simulation results. Concomitant radiation-induced grain growth was observed which, as a consequence of the non-uniform implantation, caused cracking of the nano-samples induced by local stresses at the irradiated/non-irradiated interfaces.« less

  2. Radiation Tolerance of Nanocrystalline Ceramics: Insights from Yttria Stabilized Zirconia

    PubMed Central

    Dey, Sanchita; Drazin, John W.; Wang, Yongqiang; Valdez, James A.; Holesinger, Terry G.; Uberuaga, Blas P.; Castro, Ricardo H. R.

    2015-01-01

    Materials for applications in hostile environments, such as nuclear reactors or radioactive waste immobilization, require extremely high resistance to radiation damage, such as resistance to amorphization or volume swelling. Nanocrystalline materials have been reported to present exceptionally high radiation-tolerance to amorphization. In principle, grain boundaries that are prevalent in nanomaterials could act as sinks for point-defects, enhancing defect recombination. In this paper we present evidence for this mechanism in nanograined Yttria Stabilized Zirconia (YSZ), associated with the observation that the concentration of defects after irradiation using heavy ions (Kr+, 400 keV) is inversely proportional to the grain size. HAADF images suggest the short migration distances in nanograined YSZ allow radiation induced interstitials to reach the grain boundaries on the irradiation time scale, leaving behind only vacancy clusters distributed within the grain. Because of the relatively low temperature of the irradiations and the fact that interstitials diffuse thermally more slowly than vacancies, this result indicates that the interstitials must reach the boundaries directly in the collision cascade, consistent with previous simulation results. Concomitant radiation-induced grain growth was observed which, as a consequence of the non-uniform implantation, caused cracking of the nano-samples induced by local stresses at the irradiated/non-irradiated interfaces. PMID:25582769

  3. Microscopic observation of laser glazed yttria-stabilized zirconia coatings

    NASA Astrophysics Data System (ADS)

    Morks, M. F.; Berndt, C. C.; Durandet, Y.; Brandt, M.; Wang, J.

    2010-08-01

    Thermal barrier coatings (TBCs) are frequently used as insulation system for hot components in gas-turbine, combustors and power plant industries. The corrosive gases which come from combustion of low grade fuels can penetrate into the TBCs and reach the metallic components and bond coat and cause hot corrosion and erosion damage. Glazing the top coat by laser beam is advanced approach to seal TBCs surface. The laser beam has the advantage of forming a dense thin layer composed of micrograins. Plasma-sprayed yttria-stabilized zirconia (YSZ) coating was glazed with Nd-YAG laser at different operating conditions. The surface morphologies, before and after laser treatment, were investigated by scanning electron microscopy. Laser beam assisted the densification of the surface by remelting a thin layer of the exposed surface. The laser glazing converted the rough surface of TBCs into smooth micron-size grains with size of 2-9 μm and narrow grain boundaries. The glazed surfaces showed higher Vickers hardness compared to as-sprayed coatings. The results revealed that the hardness increases as the grain size decreases.

  4. Phase transformation of a new generation yttria-stabilized zirconia femoral head after total hip arthroplasty.

    PubMed

    Hayaishi, Yasuhisa; Miki, Hidenobu; Yoshikawa, Hideki; Sugano, Nobuhiko

    2008-01-01

    We examined a new-generation yttria-stabilized zirconia head manufactured by NGK 1 year after total hip arthroplasty. Monoclinic content of the retrieved head was twice that of the unused head at the pole and equator. A fourfold increase in monoclinic content was observed at 5 mm below the equator. Transformation from the tetragonal phase to the monoclinic phase occurred in the new generation zirconia with alumina doping within a relatively short period in vivo.

  5. Dynamic annealing of defects in irradiated zirconia-based ceramics

    SciTech Connect

    Devanathan, Ram; Weber, William J.

    2008-03-06

    We have observed self-healing behavior in large scale molecular dynamics simulations of 30 keV Zr recoils in pure zirconia and 10 mole % yttria-stabilized zirconia. Our results reveal that dynamic annealing is highly effective during the first 5 ps of damage evolution, especially in the presence of oxygen structural vacancies introduced by aliovalent doping (Y3+ substitution for Zr4+). The presence of mobile oxygen vacancies results in near complete recovery of damage. Damage recovery on the cation sublattice is assisted by the anion sublattice recovery, which explains the remarkable radiation tolerance of stabilized zirconia. Ceramics engineered to heal themselves in this fashion hold great promise for use in high-radiation environments or for safely encapsulating high-level radioactive waste over geological time scales.

  6. Modulation of osteoblast behavior on nanopatterned yttria-stabilized zirconia surfaces.

    PubMed

    Soon, Ginny; Pingguan-Murphy, Belinda; Akbar, Sheikh Ali

    2017-04-01

    This study utilizes the technique of self-assembly to fabricate arrays of nanoislands on (001)-oriented yttria-stabilized zirconia single crystal substrates with miscut of 10° toward <110> direction. These self-assembled nanostructures were annealed at 1100°C for 5h upon doping with 10mol% gadolinium-doped ceria (GDC) by powder-suspension based method. X-Ray diffraction result showed that the miscut substrate after doping GDC was in the cubic phase. Energy dispersive X-ray (EDX) illustrates that the nanopatterned material contains all the elements from the GDC source and yttria-stabilized zirconia (YSZ) substrate. It also demonstrates a higher surface roughness and a more hydrophilic surface. The nanostructured materials were subsequently used for an in vitro study using a human fetal osteoblastic cell line (hFOB). An improved spreading, enhanced cell proliferation and up-regulated alkaline phosphatase activity (ALP) were observed on the nanopatterned substrates compared to the control substrates. Calcium deposits, which were stained positively by Alizarin Red S, appeared to be more abundant on the nanopatterned surfaces on day 7. The overall findings suggest that post fabrication treatment with surface modification such as creating a nanostructure (e.g. nanopatterns) can improve biocompatibility. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Aqueous synthesis and processing of nanosized yttria tetragonally stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Kimel, Robert Allen

    The goal of this study is the production of bulk ceramics from well-dispersed nanosized aqueous ceramic suspensions via wet processing routes. In order to obtain this goal, yttria tetragonally stabilized zirconia (Y-TZP) was used as a model system to develop an understanding of and ability to manipulate the solution chemistry parameters of solution pH, solid loading, zeta potential and complexation chemistry in order to accomplish synthesis and processing of nanosized doped metal oxide powders in an aqueous environment. The objective of the aqueous degradation study was to establish the mechanism(s) controlling degradation of 3Y-TZP powder in aqueous suspensions at room temperature and determine the effect of this degradation on the aqueous physical chemistry of 3Y-TZP. This objective was accomplished by performing experiments on commercially available 3Y-TZP powder placed in aqueous suspensions at 25°C. It was determined that the mechanism of aqueous degradation of 3Y-TZP at room temperature was yttrium leaching. Furthermore, it was determined that the addition of oxalic acid to the aqueous suspension of 3Y-TZP impeded the aqueous degradation by interaction with the 3Y-TZP powder surface. The objective of the synthesis study was to produce well-dispersed nanosized yttria tetragonally stabilized zirconia (Y-TZP) powder in aqueous suspension. Once the nominally 7 to 8 nanometer hydrothermally prepared 1.7 Y-TZP powder was produced, experiments were begun to disperse, recover and concentrate by washing the powder via centrifugation. Centrifugation without irreversible aggregate formation was possible by taking advantage of a protective colloid formation. Protection was provided after synthesis by bicine, the synthesis complexation agent. The change in the surface chemistry of the 1.7Y-TZP powder as a function of washing was monitored by diffuse reflectance infrared Fourier transformed spectroscopy (DRIFTS) and solution chemistry analysis for metal ions in solution

  8. Fusion sputtering for bonding to zirconia-based materials.

    PubMed

    Aboushelib, Moustafa N

    2012-08-01

    To evaluate the influence of fusion sputtering on zirconia-resin microtensile bond strength after 6 months of water storage. Zirconia disks received one of the following surface treatments: particle abrasion with 50-µm aluminum oxide particles or fusion sputtering, while as-sintered specimens served as a control. The prepared zirconia disks (Lava Zirconia) were bonded to pre-aged composite disks (Filtek Z250) using a phosphatemonomer- containing resin cement (RelyX Unicem), and the bonded specimens were sectioned into micro-bars (1 x 1 x 6 mm) which were either immediately tested or after 6 months of water storage (n = 25). Scanning electron microscopy (SEM) and surface roughness were performed for the prepared specimens. Data were analyzed using two-way ANOVA (α = 0.05). Particle abrasion (33.1 MPa) and fusion sputtering (42.5 MPa) produced significantly higher MTBS values and resisted degradation after 6 months of water storage, while as-sintered specimens (12.4 MPa) demonstrated a significant reduction in bond strength after water storage (2.9 MPa). SEM examination indicated that fusion sputtering resulted in the creation of retentive zirconia beads on the treated surface, which enhanced micromechanical retention with adhesive resin and prevented interfacial failure. Fusion sputtering is a new and a simple method suitable for enhancing the bond strength of adhesive resins to zirconia-based frameworks.

  9. Molecular dynamics simulation of yttria-stabilized zirconia (YSZ) crystalline and amorphous solids.

    PubMed

    Lau, Kah Chun; Dunlap, Brett I

    2011-01-26

    An empirically fitted atomic potential allows a classical molecular dynamics study of the static and dynamic properties of both crystalline and amorphous yttria-stabilized zirconia (YSZ) with typical dilute Y(2)O(3) concentrations (i.e. 3.0-12.0 mol% Y(2)O(3)) in the temperature range 300-1400 K. Based on the rigid ion model approximation, we find, regardless of the distinctly different geometries, that the oxygen ionic conductivity shows a maximum at ∼ 8.0 mol% Y(2)O(3), close to the experimental maximum. A lower absolute ionic conductivity is found for the high density YSZ amorphous solid, relative to crystalline YSZ, consistent with the trends observed in crystalline and stabilized amorphous thin films of YSZ reported in experiments. Different from YSZ crystals, intriguing features of mutual diffusion among the heavy cations and mobile anions are found in the amorphous phase.

  10. Zirconia-coated carbonyl-iron-particle-based magnetorheological fluid for polishing optical glasses and ceramics

    SciTech Connect

    Shafrir, Shai N.; Romanofsky, Henry J.; Skarlinski, Michael; Wang, Mimi; Miao, Chunlin; Salzman, Sivan; Chartier, Taylor; Mici, Joni; Lambropoulos, John C.; Shen Rui; Yang Hong; Jacobs, Stephen D.

    2009-12-10

    We report on magnetorheological finishing (MRF) spotting experiments performed on glasses and ceramics using a zirconia-coated carbonyl-iron (CI)-particle-based magnetorheological (MR) fluid. The zirconia-coated magnetic CI particles were prepared via sol-gel synthesis in kilogram quantities. The coating layer was {approx}50-100 nm thick, faceted in surface structure, and well adhered. Coated particles showed long-term stability against aqueous corrosion. ''Free'' nanocrystalline zirconia polishing abrasives were cogenerated in the coating process, resulting in an abrasive-charged powder for MRF. A viable MR fluid was prepared simply by adding water. Spot polishing tests were performed on a variety of optical glasses and ceramics over a period of nearly three weeks with no signs of MR fluid degradation or corrosion. Stable material removal rates and smooth surfaces inside spots were obtained.

  11. Local structures surrounding Zr in nanostructurally stabilized cubic zirconia: Structural origin of phase stability

    SciTech Connect

    Soo, Y. L.; Chen, P. J.; Huang, S. H.; Shiu, T. J.; Tsai, T. Y.; Chow, Y. H.; Lin, Y. C.; Weng, S. C.; Chang, S. L.; Wang, G.; Cheung, C. L.; Sabirianov, R. F.; Mei, W. N.; Namavar, F.; Haider, H.; Garvin, K. L.; Lee, J. F.; Lee, H. Y.; Chu, P. P.

    2008-12-01

    Local environment surrounding Zr atoms in the thin films of nanocrystalline zirconia (ZrO{sub 2}) has been investigated by using the extended x-ray absorption fine structure (EXAFS) technique. These films prepared by the ion beam assisted deposition exhibit long-range structural order of cubic phase and high hardness at room temperature without chemical stabilizers. The local structure around Zr probed by EXAFS indicates a cubic Zr sublattice with O atoms located on the nearest tetragonal sites with respect to the Zr central atoms, as well as highly disordered locations. Similar Zr local structure was also found in a ZrO{sub 2} nanocrystal sample prepared by a sol-gel method. Variations in local structures due to thermal annealing were observed and analyzed. Most importantly, our x-ray results provide direct experimental evidence for the existence of oxygen vacancies arising from local disorder and distortion of the oxygen sublattice in nanocrystalline ZrO{sub 2}. These oxygen vacancies are regarded as the essential stabilizing factor for the nanostructurally stabilized cubic zirconia.

  12. Residual stress of free-standing membranes of yttria-stabilized zirconia for micro solid oxide fuel cell applications.

    PubMed

    Tarancón, Albert; Sabaté, Neus; Cavallaro, Andrea; Gràcia, Isabel; Roqueta, Jaume; Garbayo, Iñigo; Esquivel, Juan P; Garcia, Gemma; Cané, Carles; Santiso, José

    2010-02-01

    The present study is devoted to analyze the compatibility of yttria-stabilized zirconia thin films prepared by pulsed laser deposition and metalorganic chemical vapor deposition techniques, with microfabrication processes based on silicon technologies for micro solid oxide fuel cells applications. Deposition of yttria-stabilized zirconia on Si/SiO2/Si3N4 substrates was optimized for both techniques in order to obtain high density and homogeneity, as well as a good crystallinity for film thicknesses ranging from 60 to 240 nm. In addition, stabilized zirconia free-standing membranes were fabricated from the deposited films with surface areas between 50 x 50 microm2 and 820 x 820 microm2. Particular emphasis was made on the analysis of the effect of the nature of the deposition technique and the different design and fabrication parameters (membrane area, thickness and substrate deposition temperature) on the residual stress of the membranes in order to control their thermomechanical stability for application as electrolyte in micro solid oxide fuel cells.

  13. Tetragonal BiFeO{sub 3} on yttria-stabilized zirconia

    SciTech Connect

    Liu, Heng-Jui; Du, Yu-Hao; Gao, Peng; Ikuhara, Yuichi; Huang, Yen-Chin; Chen, Yi-Chun; Chen, Hsiao-Wen; Liu, Hsiang-Lin; He, Qing; Chu, Ying-Hao

    2015-11-01

    High structural susceptibility of multiferroic BiFeO{sub 3} (BFO) makes it a potential replacement of current Pb-based piezoelectrics. In this study, a tetragonal phase is identified based on a combination of x-ray diffraction, scanning transmission electronic microscopy, x-ray absorption spectroscopy, and Raman spectroscopy when BFO is grown on yttria-stabilized zirconia (YSZ) substrates. To distinguish the discrepancy between this tetragonal phase and common cases of monoclinic BFO, piezoelectric force microscopy images and optical property are also performed. It shows a lower electrostatic energy of ferroelectric domains and a large reduction of band gap for BFO grown on YSZ substrate comparing to the well-known one grown on LaAlO{sub 3} substrate. Our findings in this work can provide more insights to understand the structural diversity of multiferroic BFO system for further applications.

  14. Shear Bond Strength of Porcelain to a Base-Metal Compared to Zirconia Core

    PubMed Central

    Abrisham, SM.; Fallah Tafti, A.; Kheirkhah, S.; Tavakkoli, MA.

    2017-01-01

    Statement of Problem: Recent clinical results for Zirconia all-ceramic restorations have revealed that the fracture rate 6-15% of the Zirconia framework is so low and the core of Zirconia has high stability. However, chipping-off fractures of porcelain are the most common reason for failures of Zirconia in the fixed partial dentures. Objectives: The purpose of this study was to compare the shear bond strength (SBS) of porcelain in the porcelain fused to metal and all-ceramic crowns with Zirconia core. Materials and Methods: Two groups were selected: porcelain fused to metal (PFM) and porcelain fused to Zirconia (PFZ) (n = 30).In the PFM group, a wax model (10 × 10 × 10mm)was used to cast metal base (Ni_Cr alloy). In the PFZ group, an acrylic cubic model (10 × 10 × 10mm) was made as Zirconia model for scanning.15 cubic Zirconia samples were milled by CAD-CAM. The procedure of porcelain veneering was conducted by the conventional layering technique up to 2 mm thickness (2.5 × 2.5 × 2 mm). All specimens were stored in water for 48 hrs. Thermal cycling was conducted for 20000 cycles between 55°C and 5ºC alternatively for 30s.All samples were mounted in acrylic resin and the SBS test was performed, using a universal testing machine. The analysis of data was performed at a significance level of 0.05 using Kolmogorov-Smirnov and Mann-Whitney U-test. Results: Mean of SBS in PFM and PFZ was 24.57 and 20.88, respectively. The results of Mann-Whitney test showed that there was no statistically significant difference between the two groups of porcelain fused to metal and Zirconia in item shear bond strength (p = 0.455). Conclusions: There was no significant difference between the two groups of PFM and PFZ in the item SBS. PMID:28959767

  15. Effects of aqueous and acid-based coloring liquids on the hardness of zirconia restorations.

    PubMed

    Nam, Ji-Young; Park, Mi-Gyoung

    2017-05-01

    The effects of the application of aqueous coloring liquids on the mechanical properties of zirconia have not yet been investigated. The purpose of this in vitro study was to evaluate the effects of 3 different coloring techniques and the number of coloring liquid applications on the hardness of zirconia. Eighty specimens were divided into 8 groups (n=10); nonshaded zirconia, preshaded zirconia, acid-based coloring liquid zirconia, and aqueous coloring liquid zirconia (1, 3, 6). Vickers hardness was measured. Data were analyzed via 1-way and 2-way ANOVAs. Multiple comparisons were performed using a Scheffé test (α=.05). Statistically significant differences in hardness were found between acid-based coloring liquid zirconia and aqueous coloring liquid zirconia (P<.001). Increasing the number of coloring liquid applications decreased the hardness value of acid-based coloring liquid zirconia (P<.001) but had no effect on the hardness of aqueous coloring liquid zirconia (P>.05). Within the limitations of this study, the hardness of zirconia was influenced to differing degrees depending on coloring technique. The number of coloring liquid applications affected the hardness of zirconia colored with the acid-based coloring liquid but not the hardness of zirconia colored with the aqueous coloring liquid. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.

  16. Properties of slips of zirconia stabilized by oxides of rare earth metals

    SciTech Connect

    Kaplan, F.S.; Shulik, I.G.; Orekhova, G.P.

    1995-10-01

    Casting properties of concentrated aqueous dispersions of zirconia stabilized by Y{sub 2}O{sub 3}, Si{sub 2}O{sub 3}, or a mixture of them are investigated. Optimum values of the pH, temperature, and slip concentration for the production of thin-walled vacuum-tight articles are established.

  17. Some inelastic effects of thermal cycling on yttria-stabilized zirconia

    NASA Technical Reports Server (NTRS)

    Hendricks, R. C.; Mcdonald, G.; Bill, R. C.

    1982-01-01

    The effects of inelastic behavior of yttria-stabilized zirconia (YSZ) materials were analyzed. The results show these materials to be sensitive to small changes in temperature and are supported by measurements of inelastic behavior in disc and bar specimens at temperatures as low as 1010 C (1850 F). At higher thermomechanical loadings, the test specimens can deform to strains above 1 percent.

  18. Observations of ferroelastic switching by Raman spectroscopy in 18-percent ceria-stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Bolon, Amy; Munoz Saldana, Juan; Gentleman, Molly

    2011-03-01

    Ferroelastic switching has been shown to be responsible for significant increases in the toughness of tetragonal zirconia ceramics. Observations of switching and measurements of coercive stress have generally been limited to TEM studies on large single crystals. In this study we show that it is possible to observe ferroelastic switching in 18 mole-percent ceria stabilized zirconia using polarized confocal Raman spectroscopy. Observations were made on bulk polycrystalline samples indented with a standard Vicker's indent and exhibited reorientation of crystal domains along the crack as well as near the crack tip. Coercive stress measurements were made by loading the samples uniaxially while making measurements of domain orientation.

  19. Recent progress in zirconia-based fuel cells for power generation

    SciTech Connect

    Singhal, S.C.

    1992-01-01

    High temperature solid oxide fuel cells based upon yttria-stabilized zirconia electrolyte offer a clean, pollution-free technology to electrochemically generate electricity at high efficiencies. This paper reviews the designs, materials and fabrication processes used for such fuel cells. Most progress to date has been achieved with tubular geometry cells. A large number of tubular cells have been electrically tested, some to times up to 30,000 hours; these cells have shown excellent performance and performance stability. In addition, successively larger size electric generators utilizing these cells have been designed, built and operated since 1984. Two 25 kW power generation field test units have recently been fabricated; these units represent a major milestone in the commercialization of zirconia-based fuel cells for power generation.

  20. Recent progress in zirconia-based fuel cells for power generation

    SciTech Connect

    Singhal, S.C.

    1992-12-01

    High temperature solid oxide fuel cells based upon yttria-stabilized zirconia electrolyte offer a clean, pollution-free technology to electrochemically generate electricity at high efficiencies. This paper reviews the designs, materials and fabrication processes used for such fuel cells. Most progress to date has been achieved with tubular geometry cells. A large number of tubular cells have been electrically tested, some to times up to 30,000 hours; these cells have shown excellent performance and performance stability. In addition, successively larger size electric generators utilizing these cells have been designed, built and operated since 1984. Two 25 kW power generation field test units have recently been fabricated; these units represent a major milestone in the commercialization of zirconia-based fuel cells for power generation.

  1. Thermal properties of the optically transparent pore-free nanostructured yttria-stabilized zirconia

    SciTech Connect

    Ghosh, S.; Teweldebrhan, D.; Morales, J. R.; Garay, J. E.; Balandin, A. A.

    2009-12-01

    The authors report results of investigation of thermal conductivity of nanocrystalline yttria-stabilized zirconia. The optically transparent pore-free bulk samples were prepared via the spark plasma sintering process to ensure homogeneity. Thermal conductivity K was measured by two different techniques. It was found that the pore-free nanostructured bulk zirconia is an excellent thermal insulator with the room-temperature Kapprox1.7-2.0 W/m K. It was also shown that the 'phonon-hopping' model can accurately describe specifics of K dependence on temperature and the grain size. The obtained results are important for optimization of zirconia properties for specific applications in advanced electronics and coatings.

  2. Mechanical behavior of yttria-stabilized tetragonal zirconia polycrystalline ceramic after different zirconia surface treatments.

    PubMed

    Pozzobon, Joao Luiz; Pereira, Gabriel Kalil Rocha; Wandscher, Vinicius Felipe; Dorneles, Lucio Strazzabosco; Valandro, Luiz Felipe

    2017-08-01

    This study investigated the effects of different zirconia surface conditioning methods on the biaxial flexure strength, surface characteristics and fractographic analysis of a Y-TZP ceramic. Disc-shaped specimens were manufactured according to ISO 6872-2008 for biaxial flexure strength testing, and then randomly assigned into seven groups (n=30). Control (CTRL): without treatment; Tribochemical silica coating (TBS): specimens were sandblasted with silica-coated aluminum oxide particles (CoJet-Sand) for 10s; Silica nanofilm (SNF): specimens were silica coated with a 5nm SiO2 nanofilm; and four protocols of low-fusing porcelain glaze (GLZ): etching with 10% hydrofluoric acid gel (HF) for 1min (GLZ1), 5min (GLZ5), 10min (GLZ10) and 15min (GLZ15). Phase transformation, roughness, micro-morphological, flexural analysis tests, and fractographic analyses were performed. X-ray diffraction (XRD) analysis showed that the TBS promoted the highest m-phase content (20.35). However, for the GLZ groups, XRD analysis was not sensitive enough to obtain an accurate reading for phase transformation. The GLZ group had the highest roughness values. The TBS group had the highest characteristic strength (1291.38MPa), followed by SNF (999.26MPa). These results suggest that (TBS) and (SNF) treatments did not reduce the mechanical properties, while (GLZ) led to a degradation in the mechanical properties. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Synthesis of Yttria-Stabilized Zirconia Aerogels by a Non-Alkoxide Sol-Gel Route

    SciTech Connect

    Chervin, C N; Clapsaddle, B J; Chiu, H W; Gash, A E; Satcher, Jr., J H; Kauzlarich, S M

    2005-02-11

    Homogeneous, nanocrystalline powders of yttria-stabilized zirconia were prepared using a nonalkoxide sol-gel method. Monolithic gels, free of precipitation, were prepared by addition of propylene oxide to aqueous solutions of Zr{sup 4+} and Y{sup 3+} chlorides at room temperature. The gels were dried with supercritical CO{sub 2}(l), resulting in amorphous aerogels that crystallized into cubic stabilized ZrO{sub 2} following calcination at 500 C. The aerogels and resulting crystalline products were characterized using in-situ temperature profile X-ray diffraction, thermal analysis, transmission electron microscopy (TEM), scanning electron microscopy (SEM), and nitrogen adsorption/desorption analysis. TEM and N{sub 2} adsorption/desorption analysis of an aerogel indicated a porous network structure with a high surface area (409 m{sup 2}/g). The crystallized yttria-stabilized zirconia maintained high surface area (159 m{sup 2}/g) upon formation of homogeneous, nanoparticles ({approx}10 nm). Ionic conductivity at 1000 C of sintered YSZ (1500 C, 3 hours) prepared by this method, was 0.13 {+-} 0.02 {Omega}{sup -1} cm{sup -1}. Activation energies for the conduction processes from 1000-550 C and 550-400 C, were 0.95 {+-} 0.09 and 1.12 {+-} 0.05 eV, respectively. This is the first reported synthesis and characterization of yttria-stabilized zirconia via an aerogel precursor.

  4. First-principles study of interstitial hydrogen in yttria-stabilized zirconia.

    NASA Astrophysics Data System (ADS)

    Marinopoulos, Apostolos

    2012-02-01

    Hydrogen is a common impurity in oxides and has been known to exhibit a dual behavior: either by being a dopant or alternatively an amphoteric impurity with the transition (pinning) level, E(+/-), lying inside the gap [1]. By means of calculations based on density-functional theory (DFT) and a hybrid-functional scheme (Heyd-Scuseria-Ernzerhof) we have studied the incorporation of hydrogen in yttria-stabilized zirconia. Equilibrium sites and formation energies were determined and the role of intrinsic oxygen vacancies needed to stabilize the cubic phase of the oxide was particularly examined. Whereas, in its positively-charged state, H^+, hydrogen was found exclusively to form a dative-type bond with O ions, the neutral paramagnetic H^0 displayed a coexistence with deep interstitial configurations with minimal lattice relaxation of the host lattice. A number of atomic-level mechanisms and migration paths were explored in order to understand this site interplay and the dynamics of neutral H^0 in a way that is consistent with the existing experimental data. [1] C.G. Van de Walle and J. Neugebauer, Nature 423, 626 (2003).

  5. Zirconia-silica based mesoporous desulfurization adsorbents

    NASA Astrophysics Data System (ADS)

    Palomino, Jessica M.; Tran, Dat T.; Kareh, Ana R.; Miller, Christopher A.; Gardner, Joshua M. V.; Dong, Hong; Oliver, Scott R. J.

    2015-03-01

    We report a series of mesoporous silicate sorbent materials templated by long-chain primary alkylamines that display record level of desulfurization of the jet fuel JP-8. Pure silica frameworks and those with a Si:Zr synthesis molar ratio ranging from 44:1 to 11:1 were investigated. The optimum sorbent was identified as dodecylamine-templated silica-zirconia synthesized from a gel with Si:Zr molar ratio of 15:1. With an optimized silver loading of 11 wt.%, a saturation adsorption capacity of 39.4 mgS g-1 and a silver efficiency of 1.21 molS mol Ag-1 were observed for JP-8. This sorbent displayed exceptional regenerability, maintaining 86% of its initial capacity in model fuel after solvent regeneration with diethyl ether. Low-cost, portable and reusable sorbents for the desulfurization of JP-8 jet fuel are needed to make solid oxide fuel cells (SOFCs) a reality for military power needs. SOFCs require ultra-low sulfur content fuel, which traditional desulfurization methods cannot achieve.

  6. Zirconia-based fixed partial dentures: a clinical review.

    PubMed

    Bachhav, Vinay Chila; Aras, Meena Ajay

    2011-02-01

    Ceramics have a long history in fixed prosthodontics of achieving optimal esthetics. Yttrium tetragonal zirconia polycrystal (Y-TZP)-based systems are a recent addition to the high-strength, all-ceramic systems used for crowns and fixed partial dentures. CAD/CAM-produced, Y-TZP-based systems are in considerable demand in esthetic and stress-bearing regions. The highly esthetic nature of zirconia coupled with its superior physical properties and biocompatibility have resulted in restorative systems that meet the demands of today's patients. Undoubtedly, these systems are considered to be prospective replacements for metal-ceramic restorations. This article reviews relevant contemporary literature regarding all-ceramic materials and systems and discusses their material properties, biocompatibility, advances in cementation, and more with special emphasis on clinical survival. The article also aims to provide recommendations for their use.

  7. Influence of dopant ion on localized relaxation of an oxygen vacancy in stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Ohta, M.; Wigmore, J. K.; Nobugai, K.; Miyasato, T.

    2002-05-01

    It is well known that stabilized zirconia exhibits long-range transport of oxygen ions which gives rise to diffusion relaxation of oxygen vacancies. The internal friction and the change in sound velocity in single-crystal calcia-stabilized zirconia (CSZ) doped with 12 mol % CaO were measured for longitudinal sound waves in the frequency range from 20 Hz to 700 Hz using a vibrating reed technique. In the temperature range from 300 K to 700 K, the relaxation strength exhibits strong anisotropy with respect to the directions of the k vectors. As the frequency increases the internal friction peak and the change in sound velocity shift toward high temperature, and the relaxation strength remains constant. The results show that a smaller number of oxygen vacancies contribute to diffusion relaxation than to localized relaxation, which is attributed to hopping of bound oxygen vacancies within the local structure. Comparison of the results with those reported previously for yttria-stabilized zirconia (YSZ) doped with 9.5 mol % Y2O3, suggests that oxygen vacancies are more strongly bound by the local structure in CSZ than in YSZ.

  8. Towards long lasting zirconia-based composites for dental implants: Transformation induced plasticity and its consequence on ceramic reliability.

    PubMed

    Reveron, Helen; Fornabaio, Marta; Palmero, Paola; Fürderer, Tobias; Adolfsson, Erik; Lughi, Vanni; Bonifacio, Alois; Sergo, Valter; Montanaro, Laura; Chevalier, Jérôme

    2017-01-15

    Zirconia-based composites were developed through an innovative processing route able to tune compositional and microstructural features very precisely. Fully-dense ceria-stabilized zirconia ceramics (84vol% Ce-TZP) containing equiaxed alumina (8vol%Al2O3) and elongated strontium hexa-aluminate (8vol% SrAl12O19) second phases were obtained by conventional sintering. This work deals with the effect of the zirconia stabilization degree (CeO2 in the range 10.0-11.5mol%) on the transformability and mechanical properties of Ce-TZP-Al2O3-SrAl12O19 materials. Vickers hardness, biaxial flexural strength and Single-edge V-notched beam tests revealed a strong influence of ceria content on the mechanical properties. Composites with 11.0mol% CeO2 or above exhibited the classical behaviour of brittle ceramics, with no apparent plasticity and very low strain to failure. On the contrary, composites with 10.5mol% CeO2 or less showed large transformation-induced plasticity and almost no dispersion in strength data. Materials with 10.5mol% of ceria showed the highest values in terms of biaxial bending strength (up to 1.1GPa) and fracture toughness (>10MPa√m). In these ceramics, as zirconia transformation precedes failure, the Weibull modulus was exceptionally high and reached a value of 60, which is in the range typically reported for metals. The results achieved demonstrate the high potential of using these new strong, tough and stable zirconia-based composites in structural biomedical applications. Yttria-stabilized (Y-TZP) zirconia ceramics are increasingly used for developing metal-free restorations and dental implants. Despite their success related to their excellent mechanical resistance, Y-TZP can undergo Low Temperature Degradation which could be responsible for restoration damage or even worst the failure of the implant. Current research is focusing on strategies to improve the LTD resistance of Y-TZP or to develop alternative composites with better stability in vivo. In

  9. Single Crystal Fibers of Yttria-Stabilized Cubic Zirconia with Ternary Oxide Additions

    NASA Technical Reports Server (NTRS)

    Ritzert, F. J.; Yun, H. M.; Miner, R. V.

    1997-01-01

    Single crystal fibers of yttria (Y2O3)-stabilized cubic zirconia, (ZrO2) with ternary oxide additions were grown using the laser float zone fiber processing technique. Ternary additions to the ZrO2-Y2O3 binary system were studied aimed at increasing strength while maintaining the high coefficient of thermal expansion of the binary system. Statistical methods aided in identifying the most promising ternary oxide candidate (Ta2O5, Sc2O3, and HfO2) and optimum composition. The yttria, range investigated was 14 to 24 mol % and the ternary oxide component ranged from 1 to 5 mol %. Hafnium oxide was the most promising ternary oxide component based on 816 C tensile strength results and ease of fabrication. The optimum composition for development was 81 ZrO2-14 Y203-5 HfO2 based upon the same elevated temperature strength tests. Preliminary results indicate process improvements could improve the fiber performance. We also investigated the effect of crystal orientation on strength.

  10. Processing-structure-property relationships in electron beam physical vapor deposited yttria stabilized zirconia coatings

    SciTech Connect

    Rao, D. Srinivasa; Valleti, Krishna; Joshi, S. V.; Janardhan, G. Ranga

    2011-05-15

    The physical and mechanical properties of yttria stabilized zirconia (YSZ) coatings deposited by the electron beam physical vapor deposition technique have been investigated by varying the key process variables such as vapor incidence angle and sample rotation speed. The tetragonal zirconia coatings formed under varying process conditions employed were found to have widely different surface and cross-sectional morphologies. The porosity, phase composition, planar orientation, hardness, adhesion, and surface residual stresses in the coated specimens were comprehensively evaluated to develop a correlation with the process variables. Under transverse scratch test conditions, the YSZ coatings exhibited two different crack formation modes, depending on the magnitude of residual stress. The influence of processing conditions on the coating deposition rate, column orientation angle, and adhesion strength has been established. Key relationships between porosity, hardness, and adhesion are also presented.

  11. Textured (100) yttria-stabilized zirconia thin films deposited by plasma-enhanced chemical vapor deposition

    NASA Astrophysics Data System (ADS)

    Holzschuh, H.; Suhr, H.

    1991-07-01

    Thin films of yttria-stabilized zirconia were deposited by plasma-enhanced chemical vapor deposition on quartz Si(100), Si(111), Ni, and the steels V2A and Hastelloy at substrate temperatures (Ts): 673-873 K. The metal beta-diketonates Y (thd)3 and Zr(thd)4 were used as precursors. The fully stabilized fluorite-type cubic structure was obtained over a wide range of yttria contents from 3.5 to 80 mol pct (Ts = 773 K). The quality of the films depended on the match of the thermal expansion coefficients of substrate and deposit.

  12. Effect of various intermediate ceramic layers on the interfacial stability of zirconia core and veneering ceramics.

    PubMed

    Yoon, Hyung-In; Yeo, In-Sung; Yi, Yang-Jin; Kim, Sung-Hun; Lee, Jai-Bong; Han, Jung-Suk

    2015-01-01

    The purposes of this study were to evaluate the effects of intermediate ceramics on the adhesion between the zirconia core and veneer ceramics. The polished surfaces of fully sintered Y-TZP blocks received three different treatments: (1) connector (C), (2) liner (L) or (3) wash layer (W). All the treated zirconia blocks were veneered with either (a) fluorapatite glass-ceramic (E) or (b) feldspathic porcelain (V) and divided into four groups (CE, CV, LE and WV). For the control group, the testing surfaces of metal blocks were veneered with feldspathic porcelain (VM). A half of the samples in each group (n = 21) were exposed to thermocycling, while the other half of the specimens were stored at room temperature under dry conditions. All specimens were subjected to the shear test and the failed surfaces were microscopically examined. The elemental distribution at the zirconia core/veneer interface was analyzed. The specimens in Groups CE and CV exhibited significantly greater mean bond strength values than those in Groups LE and WV, respectively (p < 0.05). However, the mean bond strengths significantly decreased in the connector groups (CE and CV) after thermal cycling (p < 0.05). The elemental analysis suggested diffusion of ceramic substances into the zirconia surface. A glass-ceramic based connector is significantly more favorable to core/veneer adhesion than the other intermediate ceramics evaluated in the study. However, thermal cycling affected the bond strength at the core/veneer interface differently according to the intermediate ceramics.

  13. Novel Cranial Implants of Yttria-Stabilized Zirconia as Acoustic Windows for Ultrasonic Brain Therapy.

    PubMed

    Gutierrez, Mario I; Penilla, Elias H; Leija, Lorenzo; Vera, Arturo; Garay, Javier E; Aguilar, Guillermo

    2017-08-02

    Therapeutic ultrasound can induce changes in tissues by means of thermal and nonthermal effects. It is proposed for treatment of some brain pathologies such as Alzheimer's, Parkinson's, Huntington's diseases, and cancer. However, cranium highly absorbs ultrasound reducing transmission efficiency. There are clinical applications of transcranial focused ultrasound and implantable ultrasound transducers proposed to address this problem. In this paper, biocompatible materials are proposed for replacing part of the cranium (cranial implants) based on low porosity polycrystalline 8 mol% yttria-stabilized-zirconia (8YSZ) ceramics as acoustic windows for brain therapy. In order to assess the viability of 8YSZ implants to effectively transmit ultrasound, various 8YSZ ceramics with different porosity are tested; their acoustic properties are measured; and the results are validated using finite element models simulating wave propagation to brain tissue through 8YSZ windows. The ultrasound attenuation is found to be linearly dependent on ceramics' porosity. Results for the nearly pore-free case indicate that 8YSZ is highly effective in transmitting ultrasound, with overall maximum transmission efficiency of ≈81%, compared to near total absorption of cranial bone. These results suggest that 8YSZ polycrystals could be suitable acoustic windows for ultrasound brain therapy at 1 MHz. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Orientation-dependent hydration structures at yttria-stabilized cubic zirconia surfaces

    DOE PAGES

    Hou, Binyang; Kim, Seunghyun; Kim, Taeho; ...

    2016-11-30

    Water interaction with surfaces is very important and plays key roles in many natural and technological processes. Because the experimental challenges that arise when studying the interaction water with specific crystalline surfaces, most studies on metal oxides have focused on powder samples, which averaged the interaction over different crystalline surfaces. As a result, studies on the crystal orientation-dependent interaction of water with metal oxides are rarely available in the literature. In this work, water adsorption at 8 mol % yttria-stabilized cubic single crystal zirconia (100) and (111) surfaces was studied in terms of interfacial hydration structures using high resolution X-raymore » reflectivity measurements. The interfacial electron density profiles derived from the structure factor analysis of the measured data show the existence of multiple layers of adsorbed water with additional peculiar metal adsorption near the oxide surfaces.Surface relaxation, depletion, and interaction between the adsorbed layers and bulk water are found to vary greatly between the two surfaces and are also different when compared to the previously studied (110) surface. The fractional ratio between chemisorbed and physisorbed water species were also quantitatively estimated, which turned out to vary dramatically from surface to surface. Finally, the result gives us a unique opportunity to reconsider the simplified 2:1 relation between chemisorption and physisorption, originally proposed by Morimoto et al. based on the adsorption isotherms of water on powder metal oxide samples.« less

  15. Orientation-dependent hydration structures at yttria-stabilized cubic zirconia surfaces

    SciTech Connect

    Hou, Binyang; Kim, Seunghyun; Kim, Taeho; Park, Changyong; Bahn, Chi Bum; Kim, Jongjin; Hong, Seungbum; Lee, Su Yong; Kim, Ji Hyun

    2016-11-30

    Water interaction with surfaces is very important and plays key roles in many natural and technological processes. Because the experimental challenges that arise when studying the interaction water with specific crystalline surfaces, most studies on metal oxides have focused on powder samples, which averaged the interaction over different crystalline surfaces. As a result, studies on the crystal orientation-dependent interaction of water with metal oxides are rarely available in the literature. In this work, water adsorption at 8 mol % yttria-stabilized cubic single crystal zirconia (100) and (111) surfaces was studied in terms of interfacial hydration structures using high resolution X-ray reflectivity measurements. The interfacial electron density profiles derived from the structure factor analysis of the measured data show the existence of multiple layers of adsorbed water with additional peculiar metal adsorption near the oxide surfaces.Surface relaxation, depletion, and interaction between the adsorbed layers and bulk water are found to vary greatly between the two surfaces and are also different when compared to the previously studied (110) surface. The fractional ratio between chemisorbed and physisorbed water species were also quantitatively estimated, which turned out to vary dramatically from surface to surface. Finally, the result gives us a unique opportunity to reconsider the simplified 2:1 relation between chemisorption and physisorption, originally proposed by Morimoto et al. based on the adsorption isotherms of water on powder metal oxide samples.

  16. Hydrothermal Synthesis of Yttria-Stabilized Zirconia Nanocrystals with Controlled Yttria Content.

    PubMed

    Sato, Kazuyoshi; Horiguchi, Kazuya; Nishikawa, Taku; Yagishita, Sadahiro; Kuruma, Kazuo; Murakami, Takeshi; Abe, Hiroya

    2015-08-17

    In this study, we demonstrate for the first time the hydrothermal synthesis of yttria-stabilized zirconia (YSZ) nanocrystals with controlled yttria content (x = 3-12 mol %; xYSZ) with negligible aggregation from aqueous solution. The nanocrystals were grown via the hydrothermal treatment of basic Zr(IV) and Y(III) carbonate complex aqueous solutions in the presence of a cationic ligand, N(CH3)4(+). The nanocrystals were characterized in detail by dynamic light scattering, ζ-potential measurement, X-ray diffraction, specific surface area measurement based on the Brunauer-Emmett-Teller theory, transmission electron microscopy, energy dispersive X-ray spectroscopy, and Raman spectroscopy. Shorter reaction times and higher Y2O3 content produce aqueous solutions with higher transparencies containing nanocrystals with sizes of 10 nm or less. Nanocrystals with the target composition were obtained by hydrothermal reaction for longer than 3 h, regardless of the Y2O3 content. The main phase is tetragonal for (3-6)YSZ and cubic with disordered oxygen vacancies for (8-12)YSZ. The characteristics of the nanocrystalline material synthesized are consistent with those of bulk YSZ crystals, indicating the growth of high-quality nanocrystals.

  17. Mechanical and physical properties of plasma-sprayed stabilized zirconia

    NASA Technical Reports Server (NTRS)

    Siemers, P. A.; Mehan, R. L.

    1983-01-01

    Physical and mechanical properties were determined for plasma-sprayed MgO- or Y2O3-stabilized ZrO2 thermal barrier coatings. Properties were determined for the ceramic coating in both the freestanding condition and as-bonded to a metal substrate. The properties of the NiCrAlY bond coating were also investigated.

  18. Analysis of tetragonal to monoclinic phase transformation caused by accelerated artificial aging and the effects of microstructure in stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Lucas, Thomas J.

    This investigation addresses the issue that yttria stabilized zirconia is being used as a dental biomaterial without substantial evidence of its long-term viability. Furthermore, stabilized zirconia (SZ) undergoes low temperature degradation (LTD), which can lead to roughening of the surface. A rougher exterior can lead to increased wear of the antagonist in the oral environment. Despite the LTD concerns, SZ is now widely used in restorative dentistry, including full contour crowns. A comparison of aging methods to determine the role of artificial aging on inducing the transformation has not been extensively studied. Therefore, simulations of the transformation process were investigated by comparing different methods of accelerated aging. The rejected null hypothesis is that the temperature of aging treatment will not affect the time required to cause measurable monoclinic transformation of yttria stabilized zirconia. The transformation of SZ starts at the surface and progresses inward; however, it is unclear whether the progression is constant for different aging conditions. This investigation analyzed the depth of transformation as a function of aging conditions for stabilized zirconia in the top 5-6 mum from the surface. The rejected null hypothesis is that the transformation amount is constant throughout the first six micrometers from the surface. The effects of grain size on the amount of monoclinic transformation were also investigated. This study aimed to determine if the grain size of partially stabilized zirconia affects the amount of monoclinic transformation, surface roughness, and property degradation due to aging. The rejected null hypothesis is that the grain size will not affect the amount of monoclinic transformation, thus have no effect on surface roughening or property degradation. The final part of this study addresses the wear of enamel when opposing zirconia by observing how grain size and aging affected the wear rate of an enamel antagonist

  19. Bulk and Interface Thermodynamics of Calcia-, and Yttria-doped Zirconia Ceramics: Nanograined Phase Stability

    NASA Astrophysics Data System (ADS)

    Drazin, John Walter

    while simultaneously collecting the energetic contribution of the adsorbing water vapor. With this data and apparatus, I have derived a 2nd order differential equation that relates the surface energy to the measured quantities such that I collected surfaces energies for over 35 specimens in the calcia-zirconia and yttria-zirconia systems for the first time. From the results, it was found that the monoclinic polymorph had the largest surface energy in the range of 1.9 - 2.1 ( J/m2) while the tetragonal surface energies were roughly 1.4 - 1.6 (J/m2), the cubic surface energies were roughly 0.8 - 1.0 (J/m2), and the amorphous surface energies were the smallest at roughly 0.7 - 0.8 (J/m 2). With the measured surface energy data, collected for the first time, we can create a nano-grain phase diagram similar to a bulk phase diagram that shows the stable polymorph as a function of dopant concentration and grain size using the bulk enthalpy data collected from high temperature oxide melt drop solution calorimetry. The phase diagrams show that pure zirconia will transform into tetragonal and cubic polymorphs from the monoclinic one at 7 and 5 nm respectively which confirms the experimental observations. The results are powerful predictive tools successfully applied in the nCZ and nYZ systems to a high degree of accuracy and adds a new development to conventional bulk phase diagrams. These diagrams should be the basis for nanotechnological efforts in nCZ and nYZ based systems, and suggest similar efforts are needed in other nano systems to pursue an in depth understanding and optimization of nanomaterials. After working on the theoretical aspects of phase stability, the focus of the research will shift to producing dense samples to measure observable quantities such as oxygen conduction and mechanical hardness. However, producing said samples with the nanocrystalline grain sizes has also been challenging as conventional sintering requires high temperatures which, as a consequence

  20. Synthesis of multi-hierarchical structured yttria-stabilized zirconia powders and their enhanced thermophysical properties

    SciTech Connect

    Cao, Fengmei; Gao, Yanfeng; Chen, Hongfei; Liu, Xinling; Tang, Xiaoping; Luo, Hongjie

    2013-06-01

    Multi-hierarchical structured yttria-stabilized zirconia (YSZ) powders were successfully synthesized by a hydrothermal-calcination process. The morphology, crystallinity, and microstructure of the products were characterized by SEM, XRD, TEM, and BET. A possible formation mechanism of the unique structure formed during hydrothermal processing was also investigated. The measured thermophysical results indicated that the prepared YSZ powders had a low thermal conductivity (0.63–1.27 W m⁻¹ K⁻¹), good short-term high-temperature stability up to 1300 °C. The influence of the morphology and microstructure on their thermophysical properties was briefly discussed. The unique multi-hierarchical structure makes the prepared YSZ powders candidates for use in enhanced applications involving thermal barrier coatings. - Graphical abstract: There are many tiny pores and grain boundaries in the multi-hierarchical structured yttria-stabilized zirconia (YSZ) powders,which greatly decrease the thermal conductivities of the YSZ powders. - Highlights: • Multi-hierarchical structured YSZ powders were successfully prepared. • The prepared YSZ powders had a low thermal conductivity (0.63–1.27 W m⁻¹ K⁻¹). • Improved high-temperature stability had been achieved for the prepared YSZ powders. • The influence of the morphology on their thermophysical properties was explored.

  1. Maximizing esthetic results on zirconia-based restorations.

    PubMed

    Chang, Yi-Yuan

    2011-01-01

    With a flexural strength of approximately 900-1,100 MPa, zirconium oxide is one of the toughest all-ceramic materials available in dentistry.1 It can be used to fabricate both single-unit and long-span bridge frameworks. A moderate level of translucency makes it suitable for esthetically demanding clinical cases, such as restoring maxillary anterior teeth. A variety of well-designed porcelain veneering systems allow technicians to apply their artistic skills to create natural, lifelike restorations. A good balance of strength, precision, and translucency allows zirconia-based restorations to accommodate a variety of clinical situations.

  2. Characterization of Densified Fully-Stabilized Nanometric Zirconia by Positron Annihilation Spectroscopy

    SciTech Connect

    Garay, J E; Glade, S C; Asoka-Kumar, P; Anselmi-Tamburini, U; Munir, Z A

    2005-04-05

    Fully-stabilized nanometric zirconia samples with varying degrees of porosity and grain sizes were analyzed using the coincidence Doppler broadening mode of the positron annihilation spectroscopy (PAS). A decrease in the low momentum fraction was observed and coincided with a decrease in porosity. In addition to pores, it is proposed that defects in the negatively charges grain boundary space region act as positron trapping centers; their effectiveness decreases with an increase in grain size. It is shown that PAS is sensitive to small grain size differences within the nanometric regime in these oxide materials.

  3. Structural and optical properties of electron beam evaporated yttria stabilized zirconia thin films

    SciTech Connect

    Kirubaharan, A. Kamalan; Kuppusami, P. Dharini, T.; Ramachandran, D.; Singh, Akash; Mohandas, E.

    2015-06-24

    Yttria stabilized zirconia (10 mole % Y{sub 2}O{sub 3}) thin films were deposited on quartz substrates using electron beam physical vapor deposition at the substrate temperatures in the range 300 – 973 K. XRD analysis showed cubic crystalline phase of YSZ films with preferred orientation along (111). The surface roughness was found to increase with the increase of deposition temperatures. The optical band gap of ∼5.7 eV was calculated from transmittance curves. The variation in the optical properties is correlated with the changes in the microstructural features of the films prepared as a function of substrate temperature.

  4. Optical absorption of electrolytically colored single crystals of yttria-stabilized zirconia

    SciTech Connect

    Nagle, D.; Paiverneker, V.R.; Petelin, A.N.; Groff, G. )

    1989-05-01

    Electroreduction of yttria-stabilized zirconia (YSZ) has been reported to produce a broad optical absorption peak at 480-500 nm. This result is at variance with the empirically predicted absorption for F and F' centers, which should occur at 325 nm and 400 nm, respectively. The authors electroreduced YSZ single crystals at electric fields and temperatures lower than those used by earlier workers, and observed a broad absorption peak at 360-380 nm, in agreement with theoretical predictions. They present their results in this paper.

  5. EPR study of electron traps in x-ray-irradiated yttria-stabilized zirconia

    SciTech Connect

    Azzoni, C.B.; Paleari, A. )

    1989-10-01

    Single crystals of yttria-stabilized zirconia (12 mol % of Y{sub 2}O{sub 3}) have been x-ray irradiated at room temperature. The electron paramagnetic resonance spectrum of the filled electron traps is analyzed in terms of a single oxygen vacancy type of defect with its symmetry axis along the {l angle}111{r angle} direction. The angular dependence of the linewidth and the asymmetry of the line shape are attributed to the disordered rearrangements of the anion sublattice surrounding the oxygen vacancy. This affects the local crystal fields and the directions of the symmetry axis of the defects.

  6. Low-temperature electrochemical characterization of sputtered yttria-stabilized zirconia thin film on silicon substrate

    NASA Astrophysics Data System (ADS)

    Hua, Ching-Han; Chou, Chen-Chia

    2016-08-01

    The microstructure and electrical conductivity of yttria-stabilized zirconia (YSZ) thin films with Pt electrodes were evaluated through three configurations in the temperature range from 25 to 500 °C. Using ac-impedance spectra, the contribution of the Si substrate to resistance was separated by an equivalent-circuit analysis. The colossal ionic conductivity of YSZ thin films at temperatures higher than 125 °C was observed parallel to the interface. The total ionic conductivity of YSZ thin films increased significantly in comparison w the bulk YSZ electrolyte. An alternative conductive pathway ascribed to the homogeneous and heterogeneous interfaces with high strain and charge-containing defects was proposed.

  7. Grain growth and phase stability of nanocrystalline cubic zirconia under ion irradiation

    SciTech Connect

    Zhang, Yanwen; Jiang, Weilin; Wang, Chong M.; Namavar, Fereydoon; Edmondson, Philip D.; Zhu, Zihua; Gao, Fei; Lian, Jie; Weber, William J.

    2010-11-10

    Grain growth, oxygen stoichiometry and phase stability of nanostructurally-stabilized zirconia (NSZ) in pure cubic phase are investigated under 2 MeV Au ion bombardment at 160 and 400 K to doses up to 35 displacements per atom (dpa). The NSZ films are produced by ion-beam-assisted deposition technique at room temperature with an average grain size of 7.7 nm. The grain size increases with dose, and follows a power law (n=6) to a saturation value of ~30 nm that decreases with temperature. Slower grain growth is observed under 400 K irradiations, as compared to 160 K irradiations, indicating that thermal grain growth is not activated and defect-stimulated grain growth is the dominating mechanism. While cubic phase is perfectly retained and no new phases are identified after the high-dose irradiations, reduction of oxygen in the irradiated NSZ films is detected. The ratio of O to Zr decreases from ~2.0 for the as-deposited films to ~1.65 after irradiation to ~35 dpa. Significant increase of oxygen vacancies in nanocrystalline zirconia suggests substantially enhanced oxygen diffusion under ion irradiation, a materials behavior far from equilibrium. The oxygen deficiency may be essential in stabilizing cubic phase to larger grain sizes.

  8. Influence of Accelerated Aging on the Color Stability of Dental Zirconia.

    PubMed

    Ângela Mazıero Volpato, Cláudıa; Francısco Cesar, Paulo; Antônıo Bottıno, Marco

    2016-09-01

    This study evaluated the influence of different aging times on the color stability of zirconia that is either veneered or not by ceramic. Fifteen zirconia disks (3Y-TZP) were produced (12.0 mm in diameter and 1.0 mm-thick). Five disks (G1) did not receive veneering ceramic layer; 5 disks (G2) were veneered with 1.0 mm a ceramic layer and the other 5 disks (G3) were veneered with layer of 1.5 mm. The L*a*b* coordinates (T1) were measured with a spectrophotometer. The disks were subjected to an accelerated aging protocol for 1 hour (T2), 2 hours (T3) and 4 hours (T4). Measurements were made after each aging time. Differences in color (ΔE00), lightness (ΔL'), chroma (ΔC'), and hue (ΔH') were calculated by CIEDE2000 color difference formula among standard-averages, aging times and thickness tested. For ΔE00 , one-way ANOVA was performed for the G1 and two-way ANOVA for G2 and G3. Repeated measures ANOVA was performed for ΔL', ΔC', and ΔH'. Multiple comparisons were performed using Tukey's test (α = 0.05). For G1, statistical differences were found for lightness (ΔL'), chroma (ΔC'), and hue differences (ΔH') (p = 0.0001), highlighting the major in chroma differences (ΔC'). Discrete color differences (ΔE00 ) were observed (0.95ΔE00 ) especially after 4 hours of aging (T4). For G2 and G3, statistical differences for ΔL', ΔC', and ΔH' were found as a function of the thickness of the ceramic coating (p < 0.0001) and aging time (p = 0.02). When 3Y-TZP was subjected to aging, discrete color differences were present. With exception of the G2, the color difference was less than 1.25ΔE00 , demonstrating that the zirconia maintained its colorimetric properties after aging protocol. After prolonged aging, discrete color changes can occur in zirconia, particularly when it is contact with the oral environment, as is the case of abutments and monolithic crowns. Thus, clinical and laboratory care should be taken to maintain surface integrity of

  9. High Temperature Fabrication of Nanostructured Yttria-Stabilized-Zirconia (YSZ) Scaffolds by In Situ Carbon Templating Xerogels.

    PubMed

    Muhoza, Sixbert P; Cottam, Matthew A; Gross, Michael D

    2017-04-16

    We demonstrate a method for the high temperature fabrication of porous, nanostructured yttria-stabilized-zirconia (YSZ, 8 mol% yttria - 92 mol% zirconia) scaffolds with tunable specific surface areas up to 80 m(2)·g(-1). An aqueous solution of a zirconium salt, yttrium salt, and glucose is mixed with propylene oxide (PO) to form a gel. The gel is dried under ambient conditions to form a xerogel. The xerogel is pressed into pellets and then sintered in an argon atmosphere. During sintering, a YSZ ceramic phase forms and the organic components decompose, leaving behind amorphous carbon. The carbon formed in situ serves as a hard template, preserving a high surface area YSZ nanomorphology at sintering temperature. The carbon is subsequently removed by oxidation in air at low temperature, resulting in a porous, nanostructured YSZ scaffold. The concentration of the carbon template and the final scaffold surface area can be systematically tuned by varying the glucose concentration in the gel synthesis. The carbon template concentration was quantified using thermogravimetric analysis (TGA), the surface area and pore size distribution was determined by physical adsorption measurements, and the morphology was characterized using scanning electron microscopy (SEM). Phase purity and crystallite size was determined using X-ray diffraction (XRD). This fabrication approach provides a novel, flexible platform for realizing unprecedented scaffold surface areas and nanomorphologies for ceramic-based electrochemical energy conversion applications, e.g. solid oxide fuel cell (SOFC) electrodes.

  10. Ionic conductivity of nanocrystalline yttria-stabilized zirconia: Grain boundary and size effects

    NASA Astrophysics Data System (ADS)

    Durá, O. J.; López de La Torre, M. A.; Vázquez, L.; Chaboy, J.; Boada, R.; Rivera-Calzada, A.; Santamaria, J.; Leon, C.

    2010-05-01

    We report on the effect of grain size on the ionic conductivity of yttria-stabilized zirconia samples synthesized by ball milling. Complex impedance measurements, as a function of temperature and frequency are performed on 10mol% yttria-stabilized zirconia nanocrystalline samples with grain sizes ranging from 900 to 17 nm. Bulk ionic conductivity decreases dramatically for grain sizes below 100 nm, although its activation energy is essentially independent of grain size. The results are interpreted in terms of a space-charge layer resulting from segregation of mobile oxygen vacancies to the grain-boundary core. The thickness of this space-charge layer formed at the grain boundaries is on the order of 1 nm for large micron-sized grains but extends up to 7 nm when decreasing the grain size down to 17 nm. This gives rise to oxygen vacancies depletion over a large volume fraction of the grain and consequently to a significant decrease in oxide-ion conductivity.

  11. The Reinforcement Effect of Nano-Zirconia on the Transverse Strength of Repaired Acrylic Denture Base.

    PubMed

    Gad, Mohammed; ArRejaie, Aws S; Abdel-Halim, Mohamed Saber; Rahoma, Ahmed

    2016-01-01

    Objective. The aim of this study was to evaluate the effect of incorporation of glass fiber, zirconia, and nano-zirconia on the transverse strength of repaired denture base. Materials and Methods. Eighty specimens of heat polymerized acrylic resin were prepared and randomly divided into eight groups (n = 10): one intact group (control) and seven repaired groups. One group was repaired with autopolymerized resin while the other six groups were repaired using autopolymerized resin reinforced with 2 wt% or 5 wt% glass fiber, zirconia, or nano-zirconia particles. A three-point bending test was used to measure the transverse strength. The results were analyzed using SPSS and repeated measure ANOVA and post hoc least significance (LSD) test (P ≤ 0.05). Results. Among repaired groups it was found that autopolymerized resin reinforced with 2 or 5 wt% nano-zirconia showed the highest transverse strength (P ≤ 0.05). Repairs with autopolymerized acrylic resin reinforced with 5 wt% zirconia showed the lowest transverse strength value. There was no significant difference between the groups repaired with repair resin without reinforcement, 2 wt% zirconia, and glass fiber reinforced resin. Conclusion. Reinforcing of repair material with nano-zirconia may significantly improve the transverse strength of some fractured denture base polymers.

  12. The Reinforcement Effect of Nano-Zirconia on the Transverse Strength of Repaired Acrylic Denture Base

    PubMed Central

    ArRejaie, Aws S.; Abdel-Halim, Mohamed Saber; Rahoma, Ahmed

    2016-01-01

    Objective. The aim of this study was to evaluate the effect of incorporation of glass fiber, zirconia, and nano-zirconia on the transverse strength of repaired denture base. Materials and Methods. Eighty specimens of heat polymerized acrylic resin were prepared and randomly divided into eight groups (n = 10): one intact group (control) and seven repaired groups. One group was repaired with autopolymerized resin while the other six groups were repaired using autopolymerized resin reinforced with 2 wt% or 5 wt% glass fiber, zirconia, or nano-zirconia particles. A three-point bending test was used to measure the transverse strength. The results were analyzed using SPSS and repeated measure ANOVA and post hoc least significance (LSD) test (P ≤ 0.05). Results. Among repaired groups it was found that autopolymerized resin reinforced with 2 or 5 wt% nano-zirconia showed the highest transverse strength (P ≤ 0.05). Repairs with autopolymerized acrylic resin reinforced with 5 wt% zirconia showed the lowest transverse strength value. There was no significant difference between the groups repaired with repair resin without reinforcement, 2 wt% zirconia, and glass fiber reinforced resin. Conclusion. Reinforcing of repair material with nano-zirconia may significantly improve the transverse strength of some fractured denture base polymers. PMID:27366150

  13. Clinical performance and failures of zirconia-based fixed partial dentures: a review literature

    PubMed Central

    Triwatana, Premwara; Nagaviroj, Noppavan

    2012-01-01

    PURPOSE Zirconia has been used in clinical dentistry for approximately a decade, and there have been several reports regarding the clinical performance and survival rates of zirconia-based restorations. The aim of this article was to review the literatures published from 2000 to 2010 regarding the clinical performance and the causes of failure of zirconia fixed partial dentures (FPDs). MATERIALS AND METHODS An electronic search of English peer-reviewed dental literatures was performed through PubMed to obtain all the clinical studies focused on the performance of the zirconia FPDs. The electronic search was supplemented by manual searching through the references of the selected articles for possible inclusion of some articles. Randomized controlled clinical trials, longitudinal prospective and retrospective cohort studies were the focuses of this review. Articles that did not focus on the restoration of teeth using zirconia-based restorations were excluded from this review. RESULTS There have been three studies for the study of zirconia single crowns. The clinical outcome was satisfactory (acceptable) according to the CDA evaluation. There have been 14 studies for the study of zirconia FPDs. The survival rates of zirconia anterior and posterior FPDs ranged between 73.9% - 100% after 2 - 5 years. The causes of failure were veneer fracture, ceramic core fracture, abutment tooth fracture, secondary caries, and restoration dislodgment. CONCLUSION The overall performance of zirconia FPDs was satisfactory according to either USPHS criteria or CDA evaluations. Fracture resistance of core and veneering ceramics, bonding between core and veneering materials, and marginal discrepancy of zirconia-based restorations were discussed as the causes of failure. Because of its repeated occurrence in many studies, future researches are essentially required to clarify this problem and to reduce the fracture incident. PMID:22737311

  14. Long-term stability and properties of zirconia ceramics for heavy duty diesel engine components

    NASA Technical Reports Server (NTRS)

    Larsen, D. C.; Adams, J. W.

    1985-01-01

    Physical, mechanical, and thermal properties of commercially available transformation-toughened zirconia are measured. Behavior is related to the material microstructure and phase assemblage. The stability of the materials is assessed after long-term exposure appropriate for diesel engine application. Properties measured included flexure strength, elastic modulus, fracture toughness, creep, thermal shock, thermal expansion, internal friction, and thermal diffusivity. Stability is assessed by measuring the residual property after 1000 hr/1000C static exposure. Additionally static fatigue and thermal fatigue testing is performed. Both yttria-stabilized and magnesia-stabilized materials are compared and contrasted. The major limitations of these materials are short term loss of properties with increasing temperature as the metastable tetragonal phase becomes more stable. Fine grain yttria-stabilized material (TZP) is higher strength and has a more stable microstructure with respect to overaging phenomena. The long-term limitation of Y-TZP is excessive creep deformation. Magnesia-stabilized PSZ has relatively poor stability at elevated temperature. Overaging, decomposition, and/or destabilization effects are observed. The major limitation of Mg-PSZ is controlling unwanted phase changes at elevated temperature.

  15. Dynamic compaction of yttria-stabilized zirconia with the addition of carbon-nanotubes

    NASA Astrophysics Data System (ADS)

    Sable, P. A.; LaJeunesse, J.; Sullivan, C.; Kamavaram, V.; Borg, J. P.

    2017-01-01

    Yttria-stabilized zirconia (YSZ) is a versatile ceramic utilized for its hardness as well as thermal stability. In these experiments, carbon nanotubes (3% and 5% by weight) were added to powdered YSZ before it was statically compacted. These compacted samples were then dynamically compressed and monitored using a Photon Doppler Velocimetry (PDV) system. The objective was to better develop an understanding of how carbon nano-tubes (CNT) affects the initial shock response of the powder system. Experiments indicate the CNT both steepen the rise and increase the Hugoniot state of the YSZ-CNT system as compared to YSZ alone. Additionally, the PDV data is in good agreement with simple hydrocode simulations. The results of experiments and simulations are discussed.

  16. Oxygen vacancy induced carbon deposition at the triple phase boundary of the nickel/yttrium-stabilized zirconia (YSZ) interface

    NASA Astrophysics Data System (ADS)

    Zhang, Yanxing; Fu, Zhaoming; Wang, Mingyang; Yang, Zongxian

    2014-09-01

    The carbon deposition at the Triple Phase Boundary (TPB) of the Nickel/Yttrium-Stabilized Zirconia (YSZ) interface is studied using the first-principles method based on density functional theory, with consideration of the interface oxygen vacancy. It is found that the CH fragment (the most stable dissociation products of CH4 on Ni catalyst) can easily diffuse and be trapped at the O vacancy. The trapped CH can dissociate to C and H with a much lower dissociation barrier (0.74 eV) as compared with that (1.39 eV) on the pure Ni (111) surface. Therefore, we propose that the carbon deposition may form easily at the interface oxygen vacancy of TPB as compared with that on the pure Ni (111) surface, which offers new understanding on the carbon deposition of the Ni/YSZ anode of solid oxide fuel cell.

  17. Very low pressure plasma sprayed yttria-stabilized zirconia coating using a low-energy plasma gun

    NASA Astrophysics Data System (ADS)

    Zhu, Lin; Zhang, Nannan; Bolot, Rodolphe; Planche, Marie-Pierre; Liao, Hanlin; Coddet, Christian

    2011-12-01

    In the present study, a more economical low-energy plasma source was used to perform a very low pressure plasma-spray (VLPPS) process. The plasma-jet properties were analyzed by means of optical emission spectroscopy (OES). Moreover, yttria-stabilized zirconia coating (YSZ) was elaborated by a F100 low-power plasma gun under working pressure of 1 mbar, and the substrate specimens were partially shadowed by a baffle-plate during plasma spraying for obtaining different coating microstructures. Based on the SEM observation, a column-like grain coating was deposited by pure vapor deposition at the shadowed region, whereas, in the unshadowed region, the coating exhibited a binary microstructure which was formed by a mixed deposition of melted particles and evaporated particles. The mechanical properties of the coating were also well under investigation.

  18. Thermal Shock Resistance of Stabilized Zirconia/Metal Coat on Polymer Matrix Composites by Thermal Spraying Process

    NASA Astrophysics Data System (ADS)

    Zhu, Ling; Huang, Wenzhi; Cheng, Haifeng; Cao, Xueqiang

    2014-12-01

    Stabilized zirconia/metal coating systems were deposited on the polymer matrix composites by a combined thermal spray process. Effects of the thicknesses of metal layers and ceramic layer on thermal shock resistance of the coating systems were investigated. According to the results of thermal shock lifetime, the coating system consisting of 20 μm Zn and 125 μm 8YSZ exhibited the best thermal shock resistance. Based on microstructure evolution, failure modes and failure mechanism of the coating systems were proposed. The main failure modes were the formation of vertical cracks and delamination in the outlayer of substrate, and the appearance of coating spallation. The residual stress, thermal stress and oxidation of substrate near the substrate/metal layer interface were responsible for coating failure, while the oxidation of substrate near the substrate/coating interface was the dominant one.

  19. Study of nano-hydroxyapatite/zirconia stabilized with yttria in bone healing: histopathological study in rabbit model.

    PubMed

    Abedi, Gholamreza; Jahanshahi, Amirali; Fathi, Mohamad Hosein; Haghdost, Iraj Sohrabi; Veshkini, Abas

    2014-03-01

    Acceleration of bone healing has always been a major challenge in orthopedic surgery, the aim of this study was an evaluation of the biological effects of zirconia-stabilized yttria on bone healing, using an in vivo model. Nano-hydroxyapatite powder with zirconia-stabilized yttria were inserted in rabbit tibia and then histologically analyzed and compared with non-treated controls so thirty six. New Zealand white male rabbits randomly divided into two groups of 18 rabbits each. A cortical hole of 4 mm diameter and 8 mm depth in each tibia was drilled. In group I, the defect was left empty, whereas in group II, the bone defect was packed with nano-hydroxyapatite/5% zirconia stabilized with yttria. Histological evaluations were performed at two, four and six weeks after the implantation. Microscopic changes on two groups along with the time course were scored and statistical analysis showed that the average scores in group II were significantly higher than the other groups (p < 0.05). Histological analysis was shown to be significantly improved by the nano-hydroxyapatite/5% zirconia stabilized with yttria compared with the control group, suggesting that this biomaterial promote the healing of cortical bone, presumably by acting as an osteoconductive.

  20. Composite resin to yttria stabilized tetragonal zirconia polycrystal bonding: comparison of repair methods.

    PubMed

    Cristoforides, Priscila; Amaral, Regina; May, Liliana Gressler; Bottino, Marco Antonio; Valandro, Luiz Felipe

    2012-01-01

    The purpose of the current study was to evaluate different approaches for bonding composite to the surface of yttria stabilized tetragonal zirconia polycrystal (Y-TZP) ceramics. One hundred Y-TZP blocks were embedded in acrylic resin, had the free surface polished, and were randomly divided into 10 groups (n=10). The tested repair approaches included four surface treatments: tribochemical silica coating (TBS), methacryloxydecyldihidrogenphosphate (MDP)-containing primer/silane, sandblasting, and metal/zirconia primer. Alcohol cleaning was used as a "no treatment" control. Surface treatment was followed by the application (or lack thereof) of an MDP-containing resin cement liner. Subsequently, a composite resin was applied to the ceramic surface using a cylindrical mold (4-mm diameter). After aging for 60 days in water storage, including 6000 thermal cycles, the specimens were submitted to a shear test. Analysis of variance and the Tukey test were used for statistical analyses (α=0.05). Surface treatment was a statistically significant factor (F=85.42; p<0.0001). The application of the MDP-containing liner had no effect on bond strength (p=0.1017). TBS was the only treatment that had a significantly positive effect on bond strength after aging. Considering the evaluated approaches, TBS seems to be the best surface treatment for Y-TZP composite repairs. The use of an MDP-containing liner between the composite and Y-TZP surfaces is not effective.

  1. Hydrothermal synthesis and characterization of zirconia based catalysts

    SciTech Connect

    Caillot, T. Salama, Z.; Chanut, N.; Cadete Santos Aires, F.J.; Bennici, S.; Auroux, A.

    2013-07-15

    In this work, three equimolar mixed oxides ZrO{sub 2}/CeO{sub 2}, ZrO{sub 2}/TiO{sub 2}, ZrO{sub 2}/La{sub 2}O{sub 3} and a reference ZrO{sub 2} have been synthesized by hydrothermal method. The structural and surface properties of these materials have been fully characterized by X-ray diffraction, transmission electron microscopy, surface area measurement, chemical analysis, XPS, infrared spectroscopy after adsorption of pyridine and adsorption microcalorimetry of NH{sub 3} and SO{sub 2} probe molecules. All investigated mixed oxides are amphoteric and possess redox centers on their surface. Moreover, hydrothermal synthesis leads to catalysts with higher surface area and with better acid–base properties than classical coprecipitation method. Both Lewis and Brønsted acid sites are present on the surface of the mixed oxides. Compared to the other samples, the ZrO{sub 2}/TiO{sub 2} material appears to be the best candidate for further application in acid–base catalysis. - Graphical abstract: Mesoporous amorphous phase with a high surface area of titania zirconia mixed oxide obtained by hydrothermal preparation. - Highlights: • Three zirconia based catalysts and a reference were prepared by hydrothermal synthesis. • Mixed oxides present larger surface areas than the reference ZrO{sub 2}. • ZrO{sub 2}/TiO{sub 2} catalyst presents a mesoporous structure with high surface area. • ZrO{sub 2}/TiO{sub 2} catalyst presents simultaneously strong acidic and basic properties.

  2. Mn-stabilized zirconia: from imitation diamonds to a new potential high-Tc ferromagnetic spintronics material.

    PubMed

    Ostanin, S; Ernst, A; Sandratskii, L M; Bruno, P; Däne, M; Hughes, I D; Staunton, J B; Hergert, W; Mertig, I; Kudrnovský, J

    2007-01-05

    From the basis of ab initio electronic structure calculations which include the effects of thermally excited magnetic fluctuations, we predict Mn-stabilized cubic zirconia to be ferromagnetic above 500 K. We find this material, which is well known both as an imitation diamond and as a catalyst, to be half-metallic with the majority and minority spin Mn impurity states lying in zirconia's wide gap. The Mn concentration can exceed 40%. The high-Tc ferromagnetism is robust to oxygen vacancy defects and to how the Mn impurities are distributed on the Zr fcc sublattice. We propose this ceramic as a promising future spintronics material.

  3. Impact of radiation defects on the structural stability of pure zirconia

    SciTech Connect

    Simeone, D.; Baldinozzi, G.; Gosset, D.

    2004-10-01

    Optical spectroscopy and x-ray diffraction were used to study the behavior of polycrystalline samples of pure monoclinic zirconia irradiated by low energy ions. A microscopic model based on these experiments is proposed to explain the displacive phase transition observed in this material after irradiation. Defects, produced in the oxygen sublattice, induce important strain fields on a nanometric scale. This strain field can be handled as a secondary order parameter within the Landau theory approach, leading to a decrease of the phase transition temperature and thus quenching the high temperature tetragonal phase. The model also explains the consequences of the thermal annealing for restoring the ground state monoclinic structure.

  4. The separation of grain and grain boundary impedance in thin yttria stabilized zirconia (YSZ) layers

    PubMed Central

    Gerstl, M.; Navickas, E.; Friedbacher, G.; Kubel, F.; Ahrens, M.; Fleig, J.

    2011-01-01

    An improved electrode geometry is proposed to study thin ion conducting films by impedance spectroscopy. It is shown that long, thin, and closely spaced electrodes arranged interdigitally allow a separation of grain and grain boundary effects also in very thin films. This separation is shown to be successful for yttria stabilized zirconia (YSZ) layers thinner than 20 nm. In a series of experiments it is demonstrated that the extracted parameters correspond to the YSZ grain boundary and grain bulk resistances or to grain boundary and substrate capacitances. Results also show that our YSZ films produced by pulsed-laser deposition (PLD) on sapphire substrates exhibit a bulk conductivity which is very close to that of macroscopic YSZ samples. PMID:27570327

  5. Fabrication of Yttria stabilized zirconia thin films on poroussubstrates for fuel cell applications

    SciTech Connect

    Leming, Andres

    2003-06-16

    A process for the deposition of yttria stabilized zirconia (YSZ) films, on porous substrates, has been developed. These films have possible applications as electrolyte membranes in fuel cells. The films were deposited from colloidal suspensions through the vacuum infiltration technique. Films were deposited on both fully sintered and partially sintered substrates. A critical cracking thickness for the films was identified and strategies are presented to overcome this barrier. Green film density was also examined, and a method for improving green density by changing suspension pH and surfactant was developed. A dependence of film density on film thickness was observed, and materials interactions are suggested as a possible cause. Non-shorted YSZ films were obtained on co-fired substrates, and a cathode supported solid oxide fuel cell was constructed and characterized.

  6. Fabrication of Fe nanowires on yittrium-stabilized zirconia single crystal substrates by thermal CVD methods

    SciTech Connect

    Kawahito, A.; Yanase, T.; Endo, T.; Nagahama, T.; Shimada, T.

    2015-05-07

    Magnetic nanowires (NWs) are promising as material for use in spintronics and as the precursor of permanent magnets because they have unique properties due to their high aspect ratio. The growth of magnetic Fe whiskers was reported in the 1960s, but the diameter was not on a nanoscale level and the growth mechanism was not fully elucidated. In the present paper, we report the almost vertical growth of Fe NWs on a single crystal yttrium-stabilized zirconia (Y{sub 0.15}Zr{sub 0.85}O{sub 2}) by a thermal CVD method. The NWs show a characteristic taper part on the bottom growing from a trigonal pyramidal nucleus. The taper angle and length can be controlled by changing the growth condition in two steps, which will lead to obtaining uniformly distributed thin Fe NWs for applications.

  7. Wetting and Mechanical Characteristics of the Reactive Air Braze for Yttria-Stabilized Zirconia (YSZ) Joining

    SciTech Connect

    Kim, Jin Yong Y.; Weil, K. Scott; Hardy, John S.

    2005-03-01

    Reactive air brazing (RAB) technique was developed as an effective alternative for the joining of complicated ceramic parts. The most important advantage of RAB over conventional active metal brazing is that joining operation of RAB technique can be conducted without using controlled atmosphere. It has been reported by us that the reactive component (copper) in the Ag-CuO braze is reactively to modify faying surfaces of alumina, improving the wettability with the oxide and potentially increasing bond strenth between braze and ceramics. In this work, the effects of CuO content on wetting behavior of Ag-CuO braze with yttria-stabilized zirconia (YSZ) substrates and the mechanical properties of brazed YSZ have been investigated. The results of this study to date will be discussed.

  8. Growth and micro structural studies on Yittria Stabilized Zirconia (YSZ) and Strontium Titanate (STO) buffer layers

    NASA Technical Reports Server (NTRS)

    Srinivas, S.; Pinto, R.; Pai, S. P.; Dsousa, D. P.; Apte, P. R.; Kumar, D.; Purandare, S. C.; Bhatnagar, A. K.

    1995-01-01

    Microstructure of Yittria Stabilized Zirconia (YSZ) and Strontium Titanate (STO) of radio frequency magnetron sputtered buffer layers was studied at various sputtering conditions on Si (100), Sapphire and LaAlO3 (100) substrates. The effect of substrate temperatures up to 800 C and sputtering gas pressures in the range of 50 mTorr. of growth conditions was studied. The buffer layers of YSZ and STO showed a strong tendency for columnar growth was observed above 15 mTorr sputtering gas pressure and at high substrate temperatures. Post annealing of these films in oxygen atmosphere reduced the oxygen deficiency and strain generated during growth of the films. Strong c-axis oriented superconducting YBa2Cu3O7-x (YBCO) thin films were obtained on these buffer layers using pulsed laser ablation technique. YBCO films deposited on multilayers of YSZ and STO were shown to have better superconducting properties.

  9. Grain Boundary Resistivity of Yttria-Stabilized Zirconia at 1400°C

    DOE PAGES

    Wang, J.; Du, A.; Yang, Di; ...

    2013-01-01

    Tmore » he grain size dependence of the bulk resistivity of 3 mol% yttria-stabilized zirconia at 1400°C was determined from the effect of a dc electric field E a = 18.1  V/cm on grain growth and the corresponding electric current during isothermal annealing tests. Employing the brick layer model, the present annealing test results were in accordance with extrapolations of the values obtained at lower temperature employing impedance spectroscopy and 4-point-probe dc.he combined values give that the magnitude of the grain boundary resistivity ρ b = 133  ohm-cm.he electric field across the grain boundary width was 28–43 times the applied field for the grain size and current ranges in the present annealing test.« less

  10. Coloration Related to Nanostructure of Yttria-Stabilized Cubic Zirconia Single Crystal Implanted with Ag Ions

    NASA Astrophysics Data System (ADS)

    Fujita, Takashi; Ijima, Kaoru; Mitsui, Naoto; Mochiduki, Kazuya; Saito, Yukinori

    2007-11-01

    Ag ions were implanted into single crystals of yttria-stabilized cubic zirconia (YSZ) at 1.5 MeV to a fluence of 2× 1016 ions/cm2. After implantation, heat treatments were performed at 500, 900, and 1000 °C in air. The surface color tone markedly changed from brown to a beautiful violet after heat treatments. Scanning transmission electron microscope (STEM) observations revealed that Ag nanoparticles were formed when samples were heated at temperatures higher than about 900 °C. The absorption spectrum in the visible region was measured. A large absorption peak appeared at 510 nm after heating at 900 °C. The peak could be attributed to the surface plasmon resonance of Ag nanoparticles.

  11. Compressive Creep Behavior of Spark Plasma Sintered 8 mol% Yttria Stabilized Cubic Zirconia

    NASA Astrophysics Data System (ADS)

    Robles Arellano, K. D.; Bichler, L.; Mondal, K.; Fong, R.

    2014-10-01

    The present paper describes compressive creep behavior of cubic 8 mol% Yttria-stabilized Zirconia, fabricated by spark plasma sintering, in the temperature range of 1300-1330 °C at a stress level of 78-193 MPa in vacuum. The pre- and post-creep microstructures, along with the values of the stress exponent ( n = 1.7-2.7) and the activation energy ( Q = 711-757 kJ/mol) suggest that a mixed mode of plastic deformation, dominated by grain boundary sliding, occurred in this material. The relatively high activation energy observed was related to the pinning of the grain boundaries by voids during creep, leading to microcrack formation, shear strain-induced grain exfoliation, and finally creation of new voids at grain boundaries.

  12. Deformation mechanisms for high-temperature creep of high yttria content stabilized zirconia single crystals

    SciTech Connect

    Gomez-Garcia, D.; Martinez-Fernandez, J.; Dominguez-Rodriguez, A.; Eveno, P.; Castaing, J.

    1996-03-01

    Creep of 21 mol.% yttria-stabilized zirconia single crystals has been studied between 1,400 and 1,800 C. The creep parameters have been determined indicating a change of the controlling mechanism around 1,500 C. At higher temperatures recovery creep is found to be the rate controlling mechanism, with a stress exponent {approx_equal} 3 and an activation energy {approx_equal} 6 eV. Transition to glide controlled creep occurs below 1,500 C, associated with larger stress exponents ({approx_equal} 5) and activation energies ({approx_equal} 8.5 eV). TEM observations of the dislocation microstructure confirm this transition. The influence of the high yttria content, which is at the origin of the high creep resistance of these crystals, is discussed for each range of temperatures.

  13. Structural modifications induced by swift heavy ions in thin films of yttria fully stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Lamperti, A.; Radnóczi, G.; Caricato, A. P.; Trautmann, C.; Ossi, P. M.

    2010-10-01

    Among ceramic materials for nuclear waste containment, single crystal yttria fully stabilized zirconia (FSZ) gained particular consideration because of its excellent radiation resistance both in the elastic and inelastic collision regime. We deposited amorphous and polycrystalline, cubic FSZ thin films on (1 0 0) Si by ultraviolet pulsed laser ablation and irradiated them with swift heavy uranium ions of 2.6-GeV energy at fluences between 2 and 12 × 10 11 ions cm -2. The films were characterized before and after irradiation using X-ray reflectivity, grazing incidence X-ray diffraction, micro-Raman spectroscopy and transmission electron microscopy. Under ion irradiation, as-deposited crystalline films undergo amorphisation, followed by partial recrystallisation, whereas as-deposited amorphous films retain their disordered character. The dominant defects produced in the films are oxygen vacancies which may explain the amorphisation to recrystallisation path of our crystalline films.

  14. Microstructure and mechanical properties of bulk yttria-partially-stabilized zirconia

    NASA Technical Reports Server (NTRS)

    Valentine, P. G.; Maier, R. D.; Mitchell, T. E.

    1981-01-01

    A commercially available bulk 4.5 mole percent yttria-(Y2O3) partially stabilized zirconia (PSZ) was studied by light microscopy, X-ray analysis, microhardness measurement, and fracture toughness testing. The growth of the precipitates and the phase transformations were studied as a function of aging in air at 1500 C. Aging curves were constructed for both the as received and the solution annealed and quenched materials; the curves showed hardness peaks at 1397 and 1517 Kg/sq mm respectively. The rectangular plate shaped tetragonal precipitates were found to have a 110 habit plane. A total of twelve different types of tetragonal precipitates were found. Grinding of the Y2O3 PSZ into powder did not cause a significant amount of metastable tetragonal precipitates to transform into the monoclinc phase, thus indicating that transformation toughening is not a significant mechanism for the material.

  15. “Conductive” yttria-stabilized zirconia as an epitaxial template for oxide heterostructures

    SciTech Connect

    Caspers, C.; Müller, M.; Gloskovskii, A.; Drube, W.; Schneider, C. M.

    2014-05-07

    We report an in situ thermochemical treatment that significantly increases the macroscopic electrical conductivity of insulating yttria-stabilized zirconia (YSZ) (001) single-crystalline substrates. We demonstrate the high-quality surface crystalline structure of the resulting “conductive” cYSZ (001) by low- and high-energy electron diffraction. Soft- and hard X-ray photoemission spectroscopy measurements reveal a sizable reduction of Zr cations to a metallic state and their homogeneous distribution within the cYSZ. We discuss the correlation between the microscopic chemical processes leading to the increased macroscopic metallicity. Finally, the heteroepitaxial growth of a functional magnetic oxide model system, ultrathin EuO on cYSZ (001), was demonstrated. cYSZ (001) thereby enables both high quality oxide heteroepitaxy and the advanced sample characterization by high electron-fluence characterization techniques.

  16. The discrepancies in multistep damage evolution of yttria-stabilized zirconia irradiated with different ions

    SciTech Connect

    Yang, Tengfei; Taylor, Caitlin A.; Kong, Shuyan; Wang, Chenxu; Zhang, Yanwen; Huang, Xuejun; Xue, Jianming; Yan, Sha; Wang, Yugang

    2013-01-01

    This paper reports a comprehensive investigation of structural damage in yttria-stabilized zirconia irradiated with different ions over a wide fluence range. A similar multistep damage accumulation exists for the irradiations of different ions, but the critical doses for occurrence of second damage step, characterized by a faster increase in damage fraction, and the maximum elastic strain at the first damage step are varied and depend on ion mass. For irradiations of heavier ions, the second damage step occurs at a higher dose with a lower critical elastic strain. Furthermore, larger extended defects were observed in the irradiations of heavy ions at the second damage step. Associated with other experiment results and multistep damage accumulation model, the distinct discrepancies in the damage buildup under irradiations of different ions were interpreted by the effects of electronic excitation, energy of primary knock-on atom and chemistry contributions of deposited ions.

  17. Fabrication of Fe nanowires on yittrium-stabilized zirconia single crystal substrates by thermal CVD methods

    NASA Astrophysics Data System (ADS)

    Kawahito, A.; Yanase, T.; Endo, T.; Nagahama, T.; Shimada, T.

    2015-05-01

    Magnetic nanowires (NWs) are promising as material for use in spintronics and as the precursor of permanent magnets because they have unique properties due to their high aspect ratio. The growth of magnetic Fe whiskers was reported in the 1960s, but the diameter was not on a nanoscale level and the growth mechanism was not fully elucidated. In the present paper, we report the almost vertical growth of Fe NWs on a single crystal yttrium-stabilized zirconia (Y0.15Zr0.85O2) by a thermal CVD method. The NWs show a characteristic taper part on the bottom growing from a trigonal pyramidal nucleus. The taper angle and length can be controlled by changing the growth condition in two steps, which will lead to obtaining uniformly distributed thin Fe NWs for applications.

  18. Control of Yttrium Diffusion out of Yttria Stabilized Zirconia during SOM Electrolysis for Magnesium Production

    NASA Astrophysics Data System (ADS)

    Gratz, E.; Pati, S.; Milshtein, J.; Powell, A.; Pal, U.

    The solid oxide membrane (SOM) process has been used to produce magnesium by direct electrolysis of its oxide. In this process MgO is dissolved in a molten CaF2-MgF2 flux and an yttria-stabilized zirconia (YSZ) SOM membrane separates the cathode and the flux from the anode. YSZ membrane stability limits the operating life of the SOM electrolyzer. The YSZ membrane is known to degrade due to diffusion of yttrium into the flux. Yttrium diffusion can however be decreased by adding YF3 to the flux. This study investigates the long-term stability of the YSZ membrane. Yttrium composition profiles in the YSZ membrane were determined using WDS as a function of immersion time and YF3 content in the flux. An analytic solution to the diffusion equation was used to model the diffusion process. This study allows the determination of the optimum YF3 content needed in the flux to minimize yttrium diffusion and increase membrane stability.

  19. Fracture resistance of implant-supported screw-retained zirconia-based molar restorations.

    PubMed

    Honda, Junichi; Komine, Futoshi; Kamio, Shingo; Taguchi, Kohei; Blatz, Markus B; Matsumura, Hideo

    2017-09-01

    The objective of this in vitro study was to investigate fracture loads of screw-retained zirconia-based molar restorations (hybrid abutment crown) fabricated with different restorative materials and designs. Forty-four screw-retained zirconia-based molar restorations were fabricated on dental implants and divided into four groups (n = 11): porcelain-layered zirconia-based restorations (PLZ), indirect composite-layered zirconia-based restorations (ILZ), metal-ceramic restorations (MC), and monolithic zirconia restorations (MONO). The zirconia-based restorations in the PLZ, ILZ, and MONO groups were adhesively bonded on implant abutments with a dual-polymerized resin material. All restorations were tightened on implant bodies with titanium screws and were tested for fracture resistance. The Kruskal-Wallis test and Steel-Dwass test were used to evaluate differences in fracture loads (α = 0.05). As compared with the other groups, the MONO specimens had a significantly higher mean fracture resistance (7.54 kN); no significant differences were found among the PLZ (1.96 kN), ILZ (1.80 kN), and MC (1.45 kN) groups (P > 0.05). For the PLZ, ILZ, and MC groups, all specimens fractured within the layering materials. In contrast, the fracture mode for the MONO group was complete fracture of the restorations. All restorations withstood the masticatory forces. Fracture loads were significantly higher for screw-retained implant-supported monolithic zirconia restorations than for screw-retained bilayered restorations. For the screw-retained bilayered zirconia-based restorations, the fracture resistance of ILZ restorations was comparable to that of PLZ restorations and MC restorations. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  20. Deterioration of yttria-stabilized zirconia by boron carbide alone or mixed with metallic or oxidized Fe, Cr, Zr mixtures

    NASA Astrophysics Data System (ADS)

    De Bremaecker, A.; Ayrault, L.; Clément, B.

    2014-08-01

    In the frame of severe accident conditions (PHEBUS FPT3 test), different experiments were carried out on the interactions of 20% yttria-stabilized zirconia (YSZ) and 20% ceria-stab zirconia with boron carbide or its oxidation products (B2O3): either tests under steam between 1230° and 1700 °C with B4C alone or B4C mixed with metals, either tests under Ar with boron oxide present in a mixture of iron and chromium oxides. In all cases an interaction was observed with formation of intergranular yttrium borate. At 1700 °C boron oxide is able to “pump out” the Y stabiliser from the YSZ grains but also some trace elements (Ca and Al) and to form a eutectic containing YBO3 and yttrium calcium oxy-borate (YCOB). At the same time a substantial swelling (“bloating”) of the zirconia happens, qualitatively similar to the foaming of irradiated fuel in contact with a Zr-melt. In all samples the lowering of the Y (or Ce)-content in the YSZ grains is so sharp that in the interaction layers zirconia is no longer stabilized. This is important when YSZ is envisaged as simulant of UO2 or as inert matrix for Am-transmutation.

  1. Low Energy Surface Activation of Zirconia Based Restorations.

    PubMed

    Aboushelib, Moustafa N

    2016-03-01

    To evaluate the influence of low energy surface activation technique on the biaxial flexure strength of zirconia frameworks. Zirconia discs were prepared by cutting CAD/CAM zirconia blocks. Sintered discs were airborne particle abraded using one of the following particles: 30 μm alumina particles, 50 μm alumina particles, or modified round edges 30 μm alumina particles at low pressure. Scanning electron microscopy, x-ray diffraction analysis, surface roughness, and biaxial flexure strength tests were performed (n = 20). Fractured specimens were fractographically analyzed (α = 0.05). Low energy surface activation resulted in 7% monoclinic crystallographic transformation, increasing surface roughness from 0.05 to 0.3 μm and in significant increase in biaxial flexure strength (1718 MPa) compared 30 μm (1064 MPa), 50 μm (1210 MPa), and as-sintered specimens (1150 MPa). Low energy surface activation of zirconia specimens improved the biaxial flexure strength of zirconia frameworks without creation of surface damage. Clinical implications: by controlling particle size and shape of alumina, the flexure strength of zirconia restorations could be increased usinglow pressure particle abrasion.

  2. A Stability Study of Ni/Yttria-Stabilized Zirconia Anode for Direct Ammonia Solid Oxide Fuel Cells.

    PubMed

    Yang, Jun; Molouk, Ahmed Fathi Salem; Okanishi, Takeou; Muroyama, Hiroki; Matsui, Toshiaki; Eguchi, Koichi

    2015-12-30

    In recent years, solid oxide fuel cells fueled with ammonia have been attracting intensive attention. In this work, ammonia fuel was supplied to the Ni/yttria-stabilized zirconia (YSZ) cermet anode at 600 and 700 °C, and the change of electrochemical performance and microstructure under the open-circuit state was studied in detail. The influence of ammonia exposure on the microstructure of Ni was also investigated by using Ni/YSZ powder and Ni film deposited on a YSZ disk. The obtained results demonstrated that Ni in the cermet anode was partially nitrided under an ammonia atmosphere, which considerably roughened the Ni surface. Moreover, the destruction of the anode support layer was confirmed for the anode-supported cell upon the temperature cycling test between 600 and 700 °C because of the nitriding phenomenon of Ni, resulting in severe performance degradation.

  3. A novel electrochemical sensor based on zirconia/ordered macroporous polyaniline for ultrasensitive detection of pesticides.

    PubMed

    Wang, Yonglan; Jin, Jun; Yuan, Caixia; Zhang, Fan; Ma, Linlin; Qin, Dongdong; Shan, Duoliang; Lu, Xiaoquan

    2015-01-21

    A simple and mild strategy was proposed to develop a novel electrochemical sensor based on zirconia/ordered macroporous polyaniline (ZrO2/OMP) and further used for the detection of methyl parathion (MP), one of the organophosphate pesticides (OPPs). Due to the strong affinity of phosphate groups with ZrO2 and the advantages of OMP such as high catalytic activity and good conductivity, the developed sensor showed a limit of detection as low as 2.28 × 10(-10) mol L(-1) (S/N = 3) by square-wave voltammograms, and good selectivity, acceptable reproducibility and stability. Most importantly, this novel sensor was successfully applied to detect MP in real samples of apple and cabbage. It is expected that this method has potential applications in electrochemical sensing platforms with simple, sensitive, selective and fast analysis.

  4. Mixed conductivity, structural and microstructural characterization of titania-doped yttria tetragonal zirconia polycrystalline/titania-doped yttria stabilized zirconia composite anode matrices

    SciTech Connect

    Colomer, M.T.

    2011-02-15

    Taking advantage of the fact that TiO{sub 2} additions to 8YSZ cause not only the formation of a titania-doped YSZ solid solution but also a titania-doped YTZP solid solution, composite materials based on both solutions were prepared by solid state reaction. In particular, additions of 15 mol% of TiO{sub 2} give rise to composite materials constituted by 0.51 mol fraction titania-doped yttria tetragonal zirconia polycrystalline and 0.49 mol fraction titania-doped yttria stabilized zirconia (0.51TiYTZP/0.49TiYSZ). Furthermore, Y{sub 2}(Ti{sub 1-y}Zr{sub y}){sub 2}O{sub 7} pyrochlore is present as an impurity phase with y close to 1, according to FT-Raman results. Lower and higher additions of titania than that of 15 mol%, i.e., x=0, 5, 10, 20, 25 and 30 mol% were considered to study the evolution of 8YSZ phase as a function of the TiO{sub 2} content. Furthermore, zirconium titanate phase (ZrTiO{sub 4}) is detected when the titania content is equal or higher than 20 mol% and this phase admits Y{sub 2}O{sub 3} in solid solution according to FE-SEM-EDX. The 0.51TiYTZP/0.49TiYSZ duplex material was selected in this study to establish the mechanism of its electronic conduction under low oxygen partial pressures. In the pO{sub 2} range from 0.21 to 10{sup -7.5} atm. the conductivity is predominantly ionic and constant over the range and its value is 0.01 S/cm. The ionic plus electronic conductivity is 0.02 S/cm at 1000 {sup o}C and 10{sup -12.3} atm. Furthermore, the onset of electronic conductivity under reducing conditions exhibits a -1/4 pO{sub 2} dependence. Therefore, it is concluded that the n-type electronic conduction in the duplex material can be due to a small polaron-hopping between Ti{sup 3+} and Ti{sup 4+}. -- Graphical abstract: FE-SEM micrograph of a polished and thermal etched surface of a Ti-doped YTZP/Ti-doped YSZ composite material. Display Omitted Research highlights: {yields} Ti-doped YTZP/Ti-doped YSZ composite materials are mixed conductors under

  5. Phase transformation and wear studies of plasma sprayed yttria stabilized zirconia coatings containing various mol% of yttria

    SciTech Connect

    Aruna, S.T. Balaji, N.; Rajam, K.S.

    2011-07-15

    Plasma sprayable grade zirconia powders doped with various mol% of yttria (0, 2, 3, 4, 6, 8 and 12 mol%) were synthesized by a chemical co-precipitation route. The coprecipitation conditions were adjusted such that the powders possessed good flowability in the as calcined condition and thus avoiding the agglomeration step like spray drying. Identical plasma spray parameters were used for plasma spraying all the powders on stainless steel plates. The powders and plasma sprayed coatings were characterized by X-ray diffractometry, Scanning Electron Microscopy and Raman spectroscopy. Zirconia powders are susceptible to phase transformations when subjected to very high temperatures during plasma spraying and XRD is insensitive to the presence of some non crystalline phases and hence Raman spectroscopy was used as an important tool. The microstructure of the plasma sprayed coatings showed a bimodal distribution containing fully melted and unmelted zones. The microhardness and wear resistance of the plasma sprayed coatings were determined. Among the plasma sprayed coatings, 3 mol% yttria stabilized zirconia coating containing pure tetragonal zirconia showed the highest wear resistance. - Research Highlights: {yields} Preparation plasma sprayable YSZ powders without any agglomeration process and plasma spraying {yields} Phase transformation studies of plasma sprayed YSZ coatings by XRD and Raman spectroscopy {yields} Microstructure of the plasma sprayed coatings exhibited bimodal distribution {yields} Plasma sprayed 3 mol% YSZ coating exhibited the highest wear resistance {yields} Higher wear resistance is due to the higher fracture toughness of tetragonal 3 mol% YSZ phase.

  6. Kinetic Monte Carlo Simulation of Oxygen and Cation Diffusion in Yttria-Stabilized Zirconia

    NASA Technical Reports Server (NTRS)

    Good, Brian

    2011-01-01

    Yttria-stabilized zirconia (YSZ) is of interest to the aerospace community, notably for its application as a thermal barrier coating for turbine engine components. In such an application, diffusion of both oxygen ions and cations is of concern. Oxygen diffusion can lead to deterioration of a coated part, and often necessitates an environmental barrier coating. Cation diffusion in YSZ is much slower than oxygen diffusion. However, such diffusion is a mechanism by which creep takes place, potentially affecting the mechanical integrity and phase stability of the coating. In other applications, the high oxygen diffusivity of YSZ is useful, and makes the material of interest for use as a solid-state electrolyte in fuel cells. The kinetic Monte Carlo (kMC) method offers a number of advantages compared with the more widely known molecular dynamics simulation method. In particular, kMC is much more efficient for the study of processes, such as diffusion, that involve infrequent events. We describe the results of kinetic Monte Carlo computer simulations of oxygen and cation diffusion in YSZ. Using diffusive energy barriers from ab initio calculations and from the literature, we present results on the temperature dependence of oxygen and cation diffusivity, and on the dependence of the diffusivities on yttria concentration and oxygen sublattice vacancy concentration. We also present results of the effect on diffusivity of oxygen vacancies in the vicinity of the barrier cations that determine the oxygen diffusion energy barriers.

  7. Behavior of zirconia based fuel material under Xe irradiation

    SciTech Connect

    Degueldre, C. |; Heimgartner, P.; Ledgergerber, G.; Sasajima, N.; Hojou, K.; Muromura, T.; Wang, L.; Gong, W.; Ewing, R.

    1997-11-01

    The behavior of ZrO{sub 2}-10%YO{sub 1.5}-5%ErO{sub 1.5}-(10%ThO{sub 2}) (At %) cubic solid solutions under low and high energy Xe ion irradiation up to a fluence of 1.8 {center_dot} 10{sup 16} Xe-cm{sup {minus}2} was investigated by TEM. Low energy (60 keV) Xe ions did not yield amorphization. From the observed bubble formation, swelling values of less than one volume percent were estimated to be 0.19--0.72% during irradiation at room temperature or at high temperature (925 K). Furthermore, no amorphization was obtained by Xe irradiation under extreme conditions such as high energy (1.5 MeV) Xe ion and low temperature (20 K). This confirms the robustness of this material and argues in favor of the selection of zirconia based material as an advanced nuclear fuel for plutonium disposition.

  8. Effects of the precipitation of stabilizers on the mechanism of grain fracturing in a zirconia metering nozzle

    NASA Astrophysics Data System (ADS)

    Zhao, Liang; Xue, Qun-hu; Ding, Dong-hai

    2016-09-01

    The mechanism of grain fracturing in a zirconia metering nozzle used in the continuous casting process was studied. The phase composition, microstructure, and chemical composition of the residual samples were studied using an X-ray fluorescence analyzer, scanning electron microscope, and electron probe. Results revealed that the composition, structure, and mineral phase of the original layer, transition layer, and affected layer of the metering nozzle differed because of stabilizer precipitation and steel slag permeation. The stabilizer MgO formed low-melting phases with steel slag and impure SiO2 on the boundaries (pores) of zirconia grains; consequently, grain fracturing occurred and accelerated damage to the metering nozzle was observed.

  9. Sol-gel dip coating of yttria-stabilized tetragonal zirconia dental ceramic by aluminosilicate nanocomposite as a novel technique to improve the bonding of veneering porcelain.

    PubMed

    Madani, Azamsadat; Nakhaei, Mohammadreza; Karami, Parisa; Rajabzadeh, Ghadir; Salehi, Sahar; Bagheri, Hossein

    2016-01-01

    The aim of this in vitro study was to evaluate the effect of silica and aluminosilicate nanocomposite coating of zirconia-based dental ceramic by a sol-gel dip-coating technique on the bond strength of veneering porcelain to the yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) in vitro. Thirty Y-TZP blocks (10 mm ×10 mm ×3 mm) were prepared and were assigned to four experimental groups (n=10/group): C, without any further surface treatment as the control group; S, sandblasted using 110 μm alumina powder; Si, silica sol dip coating + calcination; and Si/Al, aluminosilicate sol dip coating + calcination. After preparing Y-TZP samples, a 3 mm thick layer of the recommended porcelain was fired on the coated Y-TZP surface. Fourier transform infrared spectroscopy (FT-IR), X-ray diffraction (XRD), scanning electron microscopy (SEM), and energy-dispersive X-ray analysis were used to characterize the coating and the nature of the bonding between the coating and zirconia. To examine the zirconia-porcelain bond strength, a microtensile bond strength (μTBS) approach was chosen. FT-IR study showed the formation of silica and aluminosilicate materials. XRD pattern showed the formation of new phases consisting of Si, Al, and Zr in coated samples. SEM showed the formation of a uniform coating on Y-TZP samples. Maximum μTBS values were obtained in aluminosilicate samples, which were significantly increased compared to control and sandblasted groups (P=0.013 and P<0.001, respectively). This study showed that aluminosilicate sol-gel dip coating can be considered as a convenient, less expensive reliable method for improving the bond strength between dental Y-TZP ceramics and veneering porcelain.

  10. Controlling Microstructure of Yttria-Stabilized Zirconia Prepared from Suspensions and Solutions by Plasma Spraying with High Feed Rates

    NASA Astrophysics Data System (ADS)

    Musalek, Radek; Medricky, Jan; Tesar, Tomas; Kotlan, Jiri; Pala, Zdenek; Lukac, Frantisek; Illkova, Ksenia; Hlina, Michal; Chraska, Tomas; Sokolowski, Pawel; Curry, Nicholas

    2017-09-01

    Introduction of suspension and solution plasma spraying led to a breakthrough in the deposition of yttria-stabilized zirconia (YSZ) coatings and enabled preparation of new types of layers. However, their deposition with high feed rates needed, for example, for the deposition of thermal barrier coatings (TBCs) on large-scale components, is still challenging. In this study, possibility of high-throughput plasma spraying of YSZ coatings is demonstrated for the latest generation of high-enthalpy hybrid water-stabilized plasma (WSP-H) torch technology. The results show that microstructure of the coatings prepared by WSP-H may be tailored for specific applications by the choice of deposition conditions, in particular formulation of the liquid feedstock. Porous and columnar coatings with low thermal conductivity (0.5-0.6 W/mK) were prepared from commercial ethanol-based suspension. Dense vertically cracked coatings with higher thermal conductivity but also higher internal cohesion were deposited from suspension containing ethanol/water mixture and coarser YSZ particles. Spraying of solution formulated from diluted zirconium acetate and yttrium nitrate hexahydrate led also to the successful deposition of YSZ coating combining regions of porous and denser microstructure and providing both low thermal conductivity and improved cohesion of the coating. Enthalpy content, liquid-plasma interaction and coating buildup mechanisms are also discussed.

  11. Evaluation of structure and material properties of RF magnetron sputter-deposited yttria-stabilized zirconia thin films

    NASA Astrophysics Data System (ADS)

    Piascik, Jeffrey Robert

    (˜ 100 MPa) in the compressive stress of the films. Environmental aging suggests the change in compressive stress was related to water vapor absorption. These effects were then evaluated for films formed under different deposition parameters with varying density (calculated packing density) and crystal structure (XRD). Based on the above results, it was determined to evaluate stress as a function of substrate bias. It was shown that increasing substrate bias power disrupted columnar grain growth and reduced the percent change in compressive stress when exposed to ambient environments. TEM confirmed a reduction in inter-granular porosity for substrate bias depositions, but an increase in lateral defects. It was hypothesized that substrate bias would increase the film's density, but after inspection of SEM and TEM micrographs, it appeared that as bias was increased the density decreased. This T⇒M phase transformation has been well documented for bulk PSZ, but limited data exists for PSZ thin films. Data is presented that supports a stress-induced T=>M transformation mechanism that occurs during sputter-deposition in the presence of a substrate bias. Substrate bias (0--50W) was originally applied to increase film density, modify microstructure, and vary film stress. The films were deposited using rf magnetron sputtering from a sintered yttria-stabilized zirconia (YSZ) target and subsequently characterized using scanning (SEM) and transmission electron microscopy (TEM), x-ray diffraction (XRD), and wafer bow measurement (for stress analysis). With no substrate bias the films exhibited a columnar grain structure consistent with sputter-deposited films, with a majority tetragonal phase as determined by XRD. Under higher substrate bias, wafer bow measurements indicated a steady increase in compressive stress as substrate bias increased (max. 310MPa at 50W bias), while XRD indicated a corresponding increase in the percentage of monoclinic phase. Both SEM and TEM analyses

  12. Microstructural Characterization of Yttria-Stabilized Zirconia Sintered at Different Temperatures Using 3D EBSD, 2D EBSD and Stereological Calculations

    NASA Astrophysics Data System (ADS)

    Bobrowski, Piotr; Faryna, Marek; Pędzich, Zbigniew

    2017-06-01

    A set of yttria-stabilized zirconia samples sintered at increasing temperatures was investigated using two-dimensional (2D) and three-dimensional (3D) electron backscatter diffraction (EBSD) techniques to calculate grain size distributions and grain boundary densities. The obtained results were compared to the results of stereological calculations and revealed that mean intercept length, a commonly used stereological parameter, is ca. 20% lower than an average grain diameter derived from 2D and 3D EBSD data. Moreover, the results based on 2D and 3D EBSD analyses were similar to each other in grain boundary density, while the values obtained from the stereological approach were noticeably lower.

  13. Synthesis and Phase Stability of Scandia, Gadolinia, and Ytterbia Co-doped Zirconia for Thermal Barrier Coating Application

    NASA Astrophysics Data System (ADS)

    Li, Qi-Lian; Cui, Xiang-Zhong; Li, Shu-Qing; Yang, Wei-Hua; Wang, Chun; Cao, Qian

    2015-01-01

    Scandia, gadolinia, and ytterbia co-doped zirconia (SGYZ) ceramic powder was synthesized by chemical co-precipitation and calcination processes for application in thermal barrier coatings to promote the durability of gas turbines. The ceramic powder was agglomerated and sintered at 1150 °C for 2 h, and the powder exhibited good flowability and apparent density to be suitable for plasma spraying process. The microstructure, morphology and phase stability of the powder and plasma-sprayed SGYZ coatings were analyzed by means of scanning electron microscope and x-ray diffraction. Thermal conductivity of plasma-sprayed SGYZ coatings was measured. The results indicated that the SGYZ ceramic powder and the coating exhibit excellent stability to retain single non-transformable tetragonal zirconia even after high temperature (1400 °C) exposure for 500 h and do not undergo a tetragonal-to-monoclinic phase transition upon cooling. Furthermore, the plasma-sprayed SGYZ coating also exhibits lower thermal conductivity than yttria stabilized zirconia coating currently used in gas turbine engine industry. SGYZ can be explored as a candidate material of ultra-high temperature thermal barrier coating for advanced gas turbine engines.

  14. Stabilizing Ir(001) Epitaxy on Yttria-Stabilized Zirconia Using a Thin Ir Seed Layer Grown by Pulsed Laser Deposition

    SciTech Connect

    Fan, Lisha; Jacobs, Christopher B.; Rouleau, Christopher M.; Eres, Gyula

    2016-11-18

    In this paper, we demonstrate the reproducible epitaxial growth of 100 nm thick Ir(001) films on a heteroepitaxial stack consisting of 5 nm Ir and 100 nm yttria-stabilized zirconia (YSZ) grown on Si(001) substrates. It is shown that a 5 nm thick Ir layer grown by pulsed laser deposition in the same chamber as the YSZ film without breaking the vacuum is the key to stabilizing Ir(001) epitaxial growth. Growth of the Ir seed layer with pure (001) orientation occurs only in a narrow growth temperature window from 550 to 750 °C, and the fraction of Ir(111) increases at substrate temperatures outside of this window. The Ir seed layer prevents exposure of the YSZ film to air during sample transfer and enables highly reproducible Ir(001) heteroepitaxy on YSZ buffered Si(001). In contrast, if Ir is grown directly on a bare YSZ layer that was exposed to ambient conditions, the films are prone to change orientation to (111). These results reveal that preserving the chemical and structural purity of the YSZ surface is imperative for achieving Ir(001) epitaxy. The narrow range of the mosaic spread values from eight experiments demonstrates the high yield and high reproducibility of Ir(001) heteroepitaxy by this approach. Lastly, the improved Ir(001) epitaxial growth method is of great significance for integrating a variety of technologically important materials such as diamond, graphene, and functional oxides on a Si platform.

  15. Stabilizing Ir(001) Epitaxy on Yttria-Stabilized Zirconia Using a Thin Ir Seed Layer Grown by Pulsed Laser Deposition

    DOE PAGES

    Fan, Lisha; Jacobs, Christopher B.; Rouleau, Christopher M.; ...

    2016-11-18

    In this paper, we demonstrate the reproducible epitaxial growth of 100 nm thick Ir(001) films on a heteroepitaxial stack consisting of 5 nm Ir and 100 nm yttria-stabilized zirconia (YSZ) grown on Si(001) substrates. It is shown that a 5 nm thick Ir layer grown by pulsed laser deposition in the same chamber as the YSZ film without breaking the vacuum is the key to stabilizing Ir(001) epitaxial growth. Growth of the Ir seed layer with pure (001) orientation occurs only in a narrow growth temperature window from 550 to 750 °C, and the fraction of Ir(111) increases at substratemore » temperatures outside of this window. The Ir seed layer prevents exposure of the YSZ film to air during sample transfer and enables highly reproducible Ir(001) heteroepitaxy on YSZ buffered Si(001). In contrast, if Ir is grown directly on a bare YSZ layer that was exposed to ambient conditions, the films are prone to change orientation to (111). These results reveal that preserving the chemical and structural purity of the YSZ surface is imperative for achieving Ir(001) epitaxy. The narrow range of the mosaic spread values from eight experiments demonstrates the high yield and high reproducibility of Ir(001) heteroepitaxy by this approach. Lastly, the improved Ir(001) epitaxial growth method is of great significance for integrating a variety of technologically important materials such as diamond, graphene, and functional oxides on a Si platform.« less

  16. Effects of artificial aging conditions on yttria-stabilized zirconia implant abutments.

    PubMed

    Basílio, Mariana de Almeida; Cardoso, Kátia Vieira; Antonio, Selma Gutierrez; Rizkalla, Amin Sami; Santos Junior, Gildo Coelho; Arioli Filho, João Neudenir

    2016-08-01

    Most ceramic abutments are fabricated from yttria-stabilized tetragonal zirconia (Y-TZP). However, Y-TZP undergoes hydrothermal degradation, a process that is not well understood. The purpose of this in vitro study was to assess the effects of artificial aging conditions on the fracture load, phase stability, and surface microstructure of a Y-TZP abutment. Thirty-two prefabricated Y-TZP abutments were screwed and tightened down to external hexagon implants and divided into 4 groups (n = 8): C, control; MC, mechanical cycling (1×10(6) cycles; 10 Hz); AUT, autoclaving (134°C; 5 hours; 0.2 MPa); and TC, thermal cycling (10(4) cycles; 5°/55°C). A single-load-to-fracture test was performed at a crosshead speed of 0.5 mm/min to assess the assembly's resistance to fracture (ISO Norm 14801). X-ray diffraction (XRD) analysis was applied to observe and quantify the tetragonal-monoclinic (t-m) phase transformation. Representative abutments were examined with high-resolution scanning electron microscopy (SEM) to observe the surface characteristics of the abutments. Load-to-fracture test results (N) were compared by ANOVA and Tukey test (α=.05). XRD measurements revealed the monoclinic phase in some abutments after each aging condition. All the aging conditions reduced the fracture load significantly (P<.001). Mechanical cycling reduced the fracture load more than autoclaving (P=.034). No differences were found in the process of surface degradation among the groups; however, the SEM detected grinding-induced surface flaws and microcracks. The resistance to fracture and the phase stability of Y-TZP implant abutments were susceptible to hydrothermal and mechanical conditions. The surface microstructure of Y-TZP abutments did not change after aging conditions. Copyright © 2016 Editorial Council for the Journal of Prosthetic Dentistry. Published by Elsevier Inc. All rights reserved.

  17. Evaluation of laser bacterial anti-fouling of transparent nanocrystalline yttria-stabilized-zirconia cranial implant.

    PubMed

    Damestani, Yasaman; De Howitt, Natalie; Halaney, David L; Garay, Javier E; Aguilar, Guillermo

    2016-10-01

    The development and feasibility of a novel nanocrystalline yttria-stabilized-zirconia (nc-YSZ) cranial implant has been recently established. The purpose of what we now call "window to the brain (WttB)" implant (or platform), is to improve patient care by providing a technique for delivery and/or collection of light into/from the brain, on demand, over large areas, and on a chronically recurring basis without the need for repeated craniotomies. WttB holds the transformative potential for enhancing light-based diagnosis and treatment of a wide variety of brain pathologies including cerebral edema, traumatic brain injury, stroke, glioma, and neurodegenerative diseases. However, bacterial adhesion to the cranial implant is the leading factor for biofilm formation (fouling), infection, and treatment failure. Escherichia coli (E. coli), in particular, is the most common isolate in gram-negative bacillary meningitis after cranial surgery or trauma. The transparency of our WttB implant may provide a unique opportunity for non-invasive treatment of bacterial infection under the implant using medical lasers. A drop of a diluted overnight culture of BL21-293 E. coli expressing luciferase was seeded between the nc-YSZ implant and the agar plate. This was followed by immediate irradiation with selected laser. After each laser treatment the nc-YSZ was removed, and cultures were incubated for 24 hours at 37 °C. The study examined continuous wave (CW) and pulsed wave (PW) modes of near-infrared (NIR) 810 nm laser wavelength with a power output ranging from 1 to 3 W. During irradiation, the temperature distribution of nc-YSZ surface was monitored using an infrared thermal camera. Relative luminescence unit (RLU) was used to evaluate the viability of bacteria after the NIR laser treatment. Analysis of RLU suggests that the viability of E. coli biofilm formation was reduced with NIR laser treatment when compared to the control group (P < 0.01) and loss of viability

  18. Evaluation of self-adhesive resin cement bond strength to yttria-stabilized zirconia ceramic (Y-TZP) using four surface treatments.

    PubMed

    Miragaya, Luciana; Maia, Luciane Cople; Sabrosa, Carlos Eduardo; de Goes, Mário Fernando; da Silva, Eduardo Moreira

    2011-10-01

    To evaluate the influence of four surface treatments on the bond strength of a self-adhesive resin cement to an yttria-stabilized zirconia (Y-TZP) ceramic material (Lava Frame zirconia). Forty plates (8 x 6 x 1 mm) of a Y-TZP ceramic restorative material were randomly assigned to four groups (n = 10) according to the surface treatments: control, no treatment; airborne-particle abrasion with 50-μm Al2O3; coating with an MDP-based primer; conditioning with Rocatec System. The ceramic plates treated with each of the four methods were further divided into 2 subgroups according to the resin cement tested: RelyXTM ARC (ARC, conventional) and RelyXTM Unicem (Ucem, self-adhesive). The resin cements were put into PVC tubes (diameter 0.75 mm, 0.5 mm height) placed on the ceramic plate surfaces. After water storage at 37°C for 24 h, the specimens were submitted to a microshear bond strength (μSBS) test at a crosshead speed of 1.0 mm/min. The surface treatments significantly influenced the μSBS (p < 0.05). For the four surface treatments, UCem presented significantly higher μSBS than ARC (p < 0.05). For both resin cements, the best result was produced by the MDP-based primer: ARC 15.9 ± 5.0 MPa and UCem 36.2 ± 2.1 MPa. The highest μSBS values were presented by UCem on ceramic plates treated with the MDP-based primer (36.2 ± 2.1 MPa) and Rocatec system (37.4 ± 2.3 MPa). Irrespective of the surface treatment, the self-adhesive resin cement performed better in terms of bond strength to yttria-stabilized zirconia ceramic than did conventional resin cement.

  19. Ageing and thermal recovery of paramagnetic centers induced by electron irradiation in yttria-stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Costantini, J. M.; Beuneu, F.

    We have used electron spin resonance spectroscopy to study the defects induced in yttria-stabilized zirconia (YSZ) single crystals by 2.5-MeV electron irradiations. Two paramagnetic centers are produced: the first one with an axial <111> symmetry is similar to the trigonal Zr3+ electron center (T center) found after X-ray irradiation or thermo-chemical reduction, whereas the second one is a new oxygen hole center with an axial <100> symmetry different from the orthorhombic O- center induced by X-ray irradiation. At a fluence around 10(18) e/cm(2) , both centers are bleached out near 600 K, like the corresponding X-ray induced defects. At a fluence around 10(19) e/cm(2) , defects are much more stable, since complete thermal bleaching occurs near 1000 K. Accordingly, ageing of as-irradiated samples shows that high-dose defects at more stable than the low-dose ones.

  20. Preparation and characterization of epitaxially grown unsupported yttria-stabilized zirconia (YSZ) thin films

    NASA Astrophysics Data System (ADS)

    Götsch, Thomas; Mayr, Lukas; Stöger-Pollach, Michael; Klötzer, Bernhard; Penner, Simon

    2015-03-01

    Epitaxially grown, chemically homogeneous yttria-stabilized zirconia thin films ("YSZ", 8 mol% Y2O3) are prepared by direct-current sputtering onto a single-crystalline NaCl(0 0 1) template at substrate temperatures ≥493 K, resulting in unsupported YSZ films after floating off NaCl in water. A combined methodological approach by dedicated (surface science) analytical characterization tools (transmission electron microscopy and diffraction, atomic force microscopy, angle-resolved X-ray photoelectron spectroscopy) reveals that the film grows mainly in a [0 0 1] zone axis and no Y-enrichment in surface or bulk regions takes place. In fact, the Y-content of the sputter target is preserved in the thin films. Analysis of the plasmon region in EEL spectra indicates a defective nature of the as-deposited films, which can be suppressed by post-deposition oxidation at 1073 K. This, however, induces considerable sintering, as deduced from surface morphology measurements by AFM. In due course, the so-prepared unsupported YSZ films might act as well-defined model systems also for technological applications.

  1. Growth and micro structural studies on Yittria Stabilized Zirconia (YSZ) and Strontium Titanate (STO) buffer layers

    SciTech Connect

    Srinivas, S.; Bhatnagar, A.K.; Pinto, R.

    1994-12-31

    Microstructure of Yittria Stabilized Zirconia (YSZ) and Strontium Titanate (STO) of radio frequency magnetron sputtered buffer layers was studied at various sputtering conditions on Si<100>, Sapphire and LaAlO{sub 3} <100> substrates. The effect of substrate temperatures upto 800 C and sputtering gas pressures in the range of 50 mTorr. of growth conditions was studied. The buffer layers of YSZ and STO showed a strong tendency for columnar structure with variation growth conditions. The buffer layers of YSZ and STO showed orientation. The tendency for columnar growth was observed above 15 mTorr sputtering gas pressure and at high substrate temperatures. Post annealing of these films in oxygen atmosphere reduced the oxygen deficiency and strain generated during growth of the films. Strong c-axis oriented superconducting YBa{sub 2}Cu{sub 9}O{sub 7-x} (YBCO) thin films were obtained on these buffer layers using pulsed laser ablation technique. YBCO films deposited on multilayers of YSZ and STO were shown to have better superconducting properties.

  2. Color center annealing and ageing in electron and ion-irradiated yttria-stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Costantini, Jean-Marc; Beuneu, François

    2005-04-01

    We have used X-band electron paramagnetic resonance (EPR) measurements at room-temperature (RT) to study the thermal annealing and RT ageing of color centers induced in yttria-stabilized zirconia (YSZ), i.e. ZrO2:Y with 9.5 mol% Y2O3, by swift electron and ion-irradiations. YSZ single crystals with the <1 0 0> orientation were irradiated with 2.5 MeV electrons, and implanted with 100 MeV 13C ions. Electron and ion beams produce the same two color centers, namely an F+-type center (singly ionized oxygen vacancy) and the so-called T-center (Zr3+ in a trigonal oxygen local environment) which is also produced by X-ray irradiations. Isochronal annealing was performed in air up to 973 K. For both electron and ion irradiations, the defect densities are plotted versus temperature or time at various fluences. The influence of a thermal treatment at 1373 K of the YSZ single crystals under vacuum prior to the irradiations was also investigated. In these reduced samples, color centers are found to be more stable than in as-received samples. Two kinds of recovery processes are observed depending on fluence and heat treatment.

  3. Contrasting the beam interaction characteristics of selected lasers with a partially stabilized zirconia bio-ceramic

    NASA Astrophysics Data System (ADS)

    Lawrence, J.

    2002-08-01

    Differences in the beam interaction characteristics of a CO2 laser, a Nd : YAG laser, a high power diode laser (HPDL) and an excimer laser with a partially stabilized zirconia bio-ceramic have been studied. A derivative of Beer-Lambert's law was applied and the laser beam absorption lengths of the four lasers were calculated as 33.55×10-3 cm for the CO2 laser, 18.22×10-3 cm for the Nd : YAG laser, 17.17×10-3 cm for the HPDL and 8.41×10-6 cm for the excimer laser. It was determined graphically that the fluence threshold values at which significant material removal was effected by the CO2 laser, the Nd : YAG laser, the HPDL and the excimer laser were 52 J cm-2, 97 J cm-2, 115 J cm-2 and 0.48 J cm-2, respectively. The thermal loading value for the CO2 laser, the Nd : YAG laser, the HPDL and the excimer laser were calculated as being 1.55 kJ cm-3, 5.32 kJ cm3, 6.69 kJ cm-3 and 57.04 kJ cm-3, respectively.

  4. Brazing of Stainless Steels to Yttria Stabilized Zirconia (YSZ) for Solid Oxide Fuel Cells

    NASA Technical Reports Server (NTRS)

    Shpargel, Tarah P.; Needham, Robert J.; Singh, M.; Kung, Steven C.

    2005-01-01

    Recently, there has been a great deal of interest in research, development, and commercialization of solid oxide fuel cells. Joining and sealing are critical issues that will need to be addressed before SOFC's can truly perform as expected. Ceramics and metals can be difficult to join together, especially when the joint must withstand up to 900 C operating temperature of the SOFC's. The goal of the present study is to find the most suitable braze material for joining of yttria stabilized zirconia (YSZ) to stainless steels. A number of commercially available braze materials TiCuSil, TiCuNi, Copper-ABA, Gold-ABA, and Gold-ABA-V have been evaluated. The oxidation behavior of the braze materials and steel substrates in air was also examined through thermogravimetric analysis. The microstructure and composition of the brazed regions have been examined by optical and scanning electron microscopy and EDS analysis. Effect of braze composition and processing conditions on the interfacial microstructure and composition of the joint regions will be presented.

  5. Surface modification of yttria stabilized zirconia via polydopamine inspired coating for hydroxyapatite biomineralization

    NASA Astrophysics Data System (ADS)

    Zain, Norhidayu Muhamad; Hussain, Rafaqat; Kadir, Mohammed Rafiq Abdul

    2014-12-01

    Yttria stabilized zirconia (YSZ) has been widely used as biomedical implant due to its high strength and enhanced toughening characteristics. However, YSZ is a bioinert material which constrains the formation of chemical bonds with bone tissue following implantation. Inspired by the property of mussels, the surface of YSZ ceramics was functionalized by quinone-rich polydopamine to facilitate the biomineralization of hydroxyapatite. YSZ discs were first immersed in 2 mg/mL of stirred or unstirred dopamine solution at either 25 or 37 °C. The samples were then incubated in 1.5 simulated body fluid (SBF) for 7d. The effect of coating temperature for stirred and unstirred dopamine solutions during substrate grafting was investigated on the basis of chemical compositions, wettability and biomineralization of hydroxyapatite on the YSZ functionalized surface. The results revealed that the YSZ substrate grafted at 37 °C in stirred solution of dopamine possessed significantly improved hydrophilicity (water contact angle of 44.0 ± 2.3) and apatite-mineralization ability (apatite ratio of 1.78). In summary, the coating temperature and stirring condition during grafting procedure affected the chemical compositions of the films and thus influenced the formation of apatite layer on the substrate during the biomineralization process.

  6. Microstructure and mechanical properties of bulk yttria-partially-stabilized zirconia

    NASA Technical Reports Server (NTRS)

    Valentine, P. G.; Maier, R. D.; Mitchell, T. E.

    1981-01-01

    A commercially available bulk 4.5 mole percent yttria-Y2O3)-partially-stabilized zirconia (PSZ) was studied by light microscopy, X-ray analysis, microhardness measurement, and fracture toughness testing. The growth of the precipitates and the phase transformations were studied as a function of aging in air at 1500 C. Aging cuves were constructed for both the as-received and the solution-annealed-and-quenched materials; the curves showed hardness peaks at 1397 and 1517 kg/sq mm, respectively. A total of twelve different types of tetragonal precipitates were found. The rectangular plate-shaped tetragonal precipitates were found to have a (110) habit plane. Grinding of the Y2O3 PSZ into powder did not cause a significant amount of metastable tetragonal precipitates to transform into the monoclinic phase, thus indicating that transformation toughening is not a significant mechanism for the material. The fracture toughness of the aged and of the unaged solution-annealed-and-quenched PSZ was found to be between 2 and 3 MN/cu m/2.

  7. Brazing of Stainless Steels to Yttria Stabilized Zirconia (YSZ) for Solid Oxide Fuel Cells

    NASA Technical Reports Server (NTRS)

    Shpargel, Tarah P.; Needham, Robert J.; Singh, M.; Kung, Steven C.

    2005-01-01

    Recently, there has been a great deal of interest in research, development, and commercialization of solid oxide fuel cells. Joining and sealing are critical issues that will need to be addressed before SOFC's can truly perform as expected. Ceramics and metals can be difficult to join together, especially when the joint must withstand up to 900 C operating temperature of the SOFC's. The goal of the present study is to find the most suitable braze material for joining of yttria stabilized zirconia (YSZ) to stainless steels. A number of commercially available braze materials TiCuSil, TiCuNi, Copper-ABA, Gold-ABA, and Gold-ABA-V have been evaluated. The oxidation behavior of the braze materials and steel substrates in air was also examined through thermogravimetric analysis. The microstructure and composition of the brazed regions have been examined by optical and scanning electron microscopy and EDS analysis. Effect of braze composition and processing conditions on the interfacial microstructure and composition of the joint regions will be presented.

  8. Spontaneous Rippling and Subsequent Polymer Molding on Yttria-Stabilized Zirconia (110) Surfaces.

    PubMed

    Ansari, Haris M; Niu, Zhiyuan; Ge, Chen; Dregia, Suliman A; Akbar, Sheikh A

    2017-02-28

    Spontaneous nanoripple formation on (110) surfaces of yttria-stabilized zirconia, YSZ-(110), is achieved by diffusional surface doping with rare-earth oxides. Periodic arrays of parallel nanobars separated by channels (period ∼100 nm) grow out of the dopant sources, covering relatively wide areas of the surface (∼10 μm). The nanobars mound up on the surface by diffusion, exhibiting morphological uniformity and alignment, with their long axis lying parallel to the [11̅0] direction in the YSZ-(110) surface. The process for forming these nanobar arrays can be as simple as sprinkling of rare-earth oxide powder (dopant source) on YSZ-(110) surface and annealing in a high temperature air furnace. However, higher control on dopant dispersion on the surface is demonstrated with other techniques, including photolithography and inkjet printing. The ripple arrays extend anisotropically on the (110) surface, obeying the parabolic growth law, and showing principal values of the rate constant along [11̅0] (maximum) and [001] (minimum), as expected from the symmetry of the (110) surface. The self-patterned ceramic substrates are well-suited for pattern transfer by replica molding, as illustrated by single-step molding with polydimethylsiloxane (PDMS), which is a widely used biomaterial in cell-culture studies.

  9. Infrared Radiative Properties of Yttria-Stabilized Zirconia Thermal Barrier Coatings

    NASA Technical Reports Server (NTRS)

    Eldridge, Jeff I.; Spuckler, Charles M.; Street, Ken W.; Markham, Jim R.; Gray, Hugh R. (Technical Monitor)

    2002-01-01

    The infrared (IR) transmittance and reflectance of translucent thermal barrier coatings (TBCs) have important implications for both the performance of these coatings as radiation barriers and emitters as well as affecting measurements of TBC thermal conductivity, especially as TBCs are being pushed to higher temperatures. In this paper, the infrared spectral directional-hemispherical transmittance and reflectance of plasma-sprayed 8wt% yttria-stabilized zirconia (8YSZ) TBCs are reported. These measurements are compared to those for single crystal YSZ specimens to show the effects of the plasma-sprayed coating microstructure. It is shown that the coatings exhibit negligible absorption at wavelengths up to about 5 micrometers, and that internal scattering rather than surface reflections dominates the hemispherical reflectance. The translucent nature of the 8YSZ TBCs results in the absorptance/emittance and reflectance of TBC-coated substrates depending on the TBC thickness, microstructure, as well as the radiative properties of the underlying substrate. The effects of these properties on TBC measurements and performance are discussed.

  10. Multilayer article having stabilized zirconia outer layer and chemical barrier layer

    NASA Technical Reports Server (NTRS)

    Lee, Kang N. (Inventor); Bansal, Narottam P. (Inventor)

    2004-01-01

    A multilayer article includes a substrate that includes at least one of a ceramic compound and a Si-containing metal alloy. An outer layer includes stabilized zirconia. Intermediate layers are located between the outer layer and the substrate and include a mullite-containing layer and a chemical barrier layer. The mullite-containing layer includes 1) mullite or 2) mullite and an alkaline earth metal aluminosilicate. The chemical barrier layer is located between the mullite-containing layer and the outer layer. The chemical barrier layer includes at least one of mullite, hafnia, hafnium silicate and rare earth silicate (e.g., at least one of RE.sub.2 SiO.sub.5 and RE.sub.2 Si.sub.2 O.sub.7 where RE is Sc or Yb). The multilayer article is characterized by the combination of the chemical barrier layer and by its lack of a layer consisting essentially of barium strontium aluminosilicate between the mullite-containing layer and the chemical barrier layer. Such a barium strontium aluminosilicate layer may undesirably lead to the formation of a low melting glass or unnecessarily increase the layer thickness with concomitant reduced durability of the multilayer article. In particular, the chemical barrier layer may include at least one of hafnia, hafnium silicate and rare earth silicate.

  11. Resistance to sulfur poisoning of the gold doped nickel/yttria-stabilized zirconia with interface oxygen vacancy

    NASA Astrophysics Data System (ADS)

    Zhang, Yanxing; Yang, Zongxian

    2014-12-01

    The effects of IB metal (Gold, Silver, and Copper) dopants at the triple phase boundary (TPB) on the resistance to sulfur poisoning of the Nickel/Yttria-Stabilized Zirconia (YSZ) with interface oxygen vacancy (denoted as Ni/YSZ-Ov) are studied using the first-principles method based on density functional theory. Models with Au, Ag, Cu dopants at the TPB of Ni/YSZ-Ov are proposed. It is found that the Au dopant prefers to be at the neighbor of the oxygen vacancy site (denoted as NiAu-d/YSZ-Ov) while the Ag, Cu dopants tend to be located at the top Ni layer, which have little effects on the sulfur adsorption at the interface oxygen vacancy site. Compared with Ni/YSZ-Ov, the NiAu-d/YSZ-Ov can not only weaken the sulfur adsorption at the interface oxygen vacancy site, but also restrain the diffusion of sulfur to the interface oxygen vacancy. Instead, the adsorbed S at the oxygen vacancy is more easily to diffuse out of the interface oxygen vacancy site. So we propose that doping Au in Ni at the neighbor of the interface oxygen vacancy site would be good way to increase the resistance to sulfur poisoning of the Ni/YSZ-Ov anode.

  12. Understanding on the carbon deposition on the Nickel/Yttrium-Stabilized Zirconia anode caused by the CO containing fuels

    NASA Astrophysics Data System (ADS)

    Zhang, Yanxing; Yang, Zongxian; Wang, Mingyang

    2015-04-01

    CO dissociation on clean and hydrogen covered Nickel/Yttrium-Stabilized Zirconia (Ni/YSZ) with interface oxygen vacancy is studied using the first-principles method based on density functional theory. It is found that the CO can be trapped at the interface O vacancy and the trapped CO can dissociate to C and O with a much lower dissociation barrier as compared with that on the pure Ni (111) surface (1.74 vs 2.89 eV). When H atom precovers the Ni part, the H associated CO dissociation path (H + CO → CHO, CHO → CH + O) is preferred, while when H atom precovers at the YSZ part, the direct CO dissociation (CO → C + O) is preferred. Overall, either the H at the Ni part or the YSZ part, the CO dissociations are both accelerated (0.90, 1.41 vs 1.74 eV). Therefore, we propose that the carbon deposition may form easily at the interface oxygen vacancy of triple phase boundary (TPB) and the precovered H atom can accelerate the CO dissociation, which offers new understanding on the carbon deposition of the Ni/YSZ anode of solid oxide fuel cell with the pure CO or CO and H2 mixture as the fuel.

  13. Impedancemetric NOx Sensing Using Yttria-Stabilized Zirconia (YSZ) Electrolyte and YSZ/Cr2O3 Composite Electrodes

    SciTech Connect

    Martin, L P; Woo, L Y; Glass, R S

    2006-11-01

    An impedancemetric method for NO{sub x} sensing using an yttria-stabilized zirconia (YSZ) based electrochemical cell is described. The sensor cell consists of a planar YSZ electrolyte and two identical YSZ/Cr{sub 2}O{sub 3} composite electrodes exposed to the test gas. The sensor response to a sinusoidal ac signal applied between the two electrodes is measured via two parameters calculated from the complex impedance, the modulus |Z| and phase angle {Theta}. While either of these parameters can be correlated to the NO{sub x} concentration in the test gas, {Theta} was found to provide a more robust metric than |Z|. At frequencies below approximately 100 Hz, {Theta} is sensitive to both the NO{sub x} and O{sub 2} concentrations. At higher frequencies, {Theta} is predominantly affected by the O{sub 2} concentration. A dual frequency measurement is demonstrated to compensate for changes in the O{sub 2} background between 2 and 18.9%. Excellent sensor performance is obtained for NO{sub x} concentrations in the range of 8-50 ppm in background. An equivalent circuit model was used to extract fitting parameters from the impedance spectra for a preliminary analysis of NO{sub x} sensing mechanisms.

  14. Ab initio atomistic thermodynamics study on the sulfur tolerance mechanism of the oxygen-enriched yttria-stabilized zirconia surface

    NASA Astrophysics Data System (ADS)

    Chu, Xingli; Zhang, Yanxing; Li, Shasha; Yang, Zongxian

    2014-04-01

    The first-principles method based on density functional theory (DFT) is used to investigate the reaction mechanism for the adsorption of H2S on the oxygen-enriched yttria-stabilized zirconia (YSZ + O) (111) surface. It is found that the H2S dissociation processes have low energy barriers (< 0.5 eV) and high exothermicities (2.5 eV), and the dissociative S atoms may result in the poisoning of the YSZ + O surface by forming the SO and the hyposulfite (SO22 -) species with very strong bonds to the surface. In addition, using the ab initio atomistic thermodynamics method, the surface regeneration or de-sulfurization process of a sulfur-poisoned (i.e. sulfur-covered) YSZ + O(111) surface is studied. According to the phase diagram, the adsorbed atomic sulfur can be oxidized to SO2 and removed from the YSZ + O surface by introducing oxidizing reagents, e.g. O2 and H2O.

  15. ReaxFF reactive force field for solid oxide fuel cell systems with application to oxygen ion transport in yttria-stabilized zirconia.

    PubMed

    van Duin, Adri C T; Merinov, Boris V; Jang, Seung Soon; Goddard, William A

    2008-04-10

    We present the ReaxFF reactive force field developed to provide a first-principles-based description of oxygen ion transport through yttria-stabilized zirconia (YSZ) solid oxide fuel cell (SOFC) membranes. All parameters for ReaxFF were optimized to reproduce quantum mechanical (QM) calculations on relevant condensed phase and cluster systems. We validated the use of ReaxFF for fuel cell applications by using it in molecular dynamics (MD) simulations to predict the oxygen ion diffusion coefficient in yttria-stabilized zirconia as a function of temperature. These values are in excellent agreement with experimental results, setting the stage for the use of ReaxFF to model the transport of oxygen ions through the YSZ electrolyte for SOFC. Because ReaxFF descriptions are already available for some catalysts (e.g., Ni and Pt) and under development for other high-temperature catalysts, we can now consider fully first-principles-based simulations of the critical functions in SOFC, enabling the possibility of in silico optimization of these materials. That is, we can now consider using theory and simulation to examine the effect of materials modifications on both the catalysts and transport processes in SOFC.

  16. Zirconia-Based Powders Produced by Plasma-Spray Pyrolisys and Properties of Sintered Ceramics

    NASA Astrophysics Data System (ADS)

    Kulkov, S. N.; Buyakova, S.; Gömze, L. A.

    2017-01-01

    It have been studied zirconia-based powders and sintered ceramic. It was shown that in the porous structure of zirconia-based ceramics there is a critical value of porosity the material divides into two sub-systems, being variously deformable under external loading. It have been shown that m-phase in ZrO2 is formed due to increase in the microdistortion level which destabilizes the nanocrystalline t phase. It has been found out the correlation between the sizes of crystallites and porosity, which associated with transition of the isolated porous structure to the continuous one and the porosity of 20%, corresponds to the first percolation threshold.

  17. Three-body wear potential of dental yttrium-stabilized zirconia ceramic after grinding, polishing, and glazing treatments.

    PubMed

    Amer, Rafat; Kürklü, Duygu; Kateeb, Elham; Seghi, Robert R

    2014-11-01

    Zirconia complete-coverage crowns are being widely used as restorations because of their improved esthetic characteristics. Data about the enamel wear potential of this ceramic after chair side adjustments are sparse. The purpose of this study was to investigate the 3-body wear of enamel opposing 3 types of ceramic (dense sintered yttrium-stabilized zirconia; Crystal Zirconia; DLMS) (Z), a lithium disilicate (IPS e-max CAD; Ivoclar Vivadent) (E), and a conventional low-fusing feldspathic porcelain (VitaVMK-Master; Vita Zahnfabrik) (P), treated to impart a rough, smooth, or glazed surface. Twenty-four specimens of each of the zirconia and the lithium disilicate ceramic were sectioned from computer-aided design and computer-aided manufacturing blocks into rectangular plates (15×12×2 mm). Twenty-four specimens of the feldspathic porcelain were formed into disks (12 mm diameter) from powders compressed in a silicone mold. All specimens (n=72) were prepared according to the manufacturers' recommendations. Specimens of each ceramic group were placed into 1 of 3 groups: group R, rough surface finish; group S, smooth surface finish; and group G, glazed surface finish. A total of 9 groups with 8 specimens each were placed in a 3-body wear simulator, with standardized enamel specimens (n=72) acting as the substrate. The wear of the enamel specimens was evaluated after 50,000 cycles. The data were analyzed with 2-way ANOVA and the Tukey HSD multiple comparison test (α=.05). The data showed that the smooth zirconia group (ZS) was associated with the least amount of enamel wear (1.26 ±0.55 mm(2)). The most antagonistic enamel wear was associated with the glazed groups ZG (5.58 ±0.66 mm(2)), EG (3.29 ±1.29 mm(2)), and PG (4.2 ±1.27 mm(2)). The degree of enamel wear associated with monolithic zirconia was similar to conventional feldspathic porcelain. Smoothly polished ceramic surfaces resulted in less wear of antagonistic enamel than glazing. Copyright © 2014 Editorial

  18. The effect of staining and vacuum sintering on optical and mechanical properties of partially and fully stabilized monolithic zirconia.

    PubMed

    Sulaiman, Taiseer A; Abdulmajeed, Aous A; Donovan, Terrence E; Vallittu, Pekka K; Närhi, Timo O; Lassila, Lippo V

    2015-01-01

    The effect of staining and vacuum sintering on optical properties and the bi-axial flexural strength of partially and fully stabilized monolithic zirconia (PSZ, FSZ) were evaluated. Disc-shaped specimens divided into three subgroups (n=15): non-stained, stained and non-stained with vacuum sintering. After staining and sintering, optical properties were evaluated using a reflection spectrophotometer and bi-axial flexural strength was tested using the piston-on-three balls technique. Statistical analysis was performed using multivariate analysis of variance (MANOVA) followed by post-hoc Tukey's tests (p<0.05). Staining decreased translucency parameter (TP) values of FSZ (p<0.05). Sintering under vacuum enhanced TP values for PSZ (p<0.05). Staining enhanced surface gloss for both types of zirconia (p<0.05). Staining increased bi-axial flexural strength of FSZ (p<0.05), while it decreased the strength of PSZ (p<0.05). Sintering under vacuum provided minimal benefits with either type of zirconia.

  19. An X-Ray Diffraction Investigation of alpha-Al2O2 Addition to Yttria Stabilized Zirconia (YSZ) Thermal Barrier Coatings Subject to Destabilizing Vanadium Pentoxide (V2O5) Exposure

    DTIC Science & Technology

    1993-09-01

    Stabilized Zirconia TZP - Tetragonal Stabilized Zirconia 6 The effect of ’alloying’ ceramic particles or fibers are clearly evident. The fracture toughness...TA!RL OF CONIMn3S I. INTRO.DUCTION . .. . . . 1 11. BACMWrJD .................... 2 A. CRYSTALLOGRAPHY OF ZIRCONIA .... ............ 2 1. Cubic ...7 1. ZrO2 -Y203 Phase Diagram ......... .......... 7 a. Monoclinic - Tetragonal Transformation 9 b. Cubic

  20. Paramagnetic Defects in Electron-Irradiated Yttria-Stabilized Zirconia: Effect of Yttria Content

    SciTech Connect

    Costantini, Jean-Marc; Beuneu, Francois; Morrison-Smith, Sarah; Devanathan, Ram; Weber, William J

    2011-01-01

    We have studied the effect of the yttria content on the paramagnetic centres in electron-irradiated yttria-stabilized zirconia (ZrO2: Y3+) or YSZ. Single crystals with 9.5 mol% or 18 mol% Y2O3 were irradiated with electrons of 1.0, 1.5, 2.0 and 2.5 MeV. The paramagnetic centre production was studied by X-band EPR spectroscopy. The same paramagnetic centres were identified for both chemical compositions, namely two electron centres, i.e. i) F+-type centres (involving singly ionized oxygen vacancies), and ii) so-called T centres (Zr3+ in a trigonal symmetry site), and hole-centres. A strong effect is observed on the production of hole-centres which are strongly enhanced when doubling the yttria content. However, no striking effect is found on the electron centres (except the enhancement of an extra line associated to the F+-type centres). It is concluded that hole-centres are produced by inelastic interactions, whereas F+-type centres are produced by elastic collisions with no effect of the yttria content on the defect production rate. In the latter case, the threshold displacement energy (Ed) of oxygen is estimated from the electron-energy dependence of the F+-type centre production rate, with no significant effect of the yttria content on Ed. An Ed value larger than 120 eV is found. Accordingly, classical molecular dynamics (MD) simulations with a Buckingham-type potential show that Ed values for Y and O are likely to be in excess of 200 eV. Due to the difficulty in displacing O or Y atoms, the radiation-induced defects may alternatively be a result of Zr atom displacements for Ed = 80 1 eV with subsequent defect re-arrangement.

  1. Enhancing the Bioactivity of Yttria-Stabilized Tetragonal Zirconia Ceramics via Grain-Boundary Activation.

    PubMed

    Ke, Jinhuan; He, Fupo; Ye, Jiandong

    2017-05-17

    Yttria-stabilized tetragonal zirconia (Y-TZP) has been proposed as a potential dental implant because of its good biocompatibility, excellent mechanical properties, and distinctive aesthetic effect. However, Y-TZP cannot form chemical bonds with bone tissue because of its biological inertness, which affects the reliability and long-term efficacy of Y-TZP implants. In this study, to improve the bioactivity of Y-TZP ceramics while maintaining their good mechanical performance, Y-TZP was modified by grain-boundary activation via the infiltration of a bioactive glass (BG) sol into the surface layers of Y-TZP ceramics under different negative pressures (atmospheric pressure, -0.05 kPa, and -0.1 kPa), followed by gelling and sintering. The in vitro bioactivity, mechanical properties, and cell behavior of the Y-TZP with improved bioactivity were systematically investigated using X-ray diffraction (XRD), scanning electron microscopy (SEM), energy-dispersive spectrometry (EDS), electron probe microanalysis (EPMA), and Raman spectroscopy. The results of the bioactivity test conducted by immersing Y-TZP in simulated body fluid (SBF) showed that a bonelike apatite layer was produced on the entire surface. The mechanical properties of the modified Y-TZP decreased as the negative pressure in the BG-infiltration process increased relative to those of the Y-TZP blank group. However, the samples infiltrated with the BG sol under -0.05 kPa and atmospheric pressure still retained good mechanical performance. The cell-culture results revealed that the bioactive surface modification of Y-TZP could promote cell adhesion and differentiation. The present work demonstrates that the bioactivity of Y-TZP can be enhanced by grain-boundary activation, and the bioactive Y-TZP is expected to be a potential candidate for use as a dental implant material.

  2. Color-center-induced band-gap shift in yttria-stabilized zirconia

    SciTech Connect

    PaiVerneker, V.R.; Petelin, A.N.; Crowne, F.J.; Nagle, D.C. )

    1989-10-15

    An increase of the room-temperature band gap from 4.23 to 4.96 eV is observed in crystals of the superionic material yttria-stabilized cubic zirconia (YSZ) when the crystals are reduced either electrolytically or in a hydrogen atmosphere. The original absorption edge of 4.23 eV in unreduced YSZ can be accounted for by the excitation of an {ital F}{sub {ital A}} complex consisting of an Y{sup 3+} ion and an {ital F}{sup +} oxygen vacancy. We assume the ground state of this complex lies in the valence band, whereas its first excited state {ital F}{sub {ital A}}{sup *} formed by adding an additional electron lies in the gap 0.73 eV below the conduction band; the observed absorption is then due to optical excitation of this state from the valence band. Reduction of YSZ leads to the formation of doubly occupied oxygen vacancies, i.e., {ital F} centers, giving rise to a band of states in the gap. Arguments are put forth to show that as the {ital F}-center concentration increases, the mean energy of this band is raised by {ital F}-{ital F} interactions or by changes in the lattice relaxation; eventually, part of the band will lie above the {ital F}{sub {ital A}}{sup *} state, at which point the corresponding {ital F} centers will decay by losing an electron to one of the {ital F}{sub {ital A}}{sup *} states. This results in a shift of the optical absorption edge to the true band-gap energy, i.e., 4.96 eV, which is a true band-to-band transition.

  3. Development and evaluation of suspension plasma sprayed yttria stabilized zirconia coatings as thermal barriers

    NASA Astrophysics Data System (ADS)

    van Every, Kent J.

    The insulating effects from thermal barrier coatings (TBCs) in gas turbine engines allow for increased operational efficiencies and longer service lifetimes. Consequently, improving TBCs can lead to enhanced gas turbine engine performance. This study was conducted to investigate if yttria-stabilized zirconia (YSZ) coatings, the standard industrial choice for TBCs, produced from nano-sized powder could provide better thermal insulation than current commericial YSZ coatings generated using micron-sized powders. The coatings for this research were made via the recently developed suspension plasma spraying (SPS) process. With SPS, powders are suspended in a solvent containing dispersing agents; the suspension is then injected directly into a plasma flow that evaporates the solvent and melts the powder while transporting it to the substrate. Although related to the industrial TBC production method of air plasma spraying (APS), SPS has two important differences---the ability to spray sub-micron diameter ceramic particles, and the ability to alloy the particles with chemicals dissolved in the solvent. These aspects of SPS were employed to generate a series of coatings from suspensions containing ˜100 nm diameter YSZ powder particles, some of which were alloyed with neodymium and ytterbium ions from the solvent. The SPS coatings contained columnar structures not observed in APS TBCs; thus, a theory was developed to explain the formation of these features. The thermal conductivity of the coatings was tested to evaluate the effects of these unique microstructures and the effects of the alloying process. The results for samples in the as-sprayed and heat-treated conditions were compared to conventional YSZ TBCs. This comparison showed that, relative to APS YSZ coatings, the unalloyed SPS samples typically exhibited higher as-sprayed and lower heat-treated thermal conductivities. All thermal conductivity values for the alloyed samples were lower than conventional YSZ TBCs

  4. Paramagnetic defects in electron-irradiated yttria-stabilized zirconia: Effect of yttria content

    SciTech Connect

    Costantini, Jean-Marc; Beuneu, Francois; Morrison-Smith, Sarah E.; Devanathan, Ramaswami; Weber, William J.

    2011-12-20

    We have studied the effect of the yttria content on the paramagnetic centres in electron-irradiated yttria-stabilized zirconia (ZrO2: Y3+) or YSZ. Single crystals with 9.5 mol% or 18 mol% Y2O3 were irradiated with electrons of 1.0, 1.5, 2.0 and 2.5 MeV. The paramagnetic centre production was studied by X-band EPR spectroscopy. The same paramagnetic centres were identified for both chemical compositions, namely two electron centres, i.e. i) F+-type centres (involving singly ionized oxygen vacancies), and ii) so-called T centres (Zr3+ in a trigonal symmetry site), and hole-centres. A strong effect is observed on the production of hole-centres which are strongly enhanced when doubling the yttria content. However, no striking effect is found on the electron centres (except the enhancement of an extra line associated to the F+-type centres). It is concluded that hole-centres are produced by inelastic interactions, whereas F+-type centres are produced by elastic collisions with no effect of the yttria content on the defect production rate. In the latter case, the threshold displacement energy (Ed) of oxygen is estimated from the electron-energy dependence of the F+-type centre production rate, with no significant effect of the yttria content on Ed. An Ed value larger than 120 eV is found. Accordingly, classical molecular dynamics (MD) simulations with a Buckingham-type potential show that Ed values for Y and O are likely to be in excess of 200 eV. It is concluded that F+-type centres might be actually oxygen divacancies (F2+-type centres). Due to the difficulty in displacing O or Y atoms, the radiation-induced defects may alternatively be a result of Zr atom displacements for Ed = 80 ± 1 eV with subsequent defect re-arrangement.

  5. Epitaxial growth of YBCO films on metallic substrates buffered with yttria-stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Ma, B.; Li, M.; Fisher, B. L.; Koritala, R. E.; Balachandran, U.

    2002-05-01

    Biaxially textured yttria-stabilized zirconia (YSZ) films were grown on polished Hastelloy C (HC) substrates by ion-beam-assisted deposition (IBAD) and electron-beam evaporation. A water-cooled sample stage was used to dissipate heat generated by the Kaufman ion source and to maintain the substrate temperature below 100 °C during deposition. X-ray pole figures were used for texture analysis. In-plane texture measured from the YSZ (111) φ-scan full-width-at-half-maximum (FWHM) was 13.2° and out-of-plane texture from the YSZ (002) ω-scan FWHM was 7.7°. In-plane texture improved with lowered substrate temperature during IBAD deposition. RMS surface roughness of 3.3 nm was measured by atomic force microscopy. A thin CeO2 buffer layer (≈10 nm) was deposited to improve the lattice match between the YSZ and YBCO films and to enhance the biaxial alignment of YBCO films. YBCO films were epitaxially grown on IBAD-YSZ buffered HC substrates with and without CeO2 buffer layers by pulsed laser deposition (PLD). In-plane texture FWHMs of 12° and 9° were observed for CeO2 (111) and YBCO (103), respectively. Tc=90 K, with sharp transition, and Jc values of ≈2×106 A/cm2 at 77 K in zero field were observed on 0.5-μm-thick, 5-mm-wide, and 1-cm-long samples.

  6. CHEMICALLY VAPOR DEPOSITED YTTRIA-STABILIZED ZIRCONIA (YSZ) FOR THERMAL AND ENVIRONMENTAL BARRIER COATING

    SciTech Connect

    Varanasi, V.G.; Besmann, T.M.; Lothian, J.L.; Xu, W.; Starr, T.L.

    2003-04-22

    Yttria-stabilized zirconia (YSZ) is used as a thermal barrier coating (TBC) to protect super-alloy blades such as Mar-M247 or Rene-N5 during engine operation. The current method for YSZ fabrication for TBC applications is by air-plasma spraying (APS) or electron beam physical vapor deposition (EB-PVD) (Haynes 1997). APS gives reasonable deposition rates, but has a limited life and aging effects due to its porous and lamellar structure. The EB-PVD coatings are more stable and can accommodate thermomechanical stresses due to their characteristic strain-tolerant, columnar microstructure. EB-PVD, however, is primarily line-of-sight, which often leaves ''hidden areas'' uncoated, has low throughput, and has high capital cost. The process of metal-organic chemical vapor deposition (MOCVD) is investigated here as an economical alternative to EB-PVD and APS, with the potential for better overall coverage as well as the ability to produce thick (100-250 {micro}m), strain-tolerant, columnar coatings. MOCVD of YSZ involves the use of zirconium and yttrium organometallic precursors reacting with an oxygen source. Previous researchers have used diketonate or chloride precursors and oxygen (Wahl et al. 2001a, Wahl et al. 2001b, Yamane and Harai 1989). These precursors have low transport rates due to their low carrier solvent solubility (Varanasi et al. 2003). Solvated zirconium and yttrium butoxide precursors were investigated here due to their higher vapor pressures and high solvent solubility. This work uses predictive equilibrium modeling and experiments involving butoxide precursors for tetragonal YSZ fabrication.

  7. Fracture resistance of single-tooth implant-supported zirconia-based indirect composite-layered molar restorations.

    PubMed

    Taguchi, Kohei; Komine, Futoshi; Fushiki, Ryosuke; Blatz, Markus B; Kamio, Shingo; Matsumura, Hideo

    2014-08-01

    This study evaluated the fracture resistance of single-tooth implant-supported zirconia-based indirect composite-layered molar restorations. Forty-four titanium abutments (GingiHue Post) were placed on dental implants (Osseotite Implant). Standardized single-tooth cement-retained implant-supported mandibular molar restorations were fabricated for each of four test groups (n = 11) as follows: porcelain-fused-to-metal crowns (PFM), zirconia-based all-ceramic crowns (ZAC), zirconia-based indirect composite-layered crowns primed with Estenia Opaque Primer for zirconia frameworks (ZIC-E), and zirconia-based indirect composite-layered crowns (ZIC). The crowns were luted with a glass-ionomer cement (Ketac Cem Easymix). Fracture resistance (N) was determined by force application of a perpendicular load to the crowns with a universal testing machine. One-way analysis of variance (ANOVA) and the Tukey's HSD test were used to assess differences in fracture resistance values (α = 0.05). Mean fracture resistances (SD) were 3.09 (0.22) kN, 3.11 (0.34) kN, 2.84 (0.21) kN, and 2.50 (0.36) kN for the PFM, ZAC, ZIC-E, and ZIC groups, respectively. Fracture resistance in the ZIC specimens was significantly lower (P < 0.044) than that in the other groups, which did not significantly differ. The fracture resistance of single-tooth implant-supported zirconia-based indirect composite-layered molar crowns primed with Estenia Opaque Primer for zirconia frameworks (ZIC-E) is comparable to that of porcelain-fused-to-metal (PFM) and zirconia-based all-ceramic (ZAC) restorations. Application of Estenia Opaque Primer to zirconia ceramic framework provides superior fracture resistance in implant-supported zirconia-based indirect composite-layered molar crowns. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  8. Influence of low-temperature environmental exposure on the mechanical properties and structural stability of dental zirconia.

    PubMed

    Alghazzawi, Tariq F; Lemons, Jack; Liu, Perng-Ru; Essig, Milton E; Bartolucci, Alfred A; Janowski, Gregg M

    2012-07-01

    The effect of dental fabrication procedures of zirconia monolithic restorations and changes in properties during low-temperature exposure in the oral environment is not completely understood. The purpose of this study was to investigate the effect of procedures for fabrication of dental restorations by low-temperature simulation and relative changes of flexural strength, nanoindentation hardness, Young's modulus, surface roughness, and structural stability of yttria-stabilized zirconia. A total of 64 zirconia specimens were prepared to simulate dental practice. The specimens were divided into the control group and the accelerated aging group. The simulated group followed the same procedure as the control group except for the aging treatment. Atomic force microscopy was used to measure surface roughness. The degree of tetragonal-to-monoclinic transformation was determined using X-ray diffraction. Nanoindentation hardness and modulus measurements were carried out on the surface of the zirconia specimens using a nanoindenter XP/G200 system. The yttria levels for nonaged and aged specimens were measured using energy dispersive spectroscopy. Flexural strength was determined using the piston-on-three-ball test. The t-test was used to determine statistical significance. Means and standard deviations were calculated using all observations for each condition and evaluated using a group t-test (p < 0.05). The LTD treatment resulted in increased surface roughness (from 12.23 nm to 21.56 nm for Ra and 15.06 nm to 27.45 nm for RMS) and monoclinic phase fractions (from 2% to 21%), with a concomitant decrease in hardness (from 16.56 GPa to 15.14 GPa) and modulus (from 275.68 GPa to 256.56 GPa). Yttria content (from 4.43% to 4.46%) and flexural strength (from 586 MPa to 578 MPa) were not significantly altered, supporting longer term in vivo function without biomechanical fracture. The LTD treatment induced the tetragonal-to-monoclinic transformation with surface roughening in

  9. High-speed thermal imaging of yttria-stabilized zirconia droplet impinging on substrate in plasma spraying

    SciTech Connect

    Shinoda, Kentaro; Murakami, Hideyuki; Kuroda, Seiji; Oki, Sachio; Takehara, Kohsei; Etoh, Takeharu Goji

    2007-05-07

    The authors have developed an in situ monitoring system that captures the impacting phenomena of plasma-sprayed particles at 1x10{sup 6} frames/s. The system clearly captured deformation and cooling processes of an yttria-stabilized zirconia droplet of 50 {mu}m in diameter impinging at 170 m/s on a smooth quartz glass substrate kept at room temperature. The images show that the liquid sheet jetting out sideways from the droplet detached from the substrate and kept on spreading without disintegration until its maximum extent. While the sheet was spreading, the center region of the flattened droplet cooled down much more rapidly.

  10. Radiation damage in cubic ZrO2 and yttria-stabilized zirconia from molecular dynamics simulations

    SciTech Connect

    Aidhy, Dilpuneet S.; Zhang, Yanwen; Weber, William J.

    2014-11-20

    Here, we perform molecular dynamics simulation on cubic ZrO2 and yttria-stabilized zirconia (YSZ) to elucidate defect cluster formation resulting from radiation damage, and evaluate the impact of Y-dopants. Interstitial clusters composed of split-interstitial building blocks, i.e., Zr-Zr or Y-Zr are formed. Moreover, oxygen vacancies control cation defect migration; in their presence, Zr interstitials aggregate to form split-interstitials whereas in their absence Zr interstitials remain immobile, as isolated single-interstitials. Y-doping prevents interstitial cluster formation due to sequestration of oxygen vacancies.

  11. Grain-boundary cavitation and bloating of isostatically hot-pressed magnesia-partially-stabilized zirconia on air annealing

    SciTech Connect

    Hogg, C.L.; Stringer, R.K.; Swain, M.V.

    1986-03-01

    Commercially sintered magnesia-partially-stabilized zirconia was densified to near theoretical density by isostatic hot-pressing at 200 MPa and 1700/sup 0/C in argon. Subsequent air annealing above 1100/sup 0/C resulted in bloating of the material due to grain-boundary cavitation. Mass spectrometry of crushed samples detected the evolution of CO/sub 2/ and possibly CO on annealing; the hot-pressed material showed a sudden gas evolution above 1400/sup 0/C. Preliminary Auger and ESCA analysis identified the presence of carbon as graphite and an undefined carbide in both the sintered and the hot-pressed material.

  12. Radiation damage in cubic ZrO2 and yttria-stabilized zirconia from molecular dynamics simulations

    DOE PAGES

    Aidhy, Dilpuneet S.; Zhang, Yanwen; Weber, William J.

    2014-11-20

    Here, we perform molecular dynamics simulation on cubic ZrO2 and yttria-stabilized zirconia (YSZ) to elucidate defect cluster formation resulting from radiation damage, and evaluate the impact of Y-dopants. Interstitial clusters composed of split-interstitial building blocks, i.e., Zr-Zr or Y-Zr are formed. Moreover, oxygen vacancies control cation defect migration; in their presence, Zr interstitials aggregate to form split-interstitials whereas in their absence Zr interstitials remain immobile, as isolated single-interstitials. Y-doping prevents interstitial cluster formation due to sequestration of oxygen vacancies.

  13. Shear bond strength between veneering ceramics and ceria-stabilized zirconia/alumina.

    PubMed

    Fischer, Jens; Stawarczyk, Bogna; Sailer, Irena; Hämmerle, Christoph H F

    2010-05-01

    Ceria-stabilized tetragonal ZrO(2)/Al(2)O(3) nanocomposite (Ce-TZP/A) offers superior properties compared to yttria-stabilized zirconia (Y-TZP). However, the bond quality to veneering ceramics has not been investigated. The purpose of this study was to evaluate the bond strength of different veneering ceramics to Ce-TZP/A. Cubes of Ce-TZP/A (NANOZR) (edge length, 10 mm) were layered with veneering ceramics (5 mm in thickness) with or without application of a liner and sheared at the interface. The effect of different surface treatments (polished with 3-mum diamond paste or airborne-particle abraded) was evaluated with 1 veneering ceramic (Cerabien ZR). Shear bond strength of 5 additional veneering ceramics (IPS e.max, Initial ZR, Triceram, Vintage ZR, or VITA VM 9) to polished Ce-TZP/A was measured (n=10). Polished Y-TZP (Hint-ELs ZrO(2) HIP) veneered with 2 ceramics (Cerabien ZR, Vintage ZR) served as the control. Mean shear bond strength values (MPa) were calculated. The means were statistically analyzed with 2-way ANOVA for the effect of surface treatment and liner, 2-way ANOVA for the effect of different veneering ceramic brands and liner, and 3-way ANOVA for the effect of substrate, veneering ceramic brands, and liner, as well as 1-way ANOVA for the differences between the veneering ceramics. A post hoc Scheffé test was used (alpha=.05). The effects of surface treatment (P=.007) or application of liner (P<.001) were significant. Shear bond strength with different veneering ceramics showed bond strength values with means ranging between 14.2 +/-1.7 MPa (IPS e.max with liner) and 27.5 +/-4.2 MPa (VITA VM 9). A significant difference was found between the results of shear bond tests with Y-TZP and Ce-TZP/A (P=.022). The application of a liner on Y-TZP had no significant effect. Airborne-particle abrasion is not necessary to enhance the shear bond strength of the evaluated veneering ceramics to Ce-TZP/A. Liners impair the shear bond strength of veneering ceramics

  14. Superplasticity and joining of zirconia-based ceramics

    SciTech Connect

    Gutierrez-Mora, F.; Dominguez-Rodriguez, A.; Jimenez-Melendo, M.; Chaim, R.; Ravi, G.B.; Routbort, J.L.

    2000-07-01

    Steady-state creep and joining of alumina/zirconia composites containing alumina volume fractions of 20, 60 and 85% have been investigated between 1,250 and 1,350 C. Superplasticity of these compounds is controlled by grain-boundary sliding and the creep rate is a function of alumina volume fraction, not grain size. Using the principles of superplasticity, pieces of the composite have been joined by applying the stress required to achieve 5 to 10% strain to form a strong interface at temperatures as low as 1,200 C.

  15. HOT ELUENT CAPILLARY LIQUID CHROMATOGRAPHY USING ZIRCONIA AND TITANIA BASED STATIONARY PHASES. (R825344)

    EPA Science Inventory

    Abstract

    High speed capillary liquid chromatographic separations using a simple home made system constructed from readily available inexpensive components have been studied. Using thermally stable zirconia and titania based packing, the separation of eight alkylbenzene...

  16. HOT ELUENT CAPILLARY LIQUID CHROMATOGRAPHY USING ZIRCONIA AND TITANIA BASED STATIONARY PHASES. (R825344)

    EPA Science Inventory

    Abstract

    High speed capillary liquid chromatographic separations using a simple home made system constructed from readily available inexpensive components have been studied. Using thermally stable zirconia and titania based packing, the separation of eight alkylbenzene...

  17. Sol–gel dip coating of yttria-stabilized tetragonal zirconia dental ceramic by aluminosilicate nanocomposite as a novel technique to improve the bonding of veneering porcelain

    PubMed Central

    Madani, Azamsadat; Nakhaei, Mohammadreza; Karami, Parisa; Rajabzadeh, Ghadir; Salehi, Sahar; Bagheri, Hossein

    2016-01-01

    The aim of this in vitro study was to evaluate the effect of silica and aluminosilicate nanocomposite coating of zirconia-based dental ceramic by a sol–gel dip-coating technique on the bond strength of veneering porcelain to the yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) in vitro. Thirty Y-TZP blocks (10 mm ×10 mm ×3 mm) were prepared and were assigned to four experimental groups (n=10/group): C, without any further surface treatment as the control group; S, sandblasted using 110 μm alumina powder; Si, silica sol dip coating + calcination; and Si/Al, aluminosilicate sol dip coating + calcination. After preparing Y-TZP samples, a 3 mm thick layer of the recommended porcelain was fired on the coated Y-TZP surface. Fourier transform infrared spectroscopy (FT-IR), X-ray diffraction (XRD), scanning electron microscopy (SEM), and energy-dispersive X-ray analysis were used to characterize the coating and the nature of the bonding between the coating and zirconia. To examine the zirconia–porcelain bond strength, a microtensile bond strength (μTBS) approach was chosen. FT-IR study showed the formation of silica and aluminosilicate materials. XRD pattern showed the formation of new phases consisting of Si, Al, and Zr in coated samples. SEM showed the formation of a uniform coating on Y-TZP samples. Maximum μTBS values were obtained in aluminosilicate samples, which were significantly increased compared to control and sandblasted groups (P=0.013 and P<0.001, respectively). This study showed that aluminosilicate sol–gel dip coating can be considered as a convenient, less expensive reliable method for improving the bond strength between dental Y-TZP ceramics and veneering porcelain. PMID:27478376

  18. Effect of metal chloride solutions on coloration and biaxial flexural strength of yttria-stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Oh, Gye-Jeong; Lee, Kwangmin; Lee, Doh-Jae; Lim, Hyun-Pil; Yun, Kwi-Dug; Ban, Jae-Sam; Lee, Kyung-Ku; Fisher, John G.; Park, Sang-Won

    2012-10-01

    The effect of three kinds of transition metal dopants on the color and biaxial flexural strength of zirconia ceramics for dental applications was evaluated. Presintered zirconia discs were colored through immersion in aqueous chromium, molybdenum and vanadium chloride solutions and then sintered at 1450 °C. The color of the doped specimens was measured using a digital spectrophotometer. For biaxial flexural strength measurements, specimens infiltrated with 0.3 wt% of each aqueous chloride solution were used. Uncolored discs were used as a control. Zirconia specimens infiltrated with chromium, molybdenum and vanadium chloride solutions were dark brown, light yellow and dark yellow, respectively. CIE L*, a*, and b* values of all the chromium-doped specimens and the specimens infiltrated with 0.1 wt% molybdenum chloride solution were in the range of values for natural teeth. The biaxial flexural strengths of the three kinds of metal chloride groups were similar to the uncolored group. These results suggest that chromium and molybdenum dopants can be used as colorants to fabricate tooth colored zirconia ceramic restorations.

  19. A novel etching technique for surface treatment of zirconia ceramics to improve adhesion of resin-based luting cements

    PubMed Central

    Ruyter, Eystein Ivar; Vajeeston, Nalini; Knarvang, Torbjørn; Kvam, Ketil

    2017-01-01

    Abstract Objectives: Bonding of zirconia crowns and bridges to abutments is important, not only bonding of the thin resin layer to the abutment, but also bonding to the zirconia ceramic is crucial. Both mechanical and chemical adhesion are desired. Mechanical retention of dental porcelain achieved by etching with moderately concentrated hydrofluoric acid is not possible with zirconia ceramics. The purpose of this study was to show that etching is possible with relative low melting fluoride compounds such as ammonium hydrogen difluoride and potassium hydrogen difluoride. Materials and methods: Before melting, the fluorides can be introduced as powders or as aqueous slurries to the contact surfaces of the zirconia. After melting, the yttria-stabilized zirconia surface revealed a surface similar to an HF-etched dental feldspathic porcelain surface. Shear bond testing (n = 10) was performed with zirconia attached to zirconia with the Duo-Link composite luting cement (Bisco) after treatment of the etched zirconia surfaces with Bis-Silane (Bisco) and the Porcelain Bonding Resin (Bisco). Results: Values for adhesive strength (mean ± standard deviation) after melt etching of the surfaces with initially dry powders were for K[FHF], (31.2 ± 7.5) MPa and for NH4[FHF] (31.0 ± 11.8) MPa. When initially aqueous slurries were applied, the values were for K[FHF] (42.7 ± 12.7) MPa and for NH4[FHF] (40.3 ± 10.0) MPa. Conclusion: Good adhesion to zirconia can be achieved by a procedure including etching with selected melted fluoride compounds. PMID:28642930

  20. Irradiation induced dislocations and vacancy generation in single crystal yttria stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Johnsen, Jill Noel

    A determination of the most effective method of introducing defect clusters and forming nanocrystals in single crystal Yttria Stabilized Zirconia (YSZ) to increase its oxygen ion conductivity for use in solid oxide fuel cell has been investigated using several techniques. High-energy particle irradiation using 800 keV electrons and 20 MeV protons and Ar+ and Xe ++ ion implantation promote the introduction of defects. Thermal annealing and temperature cycling were performed both ex-situ and in-situ in a TEM to study the dynamic recovery behavior of the defects introduced by irradiation and the nucleation and growth of nanocrystals. This analysis found multiple outcomes to both light particle irradiation, with electrons and protons, and heavy charged particle irradiation, including Ar+ and Xe++. Electron irradiation produced very few vacancies, and therefore a very low dislocation density after high temperature annealing. The Xe++ and Ar+ irradiated samples show a high density of vacancy clusters. Evidence also shows nanocrystalline formation in Xe++ irradiated YSZ after a 20 minute anneal at 1040°C with grain sizes on the order of 10--50nm. Defect clusters formed in samples exposed to 20.4 MeV protons with a fluence of 1.00 x 1013 p/cm2 and thermally annealed at temperatures between 800°C and 1000°C. The samples became polycrystalline after a 75 minute anneal with a grain size of approximately 20nm and remained polycrystalline throughout the 120 minute anneal. Impedance spectroscopy measurements were conducted on proton irradiated samples with various annealing conditions. From the impedance results it is concluded that the minimum annealing conditions for a noticeable improvement in ionic conductivity are 1000°C for 2 hours and the 1200°C for 1 hour. These annealing conditions correspond to the conditions for nanocrystal formation as show by microstructural characterization. The proton irradiated YSZ ceramic samples annealed under these conditions were found

  1. Thermal conductivity of yttria-stabilized zirconia thin films with a zigzag microstructure

    NASA Astrophysics Data System (ADS)

    Amaya, C.; Prías-Barragán, J. J.; Aperador, W.; Hernández-Landaverde, M. A.; Ramírez-Cardona, M.; Caicedo, J. C.; Rodríguez, L. A.; Snoeck, E.; Gómez, M. E.; Zambrano, G.

    2017-06-01

    Yttria-stabilized zirconia (YSZ) is the most common material used as a thermal barrier in several engineering applications. In order to improve the insulator potential of these thin films, an oblique-angle deposition approach was used to grow YSZ with tilted columnar structures. Initially, the period (n) was defined as the repetition unit composed of two layers each with different columnar growth directions, and then, n was increased (n = 1, 2, 10, 30, and 50), keeping constant the total thickness (˜3.50 μm). The influence of (n) on the structure, roughness, grain size, microstructure, and thermal conductivity (κ) of thin films deposited was determined by X-ray diffraction (XRD), atomic force microscopy (AFM), scanning electron microscopy (SEM), transmission electron microscopy, and hot-plate technique, respectively. For all the samples, XRD patterns indicate the presence of the characteristic 8YSZ tetragonal phase peaks. Through AFM analysis, it was established that the roughness of the films deposited decreases from (4.0 ± 0.6) to (2.0 ± 0.6) nm when n is increased. Cross-sectional images recorded by SEM corroborate the formation of marked interfaces when growth direction changes occur, allowing to identify a multilayer system with a "zigzag" microstructure and an evolution towards more refined and isolated columns. Moreover, the SEM images reveal that for n = 10, 30, 50, and 70, the growth direction of the column is perpendicular to the substrate plane, losing its tilted form and the "zigzag" behavior becomes intra-columnar, reaching nanometer scale. Finally, analyses by hot-plate technique for different n repetition units showed that the thermal conductivity of YSZ films decreases from 0.151 W/m K to 0.064 W/m K, establishing the direct influence of the "zigzag" microstructure on the κ value. This study shows the potential of growing YSZ thin films by oblique-angle deposition as an effective method to improving the thermal insulator potential of this

  2. Fatigue strength of yttria-stabilized zirconia polycrystals: Effects of grinding, polishing, glazing, and heat treatment.

    PubMed

    Zucuni, Camila Pauleski; Guilardi, Luís Felipe; Rippe, Marilia Pivetta; Pereira, Gabriel Kalil Rocha; Valandro, Luiz Felipe

    2017-11-01

    This study aimed to evaluate and compare the effect of different surface post-processing treatments (polishing, heat treatment, glazing, polishing + heat treatment and polishing + glazing) on the superficial characteristics (micromorphology and roughness), phase transformation and fatigue strength of a Y-TZP ceramic ground with diamond bur. Discs of Y-TZP ceramic were manufactured (ISO:6872-2015; final dimensions of 15mm in diameter and 1.2 ± 0.2mm in thickness) and randomly allocated according to the surface condition: Ctrl - as-sintered; Gr - ground with coarse diamond bur; Gr+HT - ground and subjected to the heat treatment; Gr+Pol - ground and polished; Gr+Pol+HT - ground, polished and heat treated; Gr+Gl - ground and glazed; Gr+Pol+Gl - ground, polished and glazed. The following analyses were performed: roughness (n = 25), surface topography (n = 2), phase transformation (n = 2) and fatigue strength by staircase method (n = 20). All treatments influenced to some extent the surface characteristics of Y-TZP, being that polishing reduced the surface roughness, the m-phase content and improved the fatigue strength; glazing led to the lowest roughness values (Ra and Rz), although it showed the worst fatigue strength; heat treatment showed limited effect on surface roughness, led to complete reversion of the existing m-phase content to t-phase, without enhancing fatigue performance. Thus, a polishing protocol after clinic adjustment (grinding) of monolithic restorations based on polycrystalline zirconia material is mandatory for surface characteristics and fatigue performance improvements. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Comparative study of protein stabilization in white wine using zirconia and bentonite: physicochemical and wine sensory analysis.

    PubMed

    Salazar, Fernando N; Achaerandio, Isabel; Labb, Mariela A; Gell, Carme; Lpez, Francisco

    2006-12-27

    A semi-industrial application of the continuous stabilization of white wine protein using a column packed with zirconia was studied and compared to the traditional bentonite treatment using a Macabeu white wine. Physicochemical and wine sensory properties were evaluated using a rating system and triangle tests. Continuous protein stabilization was analyzed in three residence times, and the equivalent of 300 BV of wine was used for both treatments. Wine protein content was reduced by 21%, 40%, and 42% using the continuous process with residence times of 7.5, 15, and 30 min, respectively, and by 61.4% using the bentonite treatment. The wines obtained from the packed column were protein stable up to 25, 75, and 175 BV for residence times of 7.5, 15, and 30 min, respectively. The amount of polyphenol removed was less than 10%, and similar amounts were removed from the wine regardless of residence time, while 20.6% of polyphenol was removed using bentonite. The physicochemical and sensory properties of wine treated with bentonite were similar to those of wine treated with zirconia.

  4. Study on nano-structured hydroxyapatite/zirconia stabilized yttria on healing of articular cartilage defect in rabbit.

    PubMed

    Sotoudeh, Amir; Jahanshahi, Amirali; Takhtfooladi, Mohammad Ashrafzadeh; Bazazan, Ali; Ganjali, Amin; Harati, Maryam Pourramezani

    2013-05-01

    Articular Cartilage has limited potential for self-repair and tissue engineering approaches attempt to repair articular cartilage by scaffolds. We hypothesized that the combined hydroxyapatite and zirconia stabilized yttria would enhance the quality of cartilage healing. In ten New Zealand white rabbits bilateral full-thickness osteochondral defect, 4 mm in diameter and 3 mm depth, was created on the articular cartilage of the patellar groove of the distal femur. In group I the scaffold was implanted into the right stifle and the same defect was created in the left stifle without any transplant (group II). Specimens were harvested at 12 weeks after implantation, examined histologically for morphologic features, and stained immunohistochemically for type-II collagen. In group I the defect was filled with a white translucent cartilage tissue In contrast, the defects in the group II remained almost empty. In the group I, the defects were mostly filled with hyaline-like cartilage evidenced but defects in group II were filled with fibrous tissue with surface irregularities. Positive immunohistochemical staining of type-II collagen was observed in group I and it was absent in the control group. The hydroxyapatite/yttria stabilized zirconia scaffold would be an effective scaffold for cartilage tissue engineering.

  5. Zirconia-poly(propylene imine) dendrimer nanocomposite based electrochemical urea biosensor.

    PubMed

    Shukla, Sudheesh K; Mishra, Ajay K; Mamba, Bhekie B; Arotiba, Omotayo A

    2014-11-01

    In this article we report a selective urea electrochemical biosensor based on electro-co-deposited zirconia-polypropylene imine dendrimer (ZrO2-PPI) nanocomposite modified screen printed carbon electrode (SPCE). ZrO2 nanoparticles, prepared by modified sol-gel method were dispersed in PPI solution, and electro-co-deposited by cyclic voltammetry onto a SPCE surface. The material and the modified electrodes were characterised using FTIR, electron microscopy and electrochemistry. The synergistic effect of the high active surface area of both materials, i.e. PPI and ZrO2 nanoparticles, gave rise to a remarkable improvement in the electrocatalytic properties of the biosensor and aided the immobilisation of the urease enzyme. The biosensor has an ampereometric response time of ∼4 s in urea concentration ranging from 0.01 mM to 2.99 mM with a correlation coefficient of 0.9985 and sensitivity of 3.89 μA mM(-1) cm(-2). The biosensor was selective in the presence of interferences. Photochemical study of the immobilised enzyme revealed high stability and reactivity.

  6. Study on the influences of reduction temperature on nickel-yttria-stabilized zirconia solid oxide fuel cell anode using nickel oxide-film electrode

    NASA Astrophysics Data System (ADS)

    Jiao, Zhenjun; Ueno, Ai; Suzuki, Yuji; Shikazono, Naoki

    2016-10-01

    In this study, the reduction processes of nickel oxide at different temperatures were investigated using nickel-film anode to study the influences of reduction temperature on the initial performances and stability of nickel-yttria-stabilized zirconia anode. Compared to conventional nickel-yttria-stabilized zirconia composite cermet anode, nickel-film anode has the advantage of direct observation at nickel-yttria-stabilized zirconia interface. The microstructural changes were characterized by scanning electron microscopy. The reduction process of nickel oxide is considered to be determined by the competition between the mechanisms of volume reduction in nickel oxide-nickel reaction and nickel sintering. Electrochemical impedance spectroscopy was applied to analyze the time variation of the nickel-film anode electrochemical characteristics. The anode performances and microstructural changes before and after 100 hours discharging and open circuit operations were analyzed. The degradation of nickel-film anode is considered to be determined by the co-effect between the nickel sintering and the change of nickel-yttria-stabilized zirconia interface bonding condition.

  7. Effect of autoclave induced low-temperature degradation on the adhesion energy between yttria-stabilized zirconia veneered with porcelain.

    PubMed

    Li, Kai Chun; Waddell, J Neil; Prior, David J; Ting, Stephanie; Girvan, Liz; van Vuuren, Ludwig Jansen; Swain, Michael V

    2013-11-01

    To investigate the effect of autoclave induced low-temperature degradation on the adhesion energy between yttria-stabilized zirconia veneered with porcelain. The strain energy release rate using a four-point bending stable fracture test was evaluated for two different porcelains [leucite containing (VM9) and glass (Zirox) porcelain] veneered to zirconia. Prior to veneering the zirconia had been subjected to 0 (control), 1, 5, 10 and 20 autoclave cycles. The specimens were manufactured to a total bi-layer dimension of 30 mm × 8 mm × 3 mm. Subsequent scanning electron microscopy/energy dispersive spectrometry, electron backscatter diffraction and X-ray diffraction analysis were performed to identify the phase transformation and fracture behavior. The strain energy release rate for debonding of the VM9 specimens were significantly higher (p<0.05) compared to the Zirox specimens across all test groups. Increasing autoclave cycles lowered the strain energy release rate significantly (p<0.05) from 18.67 J/m(2) (control) to the lowest of 12.79 J/m(2) (cycle 10) for only the VM9 specimens. SEM analyses showed predominant cohesive fracture within the porcelain for all cycle groups. XRD analysis of the substrate prior to veneering confirmed a tetragonal to monoclinic phase transformation with increasing the number of autoclave cycles between 5 and 20. The monoclinic phase reverted back to tetragonal phase after undergoing conventional porcelain firing cycles. EBSD data showed significant changes of the grain size distribution between the control and autoclaved specimen (cycle 20). Increasing autoclave cycles only significantly decreased the adhesion of the VM9 layered specimens. In addition, a conventional porcelain firing schedule completely reverted the monoclinic phase back to tetragonal. Copyright © 2013 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  8. Effect of filler metal composition on the strength of yttria stabilized zirconia joints brazed with Pd-Ag-CuOx

    SciTech Connect

    Darsell, Jens T.; Weil, K. Scott

    2008-09-08

    The Ag-CuOx system is of interest to be used to be used as an air braze filler metal for joining high temperature electrochemical devices. Previous work has shown that the melting temperatures can be increased by adding palladium to Ag-CuOx and it is expected that this may aid high temperature stability. This work compares the room temperature bend strength of joints made between yttria-stabilized zirconia (YSZ) air brazed using Ag-CuOx without palladium and with 5 and 15mol% palladium additions. It has been found that in general palladium decreases joint strength, especially in low copper oxide compositions filler metals. At high copper oxide contents, brittle fracture through both copper oxide rich phases and the YSZ limits joint strength.

  9. Epitaxial growth of In-rich InGaN on yttria-stabilized zirconia and its application to metal–insulator–semiconductor field-effect transistors

    SciTech Connect

    Kobayashi, Atsushi; Lye, Khe Shin; Ueno, Kohei; Ohta, Jitsuo; Fujioka, Hiroshi

    2016-08-28

    We grew In-rich In{sub x}Ga{sub 1-x}N films on yttria-stabilized zirconia (YSZ) substrates at low temperatures by pulsed sputtering deposition. It was found that single-crystal In{sub x}Ga{sub 1-x}N (0.63 ≤ x ≤ 0.82) films can be prepared without significant compositional fluctuations at growth temperatures below 500 °C. It was also found that the electrical properties of InGaN are strongly dependent on In composition, growth temperature, and film polarity. N-channel operation of the metal–insulator–semiconductor field-effect transistor (MISFET) with an ultrathin InGaN channel on the YSZ substrates was successfully demonstrated. These results indicate that an InGaN-based MISFET is a promising device for next-generation high-speed electronics.

  10. Formation of metastable tetragonal zirconia nanoparticles: Competitive influence of the dopants and surface state

    SciTech Connect

    Gorban, Oksana; Synyakina, Susanna; Volkova, Galina; Gorban, Sergey; Konstantiova, Tetyana; Lyubchik, Svetlana

    2015-12-15

    The effect of the surface modification of the nanoparticles of amorphous and crystalline partially stabilized zirconia by fluoride ions on stability of the metastable tetragonal phase was investigated. Based on the DSC, titrimetry and FTIR spectroscopy data it was proven that surface modification of the xerogel resulted from an exchange of the fluoride ions with the basic OH groups. The effect of the powder pre-calcination temperature before modification on the formation of metastable tetragonal phase in partially stabilized zirconia was investigated. It was shown that the main factor of tetragonal zirconia stabilization is the state of nanoparticles surface at pre-crystallization temperatures.

  11. Multiple teeth replacement with endosseous one-piece yttrium-stabilized zirconia dental implants

    PubMed Central

    Borgonovo, Andrea E.; Fabbri, Alberto; Censi, Rachele; Maiorana, Carlo

    2012-01-01

    Objectives: The purpose of this study is to clinically and radiographically evaluate survival and success rate of multiple zirconia dental implants positioned in each patient during a follow-up period of at least 12 months up to 48 months. Study Design: Eight patients were treated for multiple edentulism with 29 zirconia dental implants. All implants received immediate temporary restorations and 6 months after surgery were definitively restored. 6 months to 4 years after implant insertion, a clinical-radiographic evaluation was performed in order to estimate peri-implant tissues health and peri-implant marginal bone loss. Results: Survival rate within follow-up period was therefore 100%. The average marginal bone loss (MBL) from baseline to 6 months was +1.375±0.388 mm; from 6 months to 1 year was +0.22±0.598 mm; from 1 year to 2 years was -0.368±0.387 mm; from 2 years to 3 years was -0.0669±0.425 mm; from 3 years to 4 years +0.048±0.262 mm. The mean marginal bone loss at 4 years from the implants insertion was +1.208 mm. Conclusions: According to several studies, when using a radiographic criterion for implant success, marginal bone loss below 0.9-1.6 mm during the first year in function can be considered acceptable. In our work, radiographic measurements of MBL showed values not exceeding 1.6 mm during the first year of loading and also 1 year up to 4 years after surgery further marginal bone loss was minimal and not significant. This peri-implant bone preservation may be associated to the absence of micro-gap between fixture and abutment since zirconia dental implants are one-piece implant. Moreover, zirconia is characterized by high biocompatibility and it accumulates significantly fewer bacteria than titanium. Key words:Zirconia dental implants, multiple implants, radiographic evaluation, marginal bone loss (MBL). PMID:22926479

  12. The hydration structure at yttria-stabilized cubic zirconia (110)-water interface with sub-Ångström resolution

    DOE PAGES

    Hou, Binyang; Kim, Seunghyun; Kim, Taeho; ...

    2016-06-15

    The interfacial hydration structure of yttria-stabilized cubic zirconia (110) surface in contact with water was determined with ~0.5 Å resolution by high-resolution X-ray reflectivity measurement. The terminal layer shows a reduced electron density compared to the following substrate lattice layers, which indicates there are additional defects generated by metal depletion as well as intrinsic oxygen vacancies, both of which are apparently filled by water species. Above this top surface layer, two additional adsorbed layers are observed forming a characteristic interfacial hydration structure. The first adsorbed layer shows abnormally high density as pure water and likely includes metal species, whereas themore » second layer consists of pure water. The observed interfacial hydration structure seems responsible for local equilibration of the defective surface in water and eventually regulating the long-term degradation processes. As a result, the multitude of water interactions with the zirconia surface results in the complex but highly ordered interfacial structure constituting the reaction front.« less

  13. The hydration structure at yttria-stabilized cubic zirconia (110)-water interface with sub-Ångström resolution

    SciTech Connect

    Hou, Binyang; Kim, Seunghyun; Kim, Taeho; Kim, Jongjin; Hong, Seungbum; Bahn, Chi Bum; Park, Changyong; Kim, Ji Hyun

    2016-06-15

    The interfacial hydration structure of yttria-stabilized cubic zirconia (110) surface in contact with water was determined with ~0.5 Å resolution by high-resolution X-ray reflectivity measurement. The terminal layer shows a reduced electron density compared to the following substrate lattice layers, which indicates there are additional defects generated by metal depletion as well as intrinsic oxygen vacancies, both of which are apparently filled by water species. Above this top surface layer, two additional adsorbed layers are observed forming a characteristic interfacial hydration structure. The first adsorbed layer shows abnormally high density as pure water and likely includes metal species, whereas the second layer consists of pure water. The observed interfacial hydration structure seems responsible for local equilibration of the defective surface in water and eventually regulating the long-term degradation processes. As a result, the multitude of water interactions with the zirconia surface results in the complex but highly ordered interfacial structure constituting the reaction front.

  14. The Hydration Structure at Yttria-Stabilized Cubic Zirconia (110)-Water Interface with Sub-Ångström Resolution

    PubMed Central

    Hou, Binyang; Kim, Seunghyun; Kim, Taeho; Kim, Jongjin; Hong, Seungbum; Bahn, Chi Bum; Park, Changyong; Kim, Ji Hyun

    2016-01-01

    The interfacial hydration structure of yttria-stabilized cubic zirconia (110) surface in contact with water was determined with ~0.5 Å resolution by high-resolution X-ray reflectivity measurement. The terminal layer shows a reduced electron density compared to the following substrate lattice layers, which indicates there are additional defects generated by metal depletion as well as intrinsic oxygen vacancies, both of which are apparently filled by water species. Above this top surface layer, two additional adsorbed layers are observed forming a characteristic interfacial hydration structure. The first adsorbed layer shows abnormally high density as pure water and likely includes metal species, whereas the second layer consists of pure water. The observed interfacial hydration structure seems responsible for local equilibration of the defective surface in water and eventually regulating the long-term degradation processes. The multitude of water interactions with the zirconia surface results in the complex but highly ordered interfacial structure constituting the reaction front. PMID:27302473

  15. Zirconia in fixed implant prosthodontics.

    PubMed

    Guess, Petra Christine; Att, Wael; Strub, Joerg Rudolf

    2012-10-01

    CAD/CAM technology in combination with zirconia ceramic has increasingly gained popularity in implant dentistry. This narrative review presents the current knowledge on zirconia utilized as framework material for implant-borne restorations and implant abutments, laboratory tests and developments, clinical performance, and possible future trends for implant dentistry are addressed. A review of available literature from 1990 through 2010 was conducted with search terms zirconia,"implants,"abutment,"crown," and "fixed dental prosthesis" using electronic databases (PubMed) and manual searching. Latest applications of zirconia in implant dentistry include implant abutments, multiple unit and full-arch frameworks as well as custom-made bars to support fixed and removable prostheses. High biocompatibility, low bacterial surface adhesion as well as favorable chemical properties of zirconia ceramics are reported. Zirconia stabilized with yttrium oxide exhibits high flexural strength and fracture toughness due to a transformation toughening mechanism. Preliminary clinical data confirmed the high stability of zirconia for abutments and as a framework material for implant borne crowns and fixed dental prostheses. Zirconia abutment or framework damage has rarely been encountered. However, veneering porcelain fractures are the most common technical complication in implant-supported zirconia restorations. These porcelain veneer failures have led to concerns regarding differences in coefficient of thermal expansions between core and veneering porcelain and their respective processing techniques. As presently evidence of clinical long-term data is missing, caution with regard to especially extensive implant-borne zirconia frameworks is recommended. © 2010 Wiley Periodicals, Inc.

  16. Hot Corrosion of Yttria-Stabilized Zirconia Coating, in a Mixture of Sodium Sulfate and Vanadium Oxide at 950 °C

    NASA Astrophysics Data System (ADS)

    Qureshi, Imran Nazir; Shahid, Muhammad; Nusair Khan, A.

    2016-02-01

    Yttria-stabilized zirconia thermal barrier coating along with CoNiCrAlY bondcoat was deposited using air plasma spray on Inconel-X750 superalloy. The coated samples were exposed at 950 °C in a mixture of Na2SO4 and V2O5. The exposed specimens were investigated using XRD and SEM. The formation of spinel and perovskite structures was revealed at the interface of topcoat and the bondcoat. Further, the chemical composition profile of all samples helped to analyze the diffusion behavior of different constituent elements of bondcoat and substrate. XRD analyses of the samples confirmed the phase transformation of the tetragonal zirconia into monoclinic zirconia and yttrium vanadate. The shift of high angle peaks indicated lattice distortion, which was directly related to the stresses in the coating.

  17. The retention behaviour of polar compounds on zirconia based stationary phases under hydrophilic interaction liquid chromatography conditions.

    PubMed

    Kučera, R; Kovaříková, P; Klivický, M; Klimeš, J

    2011-09-28

    The most separations in HILIC mode are performed on silica-based supports. Nevertheless, recently published results have indicated that the metal oxides stationary phases also possess the ability to interact with hydrophilic compounds under HILIC conditions. This paper primarily describes the retention behaviour of model hydrophilic analytes (4-aminobenzene sulfonic acid, 4-aminobenzoic acid, 4-hydroxybenzoic acid, 3,4-diaminobenzoic acid, 3-aminophenol and 3-nitrophenol) on the polybutadine modified zirconia in HILIC. The results were simultaneously compared with a bare zirconia and a silica-based HILIC phase. The mobile phase strength, pH and the column temperature were systematically modified to assess their impact on the retention of model compounds. It was found that the retention of our model hydrophilic analytes on both zirconia phases was mainly governed by adsorption while on the silica-based HILIC phase partitioning was primarily involved. The ability of ligand-exchange interactions of zirconia surface with a carboxylic moiety influenced substantially the response of carboxylic acids on the elevated temperature as well as to the change of the mobile phase pH in contrast to the silica phase. However, no or negligible ligand-exchange interactions were observed for sulfanilic acid. The results of this study clearly demonstrated the ability of modified zirconia phase to retain polar acidic compounds under HILIC conditions, which might substantially enlarge the application area of the zirconia-based stationary phases. Copyright © 2011 Elsevier B.V. All rights reserved.

  18. Effects of framework design and layering material on fracture strength of implant-supported zirconia-based molar crowns.

    PubMed

    Kamio, Shingo; Komine, Futoshi; Taguchi, Kohei; Iwasaki, Taro; Blatz, Markus B; Matsumura, Hideo

    2015-12-01

    To evaluate the effects of framework design and layering material on the fracture strength of implant-supported zirconia-based molar crowns. Sixty-six titanium abutments (GingiHue Post) were tightened onto dental implants (Implant Lab Analog). These abutment-implant complexes were randomly divided into three groups (n = 22) according to the design of the zirconia framework (Katana), namely, uniform-thickness (UNI), anatomic (ANA), and supported anatomic (SUP) designs. The specimens in each design group were further divided into two subgroups (n = 11): zirconia-based all-ceramic restorations (ZAC group) and zirconia-based restorations with an indirect composite material (Estenia C&B) layered onto the zirconia framework (ZIC group). All crowns were cemented on implant abutments, after which the specimens were tested for fracture resistance. The data were analyzed with the Kruskal-Wallis test and the Mann-Whitney U-test with the Bonferroni correction (α = 0.05). The following mean fracture strength values (kN) were obtained in UNI design, ANA design, and SUP design, respectively: Group ZAC, 3.78, 6.01, 6.50 and Group ZIC, 3.15, 5.65, 5.83. In both the ZAC and ZIC groups, fracture strength was significantly lower for the UNI design than the other two framework designs (P = 0.001). Fracture strength did not significantly differ (P > 0.420) between identical framework designs in the ZAC and ZIC groups. A framework design with standardized layer thickness and adequate support of veneer by zirconia frameworks, as in the ANA and SUP designs, increases fracture resistance in implant-supported zirconia-based restorations under conditions of chewing attrition. Indirect composite material and porcelain perform similarly as layering materials on zirconia frameworks. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  19. Protection of yttria-stabilized zirconia for dental applications by oxidic PVD coating.

    PubMed

    Hübsch, C; Dellinger, P; Maier, H J; Stemme, F; Bruns, M; Stiesch, M; Borchers, L

    2015-01-01

    In this study, the application of transparent physical vapor deposition (PVD) coatings on zirconia ceramics was examined as an approach to retard the low-temperature degradation of zirconia for dental applications. Transparent monolayers of titanium oxide (TixOy) and multilayers consisting of titanium oxide-alumina-titanium oxide (TixOy-AlxOy-TixOy) were deposited onto standardized discs of 3Y-TZP using magnetron sputtering. Using X-ray photospectroscopy and time-of-flight secondary-ion mass spectrometry, the compositions of the coatings were verified, and an approximate thickness of 50 nm for each type of coating was ascertained. After aging the coated and uncoated samples in water vapor at 134°C and 3 bar for 4, 8, 16, 32, 64 and 128 h, the monoclinic phase content was determined using X-ray diffraction, and its impact on mechanical properties was assessed in biaxial flexural strength tests. In addition, the depth of the transformation zone was measured from scanning electron microscopy images of the fracture surfaces of hydrothermally aged samples. The results revealed that the tetragonal-to-monoclinic phase transformation of the zirconia ceramic was retarded by the application of PVD coatings. During the first stages of aging, the coated samples exhibited a significantly lower monoclinic phase content than the uncoated samples and, after 128 h of aging, showed a transformation zone which was only ∼12-15 μm thick compared to ∼30 μm in the control group. Biaxial flexural strength decreased by ∼10% during aging and was not influenced by the application of a PVD coating.

  20. Dilemmas in zirconia bonding: A review.

    PubMed

    Dbradović-Djuricić, Kosovka; Medić, Vesna; Dodić, Slobodan; Gavrilov, Dragan; Antonijević, Djordje; Zrilić, Milorad

    2013-01-01

    This article presents a literature review on the resin bond to zirconia ceramic. Modern esthetic dentistry has highly recognized zirconia, among other ceramic materials. Biocompatibility of zirconia, chemical and dimensional stability, excellent mechanical properties, all together could guarantee optimal therapeutical results in complex prosthodontic reconstruction. On the other hand, low thermal degradation, aging of zirconia as well as problematic bonding of zirconia framework to dental luting cements and tooth structures, opened the room for discussion concerning their clinical durability.The well known methods of mechanical and chemical bonding used on glass-ceramics are not applicable for use with zirconia. Therefore, under critical clinical situations, selection of the bonding mechanism should be focused on two important points: high initial bond strength value and long term bond strength between zirconia-resin interface. Also, this paper emphases the use of phosphate monomer luting cements on freshly air-abraded zirconia as the simplest and most effective way for zirconia cementation procedure today.

  1. Evaluation of nickel-yttria stabilized zirconia anode degradation during discharge operation and redox cycles operation by electrochemical calculation

    NASA Astrophysics Data System (ADS)

    Shimura, Takaaki; Jiao, Zhenjun; Shikazono, Naoki

    2016-10-01

    Degradation of Solid Oxide Fuel Cell (SOFC) anode during discharge operation and redox cycles operation were evaluated by three-dimensional electrochemical calculations using a Lattice Boltzmann method (LBM). Three dimensional microstructures were obtained by Focused Ion Beam Scanning Electron Microscopy (FIB-SEM) reconstruction. In the electrochemical calculations, changes in exchange current density and ionic conductivity of Yttria stabilized Zirconia (YSZ) during the operations were assumed and their values were calculated by fitting the calculated overpotential values to the experimental ones. Changes in triple phase boundary density calculated from the reconstructed microstructures were inconsistent with the gradual degradation observed during repeated redox-discharge cycles. Changes of the fitted exchange current density and YSZ ionic conductivity values in both discharge operation and redox cycle operation showed same tendency as the experimental results. Change in exchange current density or YSZ ionic conductivity should be considered as an essential factor which governs the cell performance change regardless of the redox treatment.

  2. Irradiation effects of displacement damage and gas atoms in Yttria-stabilized zirconia irradiated by Au and helium ions

    NASA Astrophysics Data System (ADS)

    Zhang, Yanwen; Zhao, Ziqiang; Guo, Gang

    2017-07-01

    Single and sequential ion beam irradiated Yttria-stabilized zirconia (YSZ) was carried out to study the irradiation effects of vacancies and helium gas atoms. The results show that the displacement damage value of sequential ion beam irradiation is less than that of single He ion irradiation and larger than that of single Au ion irradiation. The irradiation effects of displacement damage (mainly vacancies) and gas atoms may lead to a strong reduction of the interstitial helium atoms. Sequential ion beam irradiation generates more vacancies-helium bubbles than single helium ion irradiation. The results are important for fundamental understanding of interaction between vacancy and helium bubbles, and it also plays a guiding role in the practical industrial applications in the nuclear reactor.

  3. Internal Friction Due to Localized Relaxation around Y-ions in Single Crystal Yttria-Stabilized Zirconia

    NASA Astrophysics Data System (ADS)

    Ohta, Michihiro; Kirimoto, Kenta; Nobugai, Kohji; Wigmore, J. Keith; Miyasato, Tatsuro

    2001-09-01

    The internal friction in single crystal yttria-stabilized zirconia (YSZ) doped with 9.5 mol% Y2O3 was measured for longitudinal sound waves in the frequency range from 10 Hz to 800 Hz using a vibrating reed technique. In the temperature range from 300 K to 700 K, observations of internal friction reveal two closely overlapping absorption peaks, confirming the existence of two relaxation modes in YSZ@. One of the peaks is due to diffusion relaxation, which is known to be responsible for long-range transport of O-ions. The second peak shows clearly the existence of localized relaxation, which is attributed to bound oxygen vacancies within the local structure which is formed around an Y-ion due to symmetry breaking. The absorption peak caused by the localized relaxation exhibits anisotropy resulting from the asymmetric local structure, and the strength of this peak changes with temperature reflecting the number of bound oxygen vacancies.

  4. Degradation of nickel-yttria-stabilized zirconia anode in solid oxide fuel cells under changing temperature and humidity conditions

    NASA Astrophysics Data System (ADS)

    Lee, Yi-Hsuan; Muroyama, Hiroki; Matsui, Toshiaki; Eguchi, Koichi

    2014-09-01

    The performance degradation of Ni-yttria-stabilized zirconia (Ni-YSZ) cermet anode was measured by impedance spectroscopy at 1000-1200 °C and humidity atmospheres under the open circuit condition in SOFCs. More significant crack formation can be observed at 1200 °C under 40% H2O-60% H2 atmosphere. This crack formation gave rise to interruption of the ionic and electronic conduction path in the in-plane direction of anode layer, resulting in performance deterioration of anode. Focused ion beam-scanning electron microscopy (FIB-SEM) analyses were conducted for the anode layers, and then the 3D microstructures of Ni-YSZ anode were reconstructed. According to analysis of these data, the particle size of Ni was grown to the larger under higher temperature and humidity condition, accompanying with increase of isolated Ni-phase and the reduction of triple phase boundary (TPB) length.

  5. Straight-chain halocarbon forming fluids for TRISO fuel kernel production - Tests with yttria-stabilized zirconia microspheres

    NASA Astrophysics Data System (ADS)

    Baker, M. P.; King, J. C.; Gorman, B. P.; Braley, J. C.

    2015-03-01

    Current methods of TRISO fuel kernel production in the United States use a sol-gel process with trichloroethylene (TCE) as the forming fluid. After contact with radioactive materials, the spent TCE becomes a mixed hazardous waste, and high costs are associated with its recycling or disposal. Reducing or eliminating this mixed waste stream would not only benefit the environment, but would also enhance the economics of kernel production. Previous research yielded three candidates for testing as alternatives to TCE: 1-bromotetradecane, 1-chlorooctadecane, and 1-iodododecane. This study considers the production of yttria-stabilized zirconia (YSZ) kernels in silicone oil and the three chosen alternative formation fluids, with subsequent characterization of the produced kernels and used forming fluid. Kernels formed in silicone oil and bromotetradecane were comparable to those produced by previous kernel production efforts, while those produced in chlorooctadecane and iodododecane experienced gelation issues leading to poor kernel formation and geometry.

  6. Thermal Shock Properties of Yttria-Stabilized Zirconia Coatings Deposited Using Low-Energy Very Low Pressure Plasma Spraying

    NASA Astrophysics Data System (ADS)

    Zhu, Lin; Zhang, Nannan; Bolot, Rodolphe; Liao, Hanlin; Coddet, Christian

    2015-08-01

    Yttria-stabilized zirconia (YSZ) coatings have been frequently used as a thermal protective layer on the metal or alloy component surfaces. In the present study, ZrO2-7%Y2O3 thermal barrier coatings (TBCs) were successfully deposited by DC (direct current) plasma spray process under very low pressure conditions (less than 1 mbar) using low-energy plasma guns F4-VB and F100. The experiments were performed to evaluate the thermal shock resistance of different TBC specimens which were heated to 1373 K at a high-temperature cycling furnace and held for 0.5 h, followed by air cooling at room temperature for 0.2 h. For comparison, a corresponding atmospheric plasma spray (APS) counterpart was also elaborated to carry out the similar experiments. The results indicated that the very low pressure plasma spray (VLPPS) coatings displayed better thermal shock resistance. Moreover, the failure mechanism of the coatings was elucidated.

  7. Long-time aging in 3 mol.% yttria-stabilized tetragonal zirconia polycrystals at human body temperature.

    PubMed

    Keuper, Melanie; Berthold, Christoph; Nickel, Klaus Georg

    2014-02-01

    We present new findings on the low-temperature degradation of yttria-stabilized zirconia at 37°C over several years and at high and low partial pressures of water. With the aid of focused ion beam cross-section confirmation studies we are able to show an extensive linear, continuous degradation without retardation, even at low temperatures and low water pressures. The characteristic layer growth and its inferred rate constant imply a lifetime of tens of years under simple tension and open the possibility of studying the longevity of these ceramics more rigorously. In addition, we show reproducibility complications of accelerated aging tests by the use of different autoclaves and possible implications for standardized procedures. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  8. High-temperature erosion of plasma-sprayed, yttria-stabilized zirconia in a simulated turbine environment

    NASA Technical Reports Server (NTRS)

    Handschuh, R. F.

    1985-01-01

    A series of rig calibration and high temperature tests simulating gas path seal erosion in turbine engines were performed at three impingement angles and at three downstream locations. Plasma sprayed, yttria stabilized zirconia specimens were tested. Steady state erosion curves presented for 19 test specimens indicate a brittle type of material erosion despite scanning electron microscopy evidence of plastic deformation. Steady state erosion results were not sensitive to downstream location but were sensitive to impingement angle. At different downstream locations specimen surface temperature varied from 1250 to 1600 C (2280 to 2900 F) and particle velocity varied from 260 to 320 m/s (850 to 1050 ft/s). The mass ratio of combustion products to erosive grit material was typically 240.

  9. High Temperature Thermal Properties of Columnar Yttria Stabilized Zirconia Thermal Barrier Coating Performed by Suspension Plasma Spraying

    NASA Astrophysics Data System (ADS)

    Bernard, B.; Schick, V.; Remy, B.; Quet, A.; Bianchi, L.

    2016-09-01

    Performance enhancement of gas turbines is a main issue for the aircraft industry. Over many years, a large part of the effort has been focused on the development of more insulating Thermal Barrier Coatings (TBCs). In this study, Yttria Stabilized Zirconia (YSZ) columnar structures are processed by Suspension Plasma Spraying (SPS). These structures have already demonstrated abilities to get improved thermal lifetime, similarly to standard YSZ TBCs performed by EB-PVD. Thermal diffusivity measurements coupled with differential scanning calorimetry analysis are performed from room temperature up to 1100 °C, first, on HastelloyX substrates and then, on bilayers including a SPS YSZ coating. Results show an effective thermal conductivity for YSZ performed by SPS lower than 1 W.m-1K-1 whereas EB- PVD YSZ coatings exhibit a value of 1.5 W.m-1K-1.

  10. Splat formation during plasma spraying for 8 mol% yttria-stabilized zirconia droplets impacting on stainless steel substrate

    NASA Astrophysics Data System (ADS)

    Wei, Pei; Wei, Zhengying; Li, Suli; Tan, Chao; Du, Jun

    2014-12-01

    In this paper, the formation of 8 mol% yttria-stabilized zirconia (8YSZ) droplet impacting on stainless substrate during SAPS and APS has been analyzed by numerical simulation and experiments. The objective of the study was to establish the predictable relationships between the coating properties and various parameters of plasma spraying process. A mathematic model of single droplet deposition process was developed, the influence of solidification was considered in the governing equations. The model considered the following factors: surface tension, thermal contact resistance between droplet and substrate, viscosity, impacting velocity, and temperature of droplet. Dimensionless number Reynolds number, Weber number, Ohnesorge number and Biot number were used to explain the phenomena of splashing. The critical values of triggering splashing were analyzed quantitatively for 8YSZ droplets. The numerical results agreed well with the experiment data.

  11. Fractographic features of glass-ceramic and zirconia-based dental restorations fractured during clinical function.

    PubMed

    Oilo, Marit; Hardang, Anne D; Ulsund, Amanda H; Gjerdet, Nils R

    2014-06-01

    Fractures during clinical function have been reported as the major concern associated with all-ceramic dental restorations. The aim of this study was to analyze the fracture features of glass-ceramic and zirconia-based restorations fractured during clinical use. Twenty-seven crowns and onlays were supplied by dentists and dental technicians with information about type of cement and time in function, if available. Fourteen lithium disilicate glass-ceramic restorations and 13 zirconia-based restorations were retrieved and analyzed. Fractographic features were examined using optical microscopy to determine crack initiation and crack propagation of the restorations. The material comprised fractured restorations from one canine, 10 incisors, four premolars, and 11 molars. One crown was not categorized because of difficulty in orientation of the fragments. The results revealed that all core and veneer fractures initiated in the cervical margin and usually from the approximal area close to the most coronally placed curvature of the margin. Three cases of occlusal chipping were found. The margin of dental all-ceramic single-tooth restorations was the area of fracture origin. The fracture features were similar for zirconia, glass-ceramic, and alumina single-tooth restorations. Design features seem to be of great importance for fracture initiation.

  12. Fractographic features of glass-ceramic and zirconia-based dental restorations fractured during clinical function

    PubMed Central

    Øilo, Marit; Hardang, Anne D; Ulsund, Amanda H; Gjerdet, Nils R

    2014-01-01

    Fractures during clinical function have been reported as the major concern associated with all-ceramic dental restorations. The aim of this study was to analyze the fracture features of glass-ceramic and zirconia-based restorations fractured during clinical use. Twenty-seven crowns and onlays were supplied by dentists and dental technicians with information about type of cement and time in function, if available. Fourteen lithium disilicate glass-ceramic restorations and 13 zirconia-based restorations were retrieved and analyzed. Fractographic features were examined using optical microscopy to determine crack initiation and crack propagation of the restorations. The material comprised fractured restorations from one canine, 10 incisors, four premolars, and 11 molars. One crown was not categorized because of difficulty in orientation of the fragments. The results revealed that all core and veneer fractures initiated in the cervical margin and usually from the approximal area close to the most coronally placed curvature of the margin. Three cases of occlusal chipping were found. The margin of dental all-ceramic single-tooth restorations was the area of fracture origin. The fracture features were similar for zirconia, glass-ceramic, and alumina single-tooth restorations. Design features seem to be of great importance for fracture initiation. PMID:24698173

  13. Seven-year prospective clinical study on zirconia-based single crowns and fixed dental prostheses.

    PubMed

    Tartaglia, Gianluca M; Sidoti, Ernesto; Sforza, Chiarella

    2015-06-01

    Zirconia-based prostheses are used for esthetic crown and fixed restorations, but follow-ups are still limited. The authors evaluated the 7-year clinical results of 303 zirconia core restorations, performed in a general dental private practice. Clinical events (fracture and loss of retention, gingivitis, tenderness, excess cement, and temporary pain) were recorded in 303 zirconia core restorations positioned in 88 patients. Kaplan-Meier survival probability estimates were computed for failures (needed the replacement or removal of the prosthesis) and complications (resolved without replacing the prosthesis). One hundred and fifty single crowns (130 tooth-supported, 20 implant-supported) and 153 multiple units up to 6 elements (49 tooth-supported, 104 implant-supported) were followed-up for 7 years in 88 patients (40 men, 48 women), aged 35-89 years (mean 57). During the follow-up period, there were no complications for 287 (95 %) of the restorations. Sixteen restorations/abutment teeth (5 %) had some complication: extraction of abutment tooth (7, 2 %); caries (2, 1 %), porcelain veneer fracture (3, 1 %), loss of retention (4, 1 %). Nine (3 %) restorations were recorded as failures. The overall 7-year survival probability estimate for failures was 0.966 (95 % confidence limits, 0.932 and 0.983), for complications was 0.976 (95 % confidence limits 0.947 and 0.989), with a cumulative survival rate of 94.7 %. Within the analyzed follow-up, zirconia core restorations appear a good clinical solution, with favorable functional properties. All ceramic restorations can be successfully used for both single-and multiple-unit prostheses, either teeth or implants supported.

  14. Effect of the shades of background substructures on the overall color of zirconia-based all-ceramic crowns.

    PubMed

    Suputtamongkol, Kallaya; Tulapornchai, Chantana; Mamani, Jatuphol; Kamchatphai, Wannaporn; Thongpun, Noparat

    2013-08-01

    The objective of this study was to determine the effect of the color of a background substructure on the overall color of a zirconia-based all-ceramic crown. Twenty one posterior zirconia crowns were made for twenty subjects. Seven premolar crowns and six molar crowns were cemented onto abutments with metal post and core in the first and second group. In the third group, eight molar crowns were cemented onto abutments with a prefabricated post and composite core build-up. The color measurements of all-ceramic crowns were made before try-in, before and after cementation. A repeated measure ANOVA was used for a statistical analysis of a color change of all-ceramic crowns at α=.05. Twenty four zirconia specimens, with different core thicknesses (0.4-1 mm) were also prepared to obtain the contrast ratio of zirconia materials after veneering. L(*) , a(*) , and b(*) values of all-ceramic crowns cemented either on a metal cast post and core or on a prefabricated post did not show significant changes (P>.05). However, the slight color changes of zirconia crowns were detected and represented by ΔE(*) ab values, ranging from 1.2 to 3.1. The contrast ratios of zirconia specimens were 0.92-0.95 after veneering. No significant differences were observed between the L(*) , a(*) , and b(*) values of zirconia crowns cemented either on a metal cast post and core or a prefabricated post and composite core. However, the color of a background substructure could affect the overall color of posterior zirconia restorations with clinically recommended core thickness according to ΔE(*) ab values.

  15. Effect of the shades of background substructures on the overall color of zirconia-based all-ceramic crowns

    PubMed Central

    Tulapornchai, Chantana; Mamani, Jatuphol; Kamchatphai, Wannaporn; Thongpun, Noparat

    2013-01-01

    PURPOSE The objective of this study was to determine the effect of the color of a background substructure on the overall color of a zirconia-based all-ceramic crown. MATERIALS AND METHODS Twenty one posterior zirconia crowns were made for twenty subjects. Seven premolar crowns and six molar crowns were cemented onto abutments with metal post and core in the first and second group. In the third group, eight molar crowns were cemented onto abutments with a prefabricated post and composite core build-up. The color measurements of all-ceramic crowns were made before try-in, before and after cementation. A repeated measure ANOVA was used for a statistical analysis of a color change of all-ceramic crowns at α=.05. Twenty four zirconia specimens, with different core thicknesses (0.4-1 mm) were also prepared to obtain the contrast ratio of zirconia materials after veneering. RESULTS L*, a*, and b* values of all-ceramic crowns cemented either on a metal cast post and core or on a prefabricated post did not show significant changes (P>.05). However, the slight color changes of zirconia crowns were detected and represented by ΔE*ab values, ranging from 1.2 to 3.1. The contrast ratios of zirconia specimens were 0.92-0.95 after veneering. CONCLUSION No significant differences were observed between the L*, a*, and b* values of zirconia crowns cemented either on a metal cast post and core or a prefabricated post and composite core. However, the color of a background substructure could affect the overall color of posterior zirconia restorations with clinically recommended core thickness according to ΔE*ab values. PMID:24049574

  16. Kinetic Monte Carlo Investigation of the Effects of Vacancy Pairing on Oxygen Diffusivity in Yttria-Stabilized Zirconia

    NASA Technical Reports Server (NTRS)

    Good, Brian S.

    2011-01-01

    Yttria-stabilized zirconia s high oxygen diffusivity and corresponding high ionic conductivity, and its structural stability over a broad range of temperatures, have made the material of interest for use in a number of applications, for example, as solid electrolytes in fuel cells. At low concentrations, the stabilizing yttria also serves to increase the oxygen diffusivity through the presence of corresponding oxygen vacancies, needed to maintain charge neutrality. At higher yttria concentration, however, diffusivity is impeded by the larger number of relatively high energy migration barriers associated with yttrium cations. In addition, there is evidence that oxygen vacancies preferentially occupy nearest-neighbor sites around either dopant or Zr cations, further affecting vacancy diffusion. We present the results of ab initio calculations that indicate that it is energetically favorable for oxygen vacancies to occupy nearest-neighbor sites adjacent to Y ions, and that the presence of vacancies near either species of cation lowers the migration barriers. Kinetic Monte Carlo results from simulations incorporating this effect are presented and compared with results from simulations in which the effect is not present.

  17. Ferroelasticity, mechanical behavior, and phase stability of t prime zirconia ceramics

    SciTech Connect

    Jue Janfong.

    1991-01-01

    Large-grained (100-200 {mu}m), yttria doped, polycrystalline t{prime}-zirconia ceramics were fabricated by heating presintered samples at 2100C. Two point four and 3 mol% yttria-doped single crystals obtained from a commercial source were oriented by the Laue back-reflection method and cut along {l angle}100{r angle}, {l angle}110{r angle}, and {l angle}111{r angle} directions. They were also heat treated at 2100C. Ferroelastic domain structure was predicted by group theory and examined by transmission optical microscopy under polarized light and transmission electron microscopy. Orientations of domain boundaries were in accordance with predictions of group theory. X-ray diffraction showed that no monoclinic phase was detected on as-polished, ground, fracture surfaces, and on surfaces under tensile stresses as high as 400 MPa. Relative changes in the tetragonal peak intensities occurred and were attributed to ferroelastic domain switching. Higher toughness of 3 mol% Y{sub 2}O{sub 3} doped t{prime} samples (7.7MPam{sup 1/2}) compared to that of zirconia in the cubic phase (8 mol% Y{sub 2}O{sub 3}, 2.4MPam{sup 1/2}) was attributed in part to ferroelastic domain switching. Polished surfaces of polycrystalline t{prime}-materials showed no mono-clinic phase even after 1,000 hours at 275C in air, whereas conventional Y-TZP ceramics of a grain size larger than 0.5 {mu}m showed substantial transformation.

  18. Marginal fit of alumina-and zirconia-based fixed partial dentures produced by a CAD/CAM system.

    PubMed

    Tinschert, J; Natt, G; Mautsch, W; Spiekermann, H; Anusavice, K J

    2001-01-01

    Clinical long-term success of all-ceramic dental restorations can be significantly influenced by marginal discrepancies. As a result, this in vitro study evaluated the marginal fit of alumina- and zirconia-based fixed partial dentures (FPDs) machined by the Precident DCS system. Different master steel models of three-, four- and five-unit posterior FPDs with an 0.8 mm chamfer preparation were produced. FPDs made of DC-Zirkon and In-Ceram Zirconia core ceramics were machined by the Precident DCS system. The marginal fit of the milled frameworks placed on the master steel models was determined by a replica technique using a light-body silicone to fill the discrepancies between crown and tooth and a heavy-body material to stabilize the light-body impression material. The impressions were poured into an epoxy resin material and each model was cross-sectioned with a low speed diamond saw to better visualize marginal discrepancies. The marginal fit of the FPDs was evaluated by scanning electron microscopy. The measurements of the marginal fit exhibited mean marginal discrepancies in a range between 60.5 and 74.0 microm, mean marginal gaps in a range from 42.9 to 46.3 microm, mean vertical discrepancies in a range from 20.9 to 48.0 microm and mean horizontal discrepancies in the range of 42.0 to 58.8 microm. Statistical data analysis was performed using the non-parametric test of Kruskal-Wallis and Mann-Whitney. The analysis revealed no significant differences (p>0.05) between the mean marginal gaps and vertical and horizontal discrepancies. However, for some FPDs the mean values of the marginal discrepancies were significantly different (p < or =0.05). The wide range of the measured values may be attributed to the complex geometrical design of long span FPDs and difficulties regarding the milling process of brittle ceramic materials. Based on the selection of 100 microm as the limit of clinical acceptability, the results of this study can conclude that the level of

  19. Fracture stability of anterior zirconia crowns with different core designs and veneered using the layering or the press-over technique.

    PubMed

    Eisenburger, Michael; Mache, Tobias; Borchers, Lothar; Stiesch, Meike

    2011-06-01

    In the current in vitro study, the fracture stability of anterior crowns with zirconia cores of different designs was investigated after applying different veneering techniques. Four groups of zirconia cores (n = 10 in each group) were produced using a computer-aided design/computer-aided manufacturing (CAD/CAM) process. Cores with a standard cervical design were veneered using the layering technique (CCL) or the press-over technique (CCP). Further cores were designed with a porcelain shoulder, where the cervical margin of the zirconia core was reduced by 1 mm. These cores were also veneered using the layering technique (PSL) or the press-over technique (PSP). All crowns were cemented onto metal teeth and loaded until fracture in a universal testing machine. Chipping or fracture of the core was found to occur for CCL at 919±265 N (mean ±SD), for CCP at 798±226 N, for PSL at 739±184 N, and for PSP at 734±209 N. anova did not show significant differences between the four groups. For CCL and CCP, fracture lines ran in a mesio-distal orientation. For PSL and PSP, fracture lines ran into the porcelain shoulder. In summary, the use of a porcelain shoulder can be recommended with zirconia crowns in combination with either the layering or the press-over veneering technique.

  20. High-resolution and analytical TEM investigation of metastable-tetragonal phase stabilization in undoped nanocrystalline zirconia.

    PubMed

    Oleshko, Vladimir P; Howe, James M; Shukla, Satyajit; Seal, Sudipta

    2004-09-01

    Submicron and nano-sized nanocrystalline pure zirconia (ZrO2) powders having metastable tetragonal and tetragonal-plus-monoclinic crystal structures, respectively, were synthesized using the sol-gel technique. The as-precipitated and the calcinated ZrO2 powders were analyzed for their morphology, nanocrystallite size and structures, aggregation tendency, local electronic properties, and elemental compositions by conventional and high-resolution transmission electron microscopy and field-emission analytical electron microscopy, including energy-dispersive X-ray and electron energy-loss spectroscopies. The results from this study indicate that a combination of nanocrystallite size, strain-induced grain-growth confinement, and the simultaneous presence of the monoclinic phase can lead to stabilization of the metastable tetragonal-phase in undoped ZrO2. As a result, the tetragonal phase is stabilized within ZrO2 nanocrystallites up to 100 nm in size, which is 16 times larger than the previously reported critical size of 6 nm.

  1. Nano-structured yttria-stabilized zirconia coating by electrophoretic deposition

    NASA Astrophysics Data System (ADS)

    Maleki-Ghaleh, H.; Rekabeslami, M.; Shakeri, M. S.; Siadati, M. H.; Javidi, M.; Talebian, S. H.; Aghajani, H.

    2013-09-01

    The most important role of thermal barrier coatings is to reduce the temperature of the substrate in high temperature applications. Nano particle zirconia might be a suitable choice for improving the efficiency of thermal barrier coatings. Nanostructured coatings have lower thermal conduction, higher thermal expansion and lower dimensional variations at higher temperatures in comparison with the microstructured coatings. Electrophoretic deposition has been preferred for thermal barrier coatings due to its simplicity, controllability and low cost. In the present study, three different suspensions of ZrO2-8 wt%Y2O3 (40 nm) made with ethanol, acetone and acetyl acetone were used. Electrophoretic deposition was conducted at a fixed voltage of 60 V for 120 s on aluminized Inconel 738-LC, and then heat treated at 1100 ̊C for 4 h in air atmosphere. The coating morphology and elemental distribution were studied using scanning electron microscopy. It was observed that suspension media have an important effect on the quality of the final product. Acetyl acetone showed better dispersion of particles than the other two media. Consequently, deposition from acetyl acetone resulted in uniform and crack-free layers while those from ethanol and acetone were completely non-uniform due to agglomeration and low viscosity, respectively.

  2. Chemical vapor deposition of yttria-stabilized zirconia as a thermal barrier coating for gas turbine engines

    NASA Astrophysics Data System (ADS)

    Varanasi, Venu Gopal

    The gas turbine engine uses an yttria-stabilized zirconia (YSZ) coating to provide thermal insulation for its turbine blades. This YSZ coating must be tetragonal in crystal structure, columnar in microstructure, and be 100--250 mum thick to provide for adequate protection for the turbine blades in the severe engine environment. Currently, YSZ coatings are fabricated by electron-beam physical vapor deposition (EB-PVD), but this fabrication method is cost intensive. Chemical vapor deposition (CVD) is a more commercially viable processing method and a possible alternative to EB-PVD. The deposition of tetragonal YSZ from gaseous metal and oxidation sources were studied. A chemical equilibrium analysis modeled the feasibility of depositing tetragonal YSZ for both chloride CVD (Zr-Y-C-O-Cl-H-Inert system) and metal-organic CVD (MOCVD) (Zr-Y-C-O-H system). Pure thermochemical properties and the assessed YSZ phase diagram were used in this analysis. Using the molar input of metals ((nY + nZr) and ( nY/(nY + nZr ) = 0.08)) as bases, equilibrium calculations showed that tetragonal YSZ formation was feasible. Tetragonal YSZ formation was feasible with high oxygen content (nO/(nY + nZr) > 8) and high temperature (T > 100°C) in the case of chloride CVD (Zr-Y-C-O-Cl-H-Inert). Tetragonal YSZ formation was feasible with high oxygen content (nO/( nY + nZr) > 5) and high temperature (T > 950°C) in the case of MOCVD (Zr-Y-C-O-H). Although solid carbon formation did not appear in chloride CVD, additional oxygen (nO/( nY + nZr) > 32) and low hydrogen content relative to carbon (nH/nC < 2) were required to avoid solid carbon formation in MOCVD. Coatings were deposited using a set of base conditions derived from the chemical equilibrium analysis. In chloride CVD, YCl3 was not included because of its low vapor pressure, thus, ZrCl4 was oxidized with the H2-CO2 gas mixture. Monoclinic ZrO2 coatings were deposited at the thermochemically optimized conditions (n O/(nY + nZr) > 8, T > 1004

  3. Improving adhesion between luting cement and zirconia-based ceramic with an alternative surface treatment.

    PubMed

    Martins, Aurealice Rosa Maria; Gotti, Valéria Bisinoto; Shimano, Marcos Massao; Borges, Gilberto Antônio; Gonçalves, Luciano de Souza

    2015-01-01

    This study evaluated the influence of an alternative surface treatment on the microshear bond strength (μsbs) of zirconia-based ceramic. Thirty-five zirconia disks were assigned to five groups according to the following treatments: Control (CO), glass and silane were not applied to the zirconia surface; G1, air blasted with 100μm glass beads + glaze + silane; G2, a gel containing 15% (by weight) glass beads applied to the ceramic surface + glaze + silane; G3, a gel containing 25% (by weight) glass beads applied to the ceramic surface + glaze + silane; and G4, a gel containing 50% (by weight) glass beads applied to the ceramic surface + glaze + silane. The specimens were built up using RelyX ARC®, according to the manufacturer's recommendations, and inserted in an elastomeric mold with an inner diameter of 0.8 mm. The μsbs test was performed using a testing machine at a crosshead speed of 0.5 mm/min. ANOVA and Tukey's test (p < 0.05) were applied to the bond strength values (in MPa). CO (15.6 ± 4.1) showed the lowest μsbs value. There were no statistical differences between the G1 (24.9 ± 7.4), G2 (24.9 ± 2.3), G3 (35.0 ± 10.3) and G4 (35.3 ± 6.0) experimental groups. Those groups submitted to surface treatments with higher concentrations of glass showed a lower frequency of adhesive failures. In conclusion, the glass application improved the interaction between the ceramic and the luting cement.

  4. Flexural strength of glass-infiltrated zirconia/alumina-based ceramics and feldspathic veneering porcelains.

    PubMed

    Bottino, Marco Antonio; Salazar-Marocho, Susana M; Leite, Fabiola P P; Vásquez, Vanessa C; Valandro, Luiz Felipe

    2009-07-01

    To compare the flexural strength of two glass-infiltrated high-strength ceramics and two veneering glass-ceramics. Four ceramic materials were tested: two glass-infiltrated high-strength ceramics used as framework in metal-free restorations [In-Ceram Zirconia IZ (Gr1) and In-Ceram Alumina IA (Gr2)], and two glass-ceramics used as veneering material in metal-free restorations [Vita VM7 (Gr3) and Vitadur-alpha (Gr4)]. Bar specimens (25 x 5 x 2 mm3) made from core ceramics, alumina, and zirconia/alumina composites were prepared and applied to a silicone mold, which rested on a base from a gypsum die material. The IZ and IA specimens were partially sintered in an In-Ceram furnace according to the firing cycle of each material, and then were infiltrated with a low-viscosity glass to yield bar specimens of high density and strength. The Vita VM7 and Vitadur-alpha specimens were made from veneering materials, by vibration of slurry porcelain powder and condensation into a two-part brass Teflon matrix (25 x 5 x 2 mm3). Excess water was removed with absorbent paper. The veneering ceramic specimens were then removed from the matrix and were fired as recommended by the manufacturer. Another ceramic application and sintering were performed to compensate the contraction of the feldspar ceramic. The bar specimens were then tested in a three-point bending test. The core materials (Gr1: 436.1 +/- 54.8; Gr2: 419.4 +/- 83.8) presented significantly higher flexural strength (MPa) than the veneer ceramics (Gr3: 63.5 +/- 9.9; Gr4: 57.8 +/- 12.7). In-Ceram Alumina and Zirconia were similar statistically and more resistant than VM7 and Vitadur-alpha.

  5. Gelcast zirconia-alumina composites

    SciTech Connect

    Omatete, O.O.; Bleier, A.; Westmoreland, C.G.; Young, A.C.

    1991-01-01

    Near net-shaped parts of zirconia-alumina composites have been successfully formed by gelcasting, a technique which utilizes in situ polymerization of acrylamide monomers. The high solids loading required for gelcasting ({approximately}50 vol %) was obtained by controlling the pH-dependent stability of the aqueous zirconia-alumina suspensions. A strong correspondence was found among the surface charges on the particles, colloidal stability, and the maximum solids loading. 14 refs., 3 figs., 2 tabs.

  6. Assessing the feasibility of yttria-stabilized zirconia in novel designs as mandibular anterior fixed lingual retention following orthodontic treatment

    NASA Astrophysics Data System (ADS)

    Stout, Matthew

    The purpose of this study is to explore the feasibility of yttria-stabilized zirconia (Y-TZP) in fixed lingual retention as an alternative to stainless steel. Exploratory Y-TZP specimens were milled to establish design parameters. Next, specimens were milled according to ASTM standard C1161-13 and subjected to four-point flexural test to determine materials properties. Finite Element (FE) Analysis was employed to evaluate nine novel cross-sectional designs and compared to stainless steel wire. Each design was analyzed under the loading conditions to determine von Mises and bond stress. The most promising design was fabricated to assess accuracy and precision of current CAD/CAM milling technology. The superior design had a 1.0 x 0.5 mm semi-elliptical cross section and was shown to be fabricated reliably. Overall, the milling indicated a maximum percent standard deviation of 9.3 and maximum percent error of 13.5 with a cost of $30 per specimen. Y-TZP can be reliably milled to dimensions comparable to currently available metallic retainer wires. Further research is necessary to determine the success of bonding protocol and clinical longevity of Y-TZP fixed retainers. Advanced technology is necessary to connect the intraoral scan to an aesthetic and patient-specific Y-TZP fixed retainer.

  7. Methane Decomposition and Carbon Growth on Y2O3, Yttria-Stabilized Zirconia, and ZrO2.

    PubMed

    Kogler, Michaela; Köck, Eva-Maria; Perfler, Lukas; Bielz, Thomas; Stöger-Pollach, Michael; Hetaba, Walid; Willinger, Marc; Huang, Xing; Schuster, Manfred; Klötzer, Bernhard; Penner, Simon

    2014-02-25

    Carbon deposition following thermal methane decomposition under dry and steam reforming conditions has been studied on yttria-stabilized zirconia (YSZ), Y2O3, and ZrO2 by a range of different chemical, structural, and spectroscopic characterization techniques, including aberration-corrected electron microscopy, Raman spectroscopy, electric impedance spectroscopy, and volumetric adsorption techniques. Concordantly, all experimental techniques reveal the formation of a conducting layer of disordered nanocrystalline graphite covering the individual grains of the respective pure oxides after treatment in dry methane at temperatures T ≥ 1000 K. In addition, treatment under moist methane conditions causes additional formation of carbon-nanotube-like architectures by partial detachment of the graphite layers. All experiments show that during carbon growth, no substantial reduction of any of the oxides takes place. Our results, therefore, indicate that these pure oxides can act as efficient nonmetallic substrates for methane-induced growth of different carbon species with potentially important implications regarding their use in solid oxide fuel cells. Moreover, by comparing the three oxides, we could elucidate differences in the methane reactivities of the respective SOFC-relevant purely oxidic surfaces under typical SOFC operation conditions without the presence of metallic constituents.

  8. Thermal-Cycling Behavior of Plasma-Sprayed Partially Stabilized Zirconia Coatings on High-Density Graphite Substrate

    NASA Astrophysics Data System (ADS)

    Sure, Jagadeesh; Thyagarajan, K.; Mallika, C.; Mudali, U. Kamachi

    2015-08-01

    The thermal cycling behavior of partially stabilized zirconia (PSZ)-coated by plasma-spray process on NiCrAlY bond-coated high-density (HD) graphite substrate was investigated. Thermal cycling was carried out at 600 and 750 °C under vacuum, up to 200 cycles. Each cycle comprised a 10-min heating followed by forced air cooling for 10 min down to room temperature. Characterization of the microstructure and the phase analysis of thermal-cycled PSZ coatings by scanning electron microscopy, energy dispersive x-ray spectroscopy, x-ray diffraction (XRD), and Raman spectroscopy revealed the correlation between the microstructural/crystallographic phases and the mechanical integrity of the coating up to 200 cycles. Segmented and vertical cracks generated on the coating during thermal cycling were observed to propagate with increase in the number of cycles. Macrocracks and variations in elemental compositions were not observed until 200 cycles at 600 and 750 °C. XRD and Raman spectroscopic analysis confirmed the presence of nontransformable tetragonal phase only in all the thermal-cycled PSZ coatings, irrespective of temperature up to 200 cycles.

  9. Yttria-Stabilized Zirconia Ceramic Deposition on SS430 Ferritic Steel Grown by PLD - Pulsed Laser Deposition Method

    NASA Astrophysics Data System (ADS)

    Khalid Rivai, Abu; Mardiyanto; Agusutrisno; Suharyadi, Edi

    2017-01-01

    Development of high temperature materials are one of the key issues for the deployment of advanced nuclear reactors due to higher temperature operation. One of the candidate materials for that purpose is ceramic-coated ferritic steel that one of the functions is to be a thermal barrier coating (TBC). Thin films of YSZ (Ytrria-Stabilized Zirconia) ceramic have been deposited on a SS430 ferritic steel using Pulsed Laser Deposition (PLD) at Center For Science and Technology of Advanced Materials laboratory – National Nuclear Energy Agency of Indonesia (BATAN). The thin film was deposited with the chamber pressure range of 200-225 mTorr, the substrate temperature of 800oC, and the number of laser shots of 3×104, 6×104 and 9×104. Afterward, the samples were analyzed using Scanning Electron Microscope – Energy Dispersive X-ray Spectroscope (SEM-EDS), X-Ray Diffractometer (XRD), Atomic Force Microscope (AFM) and Vickers hardness tester. The results showed that the YSZ could homogeneously and sticky deposited on the surface of the ferritic steel. The surfaces were very smoothly formed with the surface roughness was in the range of 70 nm. Furthermore, thickness, composition of Zr4+ dan Y3+, the crystallinity, and hardness property was increased with the increasing the number of the shots.

  10. Ionic conductivity and electrical relaxation of nanocrystalline scandia-stabilized c-zirconia using complex impedance analysis

    NASA Astrophysics Data System (ADS)

    Kumar, Ashok; Manna, I.

    2008-07-01

    A solid solution of 8 mol% of scandia-stabilized cubic-zirconia (8ScSZ) has been prepared by co-precipitation technique. The synthesized powder has an average crystallite size ∼40 nm, surface area of 8.49 m 2/g, and agglomerated particle size of 150 nm. The activation energy of 8ScSZ has been calculated from impedance loss spectra; electrical modulus spectra are in the range of 0.90-1.30 eV. The frequency and temperature-dependent conductivities and impedance were measured in range of 50 Hz-1 MHz and 300-900 K, respectively. Complex impedance spectra, complex modulus formalism and complex conductivity spectra have been carefully analyzed in order to separate the grain, grain boundary and electrode-electrolyte effects. Analysis of ac impedance data using complex impedance indicates a typical negative temperature coefficient of resistance (NTCR) behavior of the materials. The intrinsic conductivity is mainly due to hopping of mobile ions among the available localized site. Relaxation time obtained from complex conductivity spectra are matched well with the impedance loss and modulus loss spectra. Impedance analysis suggests the presence of temperature-dependent electrical relaxation process in the material.

  11. Surface quality of yttria-stabilized tetragonal zirconia polycrystal in CAD/CAM milling, sintering, polishing and sandblasting processes.

    PubMed

    Alao, Abdur-Rasheed; Stoll, Richard; Song, Xiao-Fei; Miyazaki, Takashi; Hotta, Yasuhiro; Shibata, Yo; Yin, Ling

    2017-01-01

    This paper studied the surface quality (damage, morphology, and phase transformation) of yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) in CAD/CAM milling, and subsequent polishing, sintering and sandblasting processes applied in dental restorations. X-ray diffraction and scanning electron microscopy (SEM) were used to scan all processed surfaces to determine phase transformations and analyse surface damage morphology, respectively. The average surface roughness (Ra) and maximum roughness (Rz) for all processed surfaces were measured using desk-top SEM-assisted morphology analytical software. X-ray diffraction patterns prove the sintering-induced monoclinic-tetragonal phase transformation while the sandblasting-induced phase transformation was not detected. The CAD/CAM milling of pre-sintered Y-TZP produced very rough surfaces with extensive fractures and cracks. Simply polishing or sintering of milled pre-sintered surfaces did not significantly improve their surface roughness (ANOVA, p>0.05). Neither sintering-polishing of the milled surfaces could effectively improve the surface roughness (ANOVA, p>0.05). The best surface morphology was produced in the milling-polishing-sintering process, achieving Ra=0.21±0.03µm and Rz=1.73±0.04µm, which meets the threshold for bacterial retention. Sandblasting of intaglios with smaller abrasives was recommended as larger abrasive produced visible surface defects. This study provides technical insights into process selection for Y-TZP to achieve the improved restorative quality.

  12. Investigation of the oxygen exchange mechanism on Pt|yttria stabilized zirconia at intermediate temperatures: Surface path versus bulk path

    PubMed Central

    Opitz, Alexander K.; Lutz, Alexander; Kubicek, Markus; Kubel, Frank; Hutter, Herbert; Fleig, Jürgen

    2011-01-01

    The oxygen exchange kinetics of platinum on yttria-stabilized zirconia (YSZ) was investigated by means of geometrically well-defined Pt microelectrodes. By variation of electrode size and temperature it was possible to separate two temperature regimes with different geometry dependencies of the polarization resistance. At higher temperatures (550–700 °C) an elementary step located close to the three phase boundary (TPB) with an activation energy of ∼1.6 eV was identified as rate limiting. At lower temperatures (300–400 °C) the rate limiting elementary step is related to the electrode area and exhibited a very low activation energy in the order of 0.2 eV. From these observations two parallel pathways for electrochemical oxygen exchange are concluded. The nature of these two elementary steps is discussed in terms of equivalent circuits. Two combinations of parallel rate limiting reaction steps are found to explain the observed geometry dependencies: (i) Diffusion through an impurity phase at the TPB in parallel to diffusion of oxygen through platinum – most likely along Pt grain boundaries – as area-related process. (ii) Co-limitation of oxygen diffusion along the Pt|YSZ interface and charge transfer at the interface with a short decay length of the corresponding transmission line (as TPB-related process) in parallel to oxygen diffusion through platinum. PMID:22210951

  13. The effect of partially stabilized zirconia on the biological properties of HA/HDPE composites in vitro.

    PubMed

    Sadi, A Yari; Shokrgozar, M A; Homaeigohar, S Sh; Hosseinalipour, M; Khavandi, A; Javadpour, J

    2006-05-01

    The effect of partially stabilized zirconia (PSZ) on the biological properties of the hyroxyapatite - high density polyethylene (HA/HDPE) composites was studied by investigating the simultaneous effect of hydroxyapatite and PSZ volume fractions on the in vitro response of human osteoblast cells. The biocompatibility of composite samples with different volume fraction of HA and PSZ powders was assessed by proliferation, alkaline phosphatase (ALP) and cell attachment assays on the osteoblast cell line (G-292) in different time periods. The effect of composites on the behavior of G-292 cells was compared with those of HDPE and TPS (Tissue Culture Poly Styrene as negative control) samples. Results showed a higher proliferation rate of G-292 cells in the presence of composite samples as compared to the HDPE sample after 7 and 14 days of incubation period. ALP production rate in all composite samples was higher than HDPE and TPS samples. The number of adhered cells on the composite samples was higher than the number adhered on the HDPE and TPS samples after the above mentioned incubation periods. These findings indicates that the addition of PSZ does not have any adverse affect on the biocompatibility of HA/HDPE composites. In fact in some experiments PSZ added HA/HDPE composites performed better in proliferation, differentiation and attachment of osteoblastic cells.

  14. Dependence of the Electron Beam Energy and Types of Surface to Determine EBSD Indexing Reliability in Yttria-Stabilized Zirconia

    SciTech Connect

    Saraf, Laxmikant V.

    2012-04-01

    Electron backscatter diffraction (EBSD) is a powerful technique for the surface microstructure analysis. EBSD analysis of cubic yttria-stabilized zirconia (YSZ) in two and three dimensions (2-D, 3-D) is demonstrated using sequential slicing from a focused ion beam (FIB) followed by EBSD mapping to represent 3-D reconstructed high density grain structure with random orientation. The statistics related to accuracy of EBSD band detection shows that probability of accurate grain orientation detection increased significantly when the electron beam energy is increased from 10 kV to 30 kV. As a result of better sampling with increased interaction volume, a disparity between local and average grain orientation angle also exhibited the dependence of the electron beam energy to determine the accuracy of grain orientation. To study the accuracy and quality of EBSD band detection as a function of surface roughness and over layer formation, rapid EBSD measurement tests are performed on (a) YSZ surfaces ion-polished at ion beam energies of 65 nA at 30 kV and 1 nA at 30 kV and (b) carbon coated versus uncoated YSZ surfaces. The EBSD results at both 10 kV and 30 kV electron beam energies indicate that EBSD band detection accuracy is negatively affected by surface roughness and amorphous over layer formation.

  15. Surface and Mechanical Characterization of Dental Yttria-Stabilized Tetragonal Zirconia Polycrystals (3Y-TZP) After Different Aging Processes.

    PubMed

    Pinto, Palena A; Colas, Guillaume; Filleter, Tobin; De Souza, Grace M

    2016-12-01

    Yttria-stabilized tetragonal zirconia polycrystals (3Y-TZP) is a ceramic material used in indirect dental restorations. However, phase transformation at body temperature may compromise the material's mechanical properties, affecting the clinical performance of the restoration. The effect of mastication on 3Y-TZP aging has not been investigated. 3Y-TZP specimens (IPS E-max ZirCAD and Z5) were aged in three different modes (n=13): no aging (control), hydrothermal aging (HA), or chewing simulation (CS). Mechanical properties and surface topography were analyzed. Analysis of variance showed that neither aging protocol (p=0.692) nor material (p=0.283) or the interaction between them (p=0.216) had a significant effect on flexural strength, values ranged from 928.8 MPa (IPSHA) to 1,080.6 MPa (Z5HA). Nanoindentation analysis showed that material, aging protocol, and the interaction between them had a significant effect (p<0.001) on surface hardness and reduced Young's modulus. The compositional analysis revealed similar yttrium content for all the experimental conditions (aging: p=0.997; material: p=0.248; interaction material×aging: p=0.720). Atomic force microscopy showed an effect of aging protocols on phase transformation, with samples submitted to CS exhibiting features compatible with maximized phase transformation, such as increased volume of the material microstructure at the surface leading to an increase in surface roughness.

  16. Biological evaluation of partially stabilized zirconia added HA/HDPE composites with osteoblast and fibroblast cell lines.

    PubMed

    Yari Sadi, Amir; Shokrgozar, Mohammad Ali; Homaeigohar, Seyed Shahin; Khavandi, Alireza

    2008-06-01

    In the present study, the biocompatibility of partially stabilized zirconia (PSZ) added hydroxyapatite (HA)--high density polyethylene (HDPE) composites was evaluated by proliferation and cell attachment assays on two osteoblast cell lines (G-292, Saos-2) and a type of fibroblast cell isolated from bone tissue namely HBF in different time intervals. Cell-material interactions on the surface of the composites were observed by scanning electron microscopy (SEM). The effect of composites on the behavior of osteoblast and fibroblast cells was compared with those of HDPE and Tissue Culture Poly Styrene (TPS) (as negative control) samples. Results showed that the composite samples supported a higher proliferation rate of osteoblast cells in the presence of composite samples as compared to the HDPE and TPS samples after 3, 7 and 14 days of incubation period. It was showed that an equal or in some cases an even higher proliferation rate of G-292 and Saos-2 osteoblast cells on composite samples in compare to negative controls in culture period (P < 0.05). The number of adhered cells on the composite samples was equal and in some cases higher than the number adhered on the HDPE and TPS samples after the above mentioned incubation periods (P < 0.05). Adhered cells presented a normal morphology by SEM and many of the cells were seen to be undergoing cell division.

  17. Quinone-rich polydopamine functionalization of yttria stabilized zirconia for apatite biomineralization: The effects of coating temperature

    NASA Astrophysics Data System (ADS)

    Zain, Norhidayu Muhamad; Hussain, Rafaqat; Abdul Kadir, Mohammed Rafiq

    2015-08-01

    The use of yttria stabilized zirconia (YSZ) as biomedical implants is often offset by its bioinert nature that prevents its osseointegration to occur. Therefore, the functionalization of YSZ surface by polydopamine to facilitate the biomineralization of apatite layer on top of the coated film has incessantly been studied. In this study YSZ discs were first immersed in 2 mg/mL of stirred dopamine solution at coating temperatures between 25 and 80 °C. The specimens were then incubated for 7d in 1.5 SBF. The effect of coating temperature on the properties (chemical compositions and wettability) and the apatite mineralization on top of the generated films was investigated. It was found that at 50 °C, the specimen displayed the highest intensity of Ca 2p peak (1.55 ± 0.42 cps) with Ca/P ratio of 1.67 due to the presence of abundant quinone groups (Cdbnd O). However, the hydrophilicity (40.9 ± 01.7°) was greatly improved at 60 °C accompanied by the highest film thickness of 306 nm. Therefore, it was concluded that the presence of high intensity of quinone groups (Cdbnd O) in polydopamine film at elevated temperature affects the chelation of Ca2+ ions and thus enhance the growth of apatite layer on top of the functionalized YSZ surface.

  18. Methane Decomposition and Carbon Growth on Y2O3, Yttria-Stabilized Zirconia, and ZrO2

    PubMed Central

    2014-01-01

    Carbon deposition following thermal methane decomposition under dry and steam reforming conditions has been studied on yttria-stabilized zirconia (YSZ), Y2O3, and ZrO2 by a range of different chemical, structural, and spectroscopic characterization techniques, including aberration-corrected electron microscopy, Raman spectroscopy, electric impedance spectroscopy, and volumetric adsorption techniques. Concordantly, all experimental techniques reveal the formation of a conducting layer of disordered nanocrystalline graphite covering the individual grains of the respective pure oxides after treatment in dry methane at temperatures T ≥ 1000 K. In addition, treatment under moist methane conditions causes additional formation of carbon-nanotube-like architectures by partial detachment of the graphite layers. All experiments show that during carbon growth, no substantial reduction of any of the oxides takes place. Our results, therefore, indicate that these pure oxides can act as efficient nonmetallic substrates for methane-induced growth of different carbon species with potentially important implications regarding their use in solid oxide fuel cells. Moreover, by comparing the three oxides, we could elucidate differences in the methane reactivities of the respective SOFC-relevant purely oxidic surfaces under typical SOFC operation conditions without the presence of metallic constituents. PMID:24587591

  19. A porous yttria-stabilized zirconia layer to eliminate the delamination of air electrode in solid oxide electrolysis cells

    NASA Astrophysics Data System (ADS)

    Khan, Muhammad Shirjeel; Xu, Xiaoyong; Zhao, Jie; Knibbe, Ruth; Zhu, Zhonghua

    2017-08-01

    Delamination of La0.8Sr0.2MnO3-δ (LSM) in solid oxide electrolysis cells (SOECs) is usually associated with the high oxygen partial pressure build-up at the LSM-YSZ (yttria-stabilized zirconia) interface. Here we sandwich a porous YSZ layer between the LSM electrode and YSZ electrolyte to release this oxygen pressure. Symmetric cells with and without the porous YSZ layers are prepared and tested in air at 800 °C under the current densities of 0.5 and 1 A cm-2 for 100 h. Voltage change is continuously monitored, and impedance spectrum studies have been carried out before and after testing. No delamination has been observed for the samples with the porous YSZ layer even after 100 h. The improved performance for these samples is due to the shift of oxygen evolution reaction from the dense YSZ-LSM interface to a porous YSZ-LSM interface. This shift also helps the oxygen to be easily released instead of going into the pores or grain boundaries of the electrolyte. On the other hand, for the sample without the porous YSZ layer, the LSM is totally delaminated from the electrolyte just after 70 h.

  20. Biaxially textured YBa 2Cu 3O 7-x films deposited on polycrystalline flexible yttria-stabilized zirconia ceramic substrates

    NASA Astrophysics Data System (ADS)

    Varanasi, C. V.; Burke, J.; Lu, R.; Wu, J.; Brunke, L.; Chuck, L.; Smith, H. E.; Maartense, I.; Barnes, P. N.

    2008-07-01

    Biaxially textured YBa2Cu3O7-x (YBCO) films were grown on polycrystalline flexible yttria-stabilized zirconia (YSZ) ceramic substrates (Ceraflex) buffered with MgO and LaMnO3 layers. These substrates were initially coated with silica glass to obtain a smooth surface and then biaxially textured MgO buffer layers were deposited by ion beam assisted deposition (IBAD-MgO). Lanthanum manganate (LMO) cap layers and YBCO layers were then deposited by the pulsed laser ablation method. Highly textured YBCO films with a full width half maximum (FWHM) of 6.75° in (1 1 0) phi scans and a FWHM ∼ 5° in (2 0 0) omega scans were obtained. An initial deposition yielded samples with a Tc > 88 K and a self-field magnetization Jc of 2 × 105 A/cm2 at 77 K. A secondary ion mass spectrometry (SIMS) depth profile of the samples indicated that with the present deposition condition, some La, Mn and Mg diffusion into the YBCO layers is possible and this may reduce the Jc in the self-field. The yield strength (YS) of uncoated Ceraflex substrates was compared with that of metallic substrates and it was found that Ceraflex substrates can have a YS at least 4-5 times higher than the YS of biaxially textured Ni-5 at.%W substrates and ∼1.5 times that of HastelloyTM substrates.

  1. Calibration of Raman spectroscopy in the stress measurement of air-plasma-sprayed yttria-stabilized zirconia.

    PubMed

    Liu, Dong; Lord, Oliver; Flewitt, Peter E J

    2012-10-01

    Thermal barrier coatings (TBC) are used widely on a range of components that operate at high temperatures. We report measurement of the factor that is required to convert the Raman shift to stress for air plasma sprayed yttria (7 wt %) stabilized tetragonal zirconia (ZrO(2)) (YSZ) thermal barrier coatings. The factor is evaluated for the as-coated condition and also following a heat treatment at 1000 °C for 1050 h. Two Raman bands at 608 cm(-1) and 640 cm(-1) have been investigated in a diamond anvil cell under hydrostatic pressure up to ~24 GPa. In the range of zero to ~1.6 GPa, a linear behavior was observed in terms of the shifts of these two Raman bands with a gradient similar to dense bulk tetragonal ZrO(2). From these measurements the factors to convert wavenumber shift to stress have been derived. The application of these conversion factors to stress measurement in TBC coated test specimens and components is discussed.

  2. Structure and chemistry of epitaxial ceria thin films on yttria-stabilized zirconia substrates, studied by high resolution electron microscopy

    DOE PAGES

    Sinclair, Robert; Lee, Sang Chul; Shi, Yezhou; ...

    2017-03-18

    Here, we have applied aberration-corrected transmission electron microscopy (TEM) imaging and electron energy loss spectroscopy (EELS) to study the structure and chemistry of epitaxial ceria thin films, grown by pulsed laser deposition onto (001) yttria-stabilized zirconia (YSZ) substrates. There are few observable defects apart from the expected mismatch interfacial dislocations and so the films would be expected to have good potential for applications. Under high electron beam dose rate (above about 6000 e-/Å2s) domains of an ordered structure appear and these are interpreted as being created by oxygen vacancy ordering. The ordered structure does not appear at lower lose ratesmore » (ca. 2600 e-/Å2s) and can be removed by imaging under 1 mbar oxygen gas in an environmental TEM. EELS confirms that there is both oxygen deficiency and the associated increase in Ce3+ versus Ce4+ cations in the ordered domains. In situ high resolution TEM recordings show the formation of the ordered domains as well as atomic migration along the ceria thin film (001) surface.« less

  3. Structure and chemistry of epitaxial ceria thin films on yttria-stabilized zirconia substrates, studied by high resolution electron microscopy.

    PubMed

    Sinclair, Robert; Lee, Sang Chul; Shi, Yezhou; Chueh, William C

    2017-01-06

    We have applied aberration-corrected transmission electron microscopy (TEM) imaging and electron energy loss spectroscopy (EELS) to study the structure and chemistry of epitaxial ceria thin films, grown by pulsed laser deposition onto (001) yttria-stabilized zirconia (YSZ) substrates. There are few observable defects apart from the expected mismatch interfacial dislocations and so the films would be expected to have good potential for applications. Under high electron beam dose rate (above about 6000 e(-)/Å(2)s) domains of an ordered structure appear and these are interpreted as being created by oxygen vacancy ordering. The ordered structure does not appear at lower lose rates (ca. 2600 e(-)/Å(2)s) and can be removed by imaging under 1 mbar oxygen gas in an environmental TEM. EELS confirms that there is both oxygen deficiency and the associated increase in Ce(3+) versus Ce(4+) cations in the ordered domains. In situ high resolution TEM recordings show the formation of the ordered domains as well as atomic migration along the ceria thin film (001) surface.

  4. Investigation of the oxygen exchange mechanism on Pt|yttria stabilized zirconia at intermediate temperatures: Surface path versus bulk path.

    PubMed

    Opitz, Alexander K; Lutz, Alexander; Kubicek, Markus; Kubel, Frank; Hutter, Herbert; Fleig, Jürgen

    2011-11-30

    The oxygen exchange kinetics of platinum on yttria-stabilized zirconia (YSZ) was investigated by means of geometrically well-defined Pt microelectrodes. By variation of electrode size and temperature it was possible to separate two temperature regimes with different geometry dependencies of the polarization resistance. At higher temperatures (550-700 °C) an elementary step located close to the three phase boundary (TPB) with an activation energy of ∼1.6 eV was identified as rate limiting. At lower temperatures (300-400 °C) the rate limiting elementary step is related to the electrode area and exhibited a very low activation energy in the order of 0.2 eV. From these observations two parallel pathways for electrochemical oxygen exchange are concluded.The nature of these two elementary steps is discussed in terms of equivalent circuits. Two combinations of parallel rate limiting reaction steps are found to explain the observed geometry dependencies: (i) Diffusion through an impurity phase at the TPB in parallel to diffusion of oxygen through platinum - most likely along Pt grain boundaries - as area-related process. (ii) Co-limitation of oxygen diffusion along the Pt|YSZ interface and charge transfer at the interface with a short decay length of the corresponding transmission line (as TPB-related process) in parallel to oxygen diffusion through platinum.

  5. Coupling between creep and redox behavior in nickel - yttria stabilized zirconia observed in-situ by monochromatic neutron imaging

    NASA Astrophysics Data System (ADS)

    Makowska, Malgorzata Grazyna; Kuhn, Luise Theil; Frandsen, Henrik Lund; Lauridsen, Erik Mejdal; De Angelis, Salvatore; Cleemann, Lars Nilausen; Morgano, Manuel; Trtik, Pavel; Strobl, Markus

    2017-02-01

    Ni-YSZ (nickel - yttria stabilized zirconia) is a material widely used for electrodes and supports in solid oxide electrochemical cells. The mechanical and electrochemical performance of these layers, and thus the whole cell, depends on their microstructure. During the initial operation of a cell, NiO is reduced to Ni. When this process is conducted under external load, like also present in a stack assembly, significant deformations of NiO/Ni-YSZ composite samples are observed. The observed creep is orders of magnitude larger than the one observed after reduction during operation. This phenomenon is referred to as accelerated creep and is expected to have a significant influence on the microstructure development and stress field present in the Ni-YSZ in solid oxide electrochemical cells (SOCs), which is highly important for the durability of the SOC. In this work we present energy selective neutron imaging studies of the accelerated creep phenomenon in Ni/NiO-YSZ composite during reduction and also during oxidation. This approach allowed us to observe the phase transition and the creep behavior simultaneously in-situ under SOC operation-like conditions.

  6. Interface proximity effects on ionic conductivity in nanoscale oxide-ion conducting yttria stabilized zirconia: an atomistic simulation study.

    PubMed

    Sankaranarayanan, Subramanian K R S; Ramanathan, Shriram

    2011-02-14

    We present an atomistic simulation study on the size dependence of dopant distribution and the influence of nanoscale film thickness on carrier transport properties of the model oxide-ion conductor yttria stabilized zirconia (YSZ). Simulated amorphization and recrystallization approach was utilized to generate YSZ films with varying thicknesses (3-9 nm) on insulating MgO substrates. The atomic trajectories generated in the molecular dynamics simulations are used to study the structural evolution of the YSZ thin films and correlate the resulting microstructure with ionic transport properties at the nanoscale. The interfacial conductivity increases by 2 orders of magnitude as the YSZ film size decreases from 9 to 3 nm owing to a decrease in activation energy barrier from 0.54 to 0.35 eV in the 1200-2000 K temperature range. Analysis of dopant distribution indicates surface enrichment, the extent of which depends on the film thickness. The mechanisms of oxygen conductivity for the various film thicknesses at the nanoscale are discussed in detail and comparisons with experimental and other modeling studies are presented where possible. The study offers insights into mesoscopic ion conduction mechanisms in low-dimensional solid oxide electrolytes.

  7. Effects of specimen size and yttria concentration on mechanical properties of single crystalline yttria-stabilized tetragonal zirconia nanopillars

    NASA Astrophysics Data System (ADS)

    Zhang, Ning; Asle Zaeem, Mohsen

    2017-07-01

    The nanoscale plastic deformation of yttria-stabilized tetragonal zirconia (YSTZ) is highly dependent on the crystallographic orientations, i.e., dislocation is induced when the loading direction is 45° tilted to {111} and {101} slip planes, while tetragonal to monoclinic phase transformation dominates the plastic deformation when loading direction is perpendicular to the slip planes. This study investigates the effects of specimen size and yttria concentration on the mechanical response of single crystalline YSTZ nanopillars. Through uniaxial compression test, the smaller-is-stronger phenomenon is revealed in nanopillars deformed through a dislocation motion mechanism. Serrated stacking faults are observed in the smallest nanopillar, while neat primary slip plane forms in the largest nanopillar. In contrast, the larger-is-stronger relation is observed in nanopillars in which deformation is mediated by tetragonal to monoclinic phase transformation. It is noted that the ratio of transformed monoclinic phase to the remaining tetragonal phase is the highest in the smallest nanopillar. The strength of nanopillars is identified to decrease by increasing the amount of yttria due to the creation of more oxygen vacancies that act as weak points to facilitate dislocation motion and accelerate phase transformation.

  8. Annealing of paramagnetic centres in electron- and ion-irradiated yttria-stabilized zirconia: effect of yttria content

    SciTech Connect

    Costantini, Jean-Marc; Beuneu, Francois; Weber, William J

    2014-01-01

    We have studied the effect of the yttria content on the recovery of paramagnetic centres in electron-irradiated yttria-stabilized zirconia (ZrO2: Y3+). Single crystals with 9.5 mol% or 18 mol% Y2O3 were irradiated with electrons of 1.0, 1.5, 2.0 and 2.5 MeV. Paramagnetic centre thermal annealing was studied by X-band EPR spectroscopy. Hole-centres are found to be annealed more quickly, or at a lower temperature, for 18 mol% than for 9.5 mol% Y2O3. At long annealing times, a non-zero asymptotic behaviour is observed in the isothermal annealing curves of hole-centres and F+-type centres between 300 and 500 K. The normalized asymptotic concentration of both defects has a maximum value of about 0.5 for annealing temperatures near 375 K, below the onset of the (isochronal) recovery stage, regardless of the yttria content. Such an uncommon behaviour is analyzed on the basis of either kinetic rate equations of charge transfer or equilibria between point defects with different charge states.

  9. Tough yttria-stabilized zirconia ceramic by low-temperature spark plasma sintering of long-term stored nanopowders.

    PubMed

    Bezdorozhev, Oleksii; Borodianska, Hanna; Sakka, Yoshio; Vasylkiv, Oleg

    2011-09-01

    Weakly agglomerated 1.75 and 3 mol% yttria stabilized zirconia nanopowders were used in this study after six years of storage in vacuum-processed plastic containers. The proper storage conditions of the Y-TZP nanopowders avoided the hard agglomeration. Untreated and bead-milled nanopowders were used to obtain dense ceramics by slip casting and subsequent low-temperature sintering. Fully dense nanostructured 1.75Y-TZP and 3Y-YZP ceramics with and without doping of 1 wt% Al2O3 were produced by an optimized spark plasma sintering (SPS) technique at the temperatures of 1050-1150 degrees C at a pressure of 100 MPa. The SPS has revealed the clear advantage of consolidation of the weakly agglomerated nanopowders without preliminary deagglomeration. The Vickers hardness of both the low-temperature and spark plasma sintered samples was found to lie in the range of 10.98-13.71 GPa. A maximum fracture toughness of 15.7 MPa m(1/2) (average 14.23 MPa m(1/2)) was achieved by SPS of the 1.75Y-TZP ceramic doped with 1 wt% Al2O3 whereas the toughness of the 3Y-TZP ceramics with and without alumina doping was found to vary between 3.55 and 5.5 MPa m(1/2).

  10. Dependence of the electron beam energy and types of surface to determine EBSD indexing reliability in yttria-stabilized zirconia.

    PubMed

    Saraf, Laxmikant V

    2012-04-01

    Electron backscatter diffraction (EBSD) is a powerful technique for surface microstructure analysis. EBSD analysis of cubic yttria-stabilized zirconia (YSZ) is demonstrated. The statistics related to EBSD indexing reliability shows that the probability of accurate grain orientation detection increased significantly when the electron beam energy was increased from 10 to 30 kV. As a result of better sampling with increased interaction volume, a disparity between local and average grain misorientation angle also exhibited the dependence of the electron beam energy to determine the accuracy of grain orientation. To study EBSD indexing reliability as a function of surface roughness and overlayer formation, rapid EBSD measurement tests were performed on (a) YSZ surfaces ion-polished at ion beam energies of 65 nA at 30 kV and 1 nA at 30 kV and (b) carbon-coated versus uncoated YSZ surfaces. The EBSD results at both 10 and 30 kV electron beam energies indicate that EBSD indexing reliability is negatively affected by higher ion beam milling current and amorphous overlayer formation.

  11. Effect of Stress-Induced Phase Transformation on the Fracture Toughness of Fe3Al Intermetallic Reinforced with Yttria-Partially Stabilized Zirconia Particles

    NASA Astrophysics Data System (ADS)

    Amiri Talischi, Lima; Samadi, Ahad

    2017-10-01

    In this study, fracture toughness and microhardness of Fe3Al intermetallic reinforced with yttria-partially stabilized zirconia (Y-PSZ) particles were investigated. Fe3Al/Y-PSZ composites containing up to 20 wt pct of Y-PSZ were fabricated by hot pressing of powder mixtures. It is found that the microhardness and fracture toughness of Fe3Al intermetallic increase by adding Y-PSZ particles. The maximal levels of fracture toughness and microhardness correspond to Fe3Al-10 wt pct Y-PSZ composite with the fracture toughness of 23.1 MPa√m and the microhardness of 645 HV. The improvement in fracture toughness could be related to the stress-induced structural transformation of zirconia particles from tetragonal to monoclinic which causes crack deflection and prevents crack propagation.

  12. Use of ceria-stabilized zirconia/alumina nanocomposite for fabricating the frameworks of removable dental prostheses: A clinical report.

    PubMed

    Hagiwara, Yoshiyuki; Nakajima, Kiyoshi

    2016-08-01

    Ceria-stabilized zirconia/alumina nanocomposite (Ce-TZP/A) exhibits an elasticity equivalent to that of cobalt-chromium alloy and a flexural property that is superior to that of yttria-tetragonal zirconia polycrystal. Therefore, the use of Ce-TZP/A for the fabrication of removable dental prosthesis frameworks is being studied. However, the current English literature does not include any clinical report on the use of Ce-TZP/A for the fabrication of the entire framework. This clinical report describes the process and outcomes of fabricating a mandibular implant-supported overdenture and a maxillary complete denture with Ce-TZP/A as the framework material.

  13. Hydrothermal synthesis and characterization of zirconia based catalysts

    NASA Astrophysics Data System (ADS)

    Caillot, T.; Salama, Z.; Chanut, N.; Cadete Santos Aires, F. J.; Bennici, S.; Auroux, A.

    2013-07-01

    In this work, three equimolar mixed oxides ZrO2/CeO2, ZrO2/TiO2, ZrO2/La2O3 and a reference ZrO2 have been synthesized by hydrothermal method. The structural and surface properties of these materials have been fully characterized by X-ray diffraction, transmission electron microscopy, surface area measurement, chemical analysis, XPS, infrared spectroscopy after adsorption of pyridine and adsorption microcalorimetry of NH3 and SO2 probe molecules. All investigated mixed oxides are amphoteric and possess redox centers on their surface. Moreover, hydrothermal synthesis leads to catalysts with higher surface area and with better acid-base properties than classical coprecipitation method. Both Lewis and Brønsted acid sites are present on the surface of the mixed oxides. Compared to the other samples, the ZrO2/TiO2 material appears to be the best candidate for further application in acid-base catalysis.

  14. Zirconia: cementation of prosthetic restorations. Literature review

    PubMed Central

    GARGARI, M.; GLORIA, F.; NAPOLI, E.; PUJIA, A.M.

    2011-01-01

    SUMMARY Aim of the work Aim of the work was to execute a review of the international literature about the cementation of zirconia restorations, analyzing the properties of the cements most commonly used in clinical activities. Materials and methods It was performed, through PubMed, a bibliographic search on the international literature of the last 10 years using the following limits: studies in English, in vitro studies, randomized clinical trial, reviews, meta-analysis, guide-lines. Were excluded from the search: descriptive studies, case reports, discussion articles, opinion’s leader. Results From studies results that common surface treatments (silanization, acid etching) are ineffective on zirconia because it has an inert surface without glassy component (on which this surface treatments act primarily), instead the sandblasting at 1atm with aluminium oxide (Al2O3) results significantly effective for the resulting roughening that increase the surface energy and the wettability of the material. Furthermore it has been shown that zinc phosphate-based cements, Bis-GMA-based and glass-ionomer cements can’t guarantee a stable long-term adhesion, instead resin cements containing phosphate monomer 10-methacryloyloxyidecyl-dihyidrogenphosphate (MDP) have shown higher adhesion and stability values than the other cements. In particular, it has seen that bond strength of zirconia copings on dentin, using MDP-based cement, is about 6,9MPa; this value is comparable to that obtained with gold copings cementation. Conclusions Analyzed studies have led to the following conclusions: sandblasting with aluminium oxide (Al2O3) is the best surface treatment to improve adhesion between resin cements and zirconia; resin cements containing phosphate ester monomers 10-methacryloyloxyidecyl-dihyidrogenphosphate (MDP) have shown in the studies an higher bond strength and stability after ageing treatment; the best procedure for cementing zirconia restorations results the combination of

  15. Effects of temperature-gradient-induced damage of zirconia metering nozzles

    NASA Astrophysics Data System (ADS)

    Zhao, Liang; Xue, Qun-hu

    2017-09-01

    The effects of temperature-gradient-induced damage of zirconia metering nozzles were investigated through analysis of the phase composition and microstructure of nozzle samples. The analysis was carried out using X-ray diffraction and scanning electron microscopy after the samples were subjected to a heat treatment based on the temperatures of the affected, transition, and original layers of zirconia metering nozzles during the continuous casting of steel. The results showed that, after heat treatment at 1540, 1410, or 1300°C for a dwell time of 5 h, the monoclinic zirconia phase was gradually stabilized with increasing heat-treatment temperature. Moreover, a transformation to the cubic zirconia phase occurred, accompanied by grain growth, which illustrates that the temperature gradient in zirconia metering nozzles affects the mineral composition and microstructure of the nozzles and accelerates damage, thereby deteriorating the quality and service life of the nozzles.

  16. Failure Behavior of Plasma-Sprayed Yttria-Stabilized Zirconia Thermal Barrier Coatings Under Three-Point Bending Test via Acoustic Emission Technique

    NASA Astrophysics Data System (ADS)

    Wang, L.; Ni, J. X.; Shao, F.; Yang, J. S.; Zhong, X. H.; Zhao, H. Y.; Liu, C. G.; Tao, S. Y.; Wang, Y.; Li, D. Y.

    2017-01-01

    In this paper, the failure behavior of plasma-sprayed yttria-stabilized zirconia thermal barrier coatings fabricated by atmospheric plasma spraying (APS-TBCs) under three-point bending (3PB) test has been characterized via acoustic emission (AE) technique. Linear positioning method has been adopted to monitor dynamic failure process of the APS-TBCs under 3PB test. The investigation results indicate that the variation of AE parameters (AE event counts, amplitudes and AE energy) corresponds well with the change of stress-strain curve of the loading processes. The failure mechanism was analyzed based on the characteristics of AE parameters. The distribution of frequency of crack propagation has been obtained. The AE signals came from two aspects: i.e., plastic deformation of substrates, initiation and propagation of the cracks in the coatings. The AE analysis combined with cross-sectional observation has indicated that many critical cracks initiate at the surface of the top-coat. And some main cracks tend to propagate toward the substrate/bond-coat interface. The actual failure mechanism of the APS-TBCs under 3PB test is attributed to the debonding of metallic coating from the substrates and the propagation of the horizontal crack along the substrate/bond-coat interface under the action of flexural moment.

  17. Magnetotransport and rectifying properties in La0.67Ca0.33MnO3/yttrium-stabilized zirconia/Si heterojunction

    NASA Astrophysics Data System (ADS)

    Lang, P. L.; Zhao, Y. G.; Yang, B.; Zhang, X. L.; Li, J.; Wang, P.; Zheng, D. N.

    2005-08-01

    A heterojunction has been fabricated by growing a La0.67Ca0.33MnO3 film on silicon with a buffer layer of yttrium-stabilized zirconia (YSZ). The current-voltage measurement shows that it is a diode with a good rectifying property. At low positive bias voltage, temperature dependence of the junction resistance shows a peak at a certain temperature, which shifts to low temperatures when the voltage is increased from 0.3Vto0.7V. This behavior is quite different from the previous reports on p-n junctions composed of manganites and Nb-doped SrTiO3. The heterojunction shows remarkable magnetoresistance for both positive and negative biases. The results were discussed by considering the depletion layers in both La0.67Ca0.33MnO3 and Si, and the tunneling through YSZ. This work shows the potential application of integrating manganite-based devices and semiconductor circuits.

  18. Zirconia-molybdenum disilicide composites

    DOEpatents

    Petrovic, John J.; Honnell, Richard E.

    1991-01-01

    Compositions of matter comprised of molybdenum disilicide and zirconium oxide in one of three forms: pure, partially stabilized, or fully stabilized and methods of making the compositions. The stabilized zirconia is crystallographically stabilized by mixing it with yttrium oxide, calcium oxide, cerium oxide, or magnesium oxide and it may be partially stabilized or fully stabilized depending on the amount of stabilizing agent in the mixture.

  19. Molybdenum disilicide composites reinforced with zirconia and silicon carbide

    DOEpatents

    Petrovic, John J.

    1995-01-01

    Compositions consisting essentially of molybdenum disilicide, silicon carbide, and a zirconium oxide component. The silicon carbide used in the compositions is in whisker or powder form. The zirconium oxide component is pure zirconia or partially stabilized zirconia or fully stabilized zirconia.

  20. Molybdenum disilicide composites reinforced with zirconia and silicon carbide

    DOEpatents

    Petrovic, J.J.

    1995-01-17

    Compositions are disclosed consisting essentially of molybdenum disilicide, silicon carbide, and a zirconium oxide component. The silicon carbide used in the compositions is in whisker or powder form. The zirconium oxide component is pure zirconia or partially stabilized zirconia or fully stabilized zirconia.

  1. Molybdenum disilicide composites reinforced with zirconia and silicon carbide

    SciTech Connect

    Petrovic, J.J.

    1992-12-31

    This patent pertains to compositions consisting essentially of molybdenum disilicide, silicon carbide, and a zirconium oxide component. The silicon carbide used in the compositions is in whisker or powder form. The zirconium oxide component is pure zirconia or partially stabilized zirconia or fully stabilized zirconia. Fabrication, fracture toughness, and bend strength are covered.

  2. Fracture toughness of yttria-stabilized zirconia sintered in conventional and microwave ovens.

    PubMed

    Marinis, Aristotelis; Aquilino, Steven A; Lund, Peter S; Gratton, David G; Stanford, Clark M; Diaz-Arnold, Ana M; Qian, Fang

    2013-03-01

    The fabrication of zirconium dioxide (ZrO2) dental prosthetic substructures requires an extended sintering process (8 to 10 hours) in a conventional oven. Microwave sintering is a shorter process (2 hours) than conventional sintering. The purpose of this study was to compare the fracture toughness of 3 mol % Y2O3-stabilized ZrO2 sintered in a conventional or microwave oven. Partially sintered ZrO2 specimens from 3 manufacturers, KaVo, Lava 3M, and Crystal HS were milled (KaVo Everest engine) and randomly divided into 2 groups: conventional sintering and microwave sintering (n=16 per group). The specimens were sintered according to the manufacturers' recommendations and stored in artificial saliva for 10 days. Fracture toughness was determined by using a 4-point bend test, and load to fracture was recorded. Mean fracture toughness for each material was calculated. A 2-way ANOVA followed by the Tukey HDS post hoc test was used to assess the significance of sintering and material effects on fracture toughness, including an interaction between the 2 factors (α=.05). The 2-way ANOVA suggested a significant main effect for ZrO2 manufacturer (P<.001). The post hoc Tukey HSD test indicated that mean fracture toughness for the KaVo ZrO2 (5.85 MPa·m(1/2) ±1.29) was significantly higher than for Lava 3M (5.19 MPa·m(1/2) ±0.47) and Crystal HS (4.94 MPa·m(1/2) ±0.66) (P<.05) and no significant difference was observed between Lava 3M and Crystal HS (P>.05). The main effect of the sintering process (Conventional [5.30 MPa·m(1/2) ±1.00] or Microwave [5.36 MPa·m(1/2) ±0.92]) was not significant (P=.76), and there was no interaction between sintering and ZrO2 manufacturer (P=.91). Based on the results of this study, no statistically significant difference was observed in the fracture toughness of ZrO2 sintered in microwave or conventional ovens. Copyright © 2013 The Editorial Council of the Journal of Prosthetic Dentistry. Published by Mosby, Inc. All rights reserved.

  3. Zirconia-based mixed potential sensor with Pt electrode prepared by spin-coating of polymeric precursor

    NASA Astrophysics Data System (ADS)

    Chrzan, A.; Woźniak, Ł.; Szymczewska, D.; Jasiński, P.

    2016-11-01

    Many types of yttria-stabilized zirconia (YSZ) based gas sensors have been explored extensively in recent years. Great attention have been directed to mixed-potential-type gas sensors. It is due to growing concerns with environmental issues. Not without a significance is the fact of very attractive performance of this type of sensor allowing to detect low concentration of pollutant gases. In this paper two types of YSZ based mixed-potential planar sensors were investigated, with platinum electrode painted using commercial paste and with spin coated platinum layer. Both types had second electrode in the form of porous gold. Measurements were performed at 400 °C in synthetic air and different concentrations of SO2. Gas flow was set to 100 cm3min-1 and the concentration of 50 ppm SO2 was tested. During this measurements the sensor was sintered in-situ at increasing temperatures. Sensor with 100 nm spin-coated platinum layer sintered at 700 °C was shown to exhibit two times smaller response than sensor with 5 μm porous electrode, while consisting of over 20 times smaller amount of Pt. The influence of sintering temperature on electrical conductivity of platinum films was also examined. Moreover, the platinum microstructure was investigated using SEM microscopy.

  4. [Effect of Al₂O₃ sandblasting on the bond strength between 3mol% yttrium-stabilized tetragonal zirconium polycrystal zirconia framework and veneering porcelain].

    PubMed

    Qiang, Zeng; Ning, Li; Yanan, Zhou; Jiazhen, Yan; Wenbo, Liu

    2015-12-01

    The effect of sandblasting on the bond strength between 3mol% yttrium-stabilized tetragonal zirconium polycrystal (3Y-TZP) zirconia framework and veneering porcelain was evaluated. A total of 21 specimens [(25 ± 1) mm x (3 ± 0.1) mmx (0.5 ± 0.05) mm] were prepared according to ISO 9693. The specimens were then randomly divided into 3 groups. Sandblasting was performed on 2 meshes of Al₂O₃ particles: group A with mesh 110 and group B with mesh 80. Group C, which was not sandblasted, was the control group. The surface roughness of the zirconia framework, as well as the bond strength between 3Y-TZP zirconia framework and veneering porcelain, was measured. The interface microstructure was observed by scanning electron microscope (SEM), and elemental distribution was detected by energy dispersive spectroscopy (EDS). Surface roughness values were (1.272 ± 0.149) μm for group A, (0.622 ± 0.113) μm for group B, and (0.221 ± 0.065) μm for group C. Statistical significance were found among groups (P < 0.05). The bond strength values were (28.21 ± 1.52) MPa for group A, (27.71 ± 1.27) MPa for group B, and (24.87 ± 3.84) MPa for group C. Statistical significance was found between group A and group C (P < 0.05), whereas the other groups had no statistical significance (P > 0.05). Interface adhesion failure was the primary performance. SEM images showed the close interface bonding, and EDS showed that the interface had no obvious element penetration. Al₂O₃ sandblasting can slightly enhance the bond strength between zirconia framework and veneering porcelain.

  5. Slip-cast and hot-solution infiltrated porous yttria stabilized zirconia (YSZ) supported tubular fuel cells

    NASA Astrophysics Data System (ADS)

    Hanifi, Amir Reza; Paulson, Scott; Torabi, Alireza; Shinbine, Alyssa; Tucker, Michael C.; Birss, Viola; Etsell, Thomas H.; Sarkar, Partha

    2014-11-01

    Hot solution infiltration was investigated as a flexible and rapid method to incorporate anode and cathode components into fully sintered, porous ceramic tubular templates for use as solid oxide fuel cells (SOFC). Composed of either a porous 8 mol% yttria-stabilized zirconia (YSZ) or 5 wt% NiO-YSZ support structure, a thin Ni-YSZ anode functional layer and an outer ca. 10 μm dense YSZ electrolyte, closed end tubes were first hot solution (ca. 100 °C) infiltrated on the inside with NiO-SDC (Sm0.2Ce0.8O1.9) to serve as the anode. Cathodes were either LSM (nominally La0.8Sr0.2MnO3+δ) infiltrated into a thin porous YSZ layer on the outer electrolyte surface, or an LSCF-GDC composite (Gd0.1Ce0.9O1.95-La0.6Sr0.4Co0.2Fe0.8O3-δ) on a thin GDC buffer layer. Although hot solution infiltration of the Ni, Ce and Sm salts into the anode support structure did not result in complete penetration (with the Ni contents in the tube wall ranging between 4 and 10 vol.%), well-sealed full cells produced power densities as high as 275, 196 and 153 mW cm-2 at 800, 750 and 700 °C, respectively. Hot solution infiltration of active SOFC electrode materials is thus shown to be a very flexible approach for the evaluation of their performance.

  6. Determination of Scattering and Absorption Coefficients for Plasma-Sprayed Yttria-Stabilized Zirconia Thermal Barrier Coatings at Elevated Temperatures

    NASA Technical Reports Server (NTRS)

    Eldridge, Jeffrey I.; Spuckler, Charles M.; Markham, James R.

    2009-01-01

    The temperature dependence of the scattering and absorption coefficients for a set of freestanding plasma-sprayed 8 wt% yttria-stabilized zirconia (8YSZ) thermal barrier coatings (TBCs) was determined at temperatures up to 1360 C in a wavelength range from 1.2 micrometers up to the 8YSZ absorption edge. The scattering and absorption coefficients were determined by fitting the directional-hemispherical reflectance and transmittance values calculated by a four-flux Kubelka Munk method to the experimentally measured hemispherical-directional reflectance and transmittance values obtained for five 8YSZ thicknesses. The scattering coefficient exhibited a continuous decrease with increasing wavelength and showed no significant temperature dependence. The scattering is primarily attributed to the relatively temperature-insensitive refractive index mismatch between the 8YSZ and its internal voids. The absorption coefficient was very low (less than 1 per centimeter) at wavelengths between 2 micrometers and the absorption edge and showed a definite temperature dependence that consisted of a shift of the absorption edge to shorter wavelengths and an increase in the weak absorption below the absorption edge with increasing temperature. The shift in the absorption edge with temperature is attributed to strongly temperature-dependent multiphonon absorption. While TBC hemispherical transmittance beyond the absorption edge can be predicted by a simple exponential decrease with thickness, below the absorption edge, typical TBC thicknesses are well below the thickness range where a simple exponential decrease in hemispherical transmittance with TBC thickness is expected. [Correction added after online publication August 11, 2009: "edge to a shorter wavelengths" has been updated as edge to shorter wavelengths."

  7. Stress-State Effects on Strength and Fracture of Partially-Stabilized Zirconia

    DTIC Science & Technology

    1994-03-01

    zone Dugdale model2 l was verified by plastic zone size measurements size would also be expected to vary with the applied load. The in thin steel...19], Garvie and Swain [20] and others (see the review zone length measurements in thin sheets of mild steel by Evans and Cannon [21]), stability of...transformed tetragonal phase. V, by many investigators and it has been reviewed recently intrinsic fracture toughness of the transformed zone by Evans and

  8. Characterization and durability testing of plasma-sprayed zirconia-yttria and hafnia-yttria thermal barrier coatings. Part 1: Effect of spray parameters on the performance of several lots of partially stabilized zirconia-yttria powder

    NASA Technical Reports Server (NTRS)

    Miller, Robert A.; Leissler, George W.; Jobe, J. Marcus

    1993-01-01

    Initial experiments conducted on thermal barrier coatings prepared in the newly upgraded research plasma spray facility and the burner rig test facilities are discussed. Part 1 discusses experiments which establish the spray parameters for three baseline zirconia-yttria coatings. The quality of five similar coating lots was judged primarily by their response to burner rig exposure supplemented by data from other sources such as specimen characterizations and thermal diffusivity measurements. After allowing for burner rig variability, although there appears to be an optimum density (i.e., optimum microstructure) for maximum burner rig life, the distribution tends to be rather broad about the maximum. In Part 2, new hafnia-yttria-based coatings were evaluated against both baseline and alternate zirconia-yttria coatings. The hafnia-yttria coatings and the zirconia-yttria coatings that were prepared by an alternate powder vendor were very sensitive to plasma spray parameters, in that high-quality coatings were only obtained when certain parameters were employed. The reasons for this important observation are not understood. Also not understood is that the first of two replicate specimens sprayed for Part 1 consistently performed better than the second specimen. Subsequent experiments did not display this spray order affect, possibly because a chiller was installed in the torch cooling water circuit. Also, large changes in coating density were observed after switching to a new lot of electrodes. Analyses of these findings were made possible, in part, because of the development of a sensitive density measurement technique described herein in detail. The measured thermal diffusivities did not display the expected strong relationship with porosity. This surprising result was believed to have been caused by increased microcracking of the denser coatings on the stainless steel substrates.

  9. [Microwave sintering of nanometer powder of alumina and zirconia-based dental ceramics].

    PubMed

    Chen, Yi-Fan; Lu, Dong-Mei; Wan, Qian-Bing; Jin, Yong; Zhu, Ju-Mu

    2006-02-01

    The objective of the present study was to investigate the feasibility and reliability of sintering alumina and zirconia-based all-ceramic materials through a recently introduced microwave heating technique. The variation of crystal phases, the growth of grain sizes and microstructural features of these materials were evaluated after sintering. Four different groups of powder (l00%Al2O3, 60%Al2O3+40%ZrO2, 40% Al2O3+60%ZrO2, 100% ZrO2) were respectively press-compacted to fabricate green disk samples, 5 specimen of each group were prepared. All the samples were surrounded by refractory materials for heat containment and processed at 1 600 degrees C in a domestic microwave oven (850 W, 2 450 MHz), 1 600 degrees C/5 min for heating rate, 10 min for holding time. After sintering, the phase composition and average grain size of these ceramics were examined using X-ray diffraction (XRD). Their microstructure characteristics were studied by scanning electron microscopy (SEM). All the specimens were successfully sintered with the application of microwave heating system in combination with a suitable thermal insulator. No phase change was found in alumina while monoclinic-zirconia was found to be transformed to tetragonal-zirconia. A little grain size growth of Al2O3 and ZrO2 has been observed with Al2O3 24.1 nm/before and 51.8 nm/after; ZrO2 25.3 nm/before and 29.7 nm/after. The SEM photos indicated that the microwave-sintered Al2O3-ZrO2 ceramics had a uniform crystal distribution and their crystal sizes could be maintained within the range of nanometers. It is expected that in the near future microwave heating system could be a promising substitute for conventional processing methods due to its unparalled advantages, including more rapid heating rate, shortened sintering time, superfine grain size, improved microstructure and much less expensive equipment.

  10. Five-year prospective clinical study of posterior three-unit zirconia-based fixed dental prostheses.

    PubMed

    Sorrentino, Roberto; De Simone, Giorgio; Tetè, Stefano; Russo, Simona; Zarone, Fernando

    2012-06-01

    This prospective clinical trial aimed at evaluating the clinical performance of three-unit posterior zirconia fixed dental prostheses (FDPs) after 5 years of clinical function. Thirty-seven patients received 48 three-unit zirconia-based FDPs. The restorations replaced either a premolar or a molar. Specific inclusion criteria were needed. Tooth preparation was standardized. Computer-aided design/computer-assisted manufacturing frameworks with a 9-mm(2) cross section of the connector and a 0.6-mm minimum thickness of the retainer were made. The restorations were luted with resin cement. The patients were recalled after 1, 6, 12, 24, 36, 48, and 60 months. The survival and success of the ceramics and zirconia were evaluated. The technical and aesthetic outcomes were examined using the United States Public Health Service criteria. The biologic outcomes were analyzed at abutment and contralateral teeth. Descriptive statistics were performed. All FDPs completed the study, resulting in 100% cumulative survival rate and 91.9% and 95.4% cumulative success rates for patients wearing one and two FDPs, respectively. No losses of retention were recorded. Forty-two restorations were rated alpha in all measured parameters. A minor chipping of the ceramics was detected in three restorations. No significant differences between the periodontal parameters of the test and control teeth were observed. Five-year clinical results proved that three-unit posterior zirconia-based FDPs were successful in the medium term for both function and aesthetic. Zirconia can be considered a promising substitute of metal frameworks for the fabrication of short-span posterior prostheses.

  11. Conditioning effects on La1-xSrxMnO3-Yttria stabilized Zirconia electrodes for thin-film solid oxide fuel cells

    SciTech Connect

    Lee, You-Kee; Kim, Jung-Yeul; Lee, Young-Ki; Kim, Insoo; Moon, Hee-Soo; Park, Jong-Wan; Jacobson, Craig P.; Visco, Steven J.

    2002-12-06

    Composite cathodes of 50/50 vol percent LSM-YSZ (La1-xSrxMnO3-yttria stabilized zirconia) were deposited onto dense YSZ electrolytes by a colloidal deposition technique. The cathode characteristics were then examined by scanning electron microscopy (SEM) and studied by an impedance spectroscopy (IS). Conditioning effects of the LSM-YSZ cathodes were seen, and remedies for these effects were proposed for improving the performance of a solid oxide fuel cell (SOFC). LSM surface contamination and modification, cathode bonding to the YSZ electrolyte, changing Pt electrode and bonding paste, and curvature of sintered YSZ electrolytes led to some changes in microstructure and variability in cell performances.

  12. Epitaxial yttria-stabilized zirconia on (1 -1 0 2) sapphire for YBa2Cu3O(7-delta) thin films

    NASA Technical Reports Server (NTRS)

    Wu, X. D.; Muenchausen, R. E.; Nogar, N. S.; Pique, A.; Edwards, R.

    1991-01-01

    Epitaxial yttria-stabilized zirconia (YSZ) films were deposited on (1 -1 0 2) sapphire by pulsed laser deposition. The films are formed in a cubic phase with the a axis normal to the substrate surface. Ion beam channeling measurements show that the YSZ films are highly crystalline with a channeling minimum yield of 8 percent. The epitaxial relationship between the film and substrate is further confirmed by a cross-section TEM study. Epitaxial YBa2Cu3O(7-delta) thin films deposited on YSZ/sapphire have Tc and Jc of up to 89 K and 10 to the 6th A/sq cm at 77 K, respectively.

  13. Microstructural examination of a superplastic yttria-stabilized zirconia: Implications for the superplasticity mechanism

    SciTech Connect

    Primdahl, S.; Thoelen, A.; Langdon, T.G.

    1995-03-01

    A detailed microstructural examination was conducted on specimens of high purity superplastically-deformed 3Y-TZP (tetragonal ZrO{sub 2} stabilized with {approximately}3 mol.% Y{sub 2}O{sub 3}). Several of the microstructural features were similar to conventional superplastic metallic alloys including the retention of an equiaxed grain configuration, evidence for only limited dislocation activity within the grains and the concurrent development of internal cavitation. There was no detectable amorphous phase at any of the grain boundaries or at the triple junctions but there was some segregation of yttria to the boundary regions. It is concluded that there are two types of superplastic Y-TZP materials depending upon whether there is an amorphous phase at the grain boundaries. When an amorphous phase is absent, the behavior is fairly similar to superplastic metals except that an additional mechanism operates at the lower stress levels to impede grain boundary sliding.

  14. Temperature dependence of hardness in yttria-stabilized zirconia single crystals

    NASA Technical Reports Server (NTRS)

    Morscher, Gregory N.; Pirouz, Pirouz; Heuer, Arthur H.

    1991-01-01

    The temperature dependence of hardness and microcracking in single-crystal 9.5-mol pct-Y2O3-fully-stabilized cubic-ZrO2 was studied as a function of orientation. Crack lengths increased with increased temperature up to 500 C; above 800 C, no cracks were found, indicating an indentation brittle-to-ductile transition of about 800 C. The temperature dependence of hardness was reduced around 500 C. Etching studies to delineate the plastic zone around and below indents identified the operative slip systems. The role of dislocations and their interactions within the plastic zone on the hardness and indentation fracture behavior of cubic-ZrO2 are discussed.

  15. Temperature dependence of hardness in yttria-stabilized zirconia single crystals

    NASA Technical Reports Server (NTRS)

    Morscher, Gregory N.; Pirouz, Pirouz; Heuer, Arthur H.

    1991-01-01

    The temperature dependence of hardness and microcracking in single-crystal 9.5-mol pct-Y2O3-fully-stabilized cubic-ZrO2 was studied as a function of orientation. Crack lengths increased with increased temperature up to 500 C; above 800 C, no cracks were found, indicating an indentation brittle-to-ductile transition of about 800 C. The temperature dependence of hardness was reduced around 500 C. Etching studies to delineate the plastic zone around and below indents identified the operative slip systems. The role of dislocations and their interactions within the plastic zone on the hardness and indentation fracture behavior of cubic-ZrO2 are discussed.

  16. Spontaneous gradual accumulation of hexagonally-aligned nano-silica on gold nanoparticles embedded in stabilized zirconia: a pathway from catalytic to NH3-sensing performance

    NASA Astrophysics Data System (ADS)

    Plashnitsa, Vladimir V.; Elumalai, Perumal; Fujio, Yuki; Kawaguchi, Toshikazu; Miura, Norio

    2011-05-01

    The present study highlights the influence of nano-impurities on the catalytic/sensing performance of nano-structured Au sensing-electrodes (SEs) housed in a quartz reactor and operated at high temperature over a long period of time. The planar sensor, made from a nano-structured Au-SE on a polished-polycrystalline (pp) yttria-stabilized zirconia (YSZ) substrate exhibited initially negligible electromotive force (emf) response to each of the examined gases (CO, CH4, C3H8, C3H6, NOx and NH3; 400 ppm each) at 700 °C in the presence of 5 vol.% oxygen and 5 vol.% water vapor. Such a poor emf response was attributed to the excellent gas-phase oxidation/reduction ability of Au nanoparticles embedded in the YSZ substrate at high temperature. The response of the planar sensor made up of nano-structured Au-SE was monitored for about 75 days at 700 °C. As a result of this long-term monitoring, we detected the appearance of highly sensitive and selective NH3 gas-sensing properties after 45-75 days of sensor operation. Detailed observation of the morphology and composition of the as-fabricated nano-structured Au-SE after 75 days operation at 700 °C revealed the gradual accumulation of hexagonally-aligned SiO2 nano-impurities on the surface of the Au nanoparticles. The NH3 sensing mechanism of the YSZ-based sensor using the spontaneously-formed composite (nano-Au + nano-SiO2)-SE is therefore proposed to be based on a strong acid-base interaction between gaseous NH3 and SiO2 nano-impurities, followed by spillover of adsorbed NH3 towards the nano-Au/pp-YSZ interface.

  17. Flexural strengths of implant-supported zirconia based bridges in posterior regions

    PubMed Central

    Rismanchian, Mansour; Nourbakhshian, Farzaneh; Davoudi, Amin

    2014-01-01

    PURPOSE Impact forces in implant supported FDP (fixed dental prosthesis) are higher than that of tooth supported FDPs and the compositions used in frameworks also has a paramount role for biomechanical reasons. The aim of this study was to evaluate the flexural strength of two different zirconia frameworks. MATERIALS AND METHODS Two implant abutments with 3.8 mm and 4.5 mm platform were used as premolar and molar. They were mounted vertically in an acrylic resin block. A model with steel retainers and removable abutments was fabricated by milling machine; and 10 FDP frameworks were fabricated for each Biodenta and Cercon systems. All samples were thermo-cycled for 2000 times in 5-55℃ temperature and embedded in 37℃ artificial saliva for one week. The flexural test was done by a rod with 2 mm ending diameter which was applied to the multi-electromechanical machine. The force was inserted until observing fracture. The collected data were analyzed with SPSS software ver.15, using Weibull modulus and independent t-test with the level of significance at α=.05. RESULTS The mean load bearing capacity values were higher in Biodenta but with no significant differences (P>.05). The Biodenta frameworks showed higher load bearing capacity (F0=1700) than Cercon frameworks (F0=1520) but the reliability (m) was higher in Cercon (m=7.5). CONCLUSION There was no significant difference between flexural strengths of both zirconia based framework systems; and both Biodenta and Cercon systems are capable to withstand biting force (even parafunctions) in posterior implant-supported bridges with no significant differences. PMID:25352956

  18. Development of a nano-zirconia based 68Ge/68Ga generator for biomedical applications.

    PubMed

    Chakravarty, Rubel; Shukla, Rakesh; Ram, Ramu; Tyagi, Avesh Kumar; Dash, Ashutosh; Venkatesh, Meera

    2011-05-01

    Most of the commercially available (68)Ge/(68)Ga generator systems are not optimally designed for direct applications in a clinical context. We have developed a nano-zirconia based (68)Ge/(68)Ga generator system for accessing (68)Ga amenable for the preparation of radiopharmaceuticals. Nano-zirconia was synthesized by the in situ reaction of zirconyl chloride with ammonium hydroxide in alkaline medium. The physical characteristics of the material were studied by various analytical techniques. A 740 MBq (20 mCi) (68)Ge/(68)Ga generator was developed using this sorbent and its performance was evaluated for a period of 1 year. The suitability of (68)Ga for labeling biomolecules was ascertained by labeling DOTA-TATE with (68)Ga. The material synthesized was nanocrystalline with average particle size of ~7 nm, pore-size of ~4 Å and a high surface area of 340±10 m(2) g(-1). (68)Ga could be regularly eluted from this generator in 0.01N HCl medium with an overall radiochemical yield >80% and with high radionuclidic (<10(-5)% of (68)Ge impurity) and chemical purity (<0.1 ppm of Zr, Fe and Mn ions). The compatibility of the product for preparation of (68)Ga-labeled DOTA-TATE under the optimized reaction conditions was found to be satisfactory in terms of high labeling yields (>99%). The generator gave a consistent performance with respect to the elution yield and purity of (68)Ga over a period of 1 year. The feasibility of preparing an efficient (68)Ge/(68)Ga generator which can directly be used for biomedical applications has been demonstrated. Copyright © 2011 Elsevier Inc. All rights reserved.

  19. Fracture Strength of Aged Monolithic and Bilayer Zirconia-Based Crowns.

    PubMed

    Lameira, Deborah Pacheco; Buarque e Silva, Wilkens Aurélio; Andrade e Silva, Frederico; De Souza, Grace M

    2015-01-01

    The purpose of this study was to evaluate the effect of design and surface finishing on fracture strength of yttria-tetragonal zirconia polycrystal (Y-TZP) crowns in monolithic (1.5 mm thickness) and bilayer (0.8 mm zirconia coping and 0.7 mm porcelain veneer) configuration after artificial aging. Bovine incisors received crown preparation and Y-TZP crowns were manufactured using CAD/CAM technique, according to the following groups (n = 10): Polished monolithic zirconia crowns (PM); Glazed monolithic zirconia crowns (GM); Bi-layer crowns (BL). Crowns were cemented with resin cement, submitted to artificial aging in a chewing simulator (2.5 million cycles/80 N/artificial saliva/37 °C), and tested for fracture strength. Two remaining crowns referring to PM and GM groups were submitted to a chemical composition analysis to measure the level of yttrium after aging. One-way ANOVA and Tukey's test (P = .05) indicated that monolithic zirconia crowns presented similar fracture strength (PM = 3476.2 N ± 791.7; GM = 3561.5 N ± 991.6), which was higher than bilayer crowns (2060.4 N ± 810.6). There was no difference in the yttrium content among the three surfaces evaluated in the monolithic crowns. Thus, monolithic zirconia crowns present higher fracture strength than bilayer veneered zirconia after artificial aging and surface finishing does not affect their fracture strength.

  20. Fracture resistance of zirconia-composite veneered crowns in comparison with zirconia-porcelain crowns.

    PubMed

    Alsadon, Omar; Patrick, David; Johnson, Anthony; Pollington, Sarah; Wood, Duncan

    2017-02-11

    The objectives were to evaluate the fracture resistance and stress concentration in zirconia/composite veneered crowns in comparison to zirconia/porcelain crowns using occlusal fracture resistance and by stress analysis using finite element analysis method. Zirconia substructures were divided into two groups based on the veneering material. A static load was applied occlusally using a ball indenter and the load to fracture was recorded in Newtons (N). The same crown design was used to create 3D crown models and evaluated using FEA. The zirconia/composite crowns subjected to static occlusal load showed comparable results to the zirconia/porcelain crowns. Zirconia/composite crowns showed higher stress on the zirconia substructure at 63.6 and 50.9 MPa on the zirconia substructure veneered with porcelain. In conclusion, zirconia/composite crowns withstood high occlusal loads similar to zirconia/porcelain crowns with no significant difference. However, the zirconia/composite crowns showed higher stress values than the zirconia/porcelain crowns at the zirconia substructure.

  1. Bacterial adhesion and biofilm formation on yttria-stabilized, tetragonal zirconia and titanium oral implant materials with low surface roughness - an in situ study.

    PubMed

    Al-Ahmad, Ali; Karygianni, Lamprini; Schulze Wartenhorst, Max; Bächle, Maria; Hellwig, Elmar; Follo, Marie; Vach, Kirstin; Han, Jung-Suk

    2016-04-19

    Bacterially-driven mucosal inflammation and the development of periimplantitis can lead to oral implant failure. In this study, initial bacterial adhesion after 2 h and biofilm formation after 1 day and 3 days were analyzed in situ on novel 3 mol% yttria-stabilized tetragonal zirconia polycrystal samples (Zr; 3Y-TZP), as well as on alumina and niobium co-doped yttria-stabilized tetragonal zirconia samples (Al-Zr; Al2O3/Y(Nb)-TZP). Pure titanium implant material (Ti) and bovine enamel slabs (BES) served as controls. The initially adherent oral bacteria were determined by DAPI-staining. Biofilm thickness, surface covering grade and content of oral streptococci within the biofilm were measured by fluorescence in situ hybridization. No significant differences between the ceramic and titanium surfaces were detectable for either initial bacterial adhesion or the oral streptococci content of the in situ biofilm. The values of oral biofilm thickness on the implant surfaces were almost doubled after three days compared to the first day of oral exposure. Nevertheless, the biofilm thickness values among the different implant surfaces and controls did not differ significantly for any time point of measurement after 1 day or 3 days of biofilm formation. Significant differences in the covering grade were only detected between day 1 and day 3 for each tested implant material group. The content of oral streptococci increased significantly in parallel with the increase of biofilm age from day 1 to day 3. In conclusion, oral implant zirconia surfaces with low surface roughness are comparable to titanium surfaces with regard to initial bacterial adhesion and biofilm formation.

  2. Manganese Oxide Formation in Lanthanum Strontium Manganite-Yttria-Stabilized Zirconia SOFC Cathodes

    NASA Astrophysics Data System (ADS)

    Wang, Hsiang-Jen; De Guire, Mark R.; Xing, Zhengliang; Agnew, Gerry; Goettler, Richard; Liu, Zhien; Heuer, Arthur H.

    2014-09-01

    Microstructural changes in the cathode adjacent to the cathode-electrolyte interface were studied in SOFCs with lanthanum strontium manganite (LSM)/Y2O3-stabilized ZrO2 (YSZ) composite cathodes after long-term operation (1.3 to 2.0 kh) with steam (1 to 3 pct H2O) added to the cathode gas. We specifically sought to understand why the degradation rate (the increase of area specific resistance with time) was markedly higher at lower temperatures ( e.g., 1073 K (800 °C)) than at higher temperatures ( e.g., 1198 K (925 °C)). Transmission electron microscopy, combined with X-ray energy-dispersive spectroscopy and electron energy-loss spectroscopy, was used to detect and identify submicron MnxOy precipitates. The particles were shown to be Mn3O4 in cells operated at 1198 K (925 °C), and both Mn3O4 and Mn2O3 in cells operated at 1073 K (800 °C). In a cell exposed for 5 kh at 1198 K (925 °C) to a cathode atmosphere of 1.1 pct H2O at 4 bara, MnxOy precipitates were uniformly distributed across the cathode. On the other hand, in an identical cell exposed to the same conditions but operated continuously at 380 mA cm-2, MnxOy precipitates were observed almost exclusively within about 3 µm of the electrolyte/cathode interface. Whether MnxOy formation is causative or simply correlative with the steam effect remains an important question for future work.

  3. Comparative evaluation of shear bond strengths of veneering porcelain to base metal alloy and zirconia substructures before and after aging – An in vitro study

    PubMed Central

    Sreekala, Laju; Narayanan, Mahesh; Eerali, Sunil M.; Eerali, Susil M.; Varghese, Joju; Zainaba Fathima, A. l.

    2015-01-01

    Objective: The aim of this study was to evaluate and compare the shear bond strength of veneering porcelain to base metal alloy and zirconia substructures before and after aging. Scanning electron microscopy (SEM) was used to determine the failure pattern. Materials and Methods: Twenty rectangular blocks (9 mm length × 4 mm height × 4 mm width) of base metal alloy (Bellabond plus, Bego, Germany) and zirconia (Will ceramZ zirconia K block) were fabricated for shear bond strength test. Surface of the base metal alloy block (4 mm × 4 mm area) was veneered with corresponding veneering porcelain (Ivoclar, IPS classic, vivadent). Similarly, surface of the zirconia rectangular block (4 mm × 4 mm) was veneered with corresponding veneering ceramic (Cercon ceram kiss, Degudent). Out of forty rectangular porcelain veneered core specimen, ten porcelain veneered base metal alloy specimen and ten porcelain veneered zirconia specimen were immersed in water at 37°C for one month to simulate the oral environment. Results: On comparison, the highest shear bond strength value was obtained in porcelain veneered base metal alloy before aging group followed by porcelain veneered base metal alloy after aging group, Porcelain veneered zirconia before aging group, porcelain veneered zirconia after aging group. SEM analysis revealed predominantly cohesive failure of veneering ceramic in all groups. Conclusion: Porcelain veneered base metal alloy samples showed highest shear bond strength than porcelain veneered zirconia samples. Study concluded that aging had an influence on shear bond strength. Shear bond strength was found to be decreasing after aging. SEM analysis revealed cohesive failure of veneering ceramic in all groups suggestive of higher bond strength of the interface than cohesive strength of ceramic. Hence, it was concluded that veneering ceramic was the weakest link. PMID:26942121

  4. Evaluation of resin bond strength to yttria-stabilized tetragonal zirconia and framework marginal fit: comparison of different surface conditionings.

    PubMed

    Vanderlei, A; Bottino, M A; Valandro, L F

    2014-01-01

    The purpose of this study was to evaluate the effect of different surface treatments of yttria-stabilized tetragonal zirconia (Y-TZP) on bond strength durability and marginal discrepancies. For adhesion testing, 144 specimens of VITA In-Ceram YZ ceramic for InLab were obtained (5.25×3.75×4.5 mm) and divided into six groups (n=24) according to the surface treatment: 1) Control (CRTL): untreated; 2) SIL: tribochemical silica coating (CoJet system, 3M/ESPE AG); 3) V1+HF: spray application of low-fusing porcelain glaze (V1, VITA Akzent Spray Glaze) followed by etching with hydrofluoric acid (HF) (one minute); 4) V1+SIL: V1 glazing (VITA Akzent Spray Glaze) followed by tribochemical silica coating; 5) V2+HF: brush application of low-fusing porcelain glaze (VITA Akzent Glaze) plus etching with HF (one minute); and 6) V2+SIL: V2 glazing (VITA Akzent Glaze) plus tribochemical silica coating. After all treatments, the surfaces were silanized for five minutes (ESPE-SIL) and cementation was performed using Panavia F (Kuraray). Half of the specimens in each treatment were tested 24 hours after cementation (dry), with the other half subjected to storage (150 days) and thermocycling (12,000×) (aging), and then a shear test was carried out (1 mm/min). The micromorphological (digital optical profilometry and scanning electron microscopy) and elemental analyses of the treated surfaces were performed. The inner surfaces of 60 Y-TZP infrastructures were conditioned and marginal fit was evaluated. The statistical analysis revealed that the groups treated via surface glaze application followed by hydrofluoric acid etching and silanization showed the highest bond strength (in dry and aging conditions), but the bond strengths were affected by aging. The highest marginal discrepancies were observed in the groups receiving glaze (117.4 ± 29.6 to 105.8 ± 12.2 μm) when compared to other groups (55.3 ± 8.7 and 55 ± 8.5 μm). Low-fusing porcelain glaze + hydrofluoric acid etching

  5. Evaluation of the optical properties of CAD-CAM generated yttria-stabilized zirconia and glass-ceramic laminate veneers.

    PubMed

    Alghazzawi, Tariq F; Lemons, Jack; Liu, Perng-Ru; Essig, Milton E; Janowski, Gregg M

    2012-05-01

    When feldspathic porcelain (FP) laminate veneers are used to mask tooth discoloration that extends into the dentin, significant tooth reduction is needed to provide space for the opaque layer and optimize the bonding of the restoration. The purpose of this study was to investigate the color effect of trial insertion paste (TP), composite resin abutment (CRA), and veneer regions on the optical properties of feldspathic porcelain (FP), yttria-stabilized zirconia (Y-TZP), and IPS e.max CAD HT (IEC) veneers. A melamine tooth was prepared for a laminate veneer on a model, and a definitive cast was made. The definitive die was scanned by using the TurboDent System (TDS), then 30 CRA were machined and 10 veneers were fabricated for each ceramic material (FP, Y-TZP, IEC). The optical properties of different veneer materials, CRA (A(1), A(2), A(3)) and TP (bleach XL, opaque white, transparent, and yellow) were evaluated in the cervical, body, and incisal regions with a spectrophotometer. Results were analyzed by using 1-way ANOVA (.05). The color difference for all the veneers was affected by TP and CRA colors in different regions. The mean values for the Y-TZP veneer color coordinates (L*: 74 ±0.34, a*: 0.09 ±0.20, and b*: 17.43 ±0.44) were significantly different (P<.001) from those of IEC veneers (L*: 70.15 ±0.23, a*: -0.69 ±0.073, and b*:11.48 ±0.30) and FP veneers (L*: 70.00 ±0.86, a*: - 0.28 ±0.203, and b*: 13.86 ±1.08). There was no difference between IEC for L* and FP. Significant difference was detected (P<.001) in color coordinates among the 3 veneer materials for a* and b*. The TP color affected the color difference for all veneer materials except the Y-TZP, while there was no effect on the CRA color. The magnitude of color coordinates changed as a function of TP color and veneer material. Copyright © 2012 The Editorial Council of the Journal of Prosthetic Dentistry. Published by Mosby, Inc. All rights reserved.

  6. Cell attachment and proliferation of bone marrow-derived osteoblast on zirconia of various surface treatment

    PubMed Central

    Lee, Heesu; Noh, Kwantae; Woo, Yi-Hyung

    2014-01-01

    PURPOSE This study was performed to characterize the effects of zirconia coated with calcium phosphate and hydroxyapatite compared to smooth zirconia after bone marrow-derived osteoblast culture. MATERIALS AND METHODS Bone marrow-derived osteoblasts were cultured on (1) smooth zirconia, (2) zirconia coated with calcium phosphate (CaP), and (3) zirconia coated with hydroxyapatite (HA). The tetrazolium-based colorimetric assay (MTT test) was used for cell proliferation evaluation. Scanning electron microscopy (SEM) and alkaline phosphatase (ALP) activity was measured to evaluate the cellular morphology and differentiation rate. X-ray photoelectron spectroscopy (XPS) was employed for the analysis of surface chemistry. The genetic expression of the osteoblasts and dissolution behavior of the coatings were observed. Assessment of the significance level of the differences between the groups was done with analysis of variance (ANOVA). RESULTS From the MTT assay, no significant difference between smooth and surface coated zirconia was found (P>.05). From the SEM image, cells on all three groups of discs were sporadically triangular or spread out in shape with formation of filopodia. From the ALP activity assay, the optical density of osteoblasts on smooth zirconia discs was higher than that on surface treated zirconia discs (P>.05). Most of the genes related to cell adhesion showed similar expression level between smooth and surface treated zirconia. The dissolution rate was higher with CaP than HA coating. CONCLUSION The attachment and growth behavior of bone-marrow-derived osteoblasts cultured on smooth surface coated zirconia showed comparable results. However, the HA coating showed more time-dependent stability compared to the CaP coating. PMID:24843393

  7. Yttria-stabilized zirconia solid oxide electrolyte fuel cells--- monolithic solid oxide fuel cells

    SciTech Connect

    Not Available

    1990-10-01

    The monolithic solid oxide fuel cell (MSOFC) is currently under development for a variety of applications including coal-based power generation. The MSOFC is a design concept that places the thin components of a solid oxide fuel cell in lightweight, compact, corrugated structure, and so achieves high efficiency and excellent performance simultaneously with high power density. The MSOFC can be integrated with coal gasification plants and is expected to have high overall efficiency in the conversion of the chemical energy of coal to electrical energy. This report describes work aimed at (1) assessing manufacturing costs for the MSOFC and system costs for a coal-based plant; (2) modifying electrodes and electrode/electrolyte interfaces to improve the electrochemical performance of the MSOFC; and (3) testing the performance of the MSOFC on hydrogen and simulated coal gas. Manufacturing costs for both the coflow and crossflow MSOFC's were assessed based on the fabrication flow charts developed by direct scaleup of tape calendering and other laboratory processes. Integrated coal-based MSOFC systems were investigated to determine capital costs and costs of electricity. Design criteria were established for a coal-fueled 200-Mw power plant. Four plant arrangements were evaluated, and plant performance was analyzed. Interfacial modification involved modification of electrodes and electrode/electrolyte interfaces to improve the MSOFC electrochemical performance. Work in the cathode and cathode/electrolyte interface was concentrated on modification of electrode porosity, electrode morphology, electrode material, and interfacial bonding. Modifications of the anode and anode/electrolyte interface included the use of additives and improvement of nickel distribution. Single cells have been tested for their electrochemical performance. Performance data were typically obtained with humidified H{sub 2} or simulated coal gas and air or oxygen. 68 figs., 29 tabs.

  8. Preparation and properties evaluation of zirconia-based/Al(sub 2)O(sub 3) composites electrolytes for solid oxide fuel cell systems part II sintering behaviour and microstructural development

    NASA Astrophysics Data System (ADS)

    Navarro, L. M.; Recio, P.; Duran, P.

    1995-04-01

    The compaction behavior of ultrafine yttria-doped zirconia powders (6-8 nm) without and with alumina additions (0 to 20 wt%) has been studied. From the pore size distribution and using isothermal and nonisothermal techniques, the sintering behavior of zirconia compacts in the temperature range 800-1500 C was studied. It was found that alumina additions (up to 10 wt%) enhanced the zirconia compacts' densification process and, above that alumina content, that process was retarded. Alumina additions did not affect the grain grown process in tetragonal zirconia samples. However, this was strongly hindered in the fully stabilized zirconia ones. The results were compared with those obtained in the same experimental conditions on a commercial zirconia powder.

  9. Modeling of gas transport with electrochemical reaction in nickel-yttria-stabilized zirconia anode during thermal cycling by Lattice Boltzmann method

    NASA Astrophysics Data System (ADS)

    Guo, Pengfei; Guan, Yong; Liu, Gang; Liang, Zhiting; Liu, Jianhong; Zhang, Xiaobo; Xiong, Ying; Tian, Yangchao

    2016-09-01

    This work reports an investigation of the impact of microstructure on the performance of solid oxide fuel cells (SOFC) composed of nickel yttria-stabilized zirconia (Ni YSZ). X-ray nano computed tomography (nano-CT) was used to obtain three-dimensional (3D) models of Ni-YSZ composite anode samples subjected to different thermal cycles. Key parameters, such as triple phase boundary (TPB) density, were calculated using 3D reconstructions. The electrochemical reaction occurring at active-TPB was modeled by the Lattice Boltzmann Method for simulation of multi-component mass transfer in porous anodes. The effect of different electrode geometries on the mass transfer and the electrochemical reaction in anodes was studied by TPB distributions measured by nano CT for samples subjected to different thermal cycles. The concentration polarization and the activation polarization were estimated respectively. The results demonstrate that a combined approach involving nano-CT experiments in conjunction with simulations of gas transport and electrochemical reactions using the Lattice Boltzmann method can be used to better understand the relationship between electrode microstructure and performance of nickel yttria-stabilized zirconia anodes.

  10. How to Bond Zirconia: The APC Concept.

    PubMed

    Blatz, Markus B; Alvarez, Marcela; Sawyer, Kimiyo; Brindis, Marco

    2016-10-01

    Zirconia has become one of the most popular materials in dentistry. New high-translucent zirconia ceramics have favorable optical properties and can be applied as monolithic full-contour restorations in various clinical indications for posterior and anterior teeth. However, having reliable cementation protocols is fundamental for clinical success of indirect ceramic dental restorations, including those made from zirconia materials. Resin bonding supports ceramic restorations and is necessary for onlays, laminate veneers, and resinbonded fixed dental prostheses. The APC zirconia-bonding concept is based on decades of research on how to achieve high and long-term durable bond strengths to high-strength ceramics. It includes three practical steps: (A) airparticle abrasion, (P) zirconia primer, and (C) adhesive composite resin. This article discusses the history and development of high-translucent zirconia and explains the necessity for proper cementation. The rationale and science behind a simplified zirconia-bonding concept is explained and illustrated with a clinical case presentation.

  11. Selective enrichment of the degradation products of organophosphorus nerve agents by zirconia based solid-phase extraction.

    PubMed

    Kanaujia, Pankaj K; Pardasani, Deepak; Tak, Vijay; Purohit, Ajay K; Dubey, D K

    2011-09-23

    Selective extraction and enrichment of nerve agent degradation products has been achieved using zirconia based commercial solid-phase extraction cartridges. Target analytes were O-alkyl alkylphosphonic acids and alkylphosphonic acids, the environmental markers of nerve agents such as sarin, soman and VX. Critical extraction parameters such as modifier concentration, nature and volume of washing and eluting solvents were investigated. Amongst other anionic compounds, selectivity in extraction was observed for organophosphorus compounds. Recoveries of analytes were determined by GC-MS which ranged from 80% to 115%. Comparison of zirconia based solid-phase extraction method with anion-exchange solid-phase extraction revealed its selectivity towards phosphonic acids. The limits of detection (LOD) and limit of quantification (LOQ) with selected analytes were achieved down to 4.3 and 8.5 ng mL(-1), respectively, in selected ion monitoring mode.

  12. Role of temperature in the radiation stability of yttria stabilized zirconia under swift heavy ion irradiation: A study from the perspective of nuclear reactor applications

    NASA Astrophysics Data System (ADS)

    Kalita, Parswajit; Ghosh, Santanu; Sattonnay, Gaël; Singh, Udai B.; Grover, Vinita; Shukla, Rakesh; Amirthapandian, S.; Meena, Ramcharan; Tyagi, A. K.; Avasthi, Devesh K.

    2017-07-01

    The search for materials that can withstand the harsh radiation environments of the nuclear industry has become an urgent challenge in the face of ever-increasing demands for nuclear energy. To this end, polycrystalline yttria stabilized zirconia (YSZ) pellets were irradiated with 80 MeV Ag6+ ions to investigate their radiation tolerance against fission fragments. To better simulate a nuclear reactor environment, the irradiations were carried out at the typical nuclear reactor temperature (850 °C). For comparison, irradiations were also performed at room temperature. Grazing incidence X-ray diffraction and Raman spectroscopy measurements reveal degradation in crystallinity for the room temperature irradiated samples. No bulk structural amorphization was however observed, whereas defect clusters were formed as indicated by transmission electron microscopy and supported by thermal spike simulation results. A significant reduction of the irradiation induced defects/damage, i.e., improvement in the radiation tolerance, was seen under irradiation at 850 °C. This is attributed to the fact that the rapid thermal quenching of the localized hot molten zones (arising from spike in the lattice temperature upon irradiation) is confined to 850 °C (i.e., attributed to the resistance inflicted on the rapid thermal quenching of the localized hot molten zones by the high temperature of the environment) thereby resulting in the reduction of the defects/damage produced. Our results present strong evidence for the applicability of YSZ as an inert matrix fuel in nuclear reactors, where competitive effects of radiation damage and dynamic thermal healing mechanisms may lead to a strong reduction in the damage production and thus sustain its physical integrity.

  13. Effect of artificial saliva and pH on shear bond strength of resin cements to zirconia-based ceramic.

    PubMed

    Geramipanah, F; Majidpour, M; Sadighpour, L; Fard, M J Kharazi

    2013-03-01

    The aim of the present study was to evaluate the effect of media with different pH on shear and strength of resin cements to zirconia-based ceramics. Sixty rectangularly shaped specimens made of a zirconia based ceramic (Cercon, Dentsply) were prepared, air-blasted with 110 microm aluminum oxide particles (Al203) and randomly assigned into three groups (n = 30). A universal resin composite (Filtek Z250, 3M/ESPE) was bonded to each specimen using one of the following three cements: Calibra (Dentsply), Panavia F2 (kurary) and Unicem (3M/ESPE). Specimens were thermal cycled and stored in one of the following three media for two weeks: water at pH = 7, saliva at pH = 7 and saliva at pH = 3.5. The mean shear bond strength of each group was analyzed using the Kruskal-Wallis test (alpha = 0.05). The modes of failure were recorded using a streomicroscope. All specimens in the Calibra groups showed premature debonding. No significant difference was found between the two other cements or different media. The failure modes in the two latter cements were predominantly adhesive. Despite the adverse effect of acidic media on the properties of restorative materials, the media did not significantly influence the bond strength of MDP-containing resin cement and a self-adhesive cement to a zirconia- based ceramic.

  14. Proliferation and osteogenic response of MC3T3-E1 pre-osteoblastic cells on porous zirconia ceramics stabilized with magnesia or yttria.

    PubMed

    Hadjicharalambous, Chrystalleni; Mygdali, Evdokia; Prymak, Oleg; Buyakov, Ales; Kulkov, Sergei; Chatzinikolaidou, Maria

    2015-11-01

    Dense zirconia ceramics are used in bone applications due to their mechanical strength and biocompatibility, but lack osseointegration. A porous interface in contact with bone tissue may lead to better bone bonding but the biological properties of porous zirconia are not widely explored. The present study focuses on the manufacturing of an yttria- (YSZ) and a magnesia-stabilized (MgSZ) porous zirconia, and on their in vitro biological investigation. The sintered ceramics had similar characteristics of porosity, pore size and interconnectivity. Their elastic moduli and compressive strength values were within the range of the values of human cortical bone. MC3T3-E1 pre-osteoblasts were used to investigate the proliferation, alkaline phosphatase (ALP) activity, collagen deposition and expression profile of four genes involved in bone metabolism of cells on porous ceramics. Scanning electron and fluorescence microscopy were employed to visualize cell morphology and growth. Pre-osteoblasts adhered well on both ceramics but cell numbers on YSZ were higher. Cells exhibited an increase in ALP activity and collagen deposition after 14 days on both MgSZ and YSZ, with higher levels on YSZ. Real-time quantitative polymerase chain reaction (qPCR) showed that the expression of bone sialoprotein (Bsp) and collagen type I (col1aI) were significantly higher on YSZ. No significant differences were found in their ability to regulate the early gene expression of Runx2 and Alp. Nevertheless, the biomineralized calcium content was similar on both ceramics after 21 days, indicating that despite chemical differences, both scaffolds direct the pre-osteoblasts toward a mature state capable of mineralizing the extracellular matrix.

  15. Zirconia-based dental crown to support a removable partial denture: a three-dimensional finite element analysis using contact elements and micro-CT data.

    PubMed

    Rocha, Eduardo Passos; Anchieta, Rodolfo Bruniera; de Almeida, Erika Oliveira; Freitas, Amilcar Chagas; Martini, Ana Paula; Sotto-Maior, Bruno Sales; Luersen, Marco Antonio; Ko, Ching Chang

    2015-01-01

    Veneer fracture is the most common complication in zirconia-based restorations. The aim of this study was to evaluate the mechanical behavior of a zirconia-based crown in a lower canine tooth supporting removable partial denture (RPD) prosthesis, varying the bond quality of the veneer/coping interface. Microtomography (μCT) data of an extracted left lower canine were used to build the finite element model (M) varying the core material (gold core - MAu; zirconia core - MZi) and the quality of the veneer/core interface (complete bonded - MZi; incomplete bonded - MZi-NL). The incomplete bonding condition was only applied for zirconia coping by using contact elements (Target/Contact) with 0.3 frictional coefficients. Stress fields were obtained using Ansys Workbench 10.0. The loading condition (L = 1 N) was vertically applied at the base of the RPD prosthesis metallic support towards the dental apex. Maximum principal (σmax) and von Mises equivalent (σvM) stresses were obtained. The σmax (MPa) for the bonded condition was similar between gold and zirconia cores (MAu, 0.42; MZi, 0.40). The incomplete bonded condition (MZi-NL) raised σmax in the veneer up to 800% (3.23 MPa) in contrast to the bonded condition. The peak of σvM increased up to 270% in the MZi-NL. The incomplete bond condition increasing the stress in the veneer/zirconia interface.

  16. Solubility and strength of zirconia-based dental materials after artificial aging.

    PubMed

    Kvam, Ketil; Karlsson, Stig

    2013-10-01

    Advanced high-strength dental ceramics based on zirconium oxide are widely used for dental restorations. However, their durability in liquids has been questioned. The purpose of this study was to compare the flexure strength of zirconium dioxide materials designed for different sintering techniques before and after surface exposure to an acidic solution and to correlate the dissolution of the materials with strength data. An accelerated aging test, immersion in hot (80°C) 4 vol% acetic acid was used to study the solubility of elements from the surface and the effect on the strength of 3 dental zirconia products: DY: Y-TZP material, milled in HIPed state (Denzir); DM: Mg-PSZ material, milled in dense-sintered state (Denzir M); and CY: Y-TZP material, milled from presintered block and then dense-sintered (Cercon base). Disks were prepared with a surface conditioning as for copings provided for dental restorations. After immersion for 1 week, the liquid was analyzed for a range of elements with ICP-MS. Biaxial flexure strength was measured for 3 samples (n=15) of each material: ground on a 20 µm diamond disk without immersion; after 1 week's immersion in acetic acid; and after 1 week's immersion, grinding, and 1 more week in acid. Fracture probability was analyzed by maximum likelihood attribution of individual measurements to 1 or 2 Weibull distributions, each with 2 free parameters. Dissolution was found to be limited. The total mass loss was less than 0.7 µg/cm(2) for Y-TZP and 3.5 µg/cm(2) for Mg-PSZ. The mean strength was reduced for all materials after immersion in the fluid. Weibull statistics revealed 2 fracture mechanisms in Y-TZP milled in fully sintered condition. For DY only, 2 distributions significantly (P>.99) improved the description of individual treatment data. Y-TZP materials showed the highest biaxial flexure strength. Immersion for 1 week in hot 4 vol% acetic acid weakened all 3 zirconia materials by 100 to 200 MPa. Milling in the presintered

  17. Assessment of the performance of Ni-yttria-stabilized zirconia anodes in anode-supported Solid Oxide Fuel Cells operating on H 2-CO syngas fuels

    NASA Astrophysics Data System (ADS)

    Ye, Xiao-Feng; Wang, S. R.; Zhou, J.; Zeng, F. R.; Nie, H. W.; Wen, T. L.

    Anode-supported Solid Oxide Fuel Cells (SOFCs) with Ni-yttria-stabilized zirconia (YSZ) anode have been fabricated and studied using H 2-CO syngas fuels. Syngas fuels with different compositions of H 2-CO are supplied and the cell performance is measured at 750 °C. A high CO content has caused carbon deposition and crack formation in the Ni-YSZ anode after long-term operation, even though it is diluted with H 2O and N 2. However, it was found that a Cu-CeO 2 coating on Ni-YSZ can greatly improve the anode stability in syngas by facilitating the water gas shift reaction. The optimized single cell has run in sygas with a composition of 65%H 2-32%CO-3%H 2O for 1050 h without obvious degradation of its performance.

  18. Zirconia supported catalysts for bioethanol steam reforming: Effect of active phase and zirconia structure

    NASA Astrophysics Data System (ADS)

    Benito, M.; Padilla, R.; Rodríguez, L.; Sanz, J. L.; Daza, L.

    Three new catalysts have been prepared in order to study the active phase influence in ethanol steam reforming reaction. Nickel, cobalt and copper were the active phases selected and were supported on zirconia with monoclinic and tetragonal structure, respectively. To characterize the behaviour of the catalysts in reaction conditions a study of catalytic activity with temperature was performed. The highest activity values were obtained at 973 K where nickel and cobalt based catalysts achieved an ethanol conversion of 100% and a selectivity to hydrogen close to 70%. Nickel supported on tetragonal zirconia exhibited the highest hydrogen production efficiency, higher than 4.5 mol H 2/mol EtOH fed. The influence of steam/carbon (S/C) ratio on product distribution was another parameter studied between the range 3.2-6.5. Nickel supported on tetragonal zirconia at S/C = 3.2 operated at 973 K without by-product production such as ethylene or acetaldehyde. In order to consider a further application in an ethanol processor, a long-term reaction experiment was performed at 973 K, S/C = 3.2 and atmospheric pressure. After 60 h, nickel supported on tetragonal zirconia exhibited high stability and selectivity to hydrogen production.

  19. The bending stress distribution in bilayered and graded zirconia-based dental ceramics

    PubMed Central

    Fabris, Douglas; Souza, Júlio C.M.; Silva, Filipe S.; Fredel, Márcio; Mesquita-Guimarães, Joana; Zhang, Yu; Henriques, Bruno

    2016-01-01

    The purpose of this study was to evaluate the biaxial flexural stresses in classic bilayered and in graded zirconia-feldspathic porcelain composites. A finite element method and an analytical model were used to simulate the piston-on-ring test and to predict the biaxial stress distributions across the thickness of the bilayer and graded zirconia-feldspathic porcelain discs. An axisymmetric model and a flexure formula of Hsueh et al. were used in the FEM and analytical analysis, respectively. Four porcelain thicknesses were tested in the bilayered discs. In graded discs, continuous and stepwise transitions from the bottom zirconia layer to the top porcelain layer were studied. The resulting stresses across the thickness, measured along the central axis of the disc, for the bilayered and graded discs were compared. In bilayered discs, the maximum tensile stress decreased while the stress mismatch (at the interface) increased with the porcelain layer thickness. The optimized balance between both variables is achieved for a porcelain thickness ratio in the range of 0.30–0.35. In graded discs, the highest tensile stresses were registered for porcelain rich interlayers (p=0.25) whereas the zirconia rich ones (p=8) yield the lowest tensile stresses. In addition, the maximum stresses in a graded structure can be tailored by altering compositional gradients. A decrease in maximum stresses with increasing values of p (a scaling exponent in the power law function) was observed. Our findings showed a good agreement between the analytical and simulated models, particularly in the tensile region of the disc. Graded zirconia-feldspathic porcelain composites exhibited a more favourable stress distribution relative to conventional bilayered systems. This fact can significantly impact the clinical performance of zirconia-feldspathic porcelain prostheses, namely reducing the fracture incidence of zirconia and the chipping and delamination of porcelain. PMID:28104926

  20. Fracture Strength of Aged Monolithic and Bilayer Zirconia-Based Crowns

    PubMed Central

    Lameira, Deborah Pacheco; Silva, Wilkens Aurélio Buarque e; Silva, Frederico Andrade e; De Souza, Grace M.

    2015-01-01

    The purpose of this study was to evaluate the effect of design and surface finishing on fracture strength of yttria-tetragonal zirconia polycrystal (Y-TZP) crowns in monolithic (1.5 mm thickness) and bilayer (0.8 mm zirconia coping and 0.7 mm porcelain veneer) configuration after artificial aging. Bovine incisors received crown preparation and Y-TZP crowns were manufactured using CAD/CAM technique, according to the following groups (n = 10): Polished monolithic zirconia crowns (PM); Glazed monolithic zirconia crowns (GM); Bi-layer crowns (BL). Crowns were cemented with resin cement, submitted to artificial aging in a chewing simulator (2.5 million cycles/80 N/artificial saliva/37°C), and tested for fracture strength. Two remaining crowns referring to PM and GM groups were submitted to a chemical composition analysis to measure the level of yttrium after aging. One-way ANOVA and Tukey's test (P = .05) indicated that monolithic zirconia crowns presented similar fracture strength (PM = 3476.2 N ± 791.7; GM = 3561.5 N ± 991.6), which was higher than bilayer crowns (2060.4 N ± 810.6). There was no difference in the yttrium content among the three surfaces evaluated in the monolithic crowns. Thus, monolithic zirconia crowns present higher fracture strength than bilayer veneered zirconia after artificial aging and surface finishing does not affect their fracture strength. PMID:26576423

  1. The clinical success of tooth- and implant-supported zirconia-based fixed dental prostheses. A systematic review.

    PubMed

    Le, M; Papia, E; Larsson, C

    2015-06-01

    The aim was to make an inventory of the current literature on the clinical performance of tooth- or implant-supported zirconia-based FDPs and analyse and discuss any complications. Electronic databases, PubMed.gov, Cochrane Library and Science Direct, were searched for original studies reporting on the clinical performance of tooth- or implant-supported zirconia-based FDPs. The electronic search was complemented by manual searches of the bibliographies of all retrieved full-text articles and reviews, as well as a hand search of the following journals: International Journal of Prosthodontics, Journal of Oral Rehabilitation, International Journal of Oral & Maxillofacial Implants and Clinical Oral Implants Research. The search yielded 4253 titles. Sixty-eight potentially relevant full-text articles were retrieved. After applying pre-established criteria, 27 studies were included. Twenty-three studies reported on tooth-supported and 4 on implant-supported FDPs. Five of the studies were randomised, comparing Y-TZP-based restorations with metal-ceramic or other all-ceramic restorations. Most tooth-supported FDPs were FDPs of 3-5 units, whereas most implant-supported FDPs were full arch. The majority of the studies reported on 3- to 5-year follow-up. Life table analysis revealed cumulative 5-year survival rates of 93.5% for tooth-supported and 100% for implant-supported FDPs. For tooth-supported FDPs, the most common reasons for failure were veneering material fractures, framework fractures and caries. Cumulative 5-year complication rates were 27.6% and 30.5% for tooth- and implant-supported FDPs, respectively. The most common complications were veneering material fractures for tooth- as well as implant-supported FDPs. Loss of retention occurred more frequently in FDPs luted with zinc phosphate or glass-ionomer cement compared to those luted with resin cements. The results suggest that the 5-year survival rate is excellent for implant-supported zirconia-based FDPs

  2. Characterization and bioactive properties of zirconia based polymeric hybrid for orthopedic applications.

    PubMed

    Thomas, Nathan P; Tran, Nhiem; Tran, Phong A; Walters, Jerry L; Jarrell, John D; Hayda, Roman A; Born, Christopher T

    2014-02-01

    Zirconia is a transition metal oxide with current applications to orthopedic implants. It has been shown to up-regulate specific genes involved in bio-integration and injury repair. This study examines the effects of zirconia and polydimethylsiloxane (PDMS) hybrids on the proliferation and viability of human primary osteoblast and fibroblast cells. In this study, zirconia-PDMS hybrid coatings were synthesized using a modified sol gel process. The hybrid material was characterized using optical microscopy, scanning electron microscopy, X-ray photoelectron spectroscopy, and contact angle analysis. This study demonstrates that Zr-PMDS surface materials display hydrophobic surface properties coupled with a preferential deposition of polymer near the surface. Primary osteoblast and fibroblast proliferation and viability on hybrid coated surfaces were evaluated via a rapid screening methodology using WST-1 and calcein AM assays. The cells were seed at 5,000 cells per well in 96-well plates coated with various composition of Zr-PDMS hybrids. The results showed increasing cell proliferation with increasing zirconia concentration, which peaked at 90 % v/v zirconia. Proliferation of osteoblasts and fibroblasts displayed similar trends on the hybrid material, although osteoblasts displayed a bi-phasic dose response by the calcein AM assay. The results of this current study show that Zr-PDMS may be used to influence tissue-implant integration, supporting the use of the hybrid as a promising coating for orthopedic trauma implants.

  3. Functionally Gradient Material Ceramics of Hydroxyapatite and Yttria Partially Stabilized Zirconia Prepared by Spark Plasma Sintering for Biocompatibility and Mechanical Strength

    NASA Astrophysics Data System (ADS)

    Kawagoe, Daisuke; Eda, Hokuto; Shinohara, Akiko; Nakata, Satoshi

    2013-01-01

    Hydroxyapatite, Ca10(PO4)6(OH)2: HA, is biocompatible with human hard tissue. Zirconia has mechanical strength and toughness. Spark plasma sintering (SPS) is a processing technique that makes it possible to prepare materials at low temperatures. Therefore, the objective of this study is to use the SPS method to prepare functionally gradient material (FGM) ceramics with the biocompatibility of HA and the strength of yttria partially stabilized zirconia (Y-PSZ). Fine powders of HA and Y-PSZ (ZrO2 + 3 mol % Y2O3) were poured into the graphite mold and then subjected to SPS at 1100 °C for 10 min. The outer layer has a mixing ratio of 70 wt % HA : 30 wt % Y-PSZ and the other layers are deposited by gradually changing the mixing ratio of HA and Y-PAZ. Each layer in the obtained composite (1.5 mmφ × 1.7 mm) was approximately 0.25 mm thick. The measured compressive strength of the composite prepared by SPS at 1100 °C for 10 min was 950 MPa.

  4. Separation of parabens on a zirconia-based stationary phase in superheated water chromatography.

    PubMed

    Yarita, Takashi; Aoyagi, Yoshie; Sasai, Haruka; Nishigaki, Atsuko; Shibukawa, Masami

    2013-01-01

    A superheated water chromatography (SWC) method for the separation of alkyl esters of 4-hydroxybenzoic acid (parabens) using a zirconia-based stationary phase was developed and applied to real sample analysis. First, the SWC system was optimized in terms of the proper length of the preheating coil for establishing thermal equilibration of the mobile phase entering the column at the oven temperature. Next, the effect of the column temperature on the retention was investigated at 100-180°C. The elution time for all parabens decreased with increasing column temperature, and linear relationships between ln k and 1/T were obtained. At higher column temperatures, the elution time was further shortened because of the increased mobile-phase flow rate. Nevertheless, the loss of column efficiency at the higher flow rates was not significant. The application of the present method to the analysis of commercial lotions was then demonstrated. The quantification results obtained from SWC showed good agreement with those from a conventional HPLC method.

  5. Zirconia-based catalyst for the one-pot synthesis of coumarin through Pechmann reaction

    NASA Astrophysics Data System (ADS)

    Khan, Shahid Ali; Khan, Sher Bahadar; Asiri, Abdullah M.; Ahmad, Ikram

    2016-07-01

    Coumarins play an important role in drug development with diverse biological applications. Herein, we present the synthesis of coumarin through Pechmann reaction by using zirconia-based heterogeneous catalysts (ZrO2-TiO2, ZrO2-ZnO, and ZrO2/cellulose) in a solvent-free condition at room temperature. ZrO2-TiO2, ZrO2-ZnO, and ZrO2/cellulose were identified through spectroscopic techniques such as FESEM, X-ray, EDS, XPS, and FT-IR. ZrO2-TiO2 showed the best catalytic performance while ZrO2/cellulose was inactive. The kinetic parameters were observed in a solvent-free condition as well as in toluene and ethanol. The temperature effect was extensively studied which revealed that increasing the temperature will increase the rate of reaction. The rate of reaction in a solvent-free condition, ethanol, and toluene were 1.7 × 10-3, 1.7 × 10-2, and 5.6 × 10-3 g mol-1 min-1, respectively.

  6. Fabrication of mesoporous titania-zirconia composite membranes based on nanoparticles improved hydrosol.

    PubMed

    Yin, Yiling; Wang, Hui; Li, Dan; Jing, Wenheng; Fan, Yiqun; Xing, Weihong

    2016-09-15

    A novel method for the fabrication of mesoporous titania-zirconia (TiO2ZrO2) composite membranes was successfully developed based on nanoparticles (NPs) improved hydrosol. ZrO2 hydrosols were synthesized through a straightforward sol-gel route using zirconium oxychloride. Compared to the polymeric sol route, this method was found to be more environmentally friendly because organic solvent was not required. Further, highly hydrophilic TiO2 NPs of 10-20nm were well dispersed in the sol and effectively reduced the sol infiltrating into the channels of the support layer by a "bridging" effect. After a rapid evaporation process, a mixed matrix gel was formed on the surface of the support. The dynamic mechanical analysis results showed that the toughness and stiffness of the gel were significantly strengthened, which was beneficial to reduce the risk of membrane cracking. So, an integrated, crack-free mesoporous TiO2ZrO2 composite membrane was obtained by directly coating and sintering the mixture on a macroporous support. It showed that the composite membrane delivered better separation performance though the filtration test. The water flux, molecular weight cutoff, and average pore size of the synthesized membrane were 60Lm(-2)h(-1)bar(-1), 4704Da, and 3.5nm, respectively. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. Marginal and Internal Discrepancies of Posterior Zirconia-Based Crowns Fabricated with Three Different CAD/CAM Systems Versus Metal-Ceramic.

    PubMed

    Ortega, Rocio; Gonzalo, Esther; Gomez-Polo, Miguel; Suárez, María J

    2015-01-01

    The aim of this study was to analyze the marginal and internal fit of metalceramic and zirconia-based crowns. Forty standardized steel specimens were prepared to receive posterior crowns and randomly divided into four groups (n = 10): (1) metal-ceramic, (2) NobelProcera Zirconia, (3) Lava Zirconia, and (4) VITA In-Ceram YZ. All crowns were cemented with glass-ionomer agent and sectioned buccolingually. A scanning electron microscope was used for measurements. Kruskal-Wallis and Wilcoxon signed rank test (α = .05) statistical analyses were conducted. Significant differences (P < .0001) in marginal discrepancies were observed between metal-ceramic and zirconia groups. No differences were found for the axial wall fit (P = .057). Significant differences were shown among the groups in discrepancies at the occlusal cusp (P = .0012) and at the fossa (P = .0062). No differences were observed between surfaces. All zirconia groups showed better values of marginal discrepancies than the metal-ceramic group. Procera Zirconia showed the lowest gaps.

  8. Structural characterization of hard materials by transmission electron microscopy (TEM): Diamond-Silicon Carbide composites and Yttria-stabilized Zirconia

    NASA Astrophysics Data System (ADS)

    Park, Joon Seok

    2008-10-01

    Diamond-Silicon Carbide (SiC) composites are excellent heat spreaders for high performance microprocessors, owing to the unparalleled thermal conductivity of the former component. Such a combination is obtained by the infiltration of liquid silicon in a synthetic diamond compact, where a rigid SiC matrix forms by the reaction between the raw materials. As well as the outstanding thermal properties, this engineered compound also retains the extreme hardness of the artificial gem. This makes it difficult to perform structural analysis by transmission electron microscopy (TEM), for it is not possible to produce thin foils out of this solid by conventional polishing methods. For the first time, a dual-beam focused ion beam (FIB) instrument successfully allowed site-specific preparation of electron-transparent specimens by the lift-out technique. Subsequent TEM studies revealed that the highest concentration of structural defects occurs in the vicinity of the diamond-SiC interfaces, which are believed to act as the major barriers to the transport of thermal energy. Diffraction contrast analyses showed that the majority of the defects in diamond are isolated perfect screw or 60° dislocations. On the other hand, SiC grains contain partial dislocations and a variety of imperfections such as microtwins, stacking faults and planar defects that are conjectured to consist of antiphase (or inversion) boundaries. Clusters of nanocrystalline SiC were also observed at the diamond-SiC boundaries, and a specific heteroepitaxial orientation relationship was discovered for all cubic SiC that grows on diamond {111} facets. Yttria-stabilized Zirconia (YSZ) is the most common electrolyte material for solid oxide fuel cell (SOFC) applications. It is an ionic conductor in which charge transfer is achieved by the transport of oxygen ions (O 2-). Like the diamond composite above, it is hard and brittle, and difficult to make into electron transparent TEM samples. Provided an effective

  9. A 3-year follow-up of ceria-stabilized zirconia/alumina nanocomposite (Ce-TZP/A) frameworks for fixed dental prostheses.

    PubMed

    Tanaka, Shinpei; Takaba, Masayuki; Ishiura, Yuichi; Kamimura, Emi; Baba, Kazuyoshi

    2015-01-01

    Zirconia/alumina nanocomposite stabilized with cerium oxide (Ce-TZP/A) shows significantly higher mechanical strength than yttrium-oxide-partially-stabilized zirconia (Y-TZP) and allows post-sintered machining that does not require any subsequent treatment. The aim of this prospective study was to assess the clinical performance of veneered Ce-TZP/A frameworks for fixed dental prostheses. Fifteen patients with 22 Ce-TZP/A fixed prostheses were included in this study. The fixed dental prostheses were cemented with resin cement (baseline) and were evaluated at baseline and at 1, 6, 12, 24 and 36 months after cementation. Clinical events, including fracture and loss of retention, secondary caries, and marginal integrity, were recorded. The biologic outcome was judged by comparing the pre-treatment and post-treatment bleeding on probing (BOP), and probing pocket depth (PPD) of the abutment teeth. Radiographic examination was also performed at 12, 24 and 36 months. The mean observation period was 35.9±5.5 months. During this period, one abutment tooth was extracted due to root fracture and the survival rate was 95.2%. No significant change in BOP, PPD, and radiographic image was found during the 36-month follow-up period. Within the limitations of this study, Ce-TZP/A was found to provide sufficient stability as a framework material in all regions. Special attention, however, must be paid to designing framework that provides sufficient support for the veneer. Furthermore, studies with longer observation periods and more patients are needed. Copyright © 2014 Japan Prosthodontic Society. Published by Elsevier Ltd. All rights reserved.

  10. Effect of grain size on the monoclinic transformation, hardness, roughness, and modulus of aged partially stabilized zirconia.

    PubMed

    Lucas, Thomas J; Lawson, Nathaniel C; Janowski, Gregg M; Burgess, John O

    2015-12-01

    Low-temperature-degradation (LTD) has been reported to cause property changes in yttria-tetragonal zirconia polycrystals (Y-TZP). The current study measured monoclinic phase transformation of Y-TZP with different grain sizes and corresponding property changes due to artificial aging. the grain size of aged Y-TZP will not influence its transformation, roughness, hardness or modulus of elasticity. Four groups of Y-TZP were examined with differing grain sizes (n=5). The line intercept technique was used to determine grain sizes on SEM images (100,000×). Artificial aging was accomplished by autoclaving at 2 bar pressure for 5 h. X-ray diffraction (30 mA, 40 kV) was used to measure tetragonal to monoclinic transformation (t→m). Surface roughness analysis was performed using a non-contact surface-profilometer. Nano-hardness and modulus of elasticity were measured using nano-indentation. SEM analyses showed different grain sizes for each sample group (0.350 μm, 0.372 μm, 0.428 μm, and 0.574 μm). The fraction of t→m transformation increased as grain size increased; furthermore, aging of zirconia caused increased roughness. Modulus and hardness after aging displayed no significant correlation or interaction with grain size. Smaller grains caused less transformation, and aging caused increased roughness, but grain size did not influence the amount of increased surface roughness. Future studies are needed to determine the effects of grain size on the wear and fracture properties of dental zirconia. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  11. Doped zirconia phase and luminescence dependence on the nature of charge compensation

    PubMed Central

    Smits, Krisjanis; Olsteins, Dags; Zolotarjovs, Aleksejs; Laganovska, Katrina; Millers, Donats; Ignatans, Reinis; Grabis, Janis

    2017-01-01

    Zirconia is a relatively new material with many promising practical applications in medical imaging, biolabeling, sensors, and other fields. In this study we have investigated lanthanide and niobium doped zirconia by luminescence and XRD methods. It was proven that charge compensation in different zirconia phases determines the incorporation of intrinsic defects and activators. Thus, the structure of zirconia does not affect the Er luminescence directly; however, it strongly affects the defect distribution around lanthanide ions and the way in which activator ions are incorporated in the lattice. Our results demonstrate the correlation between the crystalline phase of zirconia and charge compensation, as well as the contribution of different nanocrystal grain sizes. In addition, our experimental results verify the theoretical studies of metastable (tetragonal, cubic) phase stabilization determined using only oxygen vacancies. Moreover, it was found that adding niobium drastically increases activator luminescence intensity, which makes Ln3+ doped zirconia even more attractive for various practical applications. Although this study was based on the luminescence of the Er ion, the phase stabilization, charge compensation, and luminescence properties described in our results are expected to be similar for other lanthanide elements. Our results suggest that the luminescence intensity of other oxide matrices where lanthanides incorporate in place of tetravalent cations could be increased by addition of Nb ions. PMID:28287623

  12. Doped zirconia phase and luminescence dependence on the nature of charge compensation

    NASA Astrophysics Data System (ADS)

    Smits, Krisjanis; Olsteins, Dags; Zolotarjovs, Aleksejs; Laganovska, Katrina; Millers, Donats; Ignatans, Reinis; Grabis, Janis

    2017-03-01

    Zirconia is a relatively new material with many promising practical applications in medical imaging, biolabeling, sensors, and other fields. In this study we have investigated lanthanide and niobium doped zirconia by luminescence and XRD methods. It was proven that charge compensation in different zirconia phases determines the incorporation of intrinsic defects and activators. Thus, the structure of zirconia does not affect the Er luminescence directly; however, it strongly affects the defect distribution around lanthanide ions and the way in which activator ions are incorporated in the lattice. Our results demonstrate the correlation between the crystalline phase of zirconia and charge compensation, as well as the contribution of different nanocrystal grain sizes. In addition, our experimental results verify the theoretical studies of metastable (tetragonal, cubic) phase stabilization determined using only oxygen vacancies. Moreover, it was found that adding niobium drastically increases activator luminescence intensity, which makes Ln3+ doped zirconia even more attractive for various practical applications. Although this study was based on the luminescence of the Er ion, the phase stabilization, charge compensation, and luminescence properties described in our results are expected to be similar for other lanthanide elements. Our results suggest that the luminescence intensity of other oxide matrices where lanthanides incorporate in place of tetravalent cations could be increased by addition of Nb ions.

  13. Effects of compositional changes on the performance of a thermal barrier coating system. [yttria-stabilized zirconia coatings on gas turbine engine blades

    NASA Technical Reports Server (NTRS)

    Stecura, S.

    1978-01-01

    Currently proposed thermal barrier systems for aircraft gas turbine engines consist of NiCrAlY bond coating covered with an insulating oxide layer of yttria-stabilized zirconia. The effect of yttrium concentration (from 0.15 to 1.08 w/o) in the bond coating and the yttria concentration (4 to 24.4 w/o) in the oxide layer were evaluated. Furnace, natural gas-oxygen torch, and Mach 1.0 burner rig cyclic tests on solid specimens and air-cooled blades were used to identify trends in coating behavior. Results indicate that the combinations of yttrium levels between 0.15 - 0.35 w/o in the bond coating and the yttria concentration between 6 - 8 w/o in the zirconium oxide layer were the most adherent and resistant to high temperature cyclic exposure.

  14. Modulating microstructure and magnetic properties of BaFe{sub 12}O{sub 19} thin films by using Pt and yttria stabilized zirconia underlayers

    SciTech Connect

    Li, Q. F.; Su, X. D.; Li, H.; Zhang, L.; Liu, Z. H.; Zhong, H. J.

    2009-12-15

    The c-axis oriented barium ferrite thin films were prepared by radio frequency magnetron sputtering on silicon substrates with a metal underlayer Pt (111) as well as an oxide underlayer yttria stabilized zirconia (YSZ). Microstructural studies (scanning electron microscopy, atomic force microscopy, and magnetic force microscopy) showed that the magnetic grains in BaM film have a strong relationship with the grains in the underlayer. The Pt underlayer is more effective in forming micrometer-sized and multidomain magnetic grains, which have high saturation magnetization but small coercivity and remanence of the BaM film. On the contrary, the YSZ underlayer is favorable to obtain nanometer-sized and monodomain magnetic grains, which lead to a slight decrease in saturation magnetization but dramatically increase coercivity and remanence of the BaM film. Hence, with careful selection of underlayer, it is feasible to obtain suitable magnetic grain size and domain structure of BaM films to satisfy special requirements.

  15. A phenomenological study of yttria-stabilized zirconia at 1300 K with the Green-Kubo formulation and equilibrium molecular dynamics

    NASA Astrophysics Data System (ADS)

    Valadez Huerta, G.; Kelle, A.; Kabelac, S.

    2017-03-01

    In this study, we analyze the transport mechanisms in different yttria-stabilized zirconia compositions as an example for an ionic solid at 1300 K and zero pressure with EMD and the Green-Kubo formulation. As it can be interpreted from the partial and the total correlation functions of the micro fluxes, a certain amount of anions should be given to activate the diffusion of other anions. An incomplete vacancy diffusion favors the coupled effect of heat and diffusion. The heat conduction decreases for higher concentration of vacancies and the optimum of the diffusion is reproducible with this method. We predict a minimum of the thermo-diffusion conductivity at 10 mol% Y2O3. The understanding of the heat and electrical conduction of ionic solids and of the couple effect is essential in systems, where the gradients of different kind of forces are present.

  16. Novel precipitated zirconia-based DGT technique for high-resolution imaging of oxyanions in waters and sediments.

    PubMed

    Guan, Dong-Xing; Williams, Paul N; Luo, Jun; Zheng, Jian-Lun; Xu, Hua-Cheng; Cai, Chao; Ma, Lena Q

    2015-03-17

    Water-sediment exchange is a fundamental component of oxyanion cycling in the environment. Yet, many of the (im)mobilization processes overlay complex spatial and temporal redox regimes that occur within millimeters of the interface. Only a few methods exist that can reliably capture these porewater fluxes, with the most popular being high-resolution diffusive gradients in thin films (HR-DGT). However, functionality of HR-DGT is restricted by the availability of suitable analyte binding agents within the sampler, which must be simple to cast and homogeneously distributed in the binding layer, exhibit adequate sorption capacities, be resistive to chemical change, and possess a very fine particle size (≤10 μm). A novel binding layer was synthesized to meet these requirements by in situ precipitation of zirconia into a precast hydrogel. The particle diameter≤0.2 μm of zirconia in this precipitated gel was uniform and at least 50-times smaller than the conventional molding approach. Further, this gel had superior binding and stability characteristics compared with the commonly used ferrihydrite HR-DGT technique and could be easily fabricated as an ultrathin gel (60 μm) for simultaneous oxygen imaging in conjunction with planar-optodes. Chemical imaging of anion and oxygen fluxes using the new sampler were evaluated on Lake Taihu sediments.

  17. Unique sharp photoluminescence of size-controlled sonochemically synthesized zirconia nanoparticles.

    PubMed

    Manoharan, Divinah; Loganathan, Aswaghosh; Kurapati, Vishista; Nesamony, Victor Jaya

    2015-03-01

    The present study explores the features of tetragonally stabilized polycrystalline zirconia nanophosphors prepared by a sonochemistry based synthesis from zirconium oxalate precursor complex. The sonochemically prepared pristine zirconia, 3 mol%, 5 mol% and 8 mol% yttrium doped zirconia nanophosphors were characterized using thermo-gravimetric analysis (TGA), X-ray diffraction (XRD), Raman spectroscopy, field emission scanning electron microscopy (FE-SEM) with energy dispersive X-ray spectroscopy (EDS), transmission electron microscopy (TEM), diffuse reflectance spectroscopy (DRS) and photoluminescence spectroscopy (PL). The reaction mechanism of formation of zirconia nanophosphors is discussed in detail. The probable sonochemical formation mechanism is being proposed. Stabilization of tetragonal phase of pristine zirconia even at room temperature was effectively established by controlling the particle size using ultrasonic waves. Improved phase purity and good surface morphology of the nanophosphors is being achieved via sonochemical route. FE-SEM micrographs reveal that the nanoparticles have uniform spherical shape and size. The narrow particle size distribution (∼15-25 nm) of the zirconia nanoparticles was found from FE-SEM statistical analysis and further confirmed by TEM. Zirconia nanophosphors exhibit a wide energy band gap and which was found to vary with yttrium dopant concentration. The highlight of the present study is the synthesis of novel nanocrystalline ZrO₂ and Y-ZrO₂ phosphor which simultaneously emits extremely sharp as well as intense UV, violet and cyan light on exciting the host atom. The yttrium ion dopant further enhances the photoluminescence property of zirconia. These nanocrystalline phosphors are likely to have remarkable optical applications as light emitting UV-LEDs, UV lasers and multi color displays.

  18. Survival and testing parameters of zirconia-based crowns under cyclic loading in an aqueous environment: A systematic review.

    PubMed

    Elshiyab, Shareen Hayel; Nawafleh, Noor; George, Roy

    2017-03-19

    To study the hypothesis that in vitro fatigue testing variables in an aqueous environment affect the survival results of zirconia-based restorations, and evaluate the level of agreement between in vitro and previous in vivo data. An electronic search of literature was conducted in PubMed and Scopus to identify in vitro studies testing zirconia-based crowns using cyclic loading in an aqueous environment. Only studies that complied with the inclusion criteria were included. Data extracted were used for survival analysis and assessment of in vitro parameters for fatigue testing of implant and tooth-supported crowns. Using "Assessing the Methodological Quality of Systematic Reviews" (AMSTAR), recent in vivo systematic review studies were assessed prior to consideration for comparison with the current in vitro data. After applying the inclusion criteria only 25 articles were included. Five-year cumulative survival rate of zirconia-based implant-supported crowns was lower than tooth-supported crowns (84% and 88.8% respectively). Tooth-supported crowns subjected to wet fatigue showed a lower 5-year cumulative survival rate compared to thermocycling (62.8% and 92.6% respectively). Monolithic crowns showed higher fracture resistance compared to bi-layered structure (pressed or hand-layered). Only in vivo systematic reviews, which complied with AMSTAR assessment criteria, were used for comparison to the in vitro data. As for fatigue testing parameters, differences in the experimental setting were evident and affected the outcomes. Crown survivals depend on type of support, type of fatigue test conducted, crown structure, and veneering method. In vitro fatigue testing protocols are highly variable, which introduces a need for international standardization to allow for more valid comparability of data. © 2017 John Wiley & Sons Australia, Ltd.

  19. Shear bond strength of a denture base acrylic resin and gingiva-colored indirect composite material to zirconia ceramics.

    PubMed

    Kubochi, Kei; Komine, Futoshi; Fushiki, Ryosuke; Yagawa, Shogo; Mori, Serina; Matsumura, Hideo

    2017-04-01

    To evaluate the shear bond strengths of two gingiva-colored materials (an indirect composite material and a denture base acrylic resin) to zirconia ceramics and determine the effects of surface treatment with various priming agents. A gingiva-colored indirect composite material (CER) or denture base acrylic resin (PAL) was bonded to zirconia disks with unpriming (UP) or one of seven priming agents (n=11 each), namely, Alloy Primer (ALP), Clearfil Photo Bond (CPB), Clearfil Photo Bond with Clearfil Porcelain Bond Activator (CPB+Act), Metal Link (MEL), Meta Fast Bonding Liner (MFB), MR. bond (MRB), and V-Primer (VPR). Shear bond strength was determined before and after 5000 thermocycles. The data were analyzed with the Kruskal-Wallis test and Steel-Dwass test. The mean pre-/post-thermalcycling bond strengths were 1.0-14.1MPa/0.1-12.1MPa for the CER specimen and 0.9-30.2MPa/0.1-11.1MPa for the PAL specimen. For the CER specimen, the ALP, CPB, and CPB+Act groups had significantly higher bond strengths among the eight groups, at both 0 and 5000 thermocycles. For the PAL specimen, shear bond strength was significantly lower after thermalcycling in all groups tested. After 5000 thermocycles, bond strengths were significantly higher in the CPB and CPB+Act groups than in the other groups. For the PAL specimens, bond strengths were significantly lower after thermalcycling in all groups tested. The MDP functional monomer improved bonding of a gingiva-colored indirect composite material and denture base acrylic resin to zirconia ceramics. Copyright © 2016 Japan Prosthodontic Society. Published by Elsevier Ltd. All rights reserved.

  20. Developing porous ceramics on the base of zirconia oxide with thin and permeable pores by crystallization of organic additive method

    NASA Astrophysics Data System (ADS)

    Kamyshnaya, K. S.; Khabas, T. A.

    2016-11-01

    In this paper porous ceramics on the base of ZrO2 nanopowders and micropowders has been developed by freeze-casting method. A zirconia/carbamide slurry was frozen in mold and dehydrated in CaCl2 at room temperature. This simple process enabled the formation of porous ceramics with highly aligned pores as a replica of the carbamide crystals. The samples showed higher porosity of 47.9%. In addition, these materials could be used as membrane for air cleaning.

  1. High-temperature erosion of plasma-sprayed, yttria-stabilized zirconia in a simulated turbine environment

    NASA Technical Reports Server (NTRS)

    Hanschuh, R. F.

    1984-01-01

    A series of rig calibration and high temperature tests simulating gas path seal erosion in turbine engines were performed at three impingement angles and at three downstream locations. Plasma sprayed, yttria stablized zirconia specimens were tested. Steady state erosion curves presented for 19 test specimens indicate a brittle type of material erosion despite scanning electron microscopy evidence of plastic deformation. Steady state erosion results were not sensitive to downstream location but were sensitive to impingement angle. At difference downstream locations specimen surface temperature varied from 1250 to 1600 C (2280 to 2900 F) and particle velocity varied from 260 to 320 m/s (850 to 1050 ft/s). The mass ratio of combustion products to erosive grit material was typically 240.

  2. Long-term stability of peri-implant tissues after bone or soft tissue augmentation. Effect of zirconia or titanium abutments on peri-implant soft tissues. Summary and consensus statements. The 4th EAO Consensus Conference 2015.

    PubMed

    Sicilia, Alberto; Quirynen, Marc; Fontolliet, Alain; Francisco, Helena; Friedman, Anton; Linkevicius, Tomas; Lutz, Rainer; Meijer, Henny J; Rompen, Eric; Rotundo, Roberto; Schwarz, Frank; Simion, Massimo; Teughels, Wim; Wennerberg, Ann; Zuhr, Otto

    2015-09-01

    Several surgical techniques and prosthetic devices have been developed in the last decades, aiming to improve aesthetic, hygienic and functional outcomes that may affect the peri-implant tissues, such as procedures of bone and soft tissue augmentation and the use of custom-made abutments of titanium and zirconium. Three systematic reviews, based on randomized clinical trials and prospective studies covering the above reported topics were analysed, and the detected evidence was exposed to interactive experts' discussion during the group's and general assembly's meetings of the 4th EAO Consensus Conference. The results are reported using the following abbreviations: S-T: short-term evidence, M-T: medium-term evidence; L-T: long-term evidence; LE: limited evidence. Soft tissue augmentation procedures may be indicated for the increase of soft tissue thickness and keratinized tissue, the reduction of interproximal peri-implant bone loss, and the coverage of shallow peri-implant soft tissue recessions (S-T, LE), L-T is lacking. Guided bone regeneration approaches (GBR) showed efficacy when used for ridge reconstruction after the complete healing of the soft tissues (S-T & L-T), and the stability of the augmented bone may play a role in the maintenance of the soft tissue position and dimensions (LE). No significant differences were observed between titanium and zirconia abutments when evaluating probing pocket depth, bleeding on probing, marginal bone levels and mucosal recessions. Zirconia abutments were associated with more biological complications but demonstrated superiority in terms of achieving natural soft tissue colour (S-T). © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  3. Stock Versus CAD/CAM Customized Zirconia Implant Abutments – Clinical and Patient‐Based Outcomes in a Randomized Controlled Clinical Trial

    PubMed Central

    Meijer, Henny J.A.; Kerdijk, Wouter; Raghoebar, Gerry M.; Cune, Marco

    2016-01-01

    Abstract Background Single‐tooth replacement often requires a prefabricated dental implant and a customized crown. The benefits of individualization of the abutment remain unclear. Purpose This randomized controlled clinical trial aims to study potential benefits of individualization of zirconia implant abutments with respect to preservation of marginal bone level and several clinical and patient‐based outcome measures. Material and Methods Fifty participants with a missing premolar were included and randomly assigned to standard (ZirDesign, DentsplySirona Implants, Mölndal, Sweden) or computer aided design/computer aided manufacturing (CAD/CAM) customized (Atlantis, DentsplySirona Implants, Mölndal, Sweden) zirconia abutment therapy. Peri‐implant bone level (primary outcome), Plaque‐index, calculus formation, bleeding on probing, gingiva index, probing pocket depth, recession, appearance of soft tissues and patients' contentment were assessed shortly after placement and one year later. Results No implants were lost and no complications related to the abutments were observed. Statistically significant differences between stock and CAD/CAM customized zirconia abutments could not be demonstrated for any of the operationalized variables. Conclusion The use of a CAD/CAM customized zirconia abutment in single tooth replacement of a premolar is not associated with an improvement in clinical performance or patients' contentment when compared to the use of a stock zirconia abutment. PMID:27476829

  4. Electrocatalytic oxidation of ethanol in acid medium: Enhancement of activity of vulcan-supported Platinum-based nanoparticles upon immobilization within nanostructured zirconia matrices

    NASA Astrophysics Data System (ADS)

    Rutkowska, Iwona A.; Kulesza, Pawel J.

    2014-09-01

    Composite electrocatalytic materials that utilize carbon (Vulcan) supported Pt or PtRu nanoparticles dispersed within thin films of zirconia (ZrO2) are considered here for oxidation of such a biofuel as ethanol in acid medium. The systems were characterized using electrochemical techniques as well as transmission electron microscopy. The enhancement of activity was clearly evident upon comparison of the respective voltammetric and chronoamperometric current densities recorded (at room temperature in 0.5 mol dm-3H2SO4 containing 0.5 mol dm-3 ethanol) using the Vulcan supported Pt and PtRu catalysts in the presence and absence of zirconia. In all cases, the noble metal loading was the same, 100 μg cm-2. Apparently, the existence of large population of hydroxyl groups (originating from zirconia) in the vicinity of Pt-based catalyst, in addition to possible specific interactions between zirconia and the ruthenium component of PtRu, facilitated the oxidative removal (from Pt) of the passivating (e.g., CO) reaction intermediates (adsorbates). By utilizing carbon supported, rather than bare or unsupported, Pt or PtRu nanoparticles (dispersed within the semiconducting zirconia), the overall charge distribution at the electrocatalytic interface was improved.

  5. Spectrophotometric evaluation of color match of three different porcelain systems for all-ceramic zirconia-based restorations.

    PubMed

    Vichi, Alessandro; Fazi, Giovanni; Carrabba, Michele; Corciolani, Gabriele; Louca, Chris; Ferrari, Marco

    2012-08-01

    To determine by a spectrophotometric analysis the variations in color between the intended and the fabricated shades of three different porcelain systems when applied in a standardized thickness on a zirconia core. Three porcelain systems for zirconia based restorations, Ivoclar IPS e.max Ceram, VITA VM9, and Creation Zi-F were tested. Nine disc-shaped (15 mm diameter, 0.5 mm thickness) specimens of VITA YZ zirconia core per group were made comprising a total of 27 discs. Three different shades (A2, A3, A4) of the Vitapan Classical shade guide were investigated. The porcelain veneer total thickness was set at 1.0 mm in all groups. The porcelain stratification was made by applying calibrated layers of porcelain. Thicknesses of single porcelain layers were calculated from drawings retrieved from the manufacturers' instructions. Color parameters (L*, a*, b*) of veneered specimens were measured by a clinical spectrophotometer. Color differences (deltaE) were calculated using a color difference formula. Two-way ANOVA and Tukey's test were used to analyze the data. The mean color differences for the three ceramic systems, Ivoclar IPS e.max Ceram, VITA VM9 and Creation Zi-F were respectively 4.1, 2.7 and 3.2, regardless of the shades. VITA VM9 resulted in the best average shade matching among the porcelain systems, even if results with shade A3 were considerably worse than shades with A2 and A4 (P<0.05). Color matching appeared not to be shade dependent (P>0.05) among the tested shades.

  6. Study and development of sulfated zirconia based proton exchange fuel cell membranes

    NASA Astrophysics Data System (ADS)

    Kemp, Brittany Wilson

    With the increasing consumption of energy, fuel cells are among the most promising alternatives to fossil fuels, provided some technical challenges are overcome. Proton exchange membrane fuel cells (PEMFCs) have been investigated and improvements have been made, but the problem with NafionRTM, the main membrane for PEMFCs, has not been solved. NafionRTM restricts the membranes from operating at higher temperatures, thus preventing them from working in small electronics. The problem is to develop a novel fuel cell membrane that performs comparably to NafionRTM in PEMFCs. The membranes were fabricated by applying sulfated zirconia, via template wetting, to porous alumina membranes. The fabricated membranes showed a proton conductivity of 0.016 S/cm in comparison to the proton conductivity of Nafion RTM (0.05 S/cm). Both formic acid and methanol had a lower crossover flux through the sulfated zirconia membranes (formic acid- 2.89x10 -7 mols/cm2s and methanol-1.78x10-9 mols/cm2s) than through NafionRTM (formic acid-2.03x10 -8 mols/cm2s methanol-2.42x10-6 mols/cm 2s), indicating that a sulfated zirconia PEMFC may serve as a replacement for NafionRTM.

  7. Anterosuperior rehabilitation with metal-free fixed prosthesis based on zirconia

    PubMed Central

    Cenci, Sthelen Nayara; Gontarsky, Igor Alessandro; Moro, Marcella Goetz; Pinheiro, Lidia Olga Bach; Samra, Adriana Postiglione Bührer

    2017-01-01

    The loss of upper front dental elements causes functional and psychosocial problems to the affected individuals. In this case report, the treatment planning considered hard and soft tissue loss for a complex fixed partial denture (FPD) rehabilitation. The six-element, all-ceramic FPD was manufactured using a computer-aided design/computer-aided manufacturing system with zirconia framework, veneered with leucite-reinforced ceramic. Ceramic artificial gum was also produced to guarantee tooth-facial proportions as well as lip support, promoting both esthetics and phonetics. The material's mechanical properties allowed for the coupling of the esthetic and mechanical requirements, proving an alternative to the well-established metal-ceramic technology, optimizing biomimetic. One of the endodontic-treated abutment teeth required a radicular retainer with cast metal post, but because of the opacity of zirconia, the esthetics of the prosthesis was not compromised. The low silica content of high resistance ceramics such as zirconia hampers the adhesive cementation, with numerous studies advocating for different cementation protocols, with no clear scientific consensus so far. In the present case, the internal surface of the FPD was initially blasted with aluminum oxide, followed by the application of a universal adhesive system containing 10-methacryloyloxydecyl dihydrogen phosphate. Finally, cementation to the dental structure was conducted with dual-cure self-adhesive resin cement. PMID:28729803

  8. Processing and Characterization of MMC Beads Based on Zirconia and TRIP Steel

    NASA Astrophysics Data System (ADS)

    Oppelt, Marie; Wenzel, Claudia; Aneziris, Christos G.; Berek, Harry

    2014-12-01

    A novel process for metal-matrix composite fabrication with the special focus on single beads and sintered bead structures is explored. The used gel-casting process by sodium alginate gelation is introduced, and various analyses with significant results are presented. The suspensions contained 16-7-3 steel and zirconia particles as well as sodium alginate and were subsequently added dropwise into water which contained solidifying agent for forming rubbery, substantially round beads. Sintered beads with adequate strength (~400 MPa) and perfect surface, homogeneous microstructure, and high energy absorption capability have been produced by this casting process. At lower strains (up to 15 pct), all zirconia reinforced steel beads obtain higher specific energy absorption (SEA) in comparison to pure steel beads. Especially the composition of 90 vol pct TRIP steel and 10 vol pct zirconia shows a significant improved energy absorption capability with 27.7 MJ/m3 at a strain of 15 pct. Pure steel only exhibits a SEA of 13.1 MJ/m3.

  9. Zirconia in fixed prosthesis. A literature review

    PubMed Central

    Román-Rodríguez, Juan L.; Ferreiroa, Alberto; Solá-Ruíz, María F.; Fons-Font, Antonio

    2014-01-01

    Statement of problem: Evidence is limited on the efficacy of zirconia-based fixed dental prostheses. Objective: To carry out a literature review of the behavior of zirconium oxide dental restorations. Material and Methods: This literature review searched the Pubmed, Scopus, Medline and Cochrane Library databases using key search words “zirconium oxide,” “zirconia,” “non-metal restorations,” “ceramic oxides,” “veneering ceramic,” “zirconia-based fixed dental prostheses”. Both in vivo and in vitro studies into zirconia-based prosthodontic restoration behavior were included. Results: Clinical studies have revealed a high rate of fracture for porcelain-veneered zirconia-based restorations that varies between 6% and 15% over a 3- to 5-year period, while for ceramo-metallic restorations the fracture rate ranges between 4 and 10% over ten years. These results provoke uncertainty as to the long-term prognosis for this material in the oral medium. The cause of veneering porcelain fractures is unknown but hypothetically they could be associated with bond failure between the veneer material and the zirconia sub-structure. Key words:Veneering ceramic, zirconia-based ceramic restoration, crown, zirconia, tooth-supported fixed prosthesis. PMID:24596638

  10. Effect of screw access hole preparation on fracture load of implant-supported zirconia-based crowns: an in vitro study.

    PubMed

    Mokhtarpour, Hadi; Eftekhar Ashtiani, Reza; Mahshid, Minoo; Tabatabaian, Farhad; Alikhasi, Marzieh

    2016-01-01

    Background. Fracture load of implant-supported restorations is an important factor in clinical success. This study evaluated the effect of two techniques for screw access hole preparation on the fracture load of cement-screw-retained implant-supported zirconia-based crowns. Methods. Thirty similar cement-screw-retained implant-supported zirconia-based maxillary central incisor crowns were evaluated in three groups of 10. Group NH: with no screw access holes for the control; Group HBS: with screw access holes prepared with a machine before zirconia sintering; Group HAS: with screw access holes prepared manually after zirconia sintering. In group HBS, the access holes were virtually designed and prepared by a computer-assisted design/computer-assisted manufacturing system. In group HAS, the access holes were manually prepared after zirconia sintering using a diamond bur. The dimensions of the screw access holes were equal in both groups. The crowns were cemented onto same-size abutments and were then subjected to thermocycling. The fracture load values of the crowns were measured using a universal testing machine. Data were analyzed with ANOVA and Tukey test (P < 0.05). Results. The mean fracture load value for the group NH was 888.37 ± 228.92 N, which was the highest among the groups, with a significant difference (P < 0.0001). The fracture load values were 610.48 ± 125.02 N and 496.74 ± 104.10 Nin the HBS and HAS groups, respectively, with no significant differences (P = 0.44). Conclusion. Both techniques used for preparation of screw access holes in implant-supported zirconia-based crowns decreased the fracture load.

  11. Effect of screw access hole preparation on fracture load of implant-supported zirconia-based crowns: an in vitro study

    PubMed Central

    Mokhtarpour, Hadi; Eftekhar Ashtiani, Reza; Mahshid, Minoo; Tabatabaian, Farhad; Alikhasi, Marzieh

    2016-01-01

    Background. Fracture load of implant-supported restorations is an important factor in clinical success. This study evaluated the effect of two techniques for screw access hole preparation on the fracture load of cement-screw-retained implant-supported zirconia-based crowns. Methods. Thirty similar cement-screw-retained implant-supported zirconia-based maxillary central incisor crowns were evaluated in three groups of 10. Group NH: with no screw access holes for the control; Group HBS: with screw access holes prepared with a machine before zirconia sintering; Group HAS: with screw access holes prepared manually after zirconia sintering. In group HBS, the access holes were virtually designed and prepared by a computer-assisted design/computer-assisted manufacturing system. In group HAS, the access holes were manually prepared after zirconia sintering using a diamond bur. The dimensions of the screw access holes were equal in both groups. The crowns were cemented onto same-size abutments and were then subjected to thermocycling. The fracture load values of the crowns were measured using a universal testing machine. Data were analyzed with ANOVA and Tukey test (P < 0.05). Results. The mean fracture load value for the group NH was 888.37 ± 228.92 N, which was the highest among the groups, with a significant difference (P < 0.0001). The fracture load values were 610.48 ± 125.02 N and 496.74 ± 104.10 Nin the HBS and HAS groups, respectively, with no significant differences (P = 0.44). Conclusion. Both techniques used for preparation of screw access holes in implant-supported zirconia-based crowns decreased the fracture load. PMID:27651885

  12. Evaluation of roughness, wettability, and morphology of an yttria-stabilized tetragonal zirconia polycrystal ceramic after different airborne-particle abrasion protocols.

    PubMed

    Abi-Rached, Filipe Oliveira; Martins, Samira Branco; Campos, Juliana Alvares; Fonseca, Renata Garcia

    2014-12-01

    Airborne-particle abrasion is an effective method of roughening a zirconia surface and promoting micromechanical interlocks with luting cements. However, the effect of different airborne-particle abrasion protocols on the micromechanical retention mechanism has been poorly investigated. The purpose of the study was to evaluate the effect of airborne-particle abrasion protocols on the surface roughness, wettability, and morphology of an yttria-stabilized tetragonal zirconia polycrystal ceramic. A total of 140 zirconia specimens (14 × 14 × 1.4 mm) were made from Lava and divided into 7 groups. Their surfaces were treated as follows (n = 20): as-sintered (control); airborne-particle abraded with 50-μm Al2O3 particles; 120-μm Al2O3 particles; 250-μm Al2O3 particles; 30-μm silica-coated Al2O3 particles (Rocatec Soft); 110-μm silica-coated Al2O3 particles (Rocatec Plus); and 120-μm Al2O3 particles followed by Rocatec Plus. The surface roughness (Ra) and wettability analyses were performed on the same specimens of each group. The test liquid used for the wettability analysis was the silane RelyX Ceramic Primer. Two additional specimens (6.0 × 6.0 × 1.0 mm) per group were prepared to evaluate the surface morphology with scanning electron microscopy. The roughness (Ra) data were analyzed by 1-way ANOVA and the Dunnett C test (α = .05), and the wettability data with 1-way ANOVA (α = .05). The Spearman correlation analysis was applied to test for a possible correlation between roughness and wettability. The control group (0.35 μm) exhibited the lowest mean roughness value (Ra), which was followed by Rocatec Soft (0.40 μm), 50-μm Al2O3 particles (0.52 μm), Rocatec Plus (0.69 μm), 120-μm Al2O3 particles (0.80 μm)/120-μm Al2O3 particles + Rocatec Plus (0.79 μm), and 250-μm Al2O3 particles (1.13 μm). No significant difference was found among the groups concerning wettability. No correlation (rs = -0.09; P = .27) was found between the 2 dependent variables

  13. Structural reliability of alumina-, feldspar-, leucite-, mica- and zirconia-based ceramics.

    PubMed

    Tinschert, J; Zwez, D; Marx, R; Anusavice, K J

    2000-09-01

    The objective of this study was to test the hypothesis that industrially manufactured ceramic materials, such as Cerec Mark II and Zirconia-TZP, have a smaller range of fracture strength variation and therefore greater structural reliability than laboratory-processed dental ceramic materials. Thirty bar specimens per material were prepared and tested. The four-point bend test was used to determine the flexure strength of all ceramic materials. The fracture stress values were analyzed by Weibull analysis to determine the Weibull modulus values (m) and the 1 and 5% probabilities of failure. The mean strength and standard deviation values for these ceramics are as follows: (MPa+/-SD) were: Cerec Mark II, 86.3+/-4.3; Dicor, 70.3+/-12.2; In-Ceram Alumina, 429. 3+/-87.2; IPS Empress, 83.9+/-11.3; Vitadur Alpha Core, 131.0+/-9.5; Vitadur Alpha Dentin, 60.7+/-6.8; Vita VMK 68, 82.7+/-10.0; and Zirconia-TZP, 913.0+/-50.2. There was no statistically significant difference among the flexure strength of Cerec Mark II, Dicor, IPS Empress, Vitadur Alpha Dentin, and Vita VMK 68 ceramics (p>0.05). The highest Weibull moduli were associated with Cerec Mark II and Zirconia-TZP ceramics (23.6 and 18.4). Dicor glass-ceramic and In-Ceram Alumina had the lowest m values (5.5 and 5.7), whereas intermediate values were observed for IPS-Empress, Vita VMK 68, Vitadur Alpha Dentin and Vitadur Alpha Core ceramics (8.6, 8.9, 10.0 and 13.0, respectively). Except for In-Ceram Alumina, Vitadur Alpha and Zirconia-TZP core ceramics, most of the investigated ceramic materials fabricated under the condition of a dental laboratory were not stronger or more structurally reliable than Vita VMK 68 veneering porcelain. Only Cerec Mark II and Zirconia-TZP specimens, which were prepared from an industrially optimized ceramic material, exhibited m values greater than 18. Hence, we conclude that industrially prepared ceramics are more structurally reliable materials for dental applications although CAD

  14. A reversible adsorption-desorption interface of DNA based on nano-sized zirconia and its application.

    PubMed

    Liu, Shou-Qing; Xu, Jing-Juan; Chen, Hong-Yuan

    2004-08-01

    It is essential for the information storage in DNA-based bio-chips to construct a reversible exchange interface of DNA. Here, a highly reproducible and reversible adsorption-desorption interface of DNA based on the nano-sized zirconia in different pH solution was successfully fabricated. The results showed that DNA can be adsorbed onto the nano-sized zirconia from its solution, and can desorb from the nanoparticles in 0.10 M KOH solution. When the matrix with nanoparticles returns to the DNA solution again, DNA can be re-adsorbed onto them as initial state. Moreover, the interaction of DNA with non-electroactive molecules, 2,2'-bipyridine, has been studied by electrochemistry method in the aid of probe Co(phen)(3)(3+). The experiments showed that when 2,2'-bipyridine was added into the test solution, the voltammetric peak currents of Co(phen)(3)(3+) decreased; and the decrease value of peak current against the concentration of 2,2'-bipyridine has a good Langmuir relationship, by which the equilibrium constant of interaction between 2,2'-bipyridine and DNA was estimated to be 1.57 x 10(4)M(-1).

  15. Application of sol gel spin coated yttria-stabilized zirconia layers for the improvement of solid oxide fuel cell electrolytes produced by atmospheric plasma spraying

    NASA Astrophysics Data System (ADS)

    Rose, Lars; Kesler, Olivera; Tang, Zhaolin; Burgess, Alan

    Due to its high thermal stability and purely oxide ionic conductivity, yttria-stabilized zirconia (YSZ) is the most commonly used electrolyte material for solid oxide fuel cells (SOFCs). Standard electrolyte fabrication techniques for planar SOFCs involve wet ceramic techniques such as tape-casting or screen printing, requiring sintering steps at temperatures above 1300 °C. Plasma spraying (PS) may provide a more rapid and cost efficient method to produce SOFCs without sintering. High-temperature sintering requires long processing times and can lead to oxidation of metal alloys used as mechanical supports, or to detrimental interreactions between the electrolyte and adjacent electrode layers. This study investigates the use of spin coated sol gel derived YSZ precursor solutions to fill the pores present in plasma sprayed YSZ layers, and to enhance the surface area for reaction at the electrolyte-cathode interface, without the use of high-temperature firing steps. The effects of different plasma conditions and sol concentrations and solid loadings on the gas permeability and fuel cell performance have been investigated.

  16. Effects of Nd:YAG laser treatment on the wettability characteristics of a zirconia-based bioceramic

    NASA Astrophysics Data System (ADS)

    Hao, L.; Lawrence, J.

    2006-08-01

    By enhancing the wettability characteristics of a zirconia-based bioceramic, magnesia partially stabilised zirconia (MgO-PSZ) using Nd:YAG laser irradiation, beneficial changes in the way biological fluids interact with the material will be achieved. This will consequently improve the bone-implant interface. Contact angle measurements revealed that the Nd:YAG laser-treated MgO-PSZ exhibited a considerable reduction in contact angle, θ, implying that laser treatment brought about improved wettability characteristics of this material. The changes in surface properties generated by the laser irradiation and their effects on the wettability characteristics of the MgO-PSZ were analysed. Notably, the complete melting and solidified different microstructure following laser treatment gave rise to the maximum wettability characteristics. It was found that although the increase in surface roughness is the factor influencing the wettability characteristics, it only plays a minor role. Both the enhancement in surface oxygen content and the increase in polar component of surface energy, γsvp, were seen to be influential factors in determining the wettability characteristics of the MgO-PSZ. Moreover, the increase in γsvp was found to be the chief mechanism governing the change in wettability characteristics of the MgO-PSZ.

  17. Microstructure and mechanical properties of bulk and plasma-sprayed y2O3-partially stabilized zirconia

    NASA Technical Reports Server (NTRS)

    Valentine, P. G.; Maier, R. D.

    1980-01-01

    Bulk 8.0 weight percent yttria partially stabilied zirconia (PSZ) was studied by light microscopy, transmission electron microscopy, X-ray analysis, microhardness testing, and fracture toughness testing. The as received PSZ contained spheroidal and grain boundary precipitates up to 4 micrometers in size. Spheroids up to 1.26 micrometers were metastable tetragonal; large spheroids were monoclinic. Grinding the PSZ into powder did not cause a significant amount of tetragonal to transform to monoclinic. This indicates that transformation toughness is not a significant mechanism in PSZ. Aging the PSZ at 1500 C caused the fine tetragonal precipitates to grow from 0.06 to 0.12 micrometers, in 250 minutes. A peak hardness of 1400 kg/sq mm was attained after 50 minutes. Solution annealing and quenching the as received PSZ eliminated the large precipitates, but fine tetragonal precipitates reformed on quenching. Aging at 1500 C caused the fine 0.02 micrometers tetragonal precipitates to grow into plates about 0.10 by 0.50 micrometers. A peak hardness of 1517 kg/sq mm was obtained after 250 minutes. On further aging, monoclinic percipitates formed along grain boundaries. The fracture toughness of the aged and unaged solution annealed and quenched PSZ was found to be between 2 and 3 MN /square root of m cubed. This range of fracture toughness is consistent with PSZ's that do not undergo transformation toughening.

  18. Fabrication and evaluation of solid-oxide fuel cell anodes employing reaction-sintered yttria-stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Storjohann, Daniel; Daggett, James; Sullivan, Neal P.; Zhu, Huayang; Kee, Robert J.; Menzer, Sophie; Beeaff, Dustin

    This paper reports on the fabrication and performance of solid-oxide fuel cell (SOFC) anodes utilizing yttria reaction-sintered zirconia (YRSZ). Through the reaction-sintering process, the technical-grade YSZ commonly used in the Ni-YSZ anode cermet is replaced with lower-cost ZrO 2 and Y 2O 3 materials. When sintered in the presence of nickel oxide, ZrO 2 and Y 2O 3 form cubic-phase YSZ at temperatures characteristic of SOFC processing (1400-1550 ° C). Reaction sintering enables the formation of YSZ during cell fabrication, reducing SOFC anode raw-materials cost and the number of SOFC-fabrication processes. This paper reports the results of a broad range of characterization and performance measurements to evaluate the YRSZ material, including (1) crystal structure, (2) morphology, (3) pore-size distribution, (4) electronic resistivity, (5) fracture strength, (6) gas transport and catalytic activity, and (7) electrochemical performance. Material properties and performance are found to be comparable to or better than equivalent materials fabricated by conventional processes.

  19. Evaluation of a new carbon/zirconia-based sorbent for cleanup of food extracts in multiclass analysis of pesticides and environmental contaminants

    USDA-ARS?s Scientific Manuscript database

    A novel carbon/zirconia based material, SupelTM QuE Verde (Verde), was evaluated in a filter-vial dispersive solid phase extraction (d-SPE) cleanup of QuEChERS extracts of pork, salmon, kale, and avocado for residual analysis of pesticides and environmental contaminants. Low pressure (LP) GC-MS/MS w...

  20. Durability of zirconia thermal-barrier ceramic coatings on air-cooled turbine blades in cyclic jet engine operation

    NASA Technical Reports Server (NTRS)

    Liebert, C. H.; Jacobs, R. E.; Stecura, S.; Morse, C. R.

    1976-01-01

    Thermal barrier ceramic coatings of stabilized zirconia over a bond coat of Ni Cr Al Y were tested for durability on air cooled turbine rotor blades in a research turbojet engine. Zirconia stabilized with either yttria, magnesia, or calcia was investigated. On the basis of durability and processing cost, the yttria stabilized zirconia was considered the best of the three coatings investigated.

  1. Zirconia based superhydrophobic coatings on cotton fabrics exhibiting excellent durability for versatile use

    PubMed Central

    Das, Indranee; De, Goutam

    2015-01-01

    A fluorinated silyl functionalized zirconia was synthesized by the sol-gel method to fabricate an extremely durable superhydrophobic coating on cotton fabrics by simple immersion technique. The fabric surfaces firmly attached with the coating material through covalent bonding, possessed superhydrophobicity with high water contact angle ≈163 ± 1°, low hysteresis ≈3.5° and superoleophilicity. The coated fabrics were effective to separate oil/water mixture with a considerably high separation efficiency of 98.8 wt% through ordinary filtering. Presence of highly stable (chemically and mechanically) superhydrophobic zirconia bonded with cellulose makes such excellent water repelling ability of the fabrics durable under harsh environment conditions like high temperature, strong acidic or alkaline solutions, different organic solvents and mechanical forces including extensive washings. Moreover, these coated fabrics retained self-cleanable superhydrophobic property as well as high water separation efficiency even after several cycles, launderings and abrasions. Therefore, such robust superhydrophobic ZrO2 coated fabrics have strong potential for various industrial productions and uses. PMID:26678754

  2. Zirconia based superhydrophobic coatings on cotton fabrics exhibiting excellent durability for versatile use

    NASA Astrophysics Data System (ADS)

    Das, Indranee; de, Goutam

    2015-12-01

    A fluorinated silyl functionalized zirconia was synthesized by the sol-gel method to fabricate an extremely durable superhydrophobic coating on cotton fabrics by simple immersion technique. The fabric surfaces firmly attached with the coating material through covalent bonding, possessed superhydrophobicity with high water contact angle ≈163 ± 1°, low hysteresis ≈3.5° and superoleophilicity. The coated fabrics were effective to separate oil/water mixture with a considerably high separation efficiency of 98.8 wt% through ordinary filtering. Presence of highly stable (chemically and mechanically) superhydrophobic zirconia bonded with cellulose makes such excellent water repelling ability of the fabrics durable under harsh environment conditions like high temperature, strong acidic or alkaline solutions, different organic solvents and mechanical forces including extensive washings. Moreover, these coated fabrics retained self-cleanable superhydrophobic property as well as high water separation efficiency even after several cycles, launderings and abrasions. Therefore, such robust superhydrophobic ZrO2 coated fabrics have strong potential for various industrial productions and uses.

  3. Enhanced low-temperature power density of solid oxide fuel cell by nickel nanoparticle infiltration into pre-fired Ni/yttria-stabilized zirconia anode.

    PubMed

    Kang, Lee-Seung; Park, Jae Layng; Lee, Sungkyu; Jin, Yun-Ho; Hong, Hyun-Seon; Lee, Chan-Gi; Kim, Bum Sung

    2014-12-01

    The Ni/yttria-stabilized zirconia (YSZ) anode morphology of an anode-supported solid oxide fuel cell (SOFC) unit cell was improved by nickel nanoparticle infiltration. A colloidal route was selected for efficient fabrication of nickel metal nanoparticles and subsequent infiltration into the Ni/YSZ anode of a pre-fired SOFC unit cell. The power density of the anode-supported SOFC unit cell was measured by the potentiostatic method to investigate the effect of nickel nanoparticle infiltration. The increase in the power density of the Ni/YSZ anode with nickel nanoparticle infiltration became gradually less significant as the SOFC operating temperature increased from 700 to 800 degrees C. The improved performance of the Ni/YSZ anode with nickel nanoparticle infiltration compared to that of an anode without nickel nanoparticles is tentatively attributed to two factors: The discretely distributed nanoparticles on the nanostructured electrodes exhibited significant catalytic effects on the electrochemical performance of the electrodes, in addition to substantially increasing the triple phase boundary lengths.

  4. Slurry spin coating of thin film yttria stabilized zirconia/gadolinia doped ceria bi-layer electrolytes for solid oxide fuel cells

    NASA Astrophysics Data System (ADS)

    Kim, Hyun Joong; Kim, Manjin; Neoh, Ke Chean; Han, Gwon Deok; Bae, Kiho; Shin, Jong Mok; Kim, Gyu-Tae; Shim, Joon Hyung

    2016-09-01

    Thin ceramic bi-layered membrane comprising yttria-stabilized zirconia (YSZ) and gadolinia-doped ceria (GDC) is fabricated by the cost-effective slurry spin coating technique, and it is evaluated as an electrolyte of solid oxide fuel cells (SOFCs). It is demonstrated that the slurry spin coating method is capable of fabricating porous ceramic films by adjusting the content of ethyl-cellulose binders in the source slurry. The porous GDC layer deposited by spin coating under an optimal condition functions satisfactorily as a cathode-electrolyte interlayer in the test SOFC stack. A 2-μm-thick electrolyte membrane of the spin-coated YSZ/GDC bi-layer is successfully deposited as a dense and stable film directly on a porous NiO-YSZ anode support without any interlayers, and the SOFC produces power output over 200 mW cm-2 at 600 °C, with an open circuit voltage close to 1 V. Electrochemical impedance spectra analysis is conducted to evaluate the performance of the fuel cell components in relation with the microstructure of the spin-coated layers.

  5. Microstructure tailoring of the nickel oxide-Yttria-stabilized zirconia hollow fibers toward high-performance microtubular solid oxide fuel cells.

    PubMed

    Liu, Tong; Ren, Cong; Fang, Shumin; Wang, Yao; Chen, Fanglin

    2014-11-12

    NiO-yttria-stabilized zirconia (YSZ) hollow fiber anode support with different microstructures was prepared using a phase-inversion method. The effect of the solid loading of the phase-inversion suspensions on the microstructure development of the NiO-YSZ anode support was investigated. Solid loading in the suspension was found to have an important influence on the microstructure of the NiO-YSZ anode support and viscosity-related viscous fingering mechanism can be adopted to explain the pore formation mechanism of the as-prepared hollow fibers. NiO-YSZ anode-supported microtubular solid oxide fuel cells (SOFCs) with different anode microstructures were fabricated and tested, and the correlation between the anode support microstructures, porosity, gas permeability, electrical conductivity, and the cell electrochemical performance was discussed. Microtubular SOFCs with a cell configuration of Ni-YSZ/YSZ/YSZ-LSM (LSM = (La(0.8)Sr(0.2))(0.95)MnO(3-x)) and optimized anode microstructure show cell output power density of 833.9 mW cm(-2) at 750 °C using humidified H2 as fuel and ambient air as oxidant.

  6. Corrosion Behavior of Yttria-Stabilized Zirconia-Coated 9Cr-1Mo Steel in Molten UCl3-LiCl-KCl Salt

    NASA Astrophysics Data System (ADS)

    Jagadeeswara Rao, Ch.; Venkatesh, P.; Prabhakara Reddy, B.; Ningshen, S.; Mallika, C.; Kamachi Mudali, U.

    2017-02-01

    For the electrorefining step in the pyrochemical reprocessing of spent metallic fuels of future sodium cooled fast breeder reactors, 9Cr-1Mo steel has been proposed as the container material. The electrorefining process is carried out using 5-6 wt.% UCl3 in LiCl-KCl molten salt as the electrolyte at 500 °C under argon atmosphere. In the present study, to protect the container vessel from hot corrosion by the molten salt, 8-9% yttria-stabilized zirconia (YSZ) ceramic coating was deposited on 9Cr-1Mo steel by atmospheric plasma spray process. The hot corrosion behavior of YSZ-coated 9Cr-1Mo steel specimen was investigated in molten UCl3-LiCl-KCl salt at 600 °C for 100-, 500-, 1000- and 2000-h duration. The results revealed that the weight change in the YSZ-coated specimen was insignificant even after exposure to molten salt for 2000 h, and delamination of coating did not occur. SEM examination showed the lamellar morphology of the YSZ coating after the corrosion test with occluded molten salt. The XRD analysis confirmed the presence of tetragonal and cubic phases of ZrO2, without any phase change. Formation of UO2 in some regions of the samples was evident from XRD results.

  7. Effect of tar fractions from coal gasification on nickel-yttria stabilized zirconia and nickel-gadolinium doped ceria solid oxide fuel cell anode materials

    NASA Astrophysics Data System (ADS)

    Lorente, E.; Berrueco, C.; Millan, M.; Brandon, N. P.

    2013-11-01

    The allowable tar content in gasification syngas is one of the key questions for the exploitation of the full potential of fuel cell concepts with integrated gasification systems. A better understanding of the interaction between tars and the SOFC anodes which leads to carbon formation and deposition is needed in order to design systems where the extent of gas cleaning operations is minimized. Model tar compounds (toluene, benzene, naphthalene) have been used in experimental studies to represent those arising from biomass/coal gasification. However, the use of toluene as a model tar overestimates the negative impact of a real gasification tar on SOFC anode degradation associated with carbon formation. In the present work, the effect of a gasification tar and its distillation fractions on two commercially available fuel cell anodes, Ni/YSZ (yttria stabilized zirconia) and Ni/CGO (gadolinium doped ceria), is reported. A higher impact of the lighter tar fractions was observed, in terms of more carbon formation on the anodes, in comparison with the whole tar sample. The characterization of the recovered tars after contact with the anode materials revealed a shift towards a heavier molecular weight distribution, reinforcing the view that these fractions have reacted on the anode.

  8. Combined electrochemical and X-ray tomography study of the high temperature evolution of Nickel - Yttria Stabilized Zirconia solid oxide fuel cell anodes

    NASA Astrophysics Data System (ADS)

    Kennouche, David; Chen-Wiegart, Yu-chen Karen; Riscoe, Casey; Wang, Jun; Barnett, Scott A.

    2016-03-01

    Accelerated ageing of Ni-Yttria Stabilized Zirconia (YSZ) anode functional layers (AFLs) in solid oxide fuel cells (SOFCs) is carried out at 1000-1200 °C, the resulting morphological changes are investigated using transmission X-ray microscopy (TXM), and properties are characterized using electrochemical impedance spectroscopy (EIS). Prior to ageing, the as prepared NiO-YSZ AFLs are reduced to Ni-YSZ and then aged at 1100 °C for 100 h in order to eliminate early-stage morphological changes. Measured particle size and three phase boundary (TPB) density changes with ageing time and temperature are fit reasonably well using a power-law coarsening model. This model is also used in conjunction with an electrochemical model to predict changes in the anode charge-transfer polarization resistance. The models are used to make predictions of the structural and electrochemical performance evolution of these Ni-YSZ anodes, for cells operated long-term at normal (700-850 °C) operating temperatures. Additional experiments to verify the model predictions are suggested.

  9. Ionic Conductivity of Mesostructured Yttria-Stabilized Zirconia Thin Films with Cubic Pore Symmetry—On the Influence of Water on the Surface Oxygen Ion Transport.

    PubMed

    Elm, Matthias T; Hofmann, Jonas D; Suchomski, Christian; Janek, Jürgen; Brezesinski, Torsten

    2015-06-10

    Thermally stable, ordered mesoporous thin films of 8 mol % yttria-stabilized zirconia (YSZ) were prepared by solution-phase coassembly of chloride salt precursors with an amphiphilic diblock copolymer using an evaporation-induced self-assembly process. The resulting material is of high quality and exhibits a well-defined three-dimensional network of pores averaging 24 nm in diameter after annealing at 600 °C for several hours. The wall structure is polycrystalline, with grains in the size range of 7 to 10 nm. Using impedance spectroscopy, the total electrical conductivity was measured between 200 and 500 °C under ambient atmosphere as well as in dry atmosphere for oxygen partial pressures ranging from 1 to 10(-4) bar. Similar to bulk YSZ, a constant ionic conductivity is observed over the whole oxygen partial pressure range investigated. In dry atmosphere, the sol-gel derived films have a much higher conductivity, with different activation energies for low and high temperatures. Overall, the results indicate a strong influence of the surface on the transport properties in cubic fluorite-type YSZ with high surface-to-volume ratio. A qualitative defect model which includes surface effects (annihilation of oxygen vacancies as a result of water adsorption) is proposed to explain the behavior and sensitivity of the conductivity to variations in the surrounding atmosphere.

  10. Material properties of pulsed-laser crystallized Si thin films grown on yttria-stabilized zirconia crystallization-induction layers by two-step irradiation method

    NASA Astrophysics Data System (ADS)

    Thi Kieu Lien, Mai; Horita, Susumu

    2016-03-01

    Amorphous Si thin films on yttria-stabilized zirconia (YSZ) layers were crystallized widely in solid phase by the two-step method with a pulsed laser, moving the sample stage. The crystalline quality, impurity diffusion, and electrical properties of the crystallized Si films were investigated. It was found that the crystallinity of the Si thin films was improved and their surface was smooth without an incubation layer at the interface, indicating the uniform crystallinity of Si on YSZ. The diffusion of Zr and Y into the Si thin films was as small as or smaller than the order of 1017 atoms/cm3. We evaluated the electrical properties of carrier concentration and Hall mobility of the Si thin films with/without YSZ layers by using the resistivity and AC Hall effect measurements. The temperature and doping concentration dependences were measured for both undoped and P-doped films. It was found that both the undoped and P-doped Si/YSZ/glass films showed higher mobilities and carrier concentrations (and therefore higher conductivities), which indicate a smaller number of defects, than the Si/glass films. This suggested that the Si film crystallized on the YSZ layer is more suitable for application to electronic devices than the Si film on glass.

  11. H 2O chemisorption and H 2 oxidation on yttria-stabilized zirconia: Density functional theory and temperature-programmed desorption studies

    NASA Astrophysics Data System (ADS)

    Gorski, Alexandr; Yurkiv, Vitaliy; Starukhin, Dzmitry; Volpp, Hans-Robert

    The mechanism of H 2O dissociation as well as the adsorption and oxidation reaction of H 2 on yttria-stabilized zirconia (YSZ), commonly used as part of solid oxide fuel cell (SOFC) anodes, was investigated employing temperature-programmed desorption (TPD) spectroscopy and density functional theory (DFT). In agreement with theory the experimental results show that interaction of gaseous H 2O with YSZ results in dissociative adsorption leading to strongly bound OH surface species. In the interaction of gaseous H 2 with an oxygen-enriched YSZ surface (YSZ + O) similar OH surface species are formed as reaction intermediates in the H 2 oxidation. Our experiments showed that in both the H 2O/YSZ and the H 2/YSZ + O heterogeneous reaction systems noticeable amounts of H 2O are "dissolved" in the bulk as interstitial hydrogen and hydroxyl species. The experimental H 2O desorption data is used to access the accuracy of the H 2/H 2O/YSZ adsorption/desorption and surface reaction kinetics data, employed in previous modeling studies of the electrochemical H 2 oxidation on Ni-pattern/YSZ model anodes by Vogler et al. [J. Electrochem. Soc., 156 (2009) B663] and Goodwin et al. [J. Electrochem. Soc., 156 (2009) B1004]. Finally a refined experimentally validated H 2/H 2O/YSZ adsorption/desorption and surface reaction kinetics data set is presented.

  12. Synthesis and characterization of scandia ceria stabilized zirconia powders prepared by polymeric precursor method for integration into anode-supported solid oxide fuel cells

    NASA Astrophysics Data System (ADS)

    Tu, Hengyong; Liu, Xin; Yu, Qingchun

    2011-03-01

    Scandia ceria stabilized zirconia (10Sc1CeSZ) powders are synthesized by polymeric precursor method for use as the electrolyte of anode-supported solid oxide fuel cell (SOFC). The synthesized powders are characterized in terms of crystalline structure, particle shape and size distribution by X-ray diffraction (XRD), transmission electron microscopy (TEM) and photon correlation spectroscopy (PCS). 10Sc1CeSZ electrolyte films are deposited on green anode substrate by screen-printing method. Effects of 10Sc1CeSZ powder characteristics on sintered films are investigated regarding the integration process for application as the electrolytes in anode-supported SOFCs. It is found that the 10Sc1CeSZ films made from nano-sized powders with average size of 655 nm are very porous with many open pores. In comparison, the 10Sc1CeSZ films made from micron-sized powders with average size of 2.5 μm, which are obtained by calcination of nano-sized powders at higher temperatures, are much denser with a few closed pinholes. The cell performances are 911 mW cm-2 at the current density of 1.25 A cm-2 and 800 °C by application of Ce0.8Gd0.2O2 (CGO) barrier layer and La0.6Sr0.4CoO3 (LSC) cathode.

  13. Muon-Spin-Rotation study of yttria-stabilized zirconia (ZrO2:Y): Evidence for muon and electron separate traps

    NASA Astrophysics Data System (ADS)

    Vieira, R. B. L.; Vilão, R. C.; Gordo, P. M.; Marinopoulos, A. G.; Alberto, H. V.; Piroto Duarte, J.; Gil, J. M.; Weidinger, A.; Lord, J. S.

    2014-12-01

    This paper is part of an extended study of oxide materials with the μSR technique. As an example, we present here experimental data on yttria-stabilized zirconia (ZrO2 doped with 8% Y2O3). Three different muon states can be distinguished: i) Deep muonium (less than 17(1)% fraction), seen as a fast-relaxing signal or indirectly via decoupling measurements in high longitudinal fields, ii) μ+ in a paramagnetic environment 62(6)% fraction), characterized by a very weak but clearly-visible hyperfine interaction, and iii) diamagnetic muon 21(1)% fraction); the diamagnetic signal is broadened only by the interaction with nuclear moments. The state corresponding to μ+ in a paramagnetic environment and the diamagnetic state are attributed to the same (oxygen-bound) muon configuration, but we assume that they have different electron surroundings (with or without an unpaired electron in the vicinity). The paramagnetic electron is not captured in the Coulomb potential of the positive muon but is self-trapped (polaron formation) at a nearby Zr ion. The distant electron interacts with the muon only via dipolar magnetic fields. This explains the very weak hyperfine interaction felt by the μ+ state in a paramagnetic environment. A further result of the experiment is that the disappearance of this signal with increasing temperature is not due to ionization of an electron shallowly bound to the muon but is caused by rapid spin fluctuations of the electron, averaging the hyperfine interaction to zero.

  14. High performance novel gadolinium doped ceria/yttria stabilized zirconia/nickel layered and hybrid thin film anodes for application in solid oxide fuel cells

    NASA Astrophysics Data System (ADS)

    Garcia-Garcia, F. J.; Beltrán, A. M.; Yubero, F.; González-Elipe, A. R.; Lambert, R. M.

    2017-09-01

    Magnetron sputtering under oblique angle deposition was used to produce Ni-containing ultra thin film anodes comprising alternating layers of gadolinium doped ceria (GDC) and yttria stabilized zirconia (YSZ) of either 200 nm or 1000 nm thickness. The evolution of film structure from initial deposition, through calcination and final reduction was examined by XRD, SEM, TEM and TOF-SIMS. After subsequent fuel cell usage, the porous columnar architecture of the two-component layered thin film anodes was maintained and their resistance to delamination from the underlying YSZ electrolyte was superior to that of corresponding single component Ni-YSZ and Ni-GDC thin films. Moreover, the fuel cell performance of the 200 nm layered anodes compared favorably with conventional commercially available thick anodes. The observed dependence of fuel cell performance on individual layer thicknesses prompted study of equivalent but more easily fabricated hybrid anodes consisting of simultaneously deposited Ni-GDC and Ni-YSZ, which procedure resulted in exceptionally intimate mixing and interaction of the components. The hybrids exhibited very unusual and favorable Isbnd V characteristics, along with exceptionally high power densities at high currents. Their discovery is the principal contribution of the present work.

  15. Electrochemical characteristics of samaria-doped ceria infiltrated strontium-doped LaMnO3 cathodes with varied thickness for yttria-stabilized zirconia electrolytes

    SciTech Connect

    Dong Ding; Mingyang Gonga; Chunchuan Xu; Nicholas Baxter; Yihong Li; John Zondlo; Kirk Gerdes; Xingbo Liu

    2010-11-09

    Samaria-doped ceria (SDC) infiltrated into strontium-doped LaMnO3 (LSM) cathodes with varied cathode thickness on yttria-stabilized zirconia (YSZ) were investigated via symmetrical cell, half cell, and full cell configurations. The results of the symmetrical cells showed that the interfacial polarization resistance (RP) decreased with increasing electrode thickness up to∼30#2;m, and further increases in the thickness of the cathode did not cause significant variation of electrode performance. At 800 ◦C, the minimum RP was around 0.05#2;cm2. The impedance spectra indicated that three main electrochemical processes existed, possibly corresponding to the oxygen ion incorporation, surface diffusion of oxygen species and oxygen adsorption and dissociation. The DC polarization on the half cells and characterization of the full cells also demonstrated a similar correlation between the electrode performance and the electrode thickness. The peak power densities of the single cells with the 10, 30, and 50-#2;m thick electrodes were 0.63, 1.16 and 1.11Wcm−2, respectively. The exchange current densities under moderate polarization are calculated and possible rate-determining steps are discussed.

  16. Ion-beam-assisted deposition of biaxially aligned yttria-stabilized zirconia template films on metallic substrates for YBCO-coated conductors

    NASA Astrophysics Data System (ADS)

    Ma, B.; Li, M.; Fisher, B. L.; Balachandran, U.

    2002-07-01

    Biaxially textured yttria-stabilized zirconia (YSZ) films were grown on mechanically polished Hastelloy C276 (HC) substrates by ion-beam-assisted deposition and electron-beam evaporation. The surface root-mean-square (RMS) roughness of the polished HC substrates was ≈3 nm, as measured by atomic force microscopy (AFM). A water-cooled sample stage was used to hold the substrate temperature below 100 °C during deposition. RMS roughness of ≈3.3 nm was measured on the deposited YSZ films by AFM. X-ray pole figures were conducted for texture analysis; in-plane texture measured from YSZ (111) φ-scan FWHM was 13.2° and out-of-plane texture from the YSZ (002) ω-scan FWHM was 7.7°. An ≈10 nm thick CeO2 buffer layer was deposited on the YSZ film at 800 °C before YBCO films were ablated by pulsed laser deposition at 780 °C in a 250 mTorr flowing oxygen environment. Good in-plane texture with FWHM ≈ 7° was observed in YBCO films. Tc = 90 K, with sharp transition, and transport Jc of ≈2.2 × 106 A cm-2 were observed in a 0.5 μm thick, 5 mm wide, and 1 cm long sample at 77 K in self-field.

  17. Effects of Dopant Metal Variation and Material Synthesis Method on the Material Properties of Mixed Metal Ferrites in Yttria Stabilized Zirconia for Solar Thermochemical Fuel Production

    DOE PAGES

    Leonard, Jeffrey; Reyes, Nichole; Allen, Kyle M.; ...

    2015-01-01

    Mixed metal ferrites have shown much promise in two-step solar-thermochemical fuel production. Previous work has typically focused on evaluating a particular metal ferrite produced by a particular synthesis process, which makes comparisons between studies performed by independent researchers difficult. A comparative study was undertaken to explore the effects different synthesis methods have on the performance of a particular material during redox cycling using thermogravimetry. This study revealed that materials made via wet chemistry methods and extended periods of high temperature calcination yield better redox performance. Differences in redox performance between materials made via wet chemistry methods were minimal andmore » these demonstrated much better performance than those synthesized via the solid state method. Subsequently, various metal ferrite samples (NiFe 2 O 4 , MgFe 2 O 4 , CoFe 2 O 4 , and MnFe 2 O 4 ) in yttria stabilized zirconia (8YSZ) were synthesized via coprecipitation and tested to determine the most promising metal ferrite combination. It was determined that 10 wt.% CoFe 2 O 4 in 8YSZ produced the highest and most consistent yields of O 2 and CO. By testing the effects of synthesis methods and dopants in a consistent fashion, those aspects of ferrite preparation which are most significant can be revealed. More importantly, these insights can guide future efforts in developing the next generation of thermochemical fuel production materials.« less

  18. Application of rare earth modified Zr-based ceria-zirconia solid solution in three-way catalyst for automotive emission control.

    PubMed

    Wang, Qiuyan; Zhao, Bo; Li, Guangfeng; Zhou, Renxian

    2010-05-15

    Automotive exhaust emission is a major cause of air pollution. Three-way catalyst (TWC) which can eliminate CO, HC (hydrocarbons), and NO(x) simultaneously has been used to control exhaust emissions. Ceria-zirconia is a key component in TWC and most researchers pay attention to Ceria-Zirconia (Ce-rich) solid solution. The research presented in this paper is focused on the intrinsic structure of Ceria-Zirconia (Zr-based) solid solution and its application in TWC. A series of Ce(0.2)Zr(0.8)O(2) modified with rare earths (La, Nd, Pr, Sm, and Y) have been prepared by coprecipitation method combined with supercritical drying technique. All samples showed single tetragonal solid solution, indicating that the rare earth ion inserted into the lattice structure completely, and an approximately linearly relationship between lattice parameter a and the ionic radius of doped rare earth was observed. The catalytic performances of corresponding Pd-only catalysts were investigated in simulated exhaust gas. The presence of La, Nd, and Pr was favorable to the catalytic activity and wide air/fuel operation window. The relationship between the intrinsic structure of the Zr-based ceria-zirconia solid solution and catalytic activity was discussed in detail, which has some reference value for catalyst design and application.

  19. Influence of surface treatment on the in-vitro fracture resistance of zirconia-based all-ceramic anterior crowns.

    PubMed

    Schmitter, M; Lotze, G; Bömicke, W; Rues, S

    2015-12-01

    The purpose of this study was to assess the effect of surface treatment on the fracture resistance of zirconia-based all-ceramic anterior crowns. Sixty-four zirconia-based all-ceramic anterior crowns, veneered by use of a press-on technique, were produced. For 48 crowns intraoral adjustment was simulated (A-group), 16 crowns remained unadjusted (WA-group). The adjusted area was then treated in three ways: 1. no further surface treatment; 2. polishing, with irrigation, using polishers interspersed with diamond grit for ceramics; and 3. polishing and glaze firing. Half of the specimens were loaded until fracture in an universal testing device without artificial ageing; the other crowns underwent thermocycling and chewing simulation before ultimate-load testing. Explorative statistical analysis was performed by use of non-parametric and parametric tests. In addition, fracture-strength tests according to ISO 6872 were performed for veneer ceramic subjected to the different surface treatments. Finite element analysis was also conducted for the crowns, and surface roughness was measured. Crowns in the A-group were more sensitive to aging than crowns in the WA-group (p=0.038). Although both polishing and glaze firing slightly improved the fracture resistance of the specimens, the fracture resistance in the WA-group (initial fracture resistance (IFR): 652.0 ± 107.7N, remaining fracture resistance after aging (RFR): 560.6 ± 233.3N) was higher than the fracture resistance in the A-group (polished: IFR: 477.9 ± 108.8N, RFR: 386.0 ± 218.5N; glaze firing: IFR: 535.5 ± 128.0N, RFR: 388.6 ± 202.2N). Surface roughness without adjustment was Ra=0.1 μm; for adjustment but without further treatment it was Ra=1.4 μm; for adjustment and polishing it was Ra=0.3 μm; and for adjustment, polishing, and glazing it was Ra=0.6 μm. Stress distributions obtained by finite element analysis in combination with fracture strength tests showed that fractures most probably originated from

  20. Shear Bond Strengths between Three Different Yttria-Stabilized Zirconia Dental Materials and Veneering Ceramic and Their Susceptibility to Autoclave Induced Low-Temperature Degradation

    PubMed Central

    Sehgal, Manoti; Bhargava, Akshay; Gupta, Sharad; Gupta, Prateek

    2016-01-01

    A study was undertaken to evaluate the effect of artificial aging through steam and thermal treatment as influencing the shear bond strength between three different commercially available zirconia core materials, namely, Upcera, Ziecon, and Cercon, layered with VITA VM9 veneering ceramic using Universal Testing Machine. The mode of failure between zirconia and ceramic was further analyzed as adhesive, cohesive, or mixed using stereomicroscope. X-ray diffraction and SEM (scanning electron microscope) analysis were done to estimate the phase transformation (m-phase fraction) and surface grain size of zirconia particles, respectively. The purpose of this study was to simulate the clinical environment by artificial aging through steam and thermal treatment so as the clinical function and nature of the bond between zirconia and veneering material as in a clinical trial of 15 years could be evaluated. PMID:27293439

  1. Shear Bond Strengths between Three Different Yttria-Stabilized Zirconia Dental Materials and Veneering Ceramic and Their Susceptibility to Autoclave Induced Low-Temperature Degradation.

    PubMed

    Sehgal, Manoti; Bhargava, Akshay; Gupta, Sharad; Gupta, Prateek

    2016-01-01

    A study was undertaken to evaluate the effect of artificial aging through steam and thermal treatment as influencing the shear bond strength between three different commercially available zirconia core materials, namely, Upcera, Ziecon, and Cercon, layered with VITA VM9 veneering ceramic using Universal Testing Machine. The mode of failure between zirconia and ceramic was further analyzed as adhesive, cohesive, or mixed using stereomicroscope. X-ray diffraction and SEM (scanning electron microscope) analysis were done to estimate the phase transformation (m-phase fraction) and surface grain size of zirconia particles, respectively. The purpose of this study was to simulate the clinical environment by artificial aging through steam and thermal treatment so as the clinical function and nature of the bond between zirconia and veneering material as in a clinical trial of 15 years could be evaluated.

  2. Analysis of the peri-implant soft tissues in contact with zirconia abutments: an evidence-based literature review.

    PubMed

    de Medeiros, Rodrigo Antonio; Vechiato-Filho, Aljomar José; Pellizzer, Eduardo Piza; Mazaro, Jose Vitor Quinelli; dos Santos, Daniela Micheline; Goiato, Marcelo Coelho

    2013-05-01

    The aim of this study is to evaluate through a literature review, the soft tissue response in contact with zirconia abutments, including case reports comparing prosthetics rehabilitations with zirconia and titanium abutments upto 3 years of follow-up as well as the factors that should be considered on implant's abutment selection. Metallic abutments can provide grayish color when in contact with thin soft tissues which may lead the implant prosthetic treatment to failure. In this context, the abutments of zirconia stand out because there is an excellent linking between esthetics and the health of peri-implant soft tissues. A consult of the published researches was made on the PubMed database from 2000 to September 2012. The including criteria were: literature reviews, clinical studies and case reports in English that focused on the response of the soft tissue in contact with zirconia implant abutments. The studies that were not in English and did not match the tackled issue were excluded. A total of 32 articles were found. According to the search strategy, just 16 articles were selected for this review. Three studies affirmed that zirconia abutments have an excellent soft tissue response; one study showed increased gingival recession with zirconia abutments and nine studies do not stand out any difference on biological behavior between titanium and zirconia abutments. Three studies affirmed that zirconia abutments provide natural gingival appearance, anatomic contour and greater esthetics. The use of zirconia abutments is recommended for anterior regions because of their greater optical properties and esthetic results and more studies should be performed and analyzed longitudinally regarding their biological response. The zirconia abutments have been established to be essential in order to achieve great esthetic results in cases of thin peri-implant soft tissues and in regions where the three-dimensional placement of implants is more superficial.

  3. The wetting characteristics and surface tension of some Ni-based alloys on yttria, hafnia, alumina, and zirconia substrates

    NASA Technical Reports Server (NTRS)

    Kanetkar, C. S.; Kacar, A. S.; Stefanescu, D. M.

    1988-01-01

    The surface tension and wetting characteristics of four commercial Ni-based alloys (UD718, Waspaloy, UD720, and UD520), pure Ni, and three special alloys (Ni-20 percent Cr, Ni-20 percent Cr-1 percent Al, and Ni-20 percent Cr-4 percent Al) on various ceramic substrates (including alumina, zirconia, hafnia, and yttria) were investigated using sessile drop experiments. Most of the systems studied exhibited a nonwetting behavior. Wetting improved with holding time at a given temperature to the point that some systems, such as Ni-20Cr on alumina, Ni-20Cr-4Al on alumina and on yttria, became marginally wetting. Wetting characteristics were apparently related to constitutional undercooling, which in turn could be affected by the metal dissolving some of the substrate during measurements.

  4. The Effect of two Shading Techniques on Value of Zirconia-Based Crowns

    PubMed Central

    Hassan Ahangari, Ahmad; Torabi Ardakani, Kianoosh; Mahdavi, Farideh; Torabi Ardakani, Mahshid

    2015-01-01

    Statement of the Problem By introducing the coloring liquids, it is claimed that it is possible to make the color of frameworks fabricated from zirconium oxide extremely close to the natural tooth color. Purpose The purpose of this research was to evaluate the effect of two staining techniques on value changing in zirconia crowns. Materials and Method Three groups A, B, and C, each containing ten zirconia crowns, were used. The zirconium cores samples were fabricated by a CAD/CAM device. Group A was left uncolored, Groups B was submerged for two minutes in A2 coloring liquid and Group C was stained with brush. Then all cores were sintered and the porcelain was applied by using the layering technique. Ultimately, the crowns color was determined using a spectrophotometer. Their color changing (∆E) and value changing (∆L) in relation to A2 color were also assessed. The data were analyzed with one-sample t-test, post-hoc Tukey, and one-way ANOVA tests with significant level set at 0.05. Results The mean value in all groups was higher than the value obtained from A2 color samples (p= 0.001). The highest mean value was 78.31±1.22 belonging to group C (staining with brush) and the lowest mean value was 76.99±0.65 belonging to group B (submerging). The results of post-hoc Tukey regarding both ∆E and ∆L variables showed a significant difference between groups A (uncolored) and C (staining with brush) with P∆E=0.006 and P∆L=0.039, respectively. A significant difference between group B (submerging technique) and C (staining with brush) were shown when these two variables were compared (P∆E=0.001, P∆L=0.015). Conclusion Due to the higher value increase in surface staining (brush), it is recommended to use the submerging technique for staining zirconia cores. PMID:26046109

  5. Three- to nine-year survival estimates and fracture mechanisms of zirconia- and alumina-based restorations using standardized criteria to distinguish the severity of ceramic fractures.

    PubMed

    Moráguez, Osvaldo D; Wiskott, H W Anselm; Scherrer, Susanne S

    2015-12-01

    The aims of this study were set as follows: 1. To provide verifiable criteria to categorize the ceramic fractures into non-critical (i.e., amenable to polishing) or critical (i.e., in need of replacement) 2. To establish the corresponding survival rates for alumina and zirconia restorations 3. To establish the mechanism of fracture using fractography Fifty-eight patients restored with 115 alumina-/zirconia-based crowns and 26 zirconia-based fixed dental prostheses (FDPs) were included. Ceramic fractures were classified into four types and further subclassified into "critical" or "non-critical." Kaplan-Meier survival estimates were calculated for "critical fractures only" and "all fractures." Intra-oral replicas were taken for fractographic analyses. Kaplan-Meier survival estimates for "critical fractures only" and "all fractures" were respectively: Alumina single crowns: 90.9 and 68.3 % after 9.5 years (mean 5.71 ± 2.6 years). Zirconia single crowns: 89.4 and 80.9 % after 6.3 years (mean 3.88 ± 1.2 years). Zirconia FDPs: 68.6 % (critical fractures) and 24.6 % (all fractures) after 7.2 and 4.6 years respectively (FDP mean observation time 3.02 ± 1.4 years). No core/framework fractures were detected. Survival estimates varied significantly depending on whether "all" fractures were considered as failures or only those deemed as "critical". For all restorations, fractographic analyses of failed veneering ceramics systematically demonstrated heavy occlusal wear at the failure origin. Therefore, the relief of local contact pressures on unsupported ceramic is recommended. Occlusal contacts on mesial or distal ridges should systematically be eliminated. A classification standard for ceramic fractures into four categories with subtypes "critical" and "non-critical" provides a differentiated view of the survival of ceramic restorations.

  6. Large scale synthesis of nanostructured zirconia-based compounds from freeze-dried precursors

    SciTech Connect

    Gomez, A.; Villanueva, R.; Vie, D.; Murcia-Mascaros, S.; Martinez, E.; Beltran, A.; Sapina, F.; Vicent, M.; Sanchez, E.

    2013-01-15

    Nanocrystalline zirconia powders have been obtained at the multigram scale by thermal decomposition of precursors resulting from the freeze-drying of aqueous acetic solutions. This technique has equally made possible to synthesize a variety of nanostructured yttria or scandia doped zirconia compositions. SEM images, as well as the analysis of the XRD patterns, show the nanoparticulated character of those solids obtained at low temperature, with typical particle size in the 10-15 nm range when prepared at 673 K. The presence of the monoclinic, the tetragonal or both phases depends on the temperature of the thermal treatment, the doping concentration and the nature of the dopant. In addition, Rietveld refinement of the XRD profiles of selected samples allows detecting the coexistence of the tetragonal and the cubic phases for high doping concentration and high thermal treatment temperatures. Raman experiments suggest the presence of both phases also at relatively low treatment temperatures. - Graphical abstract: Zr{sub 1-x}A{sub x}O{sub 2-x/2} (A=Y, Sc; 0{<=}x{<=}0.12) solid solutions have been prepared as nanostructured powders by thermal decomposition of precursors obtained by freeze-drying, and this synthetic procedure has been scaled up to the 100 g scale. Highlights: Black-Right-Pointing-Pointer Zr{sub 1-x}A{sub x}O{sub 2-x/2} (A=Y, Sc; 0{<=}x{<=}0.12) solid solutions have been prepared as nanostructured powders. Black-Right-Pointing-Pointer The synthetic method involves the thermal decomposition of precursors obtained by freeze-drying. Black-Right-Pointing-Pointer The temperature of the thermal treatment controls particle sizes. Black-Right-Pointing-Pointer The preparation procedure has been scaled up to the 100 g scale. Black-Right-Pointing-Pointer This method is appropriate for the large-scale industrial preparation of multimetallic systems.

  7. Overview of zirconia with respect to gas turbine applications

    NASA Technical Reports Server (NTRS)

    Cawley, J. D.

    1984-01-01

    Phase relationships and the mechanical properties of zirconia are examined as well as the thermal conductivity, deformation, diffusion, and chemical reactivity of this refractory material. Observations from the literature particular to plasma-sprayed material and implications for gas turbine engine applications are discussed. The literature review indicates that Mg-PSZ (partially stabilized zirconia) and Ca-PSZ are unsuitable for advanced gas turbine applications; a thorough characterization of the microstructure of plasma-sprayed zirconia is needed. Transformation-toughened zirconia may be suitable for use in monolithic components.

  8. Are endodontically treated incisors reliable abutments for zirconia-based fixed partial dentures in the esthetic zone?

    PubMed

    Tunjan, René; Rosentritt, Martin; Sterzenbach, Guido; Happe, Arndt; Frankenberger, Roland; Seemann, Rainer; Naumann, Michael

    2012-04-01

    This ex vivo pilot study tested the influence of defect extension and quartz-fiber post placement (QFP) on the ex vivo survival rate and fracture resistance of root-treated upper central incisors served as abutments for zirconia 2-unit cantilever fixed partial dentures (2U-FPDs) exposed to 10 years of simulated clinical function. Human maxillary central incisors were endodontically treated and divided into the following 5 groups (n = 8): (1) access cavity filled with core build-up composite, (2) biproximal class III cavities filled as in group 1, (3) specimens restored as in group 2 with QFP placed, (4) specimens decoronated and core buildup as in group 1, and (5) specimens restored as in group 4 but with QFP as in group 3. On all specimens, 2U-FPDs were placed with dual-curing resin cement. In order to simulate 10 years of clinical function, specimens were exposed to thermal cycling and mechanical loading with subsequent loading to failure. Kaplan-Meier curves were constructed, and log-rank tests were performed. Fracture force and patterns were compared by means of Kruskal-Wallis, Mann-Whitney U (post hoc), and Fisher exact tests, respectively (P = .05). For specimens only with an access cavity, it was observed that 25% had catastrophic tooth fractures and the lowest load-to-fracture values. In all other groups, chipping combined with or without debonding occurred. Groups did not differ significantly regarding the survival rate (P = .603) and fracture patterns (P = .633), but they did for fracture load including technical failures (P = .017). After 10 years of simulated clinical function, both defect extension and placement of QFP had no significant influence on survival of root-treated upper central incisors as abutments restored with zirconia-based 2U-FPDs. Copyright © 2012 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  9. On the interfacial fracture resistance of resin-bonded zirconia and glass-infiltrated graded zirconia

    PubMed Central

    Chai, Herzl; Kaizer, Marina; Chughtai, Asima; Tong, Hui; Tanaka, Carina; Zhang, Yu

    2015-01-01

    Objective A major limiting factor for the widespread use of zirconia in prosthetic dentistry is its poor resin-cement bonding capabilities. We show that this deficiency can be overcome by infiltrating the zirconia cementation surface with glass. Current methods for assessing the fracture resistance of resin-ceramic bonds are marred by uneven stress distribution at the interface, which may result in erroneous interfacial fracture resistance values. We have applied a wedge-loaded double-cantilever-beam testing approach to accurately measure the interfacial fracture resistance of adhesively bonded zirconia-based restorative materials. Methods The interfacial fracture energy GC was determined for adhesively bonded zirconia, graded zirconia and feldspathic ceramic bars. The bonding surfaces were subjected to sandblasting or acid etching treatments. Baseline GC was measured for bonded specimens subjected to 7 days hydration at 37 °C. Long-term GC was determined for specimens exposed to 20,000 thermal cycles between 5 and 55 °C followed by 2-month aging at 37 °C in water. The test data were interpreted with the aid of a 2D finite element fracture analysis. Results The baseline and long-term GC for graded zirconia was 2–3 and 8 times that for zirconia, respectively. More significantly, both the baseline and long-term GC of graded zirconia were similar to those for feldspathic ceramic. Significance The interfacial fracture energy of feldspathic ceramic and graded zirconia was controlled by the fracture energy of the resin cement while that of zirconia by the interface. GC for the graded zirconia was as large as for feldspathic ceramic, making it an attractive material for use in dentistry. PMID:26365987

  10. Effects of Purity and Phase Content of Feedstock Powder on Thermal Durability of Zirconia-Based Thermal Barrier Coatings

    NASA Astrophysics Data System (ADS)

    Park, Kwang-Yong; Jung, Yeon-Gil; Kim, In-Soo; Yang, Byung-Il

    2017-08-01

    The thermal durability of thermal barrier coatings (TBCs) obtained using feedstock powders with different purity and phase content was investigated by cyclic thermal testing, including the effects on the sintering and phase transformation behaviors. Three kinds of 8 wt.% yttria-stabilized zirconia, namely regular purity (8YSZ), high purity (HP), and no monoclinic phase (nMP), were employed to prepare top coats by atmospheric plasma spraying on a NiCoCrAlY bond coat using a high-velocity oxy-fuel system. Use of 8YSZ, HP, and nMP for plasma spraying affected the microstructure and lifetime of the TBC in furnace cyclic testing (FCT) at 1100 °C and the sintering rate during annealing at 1400 °C for 50, 100, 200, and 400 h. In FCT, the TBC formed from nMP showed the longest durability, while that formed from HP showed lifetime performance similar to that obtained with regular-purity 8YSZ. The TBC obtained with nMP also exhibited the lowest monoclinic phase transition rate, followed by those obtained using HP and 8YSZ.

  11. Impact of yttria stabilized zirconia nanoinclusions on the thermal conductivity of n-type Si80Ge20 alloys prepared by spark plasma sintering

    NASA Astrophysics Data System (ADS)

    Lahwal, Ali; Bhattacharya, S.; He, Jian; Wu, Di; Peterson, A.; Poon, S. J.; Williams, L.; Dehkordi, A. Mehdizadeh; Tritt, T. M.

    2015-04-01

    Nanocomposites have become a new paradigm for thermoelectric research in recent years and have resulted in the reduction of thermal conductivity via the nano-inclusion and grain boundary scattering. In this work, we report the preparation and thermoelectric study of SiGe-yttria stabilized zirconia (YSZ) nanocomposites prepared by Spark Plasma Sintering (SPS). We experimentally investigated the reduction of lattice thermal conductivity (κL) in the temperature range (30-800 K) of n-type Si80Ge20P2 alloys with the incorporation of YSZ nanoparticles (20-40 nm diameter) into the Si-Ge matrix. These samples synthesized by using the SPS technique were found to have densities > 95% of the theoretical density. The thermal conductivity, at both low and high temperatures, was measured by steady state and laser flash techniques, respectively. At room temperature, we observed approximately a 50% reduction in the lattice thermal conductivity as result of adding 10% YSZ by volume to the Si80Ge20P2 host matrix. A phenomenological model developed by Callaway was used to corroborate both the temperature dependence and reduction of κ L over the measured temperature range (30-800 K) of both Si80Ge20P2 and Si80Ge20P2 + YSZ samples. The observed κL is discussed and interpreted in terms of various phonon scattering mechanisms such as alloy disorder, the Umklapp phonon scattering, and boundary scattering. In addition, a contribution from the phonon scattering by YSZ nanoparticles was further included to account for the κL of Si80Ge20P2 + YSZ sample. The theoretical calculations are in reasonably good agreement with the experimental results for both the Si80Ge20P2 and Si80Ge20P2 + YSZ alloys.

  12. Microstructural Changes Induced by Heating at High Temperatures in the Single Crystal of Yttria-Stabilized Cubic Zirconia Implanted with Ag Ions

    NASA Astrophysics Data System (ADS)

    Ho, Angel Yi-Jung; Mochiduki, Kazuya; Saito, Yukinori

    2009-03-01

    Ag ions were implanted into single crystals of yttria-stabilized cubic zirconia (YSZ) with largely different energies of 20 keV, 128 keV, and 1.5 MeV, and the cross sections of the implanted layer were examined. After implantation, thermal treatments were performed for the samples at temperatures up to 1000 °C in air. The surface of the sample implanted at 20 keV with a fluence of 3× 1016 ions/cm2 was violet and showed an absorption peak at 508 nm. The samples implanted with 128 keV or 1.5 MeV with fluences of 3× 1016 and 2× 1016 ions/cm2, respectively, were light brown. However, after heating at 800-1000 °C, their color changed from light brown for the as-implanted state to violet. The absorption spectra of the samples implanted with markedly different energies showed different aspects of changes when the samples were heated at high temperatures. Scanning transmission electron microscopy (STEM) and high-angle annular dark field (HAADF) observations were conducted. Ag nanoparticles of approximately 6-12 nm were densely formed in the as-implanted state for both samples implanted with the energies of 20 and 128 keV, but they could not be observed for the sample implanted with 1.5 MeV. Ag nanoparticles were formed after heating at 1000 °C for the sample implanted at 1.5 MeV. While Ag nanoparticles remained stably even when heated at 900-1000 °C for the samples implanted at 128 keV or 1.5 MeV, those particles for the sample implanted at 20 keV gradually reduced in number when heated at high temperatures.

  13. Microstructural Changes Induced by Heating at High Temperatures in the Single Crystal of Yttria-Stabilized Cubic Zirconia Implanted with Ag Ions

    NASA Astrophysics Data System (ADS)

    Yi-Jung Ho, Angel; Mochiduki, Kazuya; Saito, Yukinori

    2009-03-01

    Ag ions were implanted into single crystals of yttria-stabilized cubic zirconia (YSZ) with largely different energies of 20 keV, 128 keV, and 1.5 MeV, and the cross sections of the implanted layer were examined. After implantation, thermal treatments were performed for the samples at temperatures up to 1000 °C in air. The surface of the sample implanted at 20 keV with a fluence of 3×1016 ions/cm2 was violet and showed an absorption peak at 508 nm. The samples implanted with 128 keV or 1.5 MeV with fluences of 3×1016 and 2×1016 ions/cm2, respectively, were light brown. However, after heating at 800-1000 °C, their color changed from light brown for the as-implanted state to violet. The absorption spectra of the samples implanted with markedly different energies showed different aspects of changes when the samples were heated at high temperatures. Scanning transmission electron microscopy (STEM) and high-angle annular dark field (HAADF) observations were conducted. Ag nanoparticles of approximately 6-12 nm were densely formed in the as-implanted state for both samples implanted with the energies of 20 and 128 keV, but they could not be observed for the sample implanted with 1.5 MeV. Ag nanoparticles were formed after heating at 1000 °C for the sample implanted at 1.5 MeV. While Ag nanoparticles remained stably even when heated at 900-1000 °C for the samples implanted at 128 keV or 1.5 MeV, those particles for the sample implanted at 20 keV gradually reduced in number when heated at high temperatures.

  14. Catastrophic failure of a monolithic zirconia prosthesis.

    PubMed

    Chang, Jae-Seung; Ji, Woon; Choi, Chang-Hoon; Kim, Sunjai

    2015-02-01

    Recently, monolithic zirconia restorations have received attention as an alternative to zirconia veneered with feldspathic porcelain to eliminate chipping failures of veneer ceramics. In this clinical report, a patient with mandibular edentulism received 4 dental implants in the interforaminal area, and a screw-retained monolithic zirconia prosthesis was fabricated. The patient also received a maxillary complete removable dental prosthesis over 4 anterior roots. At the 18-month follow-up, all of the zirconia cylinders were seen to be fractured, and the contacting abutment surfaces had lost structural integrity. The damaged abutments were replaced with new abutments, and a new prosthesis was delivered with a computer-assisted design and computer-assisted manufacturing fabricated titanium framework with denture teeth and denture base resins. At the 6-month recall, the patient did not have any problems. Dental zirconia has excellent physical properties; however, care should be taken to prevent excessive stresses on the zirconia cylinders when a screw-retained zirconia restoration is planned as a definitive prosthesis.

  15. Investigations in the mechanism of carbothermal reduction of yttria stabilized zirconia for ultra-high temperature ceramics application and its influence on yttria contained in it

    NASA Astrophysics Data System (ADS)

    Sondhi, Anchal

    Zirconium carbide (ZrC) is a high modulus ceramic with an ultra-high melting temperature and, consequently, is capable of withstanding extreme environments. Carbon-carbon composites (CCCs) are important structural materials in current commercial and future hypersonic aircraft; however, these materials may be susceptible to degradation when exposed to elevated temperatures during extreme velocities. At speeds of exceeding Mach 5, intense heating of leading edges of the aircraft triggers rapid oxidation of carbon in CCCs resulting in degradation of the structure and probable failure. Environmental/thermal barrier coatings (EBC/TBC) are employed to protect airfoil structures from extreme conditions. Yttria stabilized zirconia (YSZ) is a well-known EBC/TBC material currently used to protect metallic turbine blades and other aerospace structures. In this work, 3 mol% YSZ has been studied as a potential EBC/TBC on CCCs. However, YSZ is an oxygen conductor and may not sufficiently slow the oxidation of the underlying CCC. Under appropriate conditions, ZrC can form at the interface between CCC and YSZ. Because ZrC is a poor oxygen ion conductor in addition to its stability at high temperatures, it can reduce the oxygen transport to the CCC and thus increase the service lifetime of the structure. This dissertation investigates the thermodynamics and kinetics of the YSZ/ZrC/CCC system and the resulting structural changes across multiple size scales. A series of experiments were conducted to understand the mechanisms and species involved in the carbothermal reduction of ZrO2 to form ZrC. 3 mol% YSZ and graphite powders were uniaxially pressed into pellets and reacted in a graphite (C) furnace. Rietveld x-ray diffraction phase quantification determined that greater fractions of ZrC were formed when carbon was the majority mobile species. These results were validated by modeling the process thermochemically and were confirmed with additional experiments. Measurements were

  16. Alumina-Reinforced Zirconia Composites

    NASA Technical Reports Server (NTRS)

    Choi, Sung R.; Bansal, Narottam P.

    2003-01-01

    Alumina-reinforced zirconia composites, used as electrolyte materials for solid oxide fuel cells, were fabricated by hot pressing 10 mol percent yttria-stabilized zirconia (10-YSZ) reinforced with two different forms of alumina particulates and platelets each containing 0 to 30 mol percent alumina. Major mechanical and physical properties of both particulate and platelet composites including flexure strength, fracture toughness, slow crack growth, elastic modulus, density, Vickers microhardness, thermal conductivity, and microstructures were determined as a function of alumina content either at 25 C or at both 25 and 1000 C. Flexure strength and fracture toughness at 1000 C were maximized with 30 particulate and 30 mol percent platelet composites, respectively, while resistance to slow crack growth at 1000 C in air was greater for 30 mol percent platelet composite than for 30 mol percent particulate composites.

  17. Marginal and internal fit of zirconia based fixed dental prostheses fabricated with different concepts

    PubMed Central

    Beuer, Florian; Korczynski, Natalie; Rezac, Antonia; Naumann, Michael; Gernet, Wolfgang; Sorensen, John A

    2010-01-01

    The purpose of this in vitro study was to compare the precision of fit of substructures milled from semi-sintered zirconia blocks, fabricated with two different fabrication concepts. Three-unit, posterior fixed dental prostheses (FDP) were fabricated for standardized dies (n = 10) with the laboratory Computer Aided Design (CAD)/Computer Aided Manufacturing (CAM) system Cercon® Brain (Brain) and the centralized CAD/CAM system Compartis Integrated Systems (Compartis). After cementation to the dies, the FDP were embedded and sectioned. Four cross-sections were made of each abutment tooth, and marginal and internal fit were evaluated under an optical microscope. A one-way analysis of variance (ANOVA) was used to compare data (α = 0.05). Mean gap dimensions at the marginal opening for Brain and Compartis were 56.0 (±34.5) μm and 51.7 (±45.2) μm, respectively. Mean internal gap dimensions of 62.8 (±37.5) μm to 164.6 (±33.4) μm were measured depending on the measurement location and the fabrication concept. Mean marginal openings and internal adaptations were not significantly different for both systems. Three out of four measurement locations showed significantly different cement gaps. Within the limitations of this study, the results suggest that the accuracy of both investigated systems is satisfactory for clinical use. The laboratory fabrication exhibited similar accuracy as the centralized manufacturing. PMID:23662077

  18. In vitro performance of implant-supported monolithic zirconia crowns: Influence of patient-specific tooth-coloured abutments with titanium adhesive bases.

    PubMed

    Rosentritt, Martin; Rembs, Andreas; Behr, Michael; Hahnel, Sebastian; Preis, Verena

    2015-07-01

    To investigate the influence of the combination of patient-specific abutments and titanium adhesive bases on the long-term in vitro performance of anterior crowns. Ten systems of screw-retained implant and adhesive base combinations (n=8/group) were restored with zirconia or polyetherketone (PEEK) abutments and identical full-anatomical zirconia crowns. For simulating clinical anterior loading, implants were fixed at an angle of 135° and submitted to prolonged thermal cycling and mechanical loading (TC: 6×3000 cycles, 5°C/55°C; ML: 100N, 3.6×10(6) cycles) to cause and register fatigue failure. Failed restorations were examined by means of scanning electron microscopy. Surviving restorations were loaded to fracture. Data (mean±standard deviation) were statistically analyzed (ANOVA; Bonferroni; Kaplan-Meier-Log-Rank; α=0.05). Seven systems survived TCML without any failure. The other three systems showed loosening and fracturing of the screw (0.4-1.6×10(6) loadings) or debonding between base and abutment (0.002-3.4×10(6) loadings). None of the systems showed any fracture of the crown or failed bonding between abutment and crown. The Log-Rank test showed significant (p=0.000) differences. Fracture data significantly varied (ANOVA p=0.000) between the individual systems (minimum: 371N; maximum: 763N). Failures were mostly caused by bending or fracturing of the screw and in three cases by fracture of the abutment. Anterior implant-supported zirconia crowns on titanium adhesive bases and bonded patient-specific zirconia abutments provided good in vitro performance and high fracture resistance. Sufficient high torque moments and early re-screwing may be advised. Most adhesive base and abutment combinations may be appropriate for anterior application. Individual improvements may contribute to enduring success. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Separation of racemic 2,4-dinitrophenyl amino acids on zirconia-immobilized quinine carbamate in reversed-phase liquid chromatography.

    PubMed

    Park, Jung Hag; Lee, Joon Woo; Song, Young Tae; Ra, Chun Sup; Cha, Jin Soon; Ryoo, Jae Jeong; Lee, Wonjae; Kim, In Whan; Jang, Myung Duk

    2004-08-01

    Zirconia is known to be one of the best chromatographic support materials due to its excellent chemical, thermal, and mechanical stability. A quinine carbamate-coated zirconia was prepared as a chiral stationary phase for separation of enantiomers of DNP-amino acids in reversed-phase liquid chromatography. Retention and enantioselectivity of this phase were compared to those for quinine carbamate bonded onto silica. Most amino acids studied were separated on the quinine carbamate-zirconia CSP although retention was longer and chiral selectivity was somewhat lower than on the corresponding silica CSP. Increased retention and decreased selectivity are probably due to strong non-enantioselective Lewis acid-base interactions between the amino acid molecule and the residual Lewis acid sites on the zirconia surface.

  20. Development of a zirconia-mullite based ceramic for recuperator applications

    SciTech Connect

    Gonzalez, J.M. )

    1992-12-01

    GTE Products Corporation developed a compact ceramic high temperature recuperator for recovering heat from relatively clean exhaust gases at temperatures up to 2500F. The DOE program allowed GTE to improve the technical and economic characteristics of the recuperator and stimulate industrial acceptance of the recuperator as an energy-saving technology. From January 1981 to December 1984, 561 recuperators were installed by GTE on new or retrofitted furnaces. With over 1200 units sold commercially between 1981 and 1990, GTE has documented the effect (long and short term) of corrosive attack from alkalies and lead. One objective of this contract was to develop Z-1000 a zirconia-mullite mixed oxide ceramic for use in ceramic recuperator applications susceptible to corrosion. To first and second pass of the ceramic recuperator would utilize the current cordierite-mixed-oxide ceramic. A Z-1000 matrix element would be used in the preheated air side's third pass (exhaust inlet). Thermal stresses on Z-1000 cross flow module could be minimized by selecting appropriate heat transfer surface areas for each pass. A large surface area for first and second pass (cordierite section) could provide for sufficient heat transfer for 50% effectiveness. A surface area that generates minimal heat transfer in the third pass (Z-1000) section is envisioned. Heat transferred in this section reduces the differential temperature across the matrix and the thermal stresses. Hence, thermal shock resistance of the material in the third pass becomes less critical; however, its corrosion resistance must be sufficient to withstand corrosive attack. This modular design could utilize a field repairable, disposable matrix. This report is concerned with process technology development for fabricating such a matrix, and a series of corrosion tests that established the potential corrosion resistance of the Z-1000 ceramic.

  1. Embedded Controller based Image Stabilizer

    NASA Astrophysics Data System (ADS)

    Teare, S. W.; Lamppa, D.; Sugimoto, K.; Yates, J.; Xiao, H.; Thompson, L. A.

    2004-05-01

    An image stabilization system is commonly used on astronomical telescopes to compensate for poor mount performance, low-order effects from atmospheric seeing and local index of refraction instabilities near the telescope. An image stabilizer is comprised of an electro-optical component and a sensor that are used in concert to lock the position of a wavefront or image centroid onto a camera. There are several commercial tip-tilt and sensing systems and components that can be used for image stabilization depending on the user's performance and cost requirements. We report on an inexpensive image stabilizer for use on astronomical telescopes developed as part of the NSF funded (AST-00-96741) UnISIS laser guide-star project at the Mount Wilson Observatory. The instrument uses inexpensive, commercial-off-the-shelf (COTS) components for beam steering, position sensing and the processor/control system. The limiting magnitude of the system depends on the properties of the light sensor used. The image stabilizer operates as a turnkey system with 2 main control modes to provide different performance capabilities for different operating conditions. The normal mode uses a proportional, integrating, differentiating (PID) controller and the second mode uses a more complex fuzzy logic based control scheme. We have examined other control methods and continue to experiment with different schemes. The simplicity of the system allows for many different control models to be implemented and evaluated in the laboratory and on the telescope. This flexibility and low cost provides an inexpensive system that can be used for both image stabilization and monitoring of the astronomical seeing at an observing site. Such systems are also invaluable for introducing astronomy students to instrumentation and engineering students to the innovative control aspects of telescope systems.

  2. Implant-supported fixed dental prostheses with CAD/CAM-fabricated porcelain crown and zirconia-based framework.

    PubMed

    Takaba, Masayuki; Tanaka, Shinpei; Ishiura, Yuichi; Baba, Kazuyoshi

    2013-07-01

    Recently, fixed dental prostheses (FDPs) with a hybrid structure of CAD/CAM porcelain crowns adhered to a CAD/CAM zirconia framework (PAZ) have been developed. The aim of this report was to describe the clinical application of a newly developed implant-supported FDP fabrication system, which uses PAZ, and to evaluate the outcome after a maximum application period of 36 months. Implants were placed in three patients with edentulous areas in either the maxilla or mandible. After the implant fixtures had successfully integrated with bone, gold-platinum alloy or zirconia custom abutments were first fabricated. Zirconia framework wax-up was performed on the custom abutments, and the CAD/CAM zirconia framework was prepared using the CAD/CAM system. Next, wax-up was performed on working models for porcelain crown fabrication, and CAD/CAM porcelain crowns were fabricated. The CAD/CAM zirconia frameworks and CAD/CAM porcelain crowns were bonded using adhesive resin cement, and the PAZ was cemented. Cementation of the implant superstructure improved the esthetics and masticatory efficiency in all patients. No undesirable outcomes, such as superstructure chipping, stomatognathic dysfunction, or periimplant bone resorption, were observed in any of the patients. PAZ may be a potential solution for ceramic-related clinical problems such as chipping and fracture and associated complicated repair procedures in implant-supported FDPs. © 2012 by the American College of Prosthodontists.

  3. Nanosilica coating for bonding improvements to zirconia

    PubMed Central

    Chen, Chen; Chen, Gang; Xie, Haifeng; Dai, Wenyong; Zhang, Feimin

    2013-01-01

    Resin bonding to zirconia cannot be established from standard methods that are currently utilized in conventional silica-based dental ceramics. The solution–gelatin (sol–gel) process is a well developed silica-coating technique used to modify the surface of nonsilica-based ceramics. Here, we use this technique to improve resin bonding to zirconia, which we compared to zirconia surfaces treated with alumina sandblasting and tribochemical silica coating. We used the shear bond strength test to examine the effect of the various coatings on the short-term resin bonding of zirconia. Furthermore, we employed field emission scanning electron microscopy, energy-dispersive X-ray spectroscopy, atomic force microscopy, and Fourier transform infrared spectroscopy to characterize the zirconia surfaces. Water–mist spraying was used to evaluate the durability of the coatings. To evaluate the biological safety of the experimental sol–gel silica coating, we conducted an in vitro Salmonella typhimurium reverse mutation assay (Ames mutagenicity test), cytotoxicity tests, and in vivo oral mucous membrane irritation tests. When compared to the conventional tribochemical silica coating, the experimental sol–gel silica coating provided the same shear bond strength, higher silicon contents, and better durability. Moreover, we observed no apparent mutagenicity, cytotoxicity, or irritation in this study. Therefore, the sol–gel technique represents a promising method for producing silica coatings on zirconia. PMID:24179333

  4. The Evolution of Solid Oxide Fuel Cell Nickel-Yttria Stabilized Zirconia Anodes Studied Using Electrochemical and Three-Dimensional Microstructural Characterizations

    NASA Astrophysics Data System (ADS)

    Kennouche, David O.

    This thesis focuses on Solid Oxide Fuel Cells (SOFCs). The 21st century will see major changes in the way energy is produced, stored, and used around the world. SOFCs, which provide an efficient, scalable, and low-pollution alternative method for electricity generation, are expected to play an important role. SOFCs can also be operated in electrolysis mode for energy storage, important since health and economic reasons are causing a shift towards intermittent renewable energy resources. However, multiple limitations mainly linked to cost and durability have prevented the expansion of this technology to mass markets. This work focuses on the Nickel - Yttria Stabilized Zirconia (Ni-YSZ) anode that is widely used in SOFCs. Coarsening of Ni in the Ni-YSZ anode has been widely cited as a primary cause of long-term SOFC degradation. While there have been numerous studies of Ni coarsening reported, these have typically only tracked the evolution of Ni particle size, not the entire microstructure, and have typically not been correlated directly with electrochemical performance. In this thesis, the advanced tomography techniques Focused Ion Beam - Scanning Electron Microscopy (FIB-SEM) tomography and Trans- mission X-ray Microscopy (TXM) have been utilized to enable insight into the evolution of Ni-YSZ structure and how it relates to performance degradation. Extensive anode aging studies were done for relatively short times using temperatures higher than in normal SOFC operation in order to accelerate microstructural evolution. In addition the microstructure changes were correlated with changes in anode polarization resistance. While most of the measurements were done by comparing different anodes aged under different conditions, the first example of a "pseudo in situ" measurement where the same anode was 3D imaged repeatedly with intervening aging steps, was also demonstrated. A microstructural evolution model that focuses on the active three-phase boundary density was

  5. Preparation of High-Jc YBa2Cu3O7-y Films on CeO2-Buffered Yttria-Stabilized Zirconia Substrates by Fluorine-Free Metalorganic Deposition

    NASA Astrophysics Data System (ADS)

    Tsukada, Kenichi; Furuse, Mitsuho; Sohma, Mitsugu; Manabe, Takaaki; Yamaguchi, Iwao; Kondo, Wakichi; Fuchino, Shuichiro; Kumagai, Toshiya

    2005-07-01

    Epitaxial YBa2Cu3O7-y (YBCO) films have successfully been prepared by fluorine-free metalorganic deposition on yttria-stabilized zirconia (YSZ) substrates with an evaporated CeO2 buffer layer. The YBCO films, prepared using a metal acetylacetonate-based coating solution, were highly (001)-oriented by X-ray diffraction θ-2θ scanning and φ scanning. The 0.21-μm-thick YBCO film demonstrated a high superconducting transition temperature, Tc=90.1 K, and high critical current densities with an average in excess of 4 MA/cm2 at 77 K using an inductive method. Transport critical current (Ic) was also measured by a standard four-terminal technique; the Ic value reached 185 A in a 2.5-cm-wide current path formed on a 5-cm-diameter film. These excellent properties are attributed to the small in-plane fluctuation due to high epitaxy of the YBCO films, which resulted from good matching of the crystal structure, lattice parameter and thermal expansion coefficient among the YBCO film, CeO2 buffer layer and YSZ substrate, as well as from the smooth and uniform surface morphology, i.e., average roughness = 0.34 nm, of the CeO2 buffer layer. The present deposition conditions, i.e., 700°C and p(O2)=4× 10-2 Pa, activated by radio frequency plasma at 20 W, are valid for the growth of such CeO2(100) buffer layers on YSZ substrates.

  6. Reaction-zone expansions and mechanism of the O{sub 2}, Ag/yttria-stabilized zirconia electrode reaction

    SciTech Connect

    Jimenez, R.; Kloidt, T.; Kleitz, M.

    1997-02-01

    Experimental data obtained by impedance spectroscopy with silver droplet electrodes of different radii have been reanalyzed in the medium-frequency range under the assumption of rate-limiting oxygen diffusion through a thin slab of the electrode material. The model, which is based on literature data and has no adjustable parameters, gives a good fit. This demonstrates that in the medium-frequency range, oxygen diffusion through the electrode material is evenly distributed over the whole electrode interface. On the other hand, under dc conditions it is concentrated along the electrode triple-phase perimeter. Therefore, the distribution of the transfer current over the interface varies with the applied signal frequency. It follows that the electrode resistance and capacitance determined from the impedance diagram are related to an electrode reaction occurring over a reaction zone variable with the signal frequency.

  7. Effects of yttrium, aluminum and chromium concentrations in bond coatings on the performance of zirconia-yttria thermal barriers

    NASA Technical Reports Server (NTRS)

    Stecura, S.

    1980-01-01

    A cyclic furnace study was conducted on thermal barrier systems to evaluate the effects of yttrium, chromium, and aluminum in nickel-base alloy bond coatings and the effect of bond coating thickness on yttria-stabilized zirconia thermal barrier coating life. Without yttrium in the bond coatings, the zirconia coatings failed very rapidly. Increasing chromium and aluminum in the Ni-Cr-Al-Y bond coatings increased total coating life. This effect was not as great as that due to yttrium. Increased bond coat thickness was also found to increase life.

  8. Effects of yttrium, aluminum and chromium concentrations in bond coatings on the performance of zirconia-yttria thermal barriers

    NASA Technical Reports Server (NTRS)

    Stecura, S.

    1980-01-01

    A cyclic furnace study was conducted on thermal barrier systems to evaluate the effects of yttrium, chromium and aluminum in nickel-base alloy bond coatings and the influence of the bond coating thickness on yttria-stabilized zirconia thermal barrier coating lifetimes. Without yttrium in the bond coatings, the zirconia coatings failed very rapidly. Increasing concentrations of chromium and aluminum in the Ni-Cr-Al-Y bond coatings increased the total coating lifetimes. This effect was not as great as that due to yttrium. Increased bond coating thickness was also found to increase the lifetimes.

  9. Effects of yttrium, aluminum and chromium concentrations in bond coatings on the performance of zirconia-yttria thermal barriers

    NASA Technical Reports Server (NTRS)

    Stecura, S.

    1980-01-01

    A cyclic furnace study was conducted on thermal barrier systems to evaluate the effects of yttrium, chromium and aluminum in nickel-base alloy bond coatings and the effect of bond coating thickness on yttria-stabilized zirconia thermal barrier coating life. Without yttrium in the bond coatings, the zirconia coatings failed very rapidly. Increasing chromium and aluminum in the Ni-Cr-Al-Y bond coatings increased total coating life. This effect was not as great as that due to yttrium. Increased bond coat thickness was also found to increase life.

  10. Effects of yttrium, aluminum and chromium concentrations in bond coatings on the performance of zirconia-yttria thermal barriers

    NASA Technical Reports Server (NTRS)

    Stecura, S.

    1980-01-01

    A cyclic furnace study was conducted on thermal barrier systems to evaluate the effects of yttrium, chromium and aluminum in nickel-base alloy bond coatings and the effect of bond coating thickness on yttria-stabilized zirconia thermal barrier coating life. Without yttrium in the bond coatings, the zirconia coatings failed very rapidly. Increasing chromium and aluminum in the Ni-Cr-Al-Y bond coatings increased total coating life. This effect was not as great as that due to yttrium. Increased bond coat thickness was also found to increase life.

  11. Effects of yttrium, aluminum and chromium concentrations in bond coatings on the performance of zirconia-yttria thermal barriers

    NASA Technical Reports Server (NTRS)

    Stecura, S.

    1980-01-01

    A cyclic furnace study was conducted on thermal barrier systems to evaluate the effects of yttrium, chromium and aluminum in nickel-base alloy bond coatings and the influence of the bond coating thickness on yttria-stabilized zirconia thermal barrier coating lifetimes. Without yttrium in the bond coatings, the zirconia coatings failed very rapidly. Increasing concentrations of chromium and aluminum in the Ni-Cr-Al-Y bond coatings increased the total coating lifetimes. This effect was not as great as that due to yttrium. Increased bond coating thickness was also found to increase the lifetimes.

  12. Zirconia abutments and restorations: from laboratory to clinical investigations.

    PubMed

    Ferrari, M; Vichi, A; Zarone, F

    2015-03-01

    In last years the use of zirconia in dentistry has become very popular. Unfortunately, the clinical indications for a dental use of zirconia are not completely clear yet, neither are their limitations. The objective of this review was to evaluate the basic science knowledge on zirconia and to discuss some aspects of the clinical behavior of zirconia-based restorations. In particular, one of the goals was highlighting the possible correlation between in vitro and in vivo studies. The definition of concepts like success, survival and failure was still debated and the correlation between in vitro results and predictability of clinical behavior was investigated.

  13. Structural and Chemical Analysis of the Zirconia-Veneering Ceramic Interface.

    PubMed

    Inokoshi, M; Yoshihara, K; Nagaoka, N; Nakanishi, M; De Munck, J; Minakuchi, S; Vanmeensel, K; Zhang, F; Yoshida, Y; Vleugels, J; Naert, I; Van Meerbeek, B

    2016-01-01

    The interfacial interaction of veneering ceramic with zirconia is still not fully understood. This study aimed to characterize morphologically and chemically the zirconia-veneering ceramic interface. Three zirconia-veneering conditions were investigated: 1) zirconia-veneering ceramic fired on sandblasted zirconia, 2) zirconia-veneering ceramic on as-sintered zirconia, and 3) alumina-veneering ceramic (lower coefficient of thermal expansion [CTE]) on as-sintered zirconia. Polished cross-sectioned ceramic-veneered zirconia specimens were examined using field emission gun scanning electron microscopy (Feg-SEM). In addition, argon-ion thinned zirconia-veneering ceramic interface cross sections were examined using scanning transmission electron microscopy (STEM)-energy dispersive X-ray spectrometry (EDS) at high resolution. Finally, the zirconia-veneering ceramic interface was quantitatively analyzed for tetragonal-to-monoclinic phase transformation and residual stress using micro-Raman spectroscopy (µRaman). Feg-SEM revealed tight interfaces for all 3 veneering conditions. High-resolution transmission electron microscopy (HRTEM) disclosed an approximately 1.0-µm transformed zone at sandblasted zirconia, in which distinct zirconia grains were no longer observable. Straight grain boundaries and angular grain corners were detected up to the interface of zirconia- and alumina-veneering ceramic with as-sintered zirconia. EDS mapping disclosed within the zirconia-veneering ceramic a few nanometers thick calcium/aluminum-rich layer, touching the as-sintered zirconia base, with an equally thick silicon-rich/aluminum-poor layer on top. µRaman revealed t-ZrO2-to-m-ZrO2 phase transformation and residual compressive stress at the sandblasted zirconia surface. The difference in CTE between zirconia- and the alumina-veneering ceramic resulted in residual tensile stress within the zirconia immediately adjacent to its interface with the veneering ceramic. The rather minor chemical

  14. Grafting Sulfated Zirconia on Mesoporous Silica

    SciTech Connect

    Wang, Yong; Lee, Kwan Young; Choi, Saemin; Liu, Jun; Wang, Li Q.; Peden, Charles HF

    2007-06-01

    Sulfated zirconia has received considerable attention as a potential solid acid catalyst in recent years. In this paper, the preparation and properties of acid catalysts obtained by grafting ziconia with atomic precision on MCM-41 mesoporous silica were studied. TEM and potential titration characterizations revealed that ZrO2/MCM-41 with monolayer coverage can be obtained using this grafting technique. Sulfated ZrO2/MCM-41 exhibits improved thermal stability than that of bulk sulfated zirconia, as evidenced by temperature programmed characterizations and XRD analysis. Temperature programmed reaction of isopropanol was used to evaluate the acidity of sulfated ZrO2/MCM-41. It was found that the acid strength of sulfated ZrO2/MCM-41 with monolayer coverage is weaker than bulk sulfated zirconia but stronger than SiO2-Al2O3, a common strong acid catalyst.

  15. Processing of Alumina-Toughened Zirconia Composites

    NASA Technical Reports Server (NTRS)

    Bansal, Narottam P.; Choi, Sung R.

    2003-01-01

    Dense and crack-free 10-mol%-yttria-stabilized zirconia (10YSZ)-alumina composites, containing 0 to 30 mol% of alumina, have been fabricated by hot pressing. Release of pressure before onset of cooling was crucial in obtaining crack-free material. Hot pressing at 1600 C resulted in the formation of ZrC by reaction of zirconia with grafoil. However, no such reaction was observed at 1500 C. Cubic zirconia and -alumina were the only phases detected from x-ray diffraction indicating no chemical reaction between the composite constituents during hot pressing. Microstructure of the composites was analyzed by scanning electron microscopy and transmission electron microscopy. Density and elastic modulus of the composites followed the rule-of-mixtures. Addition of alumina to 10YSZ resulted in lighter, stronger, and stiffer composites by decreasing density and increasing strength and elastic modulus.

  16. (Hyperfine experimental investigation of zirconia ceramics)

    SciTech Connect

    Not Available

    1992-01-01

    This research program has encompassed a broad investigation of microscopic structure and point defect properties in insulating materials and some recent exploratory work on semiconductors. The major experimental technique is perturbed angular correlation (PAC) spectroscopy. Our research provides information about the microscopic structure, nucleation, and equilibrium of structural phases in materials under investigation. We have studied phase equilibria in monoclinic, tetragonal, and cubic zirconia in the past and have recently begun more detailed investigation of high-temperature anomalies in monoclinic zirconia and tetragonal stabilized zirconia. We also have found a number of instances where the indium PAC probe has detected subtle phase changes, small precipitate formation, and other phase behavior that are difficult to detect by conventional diffraction methods. The PAC experimental technique is described briefly in section 2, and recent research is reviewed in section 3.

  17. Effects of cementation surface modifications on fracture resistance of zirconia.

    PubMed

    Srikanth, Ramanathan; Kosmac, Tomaz; Della Bona, Alvaro; Yin, Ling; Zhang, Yu

    2015-04-01

    To examine the effects of glass infiltration (GI) and alumina coating (AC) on the indentation flexural load and four-point bending strength of monolithic zirconia. Plate-shaped (12 mm × 12 mm × 1.0 mm or 1.5 or 2.0 mm) and bar-shaped (4 mm × 3 mm × 25 mm) monolithic zirconia specimens were fabricated. In addition to monolithic zirconia (group Z), zirconia monoliths were glass-infiltrated or alumina-coated on their tensile surfaces to form groups ZGI and ZAC, respectively. They were also glass-infiltrated on their upper surfaces, and glass-infiltrated or alumina-coated on their lower (tensile) surfaces to make groups ZGI2 and ZAC2, respectively. For comparison, porcelain-veneered zirconia (group PVZ) and monolithic lithium disilicate glass-ceramic (group LiDi) specimens were also fabricated. The plate-shaped specimens were cemented onto a restorative composite base for Hertzian indentation using a tungsten carbide spherical indenter with a radius of 3.2mm. Critical loads for indentation flexural fracture at the zirconia cementation surface were measured. Strengths of bar-shaped specimens were evaluated in four-point bending. Glass infiltration on zirconia tensile surfaces increased indentation flexural loads by 32% in Hertzian contact and flexural strength by 24% in four-point bending. Alumina coating showed no significant effect on resistance to flexural damage of zirconia. Monolithic zirconia outperformed porcelain-veneered zirconia and monolithic lithium disilicate glass-ceramics in terms of both indentation flexural load and flexural strength. While both alumina coating and glass infiltration can be used to effectively modify the cementation surface of zirconia, glass infiltration can further increase the flexural fracture resistance of zirconia. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.

  18. Effects of cementation surface modifications on fracture resistance of zirconia

    PubMed Central

    Srikanth, Ramanathan; Kosmac, Tomaz; Bona, Alvaro Della; Yin, Ling; Zhang, Yu

    2015-01-01

    Objectives To examine the effects of glass infiltration (GI) and alumina coating (AC) on the indentation flexural load and four-point bending strength of monolithic zirconia. Methods Plate-shaped (12 mm × 12 mm × 1.0 mm or 1.5 mm or 2.0 mm) and bar-shaped (4 mm × 3 mm × 25 mm) monolithic zirconia specimens were fabricated. In addition to monolithic zirconia (group Z), zirconia monoliths were glass-infiltrated or alumina-coated on their tensile surfaces to form groups ZGI and ZAC, respectively. They were also glass-infiltrated on their upper surfaces, and glass-infiltrated or alumina-coated on their lower (tensile) surfaces to make groups ZGI2 and ZAC2, respectively. For comparison, porcelain-veneered zirconia (group PVZ) and monolithic lithium disilicate glass-ceramic (group LiDi) specimens were also fabricated. The plate-shaped specimens were cemented onto a restorative composite base for Hertzian indentation using a tungsten carbide spherical indenter with a radius of 3.2 mm. Critical loads for indentation flexural fracture at the zirconia cementation surface were measured. Strengths of bar-shaped specimens were evaluated in four-point bending. Results Glass infiltration on zirconia tensile surfaces increased indentation flexural loads by 32% in Hertzian contact and flexural strength by 24% in four-point bending. Alumina coating showed no significant effect on resistance to flexural damage of zirconia. Monolithic zirconia outperformed porcelain-veneered zirconia and monolithic lithium disilicate glass-ceramics in terms of both indentation flexural load and flexural strength. Significance While both alumina coating and glass infiltration can be used to effectively modify the cementation surface of zirconia, glass infiltration can further increase the flexural fracture resistance of zirconia. PMID:25687628

  19. Fabrication and characterization of dense zirconia and zirconia-silica ceramic nanofibers.

    PubMed

    Xu, Xiaoming; Guo, Guangqing; Fan, Yuwei

    2010-09-01

    The objective of this study was to prepare dense zirconia-yttria (ZY), zirconia-silica (ZS) and zirconia-yttria-silica (ZYS) nanofibers as reinforcing elements for dental composites. Zirconium (IV) propoxide, yttrium nitrate hexahydrate, and tetraethyl orthosilicate (TEOS) were used as precursors for the preparation of zirconia, yttria, and silica sols. A small amount (1-1.5 wt%) of polyethylene oxide (PEO) was used as a carry polymer. The sols were preheated at 70 degrees C before electrospinning and their viscosity was measured with a viscometer at different heating time. The gel point was determined by viscosity-time (eta-t) curve. The ZY, ZS and ZYS gel nanofibers were prepared using a special reactive electrospinning device under the conditions near the gel point. The as-prepared gel nanofibers had diameters between 200 and 400 nm. Dense (nonporous) ceramic nanofibers of zirconia-yttria (96/4), zirconia-silica (80/20) and zirconia-yttria-silica (76.8/3.2/20) with diameter of 100-300 nm were obtained by subsequent calcinations at different temperatures. The gel and ceramic nanofibers obtained were characterized by scanning electron microscope (SEM), high-resolution field-emission scanning electron microscope (FE-SEM), thermogravimetric analyzer (TGA), differential scanning calorimeter (DSC), Fourier transform infrared spectrometer (FT-IR), and X-ray diffraction (XRD). SEM micrograph revealed that ceramic ZY nanofibers had grained structure, while ceramic ZS and ZYS nanofibers had smooth surfaces, both showing no visible porosity under FE-SEM. Complete removal of the polymer PEO was confirmed by TGA/DSC and FT-IR. The formation of tetragonal phase of zirconia and amorphous silica was proved by XRD. In conclusion, dense zirconia-based ceramic nanofibers can be fabricated using the new reactive sol-gel electrospinning technology with minimum organic polymer additives.

  20. Effect of cation dopants in zirconia on interfacial properties in nickel/zirconia systems: an atomistic modeling study

    NASA Astrophysics Data System (ADS)

    Iskandarov, Albert M.; Ding, Yingna; Umeno, Yoshitaka

    2017-02-01

    Cation doping is often used to stabilize the cubic or tetragonal phase of zirconia for enhanced thermomechanical and electrochemical properties. In the present paper we report a combined density functional theory (DFT) and molecular dynamics study of the effect of Sc, Y, and Ce dopants on properties of Ni/\\text{Zr}{{\\text{O}}2} interfaces and nickel sintering. First, we develop an MD model that is based on DFT data for various nickel/zirconia interfaces. Then, we employ the model to simulate Ni nanoparticles coalescing on a zirconia surface. The results show the possibility of particle migration by means of fast sliding over the surface when the work of separation is small (<1.0\\text{J} {{\\text{m}}-2} ). The sliding observed for the O-terminated Ni(1 1 1)/\\text{Zr}{{\\text{O}}2} (1 1 1) interface is not affected by dopants in zirconia because the work of separation of the doped interface stays small. The most pronounced effect of the dopants is observed for the Zr-terminated Ni(1 1 1)/\\text{Zr}{{\\text{O}}2} (1 1 1) interface, which possesses a large work of separation (4.4\\text{J} {{\\text{m}}-2} ) and thus restricts the sliding mechanism of Ni nanoparticle migration. DFT calculations for the interface revealed that dopants with a smaller covalent radius result in a larger energy barriers for Ni diffusion. We analyze this effect and discuss how it can be used to suppress nickel sintering by using the dopant selection.

  1. pH control of the structure, composition, and catalytic activity of sulfated zirconia

    SciTech Connect

    Ivanov, Vladimir K.; Baranchikov, Alexander Ye.; Kopitsa, Gennady P.; Lermontov, Sergey A.; Yurkova, Lyudmila L.; Gubanova, Nadezhda N.; Ivanova, Olga S.; Lermontov, Anatoly S.; Rumyantseva, Marina N.; Vasilyeva, Larisa P.; Sharp, Melissa; Pranzas, P. Klaus; Tretyakov, Yuri D.

    2013-02-15

    We report a detailed study of structural and chemical transformations of amorphous hydrous zirconia into sulfated zirconia-based superacid catalysts. Precipitation pH is shown to be the key factor governing structure, composition and properties of amorphous sulfated zirconia gels and nanocrystalline sulfated zirconia. Increase in precipitation pH leads to substantial increase of surface fractal dimension (up to {approx}2.7) of amorphous sulfated zirconia gels, and consequently to increase in specific surface area (up to {approx}80 m{sup 2}/g) and simultaneously to decrease in sulfate content and total acidity of zirconia catalysts. Complete conversion of hexene-1 over as synthesized sulfated zirconia catalysts was observed even under ambient conditions. - Graphical abstract: Surface fractal dimension of amorphous sulfated zirconia and specific surface area and catalytic activity of crystalline sulfated zirconia as a function of precipitation pH. Highlights: Black-Right-Pointing-Pointer Structural transformation of amorphous hydrous zirconia into sulfated zirconia is studied. Black-Right-Pointing-Pointer Precipitation pH controls surface fractal dimension of amorphous zirconia gels. Black-Right-Pointing-Pointer Precipitation pH is the key factor governing properties of sulfated zirconia.

  2. Carbon tolerance, electrochemical performance and stability of solid oxide fuel cells with Ni/yttria stabilized zirconia anodes impregnated with Sn and operated with methane

    NASA Astrophysics Data System (ADS)

    Singh, Anand; Hill, Josephine M.

    2012-09-01

    Carbon formation on conventional Ni/YSZ anodes is a major problem when solid oxide fuel cells (SOFC) are operated with hydrocarbons. Carbon formation reduces the operational stability and lifetime of SOFC. In this paper, the influence of the addition of Sn to Ni/YSZ anodes (100 micron) on the carbon tolerance, electrochemical performance and stability of the anodes when operated with CH4 is studied. Sn is incorporated into the Ni/YSZ anodes of electrolyte-supported SOFC by impregnation (1 and 5 wt% Sn with respect to Ni). Addition of Sn to Ni/YSZ anodes does not reduce the carbon formation when SOFC are operated with CH4 at low steam to carbon ratios (<0.03) and high temperatures (1013 and 1073 K). Severe coking and metal dusting occurs on Sn-impregnated Ni/YSZ anodes when operated at OCV and 1073 K with dry CH4. Addition of higher amounts of Sn (5%) reduces electrochemical performance of Ni/YSZ anodes in H2 and also reduces the carbon gasification rates, leading to higher carbon accumulation. The Sn content in the anode decreases after operation at 1073 K for 30 h. Hence retaining Sn in the anode might be difficult in actual stack operations at high temperatures (1073 K) and long durations (>40,000 h).

  3. Zirconia implant abutments: microstructural analysis.

    PubMed

    Vaquero-Aguilar, Cristina; Jiménez-Melendo, Manuel; Torres-Lagares, Daniel; Llena-Blasco, Oriol; Bruguera, August; Llena-Blasco, Jaime; García-Calderón, Manuel; Velázquez-Cayón, Rocío; Gutiérrez-Pérez, José-Luis

    2012-01-01

    Yttria-stabilized zirconia (ZrO₂-Y₂O₃) ceramics have received increasing attention in recent years because of their stress-induced tetragonal-to-monoclinic (martensitic) transformation. This unique process acts as a toughening mechanism, imparting strength and toughness to the ceramic alloy. This property, along with well-documented biocompatibility, is now being exploited in an increasing number of medical applications, including implant dentistry. To prevent clinical problems and predict their behavior and physical limitations, a characterization of the ceramic elements used in dental restorations is essential. The aim of the present study is to characterize the crystal structure, elemental composition, and micr ostructure of asreceived ZiReal Post (Biomet 3i) zirconium oxide abutments, as well as specimens coated with a first layer of a low-fusing fluoroapatite ceramic. Zirconium oxide abutments, both as-received and porcelain-coated, were studied using the following techniques: x-ray diffraction, x-ray fluorescence, energy dispersive x-ray spectroscopy, optical microscopy, and scanning and transmission electron microscopy. X-ray analyses detected only the presence of Zr, O, Y, and hafnium (Hf), in an amount of 3% to 4% molecular weight Y₂O₃-ZrO₂. X-ray diffraction measurements showed that the ceramic abutment crystallizes mainly in the tetragonal phase, with some residual monoclinic phase. The microstructure is characterized by a rather homogenous grain distribution, formed by equiaxed and fine grains with a mean size of 0.30 Μm. Compositional and diffraction results are consistent with polycrystalline yttria-stabilized tetragonal zirconia. The material is susceptible to undergoing the stress-induced transformation toughening mechanism because of the very fine grain size. Except for machining ring marks, the surfaces exhibit an excellent finishing quality. No structural modifications were observed in the fluoroapatite ceramic-coated abutments

  4. Identification of peptide motif that binds to the surface of zirconia.

    PubMed

    Hashimoto, Kazuhiko; Yoshinari, Masao; Matsuzaka, Kenichi; Shiba, Kiyotaka; Inoue, Takashi

    2011-01-01

    A zirconia-binding peptide motif was identified using a peptide phage display system. Yttria stabilized zirconia beads and discs were used as the target. Quartz crystal microbalance was used to monitor the binding of phages to zirconia. Starting from a library of phages displaying random sequences of 12-mer peptides, we repeated cycles of biopanning against zirconia beads. After four cycles of biopanning, we isolated a phage clone Φ#17. DNA sequencing of the corresponding portion of Φ#17 unexpectedly revealed that it displayed a 58-mer peptide (amino acid sequence: WMPSDVDINDPQGGGSRPNLHQPKPAAEAASKKKSENRKVPFYSHSWY-SSMSEDKRGW). We found that Φ#17 had a 300-fold, significantly higher binding affinity for zirconia discs than phages displaying no peptide. In quartz crystal microbalance assay, a rapid increase in energy dissipation was observed from Φ#17 but not from the control phages, indicating that Φ#17 binds to the surface of zirconia via its displayed peptide. We successfully identified a peptide motif that binds zirconia.

  5. Enhanced electrochemiluminescence employed for the selective detection of methyl parathion based on a zirconia nanoparticle film modified electrode.

    PubMed

    Zhou, Hankun; Gan, Ning; Hou, Jianguo; Li, Tianhua; Cao, Yuting

    2012-01-01

    A simple, rapid and sensitive electrochemiluminescence (ECL) sensor was proposed for direct measurements of methyl parathion (MP) based on the strong affinity of a nano zirconia particles (ZrO(2) NPs) modified film on the electrode to the phosphoric group. ZrO(2) NPs, which could provide a larger absorption area to immobilize organophosphorus, was firstly modified on the glassy carbon electrode surface to prepare the proposed ECL sensor (ZrO(2)/GC). Subsequently, the ZrO(2)/GC electrode was scanned from -0.8 to +0.6 V to obtain the background signal at 0.44 V in a luminol/KCl solution. Then, a certain concentration of MP was added to an aqueous solution for 240 s, which was absorbed onto the ZrO(2)/GC electrode surface. Moreover, the MP absorbed on the surface of the ZrO(2)/GC electrode enhanced the ECL signal of luminol in the luminol/KCl solution, which increased with the concentration of MP. As a result, a novel ECL sensor was obtained in a luminol/KCl solution. The MP was determined in the range of from 3.8 × 10(-11) to 3.8 × 10(-6) mol L(-1), with a low detection limit of 1.27 × 10(-11) mol L(-1) (S/N = 3). The proposed ECL sensor performance for MP detection will open a new field in the application of rapid and screen detection of ultra-trace amounts of organ phosphorus pesticides (OPs) of vegetables used in farm markets.

  6. What Is in Your Zirconia?

    PubMed

    Helvey, Gregg A

    2017-04-01

    The immense popularity of zirconia as an indirect restorative material in dentistry has led to seemingly countless numbers of companies selling zirconia discs and blocks. The reliability of zirconia, however, is subject to specific manufacturing and processing protocols. Thus, it is of paramount importance for any dental professional utilizing zirconia to be aware of the source of the material and the various factors that can affect the success or failure of a final restoration. This article discusses the journey of zirconia, from being found among the elements of the earth to being placed in the patient's mouth. It also touches on drawbacks, such as translucency, associated with zirconia.

  7. Monoclinic zirconia distributions in plasma-sprayed thermal barrier coatings

    NASA Astrophysics Data System (ADS)

    Lance, M. J.; Haynes, J. A.; Ferber, M. K.; Cannon, W. R.

    2000-03-01

    Phase composition in an air plasma-sprayed Y2O3-stabilized ZrO2 (YSZ) top coating of a thermal barrier coating (TBC) system was characterized. Both the bulk phase content and localized pockets of monoclinic zirconia were measured with Raman spectroscopy. The starting powder consisted of ˜15 vol.% monoclinic zirconia, which decreased to ˜2 vol.% in the as-sprayed coating. Monoclinic zirconia was concentrated in porous pockets that were evenly distributed throughout the TBC. The pockets resulted from the presence of unmelted granules in the starting powder. The potential effect of the distributed monoclinic pockets on TBC performance is discussed.

  8. Isotropic micropatterned silica coatings on zirconia induce guided cell growth for dental implants.

    PubMed

    Pelaez-Vargas, A; Gallego-Perez, D; Magallanes-Perdomo, M; Fernandes, M H; Hansford, D J; De Aza, A H; Pena, P; Monteiro, F J

    2011-06-01

    Titanium implants are the gold standard in dentistry; however, problems such as gingival tarnishing and peri-implantitis have been reported. For zirconia to become a competitive alternative dental implant material, surface modification techniques that induce guided tissue growth must be developed. To develop alternative surface modification techniques to promote guided tissue regeneration on zirconia materials, for applications in dental implantology. A methodology that combined soft lithography and sol-gel chemistry was used to obtain isotropic micropatterned silica coatings on yttria-stabilized zirconia substrates. The materials were characterized via chemical, structural, surface morphology approaches. In vitro biological behavior was evaluated in terms of early adhesion and viability/metabolic activity of human osteoblast-like cells. Statistical analysis was conducted using one-way ANOVA/Tukey HSD post hoc test. Isotropic micropatterned silica coatings on yttria-stabilized zirconia substrates were obtained using a combined approach based on sol-gel technology and soft lithography. Micropatterned silica surfaces exhibited a biocompatible behavior, and modulated cell responses (i.e. inducing early alignment of osteoblast-like cells). After 7d of culture, the cells fully covered the top surfaces of pillar microstructured silica films. The micropatterned silica films on zirconia showed a biocompatible response, and were capable of inducing guided osteoblastic cell adhesion, spreading and propagation. The results herein presented suggest that surface-modified ceramic implants via soft lithography and sol-gel chemistry could potentially be used to guide periodontal tissue regeneration, thus promoting tight tissue apposition, and avoiding gingival retraction and peri-implantitis. Copyright © 2011 Academy of Dental Materials. All rights reserved.

  9. Lu-177-Labeled Zirconia Particles for Radiation Synovectomy.

    PubMed

    Polyak, Andras; Nagy, Lívia Naszályi; Drotár, Eszter; Dabasi, Gabriella; Jóba, Róbert P; Pöstényi, Zita; Mikolajczak, Renata; Bóta, Attila; Balogh, Lajos

    2015-12-01

    The present article describes the preparation of β-emitter lutetium-177-labeled zirconia colloid and its preliminary physicochemical and biological evaluation of suitability for local radionuclide therapy. The new (177)Lu-labeled therapeutic radiopharmaceutical candidate was based on the synthesis mode of a previously described zirconia nanoparticle system. The size and shape of the developed radiopharmaceutical compound were observed through a scanning electron microscope and dynamic light scattering methods. The radiocolloid had a 1.7 μm mean diameter and showed high in vitro radiochemical and colloid size stability at room temperature and during the blood sera stability test. After the in vitro characterizations, the product was investigated in the course of the treatment of a spontaneously diseased dog veterinary patient's hock joint completed with single-photon emission computed tomography (SPECT) imaging follow-up measurements and a dual-isotope SPECT imaging tests with conventional (99m)Tc-methanediphosphonic acid bone scintigraphy. In the treated dog, no clinical side-effects or signs of histopathological changes of the joints were recorded during the treatment. SPECT follow-up studies clearly and conspicuously showed the localization of the (177)Lu-labeled colloid in the hock joint as well as detectable but negligible leakages of the radiocolloid in the nearest lymph node. On the basis of biological follow-up tests, the orthopedic team assumed that the (177)Lu-labeled zirconia colloid-based local radionuclide therapy resulted in a significant and long-term improvement in clinical signs of the patient without any remarkable side-effects.

  10. Accelerated Testing of HT-9 with Zirconia Coatings Containing Gallium using Raman Spectroscopy and XPS

    SciTech Connect

    Windisch, Charles F.; Henager, Charles H.; Engelhard, Mark H.; Bennett, Wendy D.

    2009-12-01

    Laser Raman spectroscopy and x-ray photoelectron spectroscopy were used to study the evolution of composition of oxide films in the presence of zirconia coatings on miniature HT-9 alloy specimens subjected to elevated temperature in air. The experiments expanded on previous efforts to develop a quick-screening technique for candidate alloys for cladding materials (HT-9) and actinide-based mixed oxide fuel mixtures (represented by the zirconia coating) by investigating the effect of both coating composition and alloy pretreatment conditions on the high temperature reactions. In particular, the presence of the element Ga (a potential impurity in mixed oxide fuel) in the initial zirconia coating was found to accelerate the rate of oxide growth relative to that of yttria-stabilized zirconia studied previously. In addition, HT-9 samples that were subjected to different thermal pretreatments gave different results. The results suggest that the presence of Ga in a mixed oxide fuel will enhance the corrosion of HT-9 cladding under the conditions of this study, although the extent of enhancement is influenced by thermal pretreatment of the cladding material. The results also demonstrate the need to combine Raman spectroscopy with other techniques, particularly photoelectron spectroscopy, for optimizing composition and/or fabrication conditions of both cladding and oxide fuels for advanced nuclear reactors.

  11. Damage Maps of Veneered Zirconia under Simulated Mastication

    PubMed Central

    Kim, Jae-Won; Kim, Joo-Hyung; Janal, Malvin N.; Zhang, Yu

    2016-01-01

    Zirconia based restorations often fracture from chipping and/or delamination of the porcelain veneers. We hypothesize that veneer chipping/delamination is a result of the propagation of near-contact induced partial cone cracks on the occlusal surface under mastication. Masticatory loading involves the opposing tooth sliding along the cuspal inner incline surface with an applied biting force. To test this hypothesis, flat porcelain veneered zirconia plates were cemented to dental composites and cyclically loaded (contact–slide–liftoff) at an inclination angle as a simplified model of zirconia based restorations under occlusion. In the light of in-situ observation of damage evolution in a transparent glass/zirconia/polycarbonate trilayer, postmortem damage evaluation of porcelain/zirconia/composite trilayers using a sectioning technique revealed that deep penetrating occlusal surface partial cone fracture is the predominant fracture mode of porcelain veneers. Clinical relevance is discussed. PMID:19029080

  12. Damage maps of veneered zirconia under simulated mastication.

    PubMed

    Kim, J-W; Kim, J-H; Janal, M N; Zhang, Y

    2008-12-01

    Zirconia-based restorations often fracture from chipping and/or delamination of the porcelain veneers. We hypothesized that veneer chipping/delamination is a result of the propagation of near-contact-induced partial cone cracks on the occlusal surface under mastication. Masticatory loading involves the opposing tooth sliding along the cuspal inner incline surface with an applied biting force. To test this hypothesis, we cemented flat porcelain-veneered zirconia plates onto dental composites and cyclically loaded them (contact-slide-liftoff) at an inclination angle as a simplified model of zirconia-based restorations under occlusion. In light of in situ observation of damage evolution in a transparent glass/zirconia/polycarbonate trilayer, post mortem damage evaluation of porcelain/zirconia/composite trilayers by a sectioning technique revealed that deep-penetrating occlusal surface partial cone fracture is the predominant fracture mode of porcelain veneers. Clinical relevance is discussed.

  13. A practice-based clinical evaluation of the survival and success of metal-ceramic and zirconia molar crowns: 5-year results.

    PubMed

    Rinke, S; Kramer, K; Bürgers, R; Roediger, M

    2016-02-01

    This practice-based study evaluates the survival and success of conventionally luted metal-ceramic and zirconia molar crowns fabricated by using a prolonged cooling period for the veneering porcelain. Fifty-three patients were treated from 07/2008 to 07/2009 with either metal-ceramic crowns (MCC) or zirconia crowns (ZC). Forty-five patients (26 female) with 91 restorations (obser-vational period: 64.0 ± 4.8 months) participated in a clinical follow-up examination and were included in the study. Estimated cumulative survival (ECSv), success (ECSc) and veneering ceramic success (ECVCSc) were calculated (Kaplan-Meier) and analysed by the crown fabrication technique and the position of the restoration (Cox regression model) (P < 0.05). Five complete failures (MCC: 2, ZC: 3) were recorded (5-year ECSv: MCC: 97.6%, (95% confidence interval (95%-CI): [93%; 100%]/ZC: 94.0%, (95%-CI): [87%; 100%]). Of the MCCs (n = 41), 85.0%, [95%-CI: (77%; 96%)] remained event-free, whereas the ECSc for the ZCs (n = 50) was 74.3% (95%-CI): [61%; 87%]. No significant differences in ECSv (P = 0.51), ECSc (P = 0.43) and ECVCSc (P = 0.36) were detected between the two fabrication techniques. Restorations placed on terminal abutments (n = 44) demonstrated a significantly lower ECVCSc (P = 0.035), (5-year VCF-rate: 14.8%) than crowns placed on tooth-neighboured abutments (n = 47), (5-year VCF-rate: 4.3%). In the present study, zirconia molar crowns demonstrated a 5-year ECSv, ECSc and ECVCSc comparable to MCCs. Irrespective of the fabrication technique, crowns on terminal abutments bear a significantly increased risk for VCFs. Clinical investigations with an increased number of restorations are needed.

  14. Marginal gap, cement thickness, and microleakage of 2 zirconia crown systems luted with glass ionomer and MDP-based cements.

    PubMed

    Sener, Isil; Turker, Begum; Valandro, Luiz Felipe; Ozcan, Mutlu

    2014-01-01

    This in vitro study evaluated the marginal gap, cement thickness, and microleakage of glass-ionomer cement (GIC) and phosphate monomer-containing resin cement (MDP-RC) under 2 zirconia crown systems (Cercon and DC-Zirkon). Forty human premolars were prepared for all-ceramic zirconia crowns with a 1 mm circumferential finish line and a 1.5 mm occlusal reduction. The crowns (n = 10 per group) from each zirconia system were randomly divided into 2 groups and cemented either with GIC (Vivaglass CEM) or MDP-RC (Panavia F 2.0) cement. The cemented crowns were thermocycled 5000 times (5°-55°C). The crowns were immersed in 0.5% basic fuchsine dye solution for 24 hours and sectioned buccolingually and mesiodistally. Specimens were examined under optical microscope (100X). Data were analyzed using Student t-test and chi-square tests (α = 0.05). Mean marginal gap values for Cercon (85 ± 11.4 μm) were significantly higher than for DC-Zircon (75.3 ± 13.2 μm) (P = 0.018). The mean cement thickness values of GIC (81.7 ± 13.9 μm) and MDP-RC (78.5 ± 12.5 μm) were not significantly different (P = 0.447). Microleakage scores did not demonstrate significant difference between GIC (P = 0.385) and MDP-RC (P = 0.631) under Cercon or DC-Zircon. Considering the cement thickness values and microleakage scores obtained, both zirconia crown systems could be cemented in combination with either GIC or MDP-RC.

  15. XRD study of yttria stabilized zirconia irradiated with 7.3 MeV Fe, 10 MeV I, 16 MeV Au, 200 MeV Xe and 2.2 GeV Au ions

    NASA Astrophysics Data System (ADS)

    Nakano, K.; Yoshizaki, H.; Saitoh, Y.; Ishikawa, N.; Iwase, A.

    2016-03-01

    To simulate energetic neutron irradiation effects, yttria-stabilized zirconia (YSZ) which is one of the major materials for electrical corrosion potential sensors (ECP sensors) was irradiated with heavy ions at energies ranging from 7.3 MeV to 2.2 GeV. Ion irradiation effects on the lattice structure were analyzed using the X-ray diffraction (XRD). The increase in lattice constant was induced by the ion irradiation. It was dominated by the elastic collision process and not by the electronic excitation process. The lattice disordering which was observed as a broadening of XRD peaks was also induced by the irradiation especially for 200 MeV Xe ion irradiation. The present result suggests that the expansion and/or the disordering of YSZ lattice induced by energetic neutrons may affect the durability of a joint interface between a metal housing and YSZ membrane for the usage of ECP sensors in nuclear power reactors.

  16. Sintering and Creep Behavior of Plasma-Sprayed Zirconia and Hafnia Based Thermal Barrier Coatings

    NASA Technical Reports Server (NTRS)

    Zhu, Dongming; Miller, Robert A.

    1998-01-01

    The sintering and creep of plasma-sprayed ceramic thermal barrier coatings under high temperature conditions are complex phenomena. Changes in thermomechanical and thermophysical properties and in the stress response of these coating systems as a result of the sintering and creep processes are detrimental to coating thermal fatigue resistance and performance. In this paper, the sintering characteristics of ZrO2-8wt%y2O3, ZrO2-25wt%CeO2-2.5wt%Y2O3, ZrO2-6w%NiO- 9wt%Y2O3, ZrO2-6wt%Sc2O3-2wt%y2O3 and HfO2-27wt%y2O3 coating materials were investigated using dilatometry. It was found that the HfO2-Y2O3 and baseline ZrO2-Y2O3 exhibited the best sintering resistance, while the NiO-doped ZrO2-Y2O3 showed the highest shrinkage strain rates during the tests. Higher shrinkage strain rates of the coating materials were also observed when the specimens were tested in Ar+5%H2 as compared to in air. This phenomenon was attributed to an enhanced metal cation interstitial diffusion mechanism under the reducing conditions. It is proposed that increased chemical stability of coating materials will improve the material sintering resistance.

  17. Immediate Placement of Zirconia Implants in Teeth with Periapical Lesions: A Case Report.

    PubMed

    Ahmed, Nizar A; Jacob, Caroline Annette; Nittla, Preetham Prasad

    2017-03-01

    This case report records the replacement of two failed endodontically treated mandibular molars with one piece zirconia implants in a patient with metal hypersensitivity. The two molars were atraumatically extracted and curetted to remove any remnants of a periapical granuloma. Immediate implant placement with primary stability was achieved using one piece WhiteSky(®) Bredent zirconia implants which were restored after four months with a zirconia crown. One year follow up revealed successful osseointegration with optimal form and function.

  18. Direct silanization of zirconia for increased biointegration.

    PubMed

    Caravaca, Carlos; Shi, Liu; Balvay, Sandra; Rivory, Pascaline; Laurenceau, Emmanuelle; Chevolot, Yann; Hartmann, Daniel; Gremillard, Laurent; Chevalier, Jérôme

    2016-12-01

    High-performance bioinert ceramics such as zirconia have been used for biomedical devices since the early seventies. In order to promote osseointegration, the historical solution has been to increase the specific surface of the implant through roughness. Nevertheless these treatments on ceramics may create defects at the surface, exposing the material to higher chances of early failure. In zirconia, such treatments may also affect the stability of the surface. More recently, the interest of improving osseointegration of implants has moved the research focus towards the actual chemistry of the surface. Inspired by this, we have adapted the current knowledge and techniques of silica functionalization and applied it to successfully introduce 3-aminopropyldimethylethoxy silane (APDMES) directly on the surface of zirconia (3Y-TZP). We used plasma of oxygen to clean the surface and promote hydroxylation of the surface to increase silane density. The samples were extensively characterized by means of X-ray photoelectron spectroscopy (XPS) and contact angle, mechanically tested and its cytotoxicity was evaluated through cell adhesion and proliferation tests. Additionally, aging was studied to discard negative effects of the treatment on the stability of the tetragonal phase. No adverse effect was found on the mechanical response of treated samples. In addition, plasma-treated samples exhibited an unexpectedly higher resistance to aging. Finally, silane density was 35% lower than the one reported in literature for silica. However cells displayed a qualitatively higher spreading in opposition to the rounder appearance of cells on untreated zirconia. These results lay the foundations for the next generation of zirconia implants with biologically friendlier surfaces.

  19. Development of a zirconia toughened hydroxyapatite

    NASA Astrophysics Data System (ADS)

    Mager, Carie Christine Wilkinson

    2000-10-01

    Because of its low fracture toughness (<1 MPa m 1/2) compared to bone (2--12 MPa m1/2), the use of HAp in dentistry and orthopedics is limited to low load bearing applications. In order to broaden its applications, HAp was reinforced through the addition of partially stabilized zirconia. HAp composites with varying amounts of zirconia were processed using a 2 level, 8 variable factorial design to determine the effect of various processing conditions on the stability of the zirconia and HAp phases and on the resulting toughening behavior of the composites. The processing conditions included in the design were; (a) milling times and fluid dispersion mediums; (b) sintering times and temperatures in ambient air and atmospheric pressure; and (c) hot isostatic pressing time and temperature in inert and "wet" environments. The effect of volume fraction and particle size of the zirconia in the range of 0--30 wt % and -0.9mum to -2.0mum respectively on the material's fracture toughness were also determined. The composites were also placed in a serum like solution for 6 months to study the effect of physiological environment on the various processing parameters and the resulting toughening behavior. The toughening behavior before and after in vitro exposure was monitored using micro Raman spectroscopy which enabled the size and shape of the transformation zone to, be quantified. The optimization of the design parameter's resulted in an increase in the fracture toughness by a factor of three and the six month in vitro study indicated that a zirconia toughened HAp implant could be processed so as to retain its hardness and toughness in vivo.

  20. Phase field modeling of tetragonal to monoclinic phase transformation in zirconia

    NASA Astrophysics Data System (ADS)

    Mamivand, Mahmood

    Zirconia based ceramics are strong, hard, inert, and smooth, with low thermal conductivity and good biocompatibility. Such properties made zirconia ceramics an ideal material for different applications form thermal barrier coatings (TBCs) to biomedicine applications like femoral implants and dental bridges. However, this unusual versatility of excellent properties would be mediated by the metastable tetragonal (or cubic) transformation to the stable monoclinic phase after a certain exposure at service temperatures. This transformation from tetragonal to monoclinic, known as LTD (low temperature degradation) in biomedical application, proceeds by propagation of martensite, which corresponds to transformation twinning. As such, tetragonal to monoclinic transformation is highly sensitive to mechanical and chemomechanical stresses. It is known in fact that this transformation is the source of the fracture toughening in stabilized zirconia as it occurs at the stress concentration regions ahead of the crack tip. This dissertation is an attempt to provide a kinetic-based model for tetragonal to monoclinic transformation in zirconia. We used the phase field technique to capture the temporal and spatial evolution of monoclinic phase. In addition to morphological patterns, we were able to calculate the developed internal stresses during tetragonal to monoclinic transformation. The model was started form the two dimensional single crystal then was expanded to the two dimensional polycrystalline and finally to the three dimensional single crystal. The model is able to predict the most physical properties associated with tetragonal to monoclinic transformation in zirconia including: morphological patterns, transformation toughening, shape memory effect, pseudoelasticity, surface uplift, and variants impingement. The model was benched marked with several experimental works. The good agreements between simulation results and experimental data, make the model a reliable tool for

  1. Comparison of fracture resistance and fit accuracy of customized zirconia abutments with prefabricated zirconia abutments in internal hexagonal implants.

    PubMed

    Park, Jong-Il; Lee, Yoon; Lee, Jin-Han; Kim, Yu-Lee; Bae, Ji-Myung; Cho, Hye-Won

    2013-10-01

    Customized zirconia abutments are increasingly applied for the fabrication of esthetic implant restorations aimed at imitating the natural situation. These abutments are individually shaped according to the anatomical needs of the respective implant site. This study sought to compare the fracture resistance and fit accuracy of prefabricated and customized zirconia abutments using an internal hexagonal implant system (TSV®, Zimmer, Carlsbad, CA, USA). Two zirconia abutment groups were tested: prefabricated zirconia abutments (ZirAce, Acucera, Seoul, Korea) and customized zirconia abutments milled by the Zirkonzahn milling system. Twenty zirconia abutments per group were connected to implants on an acrylic resin base with 30-Ncm torque. The fracture resistance of zirconia abutments was measured with an angle of 30° at a crosshead speed of 1 mm/min using the universal testing machine (Z020, Zwick, Ulm, Germany). Marginal and internal gaps between implants and zirconia abutments were measured after sectioning the embedded specimens using a digital microhardness tester (MXT70, Matsuzawa, Tokyo, Japan). The customized abutments were significantly stronger (1,430.2 N) than the prefabricated abutments (1,064.1 N). The mean marginal adaptation of customized abutments revealed a microgap that was increased (11.5 µm) over that in prefabricated abutments (4.3 µm). Within the limitations of this study, the customized abutments are significantly stronger than prefabricated abutments, but the fit is less accurate. The strength and fit of both abutments are within clinically acceptable limit. © 2012 Wiley Periodicals, Inc.

  2. A new composite cathode for intermediate temperature solid oxide fuel cells with zirconia-based electrolytes

    NASA Astrophysics Data System (ADS)

    Zhang, Cuijuan; Huang, Kevin

    2017-02-01

    Improving the electrocatalytic activity of electrode materials is vitally important to achieve practically meaningful performance for intermediate temperature solid oxide fuel cells (IT-SOFCs). The present work develops a composite cathode consisting of an electronic conductor Sr-doped LaMnO3 (LSM) and an ionic conductor Y- and Ce- co-doped Bi2O3 (BYC7). BYC7 is an excellent oxide-ion conductor, exhibiting a high and stable ionic conductivity of 0.008 S cm-1 at 500 °C. The polarization resistance of LSM-BYC7 cathode in a symmetrical cell with doped ZrO2 as electrolyte varies from 5.76 at 500 °C to 0.25 Ω cm2 at 650 °C. The surface diffusion and charge transfer at the triple phase boundaries are the rate determining steps based on the dependence of polarization resistance on partial pressure of oxygen. The maximum power density of a ZrO2-based anode-supported cell with LSM-BYC7 composite cathode is 56.4, 154.6, 327.9, and 451.0 mW cm-2 at 500, 550, 600, and 650 °C respectively. AC impedance analysis reveals that the performance of IT-SOFC prepared in this study is actually limited by the anode, not by LSM-BYC7 cathode.

  3. Effect of Yttria Content on the Zirconia Unit Cell Parameters

    SciTech Connect

    Krogstad, Jessica A.; Lepple, Maren; Gao, Yan; Lipkin, Don M.; Levi, Carlos G.

    2012-02-06

    The relationship between yttria concentration and the unit cell parameters in partially and fully stabilized zirconia has been reassessed, motivated by the need to improve the accuracy of phase analysis upon decomposition of t{prime}-based thermal barrier coatings. Compositions ranging from 6 to 18 mol% YO{sub 1.5} were synthesized and examined by means of high-resolution X-ray diffraction. Lattice parameters were determined using the Rietveld refinement method, a whole-pattern fitting procedure. The revised empirical relationships fall within the range of those published previously. However, efforts to achieve superior homogeneity of the materials, as well as accuracy of the composition and lattice parameters, provide increased confidence in the reliability of these correlations for use in future studies. Additional insight into the potential sources for scatter previously reported for the transition region ({approx}12-14 mol% YO{sub 1.5}), where tetragonal and cubic phases have been observed to coexist, is also provided. Implications on the current understanding of stabilization mechanisms in zirconia are discussed.

  4. Zirconia: Established facts and perspectives for a biomaterial in dental implantology.

    PubMed

    Hisbergues, Michael; Vendeville, Sophie; Vendeville, Philippe

    2009-02-01

    Currently, zirconia is widely used in biomedical area as a material for prosthetic devices because of its good mechanical and chemical properties. Largely employed in clinical area for total hip replacement, zirconia ceramics (ZrO(2)) are becoming a prevalent biomaterial in dentistry and dental implantology. Although titanium is used in dental implantology currently, there is a trend to develop new ceramic-based implants as an alternative to monolithic titanium. This article reviews the evolution and development of zirconia through data published between 1963 and January 2008 in English language. Articles were identified via a MEDLINE search using the following keywords: zirconia, zirconia/biocompatibility, zirconia/osseointegration, zirconia/periointegration, zirconia/review, and zirconia/bacterial adhesion or colonization. This review of the literature aims at highlighting and discussing zirconia properties in biological systems for their future use in dental implantology. In conclusion, zirconia with its interesting microstructural properties has been confirmed to be a material of choice for the "new generation" of implants, thanks to its biocompatibility, osseoconductivity, tendency to reduce plaque accumulation, and interaction with soft tissues, which leads to periointegration. However, scientific studies are promptly needed to fulfill gaps like long-term clinical evaluations of "all zirconia implants," currently leading to propose an alternative use of "hybrid systems" (i.e., titanium screw with zirconia collar) and also bacterial colonization of zirconia. Moreover, there is a permanent need for consistent information about topography and chemistry of zirconia allowing easier cross-product comparisons of clinical devices. Copyright 2008 Wiley Periodicals, Inc.

  5. A Raman study of the nanocrystallite size effect on the pressure temperature phase diagram of zirconia grown by zirconium-based alloys oxidation

    NASA Astrophysics Data System (ADS)

    Bouvier, P.; Godlewski, J.; Lucazeau, G.

    2002-02-01

    The pressure-temperature phase diagrams of different zirconia samples prepared by oxidation of Zircaloy-4 and Zr-1%Nb-0.12O alloys were monitored by Raman spectrometry from 0.1 MPa to 12 GPa and from 300 to 640 K. These new diagrams show that the monoclinic-tetragonal equilibrium line is strongly downshifted in temperature compared to literature measurements performed on usual polycrystalline zirconia. In addition, the monoclinic-orthorhombic equilibrium line is slightly shifted to higher pressure (i.e. 6 GPa). The crystallite sizes smaller than 30 nm, are thought to be responsible for these equilibrium line displacements. The tetragonal phase obtained in temperature under high pressure can be quenched at room temperature, if the pressure is maintained, and it is destabilised and transforms completely into monoclinic phase if the pressure is released. These results confirm that coupled effects of stress, temperature and nanosized grain are responsible for the formation of the tetragonal phase near the metal/oxide interface during the oxidation of zirconium-based alloys.

  6. Temperature dependent dielectric function in the near-infrared to vacuum-ultraviolet ultraviolet spectral range of alumina and yttria stabilized zirconia thin films

    SciTech Connect

    Schmidt-Grund, R. Lühmann, T.; Böntgen, T.; Franke, H.; Lorenz, M.; Grundmann, M.; Opper, D.

    2013-12-14

    The dielectric function of nano-/polycrystalline alumina and yttria stabilised zirconia thin films has been investigated in a wide spectral range from 1.0 eV to 7.5 eV and temperatures between 10 K and room temperature. In the near band-edge spectral range, we found a broad distribution of optical transitions within the band gap, the so-called Urbach absorption tail which is typical for amorphous or polycrystalline materials due to the lack of long range order in the crystal structure. The coupling properties of the electronic system to the optical phonon bath and thermal lattice vibrations strongly depend on the ratio of the spectral extent of these disorder states to the main phonon energy, which we correlate with the different crystalline structure of our samples. The films have been grown at room temperature and 650 °C by pulsed laser deposition.

  7. A high-temperature liquid chromatographic reactor approach for investigating the solvolytic stability of a pharmaceutical compound and an investigation of its retention behavior on a C18-modified zirconia stationary phase.

    PubMed

    Skrdla, Peter J; Bopra, Angela; Chasse, Tyson; Wang, Tao

    2008-06-09

    The solvolysis kinetics of a developmental active pharmaceutical ingredient (API) were investigated using a high temperature (HT)-HPLC reactor approach to determine whether it might be possible to use the technique to efficiently screen the relative stabilities of typical APIs (particularly those that are stable at the column temperatures achievable on most HPLC systems and over durations of less than 60 min-a reasonable upper limit for typical method run time). It was discovered that the on-column API degradation kinetics better obeyed a second-order model than a first-order one. Employing a newly developed mathematical treatment, the apparent activation energy for the process was determined to be 85.7+/-1.6 kJ/mol; the apparent frequency factor was found to be (3.9+/-0.4)x10(4) s(-1). The retention mechanism of the API on the C18-modified zirconia column (ZirChrom) Diamondbond-C18) was investigated using a van't Hoff analysis. It was discovered that the logarithm of the retention factor (following correction for the gradient elution of the assay method) exhibited a quadratic dependence on the reciprocal of the absolute temperature. While the retention was found to be predominantly enthalpically driven over the majority of temperatures investigated in this study (ranging from 40 to 200 degrees C), a regression fit of the curve predicted a maximum at approximately 20 degrees C, indicative of a transition from predominantly enthalpically controlled retention to a mainly entropically driven mechanism. A table summarizing the thermodynamic retention parameters at each experimental column temperature is provided. Finally, the preliminary application of the HT-HPLC reactor approach to the study of degradation kinetics of other APIs is discussed in terms of some unexpected findings obtained using the zirconia column.

  8. pH control of the structure, composition, and catalytic activity of sulfated zirconia

    NASA Astrophysics Data System (ADS)

    Ivanov, Vladimir K.; Baranchikov, Alexander Ye.; Kopitsa, Gennady P.; Lermontov, Sergey A.; Yurkova, Lyudmila L.; Gubanova, Nadezhda N.; Ivanova, Olga S.; Lermontov, Anatoly S.; Rumyantseva, Marina N.; Vasilyeva, Larisa P.; Sharp, Melissa; Pranzas, P. Klaus; Tretyakov, Yuri D.

    2013-02-01

    We report a detailed study of structural and chemical transformations of amorphous hydrous zirconia into sulfated zirconia-based superacid catalysts. Precipitation pH is shown to be the key factor governing structure, composition and properties of amorphous sulfated zirconia gels and nanocrystalline sulfated zirconia. Increase in precipitation pH leads to substantial increase of surface fractal dimension (up to ˜2.7) of amorphous sulfated zirconia gels, and consequently to increase in specific surface area (up to ˜80 m2/g) and simultaneously to decrease in sulfate content and total acidity of zirconia catalysts. Complete conversion of hexene-1 over as synthesized sulfated zirconia catalysts was observed even under ambient conditions.

  9. In Vitro Cell Proliferation and Mechanical Behaviors Observed in Porous Zirconia Ceramics

    PubMed Central

    Li, Jing; Wang, Xiaobei; Lin, Yuanhua; Deng, Xuliang; Li, Ming; Nan, Cewen

    2016-01-01

    Zirconia ceramics with porous structure have been prepared by solid-state reaction using yttria-stabilized zirconia and stearic acid powders. Analysis of its microstructure and phase composition revealed that a pure zirconia phase can be obtained. Our results indicated that its porosity and pore size as well as the mechanical characteristics can be tuned by changing the content of stearic acid powder. The optimal porosity and pore size of zirconia ceramic samples can be effective for the increase of surface roughness, which results in higher cell proliferation values without destroying the mechanical properties. PMID:28773341

  10. Fabrication and Characterization of Dual Phase Magnesia-Zirconia Ceramics Doped with Plutonia

    SciTech Connect

    P. G. Medvedev; J. F. Jue; S. M. Frank; M.K. Meyer

    2005-05-01

    Dual phase magnesia-zirconia ceramics doped with plutonia are being studied as an inert matrix fuel (IMF) for light water reactors. The motivation of this work is to develop an IMF with a thermal conductivity superior to that of the fuels based on yttria stabilized zirconia. The concept uses the MgO phase as an efficient heat conductor to increase thermal conductivity of the composite. In this paper ceramic fabrication and characterization by scanning electron microscopy, energy and wavelength dispersive xray spectroscopy is discussed. Characterization shows that the ceramics consist of the two-phase matrix and PuO2-rich inclusions. The matrix is comprised of pure MgO phase and MgO-ZrO2-PuO2 solid solution. The PuO2-rich inclusion contained dissolved MgO and ZrO2.

  11. Zirconia dental implants degradation by confocal Raman microspectroscopy: analytical simulation and experiments.

    PubMed

    Djaker, Nadia; Wulfman, Claudine; Sadoun, Michaël; Lamy de la Chapelle, Marc

    2013-05-01

    Subsurface hydrothermal degradation of yttria stabilized tetragonal zirconia polycrystals (3Y-TZP) is presented. Evaluation of low temperature degradation (LTD) phase transformation induced by aging in 3Y-TZP is experimentally studied by Raman confocal microspectroscopy. A non-linear distribution of monoclinic volume fraction is determined in depth by using different pinhole sizes. A theoretical simulation is proposed based on the convolution of the excitation intensity profile and the Beer-Lambert law (optical properties of zirconia) to compare between experiment and theory. The calculated theoretical degradation curves matche closely to the experimental ones. Surface transformation (V0) and transformation factor in depth (T) are obtained by comparing simulation and experience for each sample with nondestructive optical sectioning.

  12. Zirconia dental implants degradation by confocal Raman microspectroscopy: analytical simulation and experiments

    PubMed Central

    Djaker, Nadia; Wulfman, Claudine; Sadoun, Michaël; Lamy de la Chapelle, Marc

    2013-01-01

    Subsurface hydrothermal degradation of yttria stabilized tetragonal zirconia polycrystals (3Y-TZP) is presented. Evaluation of low temperature degradation (LTD) phase transformation induced by aging in 3Y-TZP is experimentally studied by Raman confocal microspectroscopy. A non-linear distribution of monoclinic volume fraction is determined in depth by using different pinhole sizes. A theoretical simulation is proposed based on the convolution of the excitation intensity profile and the Beer-Lambert law (optical properties of zirconia) to compare between experiment and theory. The calculated theoretical degradation curves matche closely to the experimental ones. Surface transformation (V0) and transformation factor in depth (T) are obtained by comparing simulation and experience for each sample with nondestructive optical sectioning. PMID:23667788

  13. Evaluation of translucency of monolithic zirconia and framework zirconia materials.

    PubMed

    Tuncel, İlkin; Turp, Işıl; Üşümez, Aslıhan

    2016-06-01

    The opacity of zirconia is an esthetic disadvantage that hinders achieving natural and shade-matched restorations. The aim of this study was to evaluate the translucency of non-colored and colored framework zirconia and monolithic zirconia. The three groups tested were: non-colored framework zirconia, colored framework zirconia with the A3 shade according to Vita Classic Scale, and monolithic zirconia (n=5). The specimens were fabricated in the dimensions of 15×12×0.5 mm. A spectrophotometer was used to measure the contrast ratio, which is indicative of translucency. Three measurements were made to obtain the contrast ratios of the materials over a white background (L(*)w) and a black background (L(*)b). The data were analyzed using the one-way analysis of variance and Tukey HSD tests. One specimen from each group was chosen for scanning electron microscope analysis. The determined areas of the SEM images were divided by the number of grains in order to calculate the mean grain size. Statistically significant differences were observed among all groups (P<.05). Non-colored zirconia had the highest translucency with a contrast ratio of 0.75, while monolithic zirconia had the lowest translucency with a contrast ratio of 0.8. The mean grain sizes of the non-colored, colored, and monolithic zirconia were 233, 256, and 361 nm, respectively. The translucency of the zirconia was affected by the coloring procedure and the grain size. Although monolithic zirconia may not be the best esthetic material for the anterior region, it may serve as an alternative in the posterior region for the bilayered zirconia restorations.

  14. Evaluation of translucency of monolithic zirconia and framework zirconia materials

    PubMed Central

    Tuncel, İlkin; Üşümez, Aslıhan

    2016-01-01

    PURPOSE The opacity of zirconia is an esthetic disadvantage that hinders achieving natural and shade-matched restorations. The aim of this study was to evaluate the translucency of non-colored and colored framework zirconia and monolithic zirconia. MATERIALS AND METHODS The three groups tested were: non-colored framework zirconia, colored framework zirconia with the A3 shade according to Vita Classic Scale, and monolithic zirconia (n=5). The specimens were fabricated in the dimensions of 15×12×0.5 mm. A spectrophotometer was used to measure the contrast ratio, which is indicative of translucency. Three measurements were made to obtain the contrast ratios of the materials over a white background (L*w) and a black background (L*b). The data were analyzed using the one-way analysis of variance and Tukey HSD tests. One specimen from each group was chosen for scanning electron microscope analysis. The determined areas of the SEM images were divided by the number of grains in order to calculate the mean grain size. RESULTS Statistically significant differences were observed among all groups (P<.05). Non-colored zirconia had the highest translucency with a contrast ratio of 0.75, while monolithic zirconia had the lowest translucency with a contrast ratio of 0.8. The mean grain sizes of the non-colored, colored, and monolithic zirconia were 233, 256, and 361 nm, respectively. CONCLUSION The translucency of the zirconia was affected by the coloring procedure and the grain size. Although monolithic zirconia may not be the best esthetic material for the anterior region, it may serve as an alternative in the posterior region for the bilayered zirconia restorations. PMID:27350851

  15. Phase transformation of zirconia ceramics by hydrothermal degradation.

    PubMed

    Kawai, Yohei; Uo, Motohiro; Wang, Yongming; Kono, Sayaka; Ohnuki, Somei; Watari, Fumio

    2011-01-01

    Zirconia has found wide application in dentistry because of its high mechanical strength and superior esthetic properties. However, zirconia degradation caused by phase transformation occurring in a hydrothermal environment is of concern. In the present study, phase transformation and microstructure of tetragonal zirconia polycrystal partially stabilized with yttrium oxide (Y-TZP) and alumina-toughened zirconia (ATZ) sintered at different temperatures were estimated. On grazing angle X-ray diffraction analysis, ATZ showed less phase transformation to the monoclinic phase during hydrothermal treatment and this transformation appeared to occur within a few micrometers below the surface. At a higher sintering temperature the monoclinic phase content of ATZ was found to be lesser than that of Y-TZP, indicating that the alumina in ATZ was effective in suppressing hydrothermal degradation. Examination by transmission electron microscopy and studying of electron backscatter diffraction patterns indicated that grain growth in ATZ was slightly suppressed compared with that in Y-TZP at higher sintering temperatures. The present study demonstrated the effect of adding alumina to zirconia for suppressing hydrothermal degradation and studied the effect of this addition on grain growth in zirconia.

  16. Zirconia implant abutments: a review.

    PubMed

    Gomes, Ana-Luísa; Montero, Javier

    2011-01-01

    An increasing aesthetic demand within developed populations conducted to the fabrication of metal-free restorations and to a wide use of ceramic materials, due to its excellent characteristics of biocompatibility and aesthetics. With the incessant increase of commercial labels involved in this technological advance, a review is imposed on ceramic abutments, specifically on zirconia. We made a search of articles of peer-reviewed Journals in PubMed/Medline, crossing the terms "Dental Abutments", "Dental Porcelain" and "Zirconia". The review was divided by subtopics: zirconia physical and mechanical properties, precision fit in the implant-abutment interface, zirconia abutments strength and, finally, bacterial adherence and tissues response. Several studies demonstrate that zirconia abutments offer good results at all the levels but relevant issues need further studies and evaluation. One of the most important is the clinical long term success of zirconia abutments on implants, given that in the literature there are no sufficient in vivo studies that prove it.

  17. Glass ceramic toughened with tetragonal zirconia

    DOEpatents

    Keefer, K.D.

    1984-02-10

    A phase transformation-toughened glass ceramic and a process for making it are disclosed. A mixture of particulate network-forming oxide, network-modifying oxide, and zirconium oxide is heated to yield a homogeneous melt, and this melt is then heat treated to precipitate an appreciable quantity of tetragonal zirconia, which is retained at ambient temperature to form a phase transformation-toughened glass ceramic. Nuclearing agents and stabilizing agents may be added to the mixture to facilitate processing and improve the ceramic's properties. Preferably, the mixture is first melted at a temperature from 1200 to 1700/sup 0/C and is then heat-treated at a temperature within the range of 800 to 1200/sup 0/C in order to precipitate tetragonal ZrO/sub 2/. The composition, as well as the length and temperature of the heat treatment, must be carefully controlled to prevent solution of the precipitated tetragonal zirconia and subsequent conversion to the monoclinic phase.

  18. Ultrafast soliton mode-locked Zirconia-based Erbium-doped fiber laser with carbon nanotubes saturable absorber

    NASA Astrophysics Data System (ADS)

    Munira Markom, Arni; Wey Sen-Winson, Mah; Paul, Mukul Chandra; Wadi Harun, Sulaiman

    2017-06-01

    Ultrafast soliton mode-locked fiber laser was successfully generated in zirconia-yttria-alumina (Zr-Y-Al) co-doped erbium-doped fiber laser cavity using a single-wall carbon nanotubes (SWCNTs) as saturable absorber. The laser cavity was 11.5 m long with the group delay dispersion of -0.04 ps2. The laser generates soliton pulse train with a center wavelength and 3 dB bandwidth of 1564.2 nm and 3.8 nm, respectively at pump power of 92 mW. Meanwhile, the repetition rate, pulse duration and pulse energy were 17.7 MHz, 770 fs and 51.4 nJ.

  19. Concerns of hydrothermal degradation in CAD/CAM zirconia.

    PubMed

    Kim, J-W; Covel, N S; Guess, P C; Rekow, E D; Zhang, Y

    2010-01-01

    Zirconia-based restorations are widely used in prosthetic dentistry; however, their susceptibility to hydrothermal degradation remains elusive. We hypothesized that CAD/CAM machining and subsequent surface treatments, i.e., grinding and/or grit-blasting, have marked effects on the hydrothermal degradation behavior of Y-TZP. CAD/CAM-machined Y-TZP plates (0.5 mm thick), both with and without subsequent grinding with various grit sizes or grit-blasting with airborne alumina particles, were subjected to accelerated aging tests in a steam autoclave. Results showed that the CAD/CAM-machined surfaces initially exhibited superior hydrothermal degradation resistance, but deteriorated at a faster rate upon prolonged autoclave treatment compared with ground and grit-blasted surfaces. The accelerated hydrothermal degradation of CAD/CAM surfaces is attributed to the CAD/CAM machining damage and the absence of surface compressive stresses in the fully sintered material. Clinical relevance for surface treatments of zirconia frameworks in terms of hydrothermal and structural stabilities is addressed.

  20. Concerns of Hydrothermal Degradation in CAD/CAM Zirconia

    PubMed Central

    Kim, J.-W.; Covel, N.S.; Guess, P.C.; Rekow, E.D.; Zhang, Y.

    2010-01-01

    Zirconia-based restorations are widely used in prosthetic dentistry; however, their susceptibility to hydrothermal degradation remains elusive. We hypothesized that CAD/CAM machining and subsequent surface treatments, i.e., grinding and/or grit-blasting, have marked effects on the hydrothermal degradation behavior of Y-TZP. CAD/CAM-machined Y-TZP plates (0.5 mm thick), both with and without subsequent grinding with various grit sizes or grit-blasting with airborne alumina particles, were subjected to accelerated aging tests in a steam autoclave. Results showed that the CAD/CAM-machined surfaces initially exhibited superior hydrothermal degradation resistance, but deteriorated at a faster rate upon prolonged autoclave treatment compared with ground and grit-blasted surfaces. The accelerated hydrothermal degradation of CAD/CAM surfaces is attributed to the CAD/CAM machining damage and the absence of surface compressive stresses in the fully sintered material. Clinical relevance for surface treatments of zirconia frameworks in terms of hydrothermal and structural stabilities is addressed. PMID:19966039

  1. Zirconia as a Dental Biomaterial.

    PubMed

    Bona, Alvaro Della; Pecho, Oscar E; Alessandretti, Rodrigo

    2015-08-04

    Ceramics are very important in the science of dental biomaterials. Among all dental ceramics, zirconia is in evidence as a dental biomaterial and it is the material of choice in contemporary restorative dentistry. Zirconia has been applied as structural material for dental bridges, crowns, inserts, and implants, mostly because of its biocompatibility, high fracture toughness, and radiopacity. However, the clinical success of restorative dentistry has to consider the adhesion to different substrates, which has offered a great challenge to dental zirconia research and development. This study characterizes zirconia as a dental biomaterial, presenting the current consensus and challenges to its dental applications.

  2. Creep of plasma sprayed zirconia

    NASA Technical Reports Server (NTRS)

    Firestone, R. F.; Logan, W. R.; Adams, J. W.

    1982-01-01

    Specimens of plasma-sprayed zirconia thermal barrier coatings with three different porosities and different initial particle sizes were deformed in compression at initial loads of 1000, 2000, and 3500 psi and temperatures of 1100 C, 1250 C, and 1400 C. The coatings were stabilized with lime, magnesia, and two different concentrations of yttria. Creep began as soon as the load was applied and continued at a constantly decreasing rate until the load was removed. Temperature and stabilization had a pronounced effect on creep rate. The creep rate for 20% Y2O3-80% ZrO2 was 1/3 to 1/2 that of 8% Y2O3-92% ZrO2. Both magnesia and calcia stabilized ZrO2 crept at a rate 5 to 10 times that of the 20% Y2O3 material. A near proportionality between creep rate and applied stress was observed. The rate controlling process appeared to be thermally activated, with an activation energy of approximately 100 cal/gm mole K. Creep deformation was due to cracking and particle sliding.

  3. Electrophoretic bilayer deposition of zirconia and reinforced bioglass system on Ti6Al4V for implant applications: an in vitro investigation.

    PubMed

    Ananth, K Prem; Suganya, S; Mangalaraj, D; Ferreira, J M F; Balamurugan, A

    2013-10-01

    The physical, chemical and biological properties of the bioglass reinforced yttria-stabilized composite layer on Ti6Al4V titanium substrates were investigated. The Ti6Al4V substrate was deposited with yttria stabilized zirconia - YSZ as the base layer of thickness ≈4-5 μm, to inhibit metal ion leach out from the substrate and bioglass zirconia reinforced composite as the second layer of thickness ≈15 μm, which would react with surrounding bone tissue to enhance bone formation and implant fixation. The deposition of these two layers on the substrate was carried out using the most viable electrophoretic deposition (EPD) technique. Biocompatible yttria-stabilized zirconia (YSZ) in the form of nano-particles and sol gel derived bioglass in the form of micro-particles were chosen as precursors for coating. The coatings were vacuum sintered at 900 °C for 3h. The biocompatibility and corrosion resistance property were studied in osteoblast cell culture and in simulated body fluid (SBF) respectively. Analysis showed that the zirconia reinforced bioglass bilayer system promoted significant bioactivity, and it exhibited a better corrosion resistance property and elevated mechanical strength under load bearing conditions in comparison with the monolayer YSZ coating on Ti6Al4V implant surface.

  4. Measurement and Calculation of Electrochemical Potentials in Hydrogenated High Temperature Water, including an Evaluation of the Yttria-Stabilized Zirconia/Iron-Iron Oxide (Fe/Fe3O4) Probe as Reference Electrode

    SciTech Connect

    Steven A. Attanasio; David S. Morton; Mark A. Ando

    2001-10-22

    The importance of knowing the electrochemical corrosion potential (ECP, also referred to as E{sub con}) of nickel-base alloys in hydrogenated water is related to the need to understand the effects of dissolved (i.e., aqueous) hydrogen concentration ([H{sub 2}]) on primary water stress corrosion cracking (PWSCC). Also, the use of a reference electrode (RE) can improve test quality by heightening the ability to detect instances of out-of-specification or unexpected chemistry. Three methods are used to measure and calculate the ECP of nickel-based alloys in hydrogenated water containing {approx} 1 to 150 scc/kg H{sub 2} (0.1 to 13.6 ppm H{sub 2}) at 260 to 360 C. The three methods are referred to as the specimen/component method, the platinum (Pt) method, and the yttria-stabilized zirconia/iron-iron oxide (YSZ/Fe-Fe{sub 3}O{sub 4}) RE method. The specimen/component method relies upon the assumption that the specimen or component behaves as a hydrogen electrode, and its E{sub corr} is calculated using the Nernst equation. The present work shows that this method is valid for aqueous H{sub 2} levels {ge} {approx} 5 to 10 scc/kg H{sub 2}. The Pt method uses a voltage measurement between the specimen or component and a Pt electrode, with the Pt assumed to behave as a hydrogen electrode; this method is valid as long as the aqueous H{sub 2}level is known. The YSZ/Fe-Fe{sub 3}O{sub 4}, which represents a relatively new approach for measuring E{sub corr} in this environment, can be used even if the aqueous H{sub 2} level is unknown. The electrochemical performance of the YSZ/Fe-Fe{sub 3}O{sub 4} probe supports its viability as a RE for use in high temperature hydrogenated water. Recent design modifications incorporating a teflon sealant have improved the durability of this RE (however, some of the REs do still fail prematurely due to water in-leakage). The Pt method is judged to represent the best overall approach, though there are cases where the other methods are superior

  5. Surface properties of titanium and zirconia dental implant materials and their effect on bacterial adhesion.

    PubMed

    Al-Radha, Afya Sahib Diab; Dymock, David; Younes, Charles; O'Sullivan, Dominic

    2012-02-01

    Zirconia ceramic material has been widely used in implant dentistry. In this in vitro study the physiochemical properties of titanium and zirconia materials were investigated and the affinity of different bacteria to different materials was compared. Disc samples with different surface states were used: polished partially stabilized zirconia (PZ), titanium blasted with zirconia (TBZ), titanium blasted with zirconia then acid etched (TBZA), and polished titanium (PT) as a control. Surface topography was examined using scanning electron microscopy and profilometry. Contact angle, surface free energy (SFE), surface microhardness and chemical composition were determined. Disc samples were separately incubated with Streptococcus mitis and Prevotella nigrescens, either with or without pre-coating with human saliva, for 6h and the surface area covered by bacteria was calculated from fluorescence microscope images. PZ and TBZ exhibited lower surface free energy and lesser surface wettability than PT. Also, PZ and TBZ surfaces showed lower percentage of bacterial adhesion compared with control PT surface. The zirconia material and titanium blasted with zirconia surface (TBZ surface) showed superior effect to titanium material in reducing the adhesion of the experimented bacteria especially after coating with saliva pellicle. Modifying titanium with zirconia lead to have the same surface properties of pure zirconia material in reducing bacterial adhesion. SFE appears to be the most important factors that determine initial bacterial adhesion to smooth surface. Copyright © 2011 Elsevier Ltd. All rights reserved.

  6. Comparative analysis of transmittance for different types of commercially available zirconia and lithium disilicate materials.

    PubMed

    Harianawala, Husain Hatim; Kheur, Mohit Gurunath; Apte, Sanjay Krishnaji; Kale, Bharat Bhanudas; Sethi, Tania Sanjeev; Kheur, Supriya Mohit

    2014-12-01

    Translucency and colour stability are two most important aspects for an aesthetic dental restoration. Glass ceramic restorations are popular amongst clinicians because of their superior aesthetic properties. In the last decade, zirconia has generated tremendous interest due to its favorable mechanical and biological properties. However, zirconia lacks the translucency that lithium disilicate materials possess and therefore has limitations in its use, especially in esthetically demanding situations. There has been a great thrust in research towards developing translucent zirconia materials for dental restorations. The objective of the study was to evaluate and compare the transmittance of a translucent variant of zirconia to lithium disilicate. Two commercially available zirconia materials (conventional and high translucency) and 2 lithium disilicate materials (conventional and high translucency) with standardized dimensions were fabricated. Transmittance values were measured for all samples followed by a microstructural analysis using a finite element scanning electron microscope. One way analysis of variance combined with a Tukey-post hoc test was used to analyze the data obtained (P=.05). High translucency lithium disilicate showed highest transmittance of all materials studied, followed by conventional lithium disilicate, high translucency zirconia and conventional zirconia. The difference between all groups of materials was statistically significant. The transmittance of the different materials correlated to their microstructure analysis. Despite manufacturers' efforts to make zirconia significantly more translucent, the transmittance values of these materials still do not match conventional lithium disilicate. More research is required on zirconia towards making the material more translucent for its potential use as esthetic monolithic restoration.

  7. Metal stain on monolithic zirconia restoration: A case report

    PubMed Central

    2017-01-01

    In restorative treatment using fixed dental prostheses, dentists should select appropriate restoration material among various types of dental materials. The strength, marginal fit, esthetics, wear resistance, biocompatibility, and cost are important factors in the choice of restoration materials. The present case showed a surface stain on a monolithic zirconia restoration that was due to wear between the monolithic zirconia restoration and the base metal alloy restoration. This phenomenon was confirmed by surface roughness measurement and electron probe micro-analysis. PMID:28435624

  8. Metal stain on monolithic zirconia restoration: A case report.

    PubMed

    Cha, Min-Sang; Lee, Sang-Woon; Huh, Yoon-Hyuk; Cho, Lee-Ra; Park, Chan-Jin

    2017-04-01

    In restorative treatment using fixed dental prostheses, dentists should select appropriate restoration material among various types of dental materials. The strength, marginal fit, esthetics, wear resistance, biocompatibility, and cost are important factors in the choice of restoration materials. The present case showed a surface stain on a monolithic zirconia restoration that was due to wear between the monolithic zirconia restoration and the base metal alloy restoration. This phenomenon was confirmed by surface roughness measurement and electron probe micro-analysis.

  9. [Clinical application of optimal designed Upcera super transparent zirconia all-ceramic restorations].

    PubMed

    Ding, Chen; Yu, Qing; Jing, Jian-long; Liu, Zheng-ming

    2013-10-01

    To summarize the clinical application of special designed Upcera ST zirconia all-ceramic restorations in cases with limited occlusal space. Twenty-one patients with 23-unit restorations were enrolled in this study. First, the shape of abutment teeth and diagnostic wax-up were captured and digitized by Sirona inEos system. Then, each individually shaped framework to grant a defined ST zirconia base core was created by the reduced program of inLab software. Finally, all restorations were veneered with VITA VM9 and evaluated at placement using modified U.S.Public Health Service Criteria 6 to 12 months after restoration. Patients were inquired with satisfaction questionnaire at the same time. During 6 to 12 months of follow-up visit, except for one of 23 restorations was rated as failure by fractured root, none was replaced due to framework fracture or unrestorable delamination of the ceramic veneer. The shape and colour of all restorations were satisfactory. To ensure optimum long-term clinical results of all-ceramic crown restorations, one important key is to overcome the fragmentation of dental prosthesis through modifying the shape of restoration. Based on the results of this study, the specially designed processing technology shows sufficient stability for ST zirconia all-ceramic restorations within a short term, which is deserved to be used in selected cases.

  10. Cubic zirconia as a high-quality facet coating for semiconductor lasers

    NASA Astrophysics Data System (ADS)

    Chin, A. K.; Satyanarayan, A.; Zarrabi, J. H.; Vetterling, W.

    1988-08-01

    In this paper we describe the properties of high-quality, semiconductor laser facet coatings based on yttria-stabilizied cubic zirconia (90-m% ZrO2/10-m% Y2O3). We have found that cubic zirconia films can be reproducibly deposited by electron-beam evaporation with an index of refraction of 1.98 at 6328 Å, almost ideal for use as a single-layer antireflection coating for GaAs/GaAlAs-based lasers. ZrO2 has a monoclinic crystal structure at room temperature, but changes to tetragonal, hexagonal, and cubic phases upon heating to higher temperatures. However, the addition of the Y2O3 stabilizes ZrO2 in the cubic form, thus allowing electron-beam deposition of thin films of this material to be more controllable and reproducible without the usual addition of oxygen into the vacuum chamber during deposition. Preliminary aging tests of high-power GaAs/GaAlAs lasers show that cubic zirconia films suppress the photo-enhanced oxidation of laser facets that degrades device performance.

  11. High-temperature zirconia insulation and method for making same

    DOEpatents

    Wrenn, G.E. Jr.; Holcombe, C.E. Jr.; Lewis, J. Jr.

    1988-05-10

    The present invention is directed to a highly pure, partially stabilized, fibrous zirconia composite for use as thermal insulation in environments where temperatures up to about 2,000 C are utilized. The composite of the present invention is fabricated into any suitable configuration such as a cone, cylinder, dome or the like by vacuum molding an aqueous slurry of partially stabilized zirconia fibers into a desired configuration on a suitably shaped mandrel. The molded fibers are infiltrated with zirconyl nitrate and the resulting structure is then dried to form a rigid structure which may be removed and placed in a furnace. The structure is then heated in air to a temperature of about 600 C for driving off the nitrate from the structure and for oxidizing the zirconyl ion to zirconia. Thereafter, the structure is heated to about 950 to 1,250 C to fuse the zirconia fibers at their nexi in a matrix of zirconia. The composite produced by the present invention is self-supporting and can be readily machined to desired final dimensions. Additional heating to about 1,800 to 2,000 C further improves structural rigidity.

  12. High-temperature zirconia insulation and method for making same

    DOEpatents

    Wrenn, G.E. Jr.; Holcombe, C.E. Jr.; Lewis, J. Jr.

    The present invention is directed to a highly pure, partially stabilized, fibrous zirconia composite for use as thermal insulation in environments where temperatures up to about 2,000/sup 0/C are utilized. The composite of the present invention is fabricated into any suitable configuration such as a cone, cylinder dome or the like by vacuum molding an aqueous slurry of partially stabilized zirconia fibers into a desired configuration on a suitably shaped mandrel. The molded fibers are infiltrated with zirconyl nitrate and the resulting structure is then dried to form a rigid structure which may be removed and placed in a furnace. The structure is then heated in air to a temperature of about 600/sup 0/C for driving off the nitrate from the structure and for oxidizing the zirconyl ion to zirconia. Thereafter, the structure is heated to about 950/sup 0/ to 1,250/sup 0/C to fuse the zirconia fibers at their nexi in a matrix of zirconia. The composite produced by the present invention is self-supporting and can be readily machined to desired final dimensions. Additional heating to about 1800/sup 0/ to 2000/sup 0/C further improves structural rigidity.

  13. High-temperature zirconia insulation and method for making same

    DOEpatents

    Wrenn, Jr., George E.; Holcombe, Jr., Cressie E.; Lewis, Jr., John

    1988-01-01

    The present invention is directed to a highly pure, partially stabilized, fibrous zirconia composite for use as thermal insulation in environments where temperatures up to about 2000.degree. C. are utilized. The composite of the present invention is fabricated into any suitable configuration such as a cone, cylinder, dome or the like by vacuum molding an aqueous slurry of partially stabilized zirconia fibers into a desired configuration on a suitably shaped mandrel. The molded fibers are infiltrated with zirconyl nitrate and the resulting structure is then dried to form a rigid structure which may be removed and placed in a furnace. The structure is then heated in air to a temperature of about 600.degree. C. for driving off the nitrate from the structure and for oxidizing the zirconyl ion to zirconia. Thereafter, the structure is heated to about 950.degree. to 1,250.degree. C. to fuse the zirconia fibers at their nexi in a matrix of zirconia. The composite produced by the present invention is self-supporting and can be readily machined to desired final dimensions. Additional heating to about 1800.degree. to 2000.degree. C. further improves structural rigidity.

  14. Yttria-stabilized zirconia buffered silicon to optimize in-plane electrical conductivity of [Ca2CoO3]0.62[CoO2] thin films

    NASA Astrophysics Data System (ADS)

    Kraus, T.; Griesser, A.; Klein, O.; Fischer, M.; Schreck, M.; Karl, H.

    2014-05-01

    The monolithic integration of thermoelectric generators and magnetoresistive functionality on the basis of misfit cobaltate [Ca2CoO3]0.62[CoO2] thin films into silicon technology is a prerequisite for their application in miniaturized electric circuits. Here, we report on [Ca2CoO3]0.62[CoO2] thin films grown by pulsed laser deposition on (001)-silicon with a thin epitaxial yttria-stabilized zirconia (YSZ) buffer layer. X-ray diffraction and cross-sectional high resolution transmission electron microscopy analysis reveal that high quality c-axis oriented heteroepitaxial [Ca2CoO3]0.62[CoO2] films with a 12-fold in-plane rotational symmetry can be grown, which exhibit remarkable lower electrical resistivity compared to those with random in-plane orientation. This result is explained by energetically preferred epitaxial growth directions of the pseudo hexagonal [CoO2] sublayer in monoclinic [Ca2CoO3]0.62[CoO2] onto the cubic (001)-YSZ surface leading to a highly symmetric in-plane mutual orientation of the charge transporting CoO2 sublayer domains.

  15. Facile one-step forming of NiO and yttrium-stabilized zirconia composite anodes with straight open pores for planar solid oxide fuel cell using phase-inversion tape casting method

    NASA Astrophysics Data System (ADS)

    Huang, Hua; Lin, Jie; Wang, Yunlong; Wang, Shaorong; Xia, Changrong; Chen, Chusheng

    2015-01-01

    The anode of NiO and yttria-stabilized zirconia (YSZ) with straight open pores is prepared by phase-inversion tape casting method. In the as-prepared green tape, its top and middle layers are derived from a slurry of NiO and YSZ, while the bottom layer from a slurry of graphite. The graphite layer is eliminated by calcination at elevated temperatures, leaving the finger-like porous layer exposed to the gas phase. A cell supported on the as-prepared anode substrate exhibits satisfactory electrochemical performances with a maximum power density of 780 mW cm-2 at 800 °C. The cell dose not show a convex-up curvature in I-V plots at high current density as often observed for most anode-supported cells, indicating the absence of concentration polarization which is in turn attributed to the open pore structure of the phase-inversion derived anode. The phase inversion tape casting technique explored in the present study involves almost the same equipments as and similar procedures to the conventional tape casting, and after further optimization it may become a simple and effective technique for mass production of anodes for SOFCs.

  16. Stainless steel-supported solid oxide fuel cell with La0.2Sr0.8Ti0.9Ni0.1O3-δ/yttria-stabilized zirconia composite anode

    NASA Astrophysics Data System (ADS)

    Dayaghi, Amir Masoud; Kim, Kun Joong; Kim, Sunwoong; Park, Juahn; Kim, Sun Jae; Park, Byung Hyun; Choi, Gyeong Man

    2016-08-01

    A metal-supported solid oxide fuel cell (MS-SOFC) is fabricated by co-firing stainless steel (STS) support with a new reduction-resistant oxide-anode and yttria-stabilized zirconia electrolyte. La and Ni co-doped SrTiO3 (La0.2Sr0.8Ti0.9Ni0.1O3-δ, LSTN) which shows Ni exsolution capability is composited with Y0.16Zr0.84O2-δ (YSZ) electrolyte to form a new LSTN-YSZ anode. A cermet layer composed of STS and YSZ (STS-YSZ) is inserted between a porous STS support and a new LSTN-YSZ composite anode for stable contact. With La0.6Sr0.4Co0.2Fe0.8O3-δ (LSCF) cathode and Ce0.8Gd0.2O2-δ (GDC) interlayer coated on top of co-fired half-cell, YSZ/LSTN-YSZ/STS-YSZ/STS, a newly designed and fabricated cell achieved maximum power density of 185 mW cm-2 at 650 °C. This power density is an improvement over many conventional co-fired MS-SOFCs that use a Ni-cermet anode.

  17. The formation of a hydroxyl bond and the effects thereof on bone-like apatite formation on a magnesia partially stabilized zirconia (MgO-PSZ) bioceramic following CO2 laser irradiation.

    PubMed

    Hao, L; Lawrence, J; Chian, K S; Low, D K Y; Lim, G C; Zheng, H Y

    2004-09-01

    For the purpose of improving the bioactivity of a magnesia partially stabilized zirconia (MgO-PSZ) and to explore a new technique for inducing OH group and apatite formation, a CO(2) laser has been used to modified the surface properties. The bioactivity of the CO(2) laser modified MgO-PSZ has been investigated in stimulated human fluids (SBF) with ion concentrations almost equal to those in human blood plasma. Some hydroxyl groups were found on the MgO-PSZ following CO(2) laser treatment with selected power densities. The surface melting on the MgO-PSZ induced by CO(2) laser processing provides the Zr(4+) ion and OH(-) ion, in turn, the incorporation of the Zr(4+) ion and the OH(-) ion creates the Zr-OH group on the surface. After 14 days of SBF soaking, the apatites formed on the MgO-PSZ with relatively high amount of hydroxyl groups generated by the CO(2) laser treatment, while no apatite was observed on the untreated with few hydroxyl groups. It exhibits that the Zr-OH groups on the MgO-PSZ surface is the functional groups to facilitate the apatite formation. The increased surface roughness provides more active sites, meantime, increased surface energy benefits to the adsorption and reaction on the surface.

  18. Yttria-stabilized zirconia buffered silicon to optimize in-plane electrical conductivity of [Ca{sub 2}CoO{sub 3}]{sub 0.62}[CoO{sub 2}] thin films

    SciTech Connect

    Kraus, T.; Griesser, A.; Klein, O.; Fischer, M.; Schreck, M.; Karl, H.

    2014-05-05

    The monolithic integration of thermoelectric generators and magnetoresistive functionality on the basis of misfit cobaltate [Ca{sub 2}CoO{sub 3}]{sub 0.62}[CoO{sub 2}] thin films into silicon technology is a prerequisite for their application in miniaturized electric circuits. Here, we report on [Ca{sub 2}CoO{sub 3}]{sub 0.62}[CoO{sub 2}] thin films grown by pulsed laser deposition on (001)-silicon with a thin epitaxial yttria-stabilized zirconia (YSZ) buffer layer. X-ray diffraction and cross-sectional high resolution transmission electron microscopy analysis reveal that high quality c-axis oriented heteroepitaxial [Ca{sub 2}CoO{sub 3}]{sub 0.62}[CoO{sub 2}] films with a 12-fold in-plane rotational symmetry can be grown, which exhibit remarkable lower electrical resistivity compared to those with random in-plane orientation. This result is explained by energetically preferred epitaxial growth directions of the pseudo hexagonal [CoO{sub 2}] sublayer in monoclinic [Ca{sub 2}CoO{sub 3}]{sub 0.62}[CoO{sub 2}] onto the cubic (001)-YSZ surface leading to a highly symmetric in-plane mutual orientation of the charge transporting CoO{sub 2} sublayer domains.

  19. Methacrylate bonding to zirconia by in situ silica nanoparticle surface deposition.

    PubMed

    Oliveira-Ogliari, Aline; Collares, Fabrício M; Feitosa, Victor P; Sauro, Salvatore; Ogliari, Fabrício A; Moraes, Rafael R

    2015-01-01

    This study introduces an innovative method to enhance adhesion of methacrylate-based cements to yttria-stabilized zirconia (Y-TZP) by means of a silica-nanoparticle deposition process. Two alkoxide organic precursors, tetraethyl-orthosilicate (TEOS) and zirconium tert-butoxide (ZTB) were diluted in hexane at different concentrations in order to obtain several experimental materials to enhance deposition of a SiO(x) reactive layer to Y-TZP. This deposition was attained via sintering alkoxide precursors directly on pre-sintered zirconia (infiltration method—INF) or application on the surface of fully sintered zirconia (coating method—COA). Untreated specimens and a commercial tribochemical silica coating were also tested as controls and all the treated Y-TZP specimens were analyzed using SEM-EDX. Specimens were bonded using silane, adhesive and dual-cure luting cement and submitted to shear bond strength test after different water storage periods (24 h, 3-, 6- and 12-months). SEM-EDX revealed Y-TZP surface covered by silica nanoclusters. The morphology of silica-covered Y-TZP surfaces was influenced by sintering method, employed to deposit nanoclusters. High bond strength (MPa) was observed when using COA method; highest TEOS percentage achieved the greatest bond strengths to Y-TZP surface (36.7±6.3 at 24 h). However, bonds stability was dependent on ZTB presence (32.9±9.7 at 3 months; 32.3±7.1 at 6 months). Regarding INF method, the highest and more stable resin-zirconia bond strength was attained when using experimental solutions containing TEOS and no ZTB. Both sintering methods tested in this study were able to achieve a bonding performance similar to that of classic tribochemical strategies. This study demonstrates that it is possible to achieve a reliable and long-lasting bonding between yttria-stabilized zirconia ceramic and methacrylate-based cements when using this novel, simple, and cost-effective bonding approach. Copyright © 2014 Academy of Dental

  20. Comparison of alternative adhesive cementation concepts for zirconia ceramic: glaze layer vs zirconia primer.

    PubMed

    Cura, Cenk; Özcan, Mutlu; Isik, Gül; Saracoglu, Ahmet

    2012-02-01

    Zirconia-based ceramics offer strong restorations in dentistry, but the adhesive bond strength of resin cements to such ceramics is not optimal. This study evaluated the bond strength of silane/adhesive/resin cement and zirconia primer/resin cement combinations on non-glazed and glazed zirconia surfaces before and after aging. Disk-shaped zirconia ceramic specimens (diameter: 8 mm; thickness: 2 mm) (N = 80, n = 10 per group) were randomly divided into 2 groups. While half of the specimens received one coat of glaze and were later finished by grinding, the other half was only ground using 1200-grit silicone carbide abrasives under water. The glazed specimens were then conditioned with 9.5% HF acid gel for 60 s, rinsed with water for 90 s, and neutralized. The glazed and non-glazed specimens were further divided into two groups. Two resin cements, namely, Variolink II and Multilink Automix were adhered onto the zirconia surfaces with their corresponding adhesive systems. In the Variolink II group, zirconia surfaces were silanized (Monobond-S), and adhesive resin (Heliobond) was applied and photopolymerized. In the Multilink Automix group, one coat of Metal/Zirconia Primer was applied with a microbrush, left to react for 180 s, and dried using oil-free air. Half of the specimens in each cement group were subjected to 5000 thermocycles (5°C to 55°C) and the other half was kept in the dark for 24 h at 37°C prior to testing. Specimens were mounted in the jig of the universal testing machine, and force was applied to the ceramic/cement interface until failure occurred (1 mm/min). After evaluating all debonded specimens under SEM, the failure types were defined as either "adhesive" with no cement left on the zirconia (score 0) or "mixed" with less than half of the cement left on the surface with no cohesive failure of the substrate (score 1). Data were analyzed using three-way ANOVA and Dunnett-T3 post-hoc tests. Application of a glaze layer significantly improved the

  1. Thermal conductivity of zirconia thermal barrier coatings

    NASA Technical Reports Server (NTRS)

    Dinwiddie, R. B.; Beecher, S. C.; Nagaraj, B. A.; Moore, C. S.

    1995-01-01

    Thermal barrier coatings (TBC's) applied to the hot gas components of turbine engines lead to enhanced fuel efficiency and component reliability. Understanding the mechanisms which control the thermal transport behavior of the TBC's is of primary importance. Physical vapor deposition (PVD) and plasma spraying (PS) are the two most commonly used coating techniques. These techniques produce coatings with unique microstructures which control their performance and stability. The PS coatings were applied with either standard powder or hollow sphere particles. The hollow sphere particles yielded a lower density and lower thermal conductivity coating. The thermal conductivity of both fully and partially stabilized zirconia, before and after thermal aging, will be compared. The thermal conductivity of the coatings permanently increases upon exposed to high temperatures. These increases are attributed to microstructural changes within the coatings. Sintering of the as-fabricated plasma sprayed lamellar structure is observed by scanning electron microscopy of coatings isothermally heat treated at temperatures greater than 1100 C. During this sintering process the planar porosity between lamella is converted to a series of small spherical pores. The change in pore morphology is the primary reason for the observed increase in thermal conductivity. This increase in thermal conductivity can be modeled using a relationship which depends on both the temperature and time of exposure. Although the PVD coatings are less susceptible to thermal aging effects, preliminary results suggest that they have a higher thermal conductivity than PS coatings, both before and after thermal aging. The increases in thermal conductivity due to thermal aging for partially stabilized plasma sprayed zirconia have been found to be less than for fully stabilized plasma sprayed zirconia coatings. The high temperature thermal diffusivity data indicate that if these coatings reach a temperature above 1100 C

  2. Thermal conductivity of zirconia thermal barrier coatings

    NASA Technical Reports Server (NTRS)

    Dinwiddie, R. B.; Beecher, S. C.; Nagaraj, B. A.; Moore, C. S.

    1995-01-01

    Thermal barrier coatings (TBC's) applied to the hot gas components of turbine engines lead to enhanced fuel efficiency and component reliability. Understanding the mechanisms which control the thermal transport behavior of the TBC's is of primary importance. Physical vapor description (PVD) and plasma spraying (PS) are the two most commonly used coating techniques. These techniques produce coatings with unique microstructures which control their performance and stability. The PS coatings were applied with either standard power or hollow sphere particles. The hollow sphere particles yielded a lower density and lower thermal conductivity coating. The thermal conductivity of both fully and partially stabilized zirconia, before and after thermal aging, will be compared. The thermal conductivity of the coatings permanently increase upon being exposed to high temperatures. These increases are attributed to microstructural changes within the coatings. Sintering of the as fabricated plasma sprayed lamellar structure is observed by scanning electron microscopy of coatings isothermally heat treated at temperatures greater than 1100 C. During this sintering process the planar porosity between lamella is converted to a series of small spherical pores. The change in pore morphology is the primary reason for the observed increase in thermal conductivity. This increase in thermal conductivity can be modeled using a relationship which depends on both the temperature and time of exposure. Although the PVD coatings are less susceptible to thermal aging effects, preliminary results suggest that they have a higher thermal conductivity than PS coatings, both before and after thermal aging. The increases in thermal conductivity due to thermal aging for partially stabilized plasma sprayed zirconia have been found to be less than for fully stabilized plasma sprayed zirconia coatings. The high temperature thermal diffusivity data indicates that if these coatings reach a temperature above

  3. Optical properties of zirconia ceramics for esthetic dental restorations: A systematic review.

    PubMed

    Shahmiri, Reza; Standard, Owen Christopher; Hart, Judy N; Sorrell, Charles Christopher

    2017-09-16

    Yttria-stabilized tetragonal zirconia polycrystal has been used as a dental biomaterial for several decades because the fracture toughness and bend strength are increased by a stress-induced transformation-toughening mechanism. However, its esthetics are compromised by its poor translucency and grayish-white appearance. The purpose of the present systematic review was to assess information on the mechanical, chemical, and optical requirements of monolithic zirconia dental restorations. The following databases (2010 to 2015) were electronically searched: ProQuest, EMBASE, SciFinder, MRS Online Proceedings Library, Medline, Compendex, and Journal of the American Ceramic Society. The search was limited to English-language publications, in vitro studies, experimental reports, and modeling studies. The data from 57 studies were considered in order to review the intrinsic and extrinsic characteristics of zirconia and their effects on the optical properties. The materials and microstructural issues relevant to the esthetics and long-term stability of zirconia have been considered in terms of monolithic restorations, while there also are restorations specifically for esthetic applications. Although zirconia-toughened lithium silicate offers the best esthetic outcomes, transformation-toughened zirconia offers the best mechanical properties and long-term stability; cubic stabilized zirconia offers a potential compromise. The properties of these materials can be altered to some extent through the appropriate application of intrinsic (such as, annealing) and extrinsic (such as, shade-matching) parameters. Crown Copyright © 2017. Published by Elsevier Inc. All rights reserved.

  4. Sintering additives for zirconia ceramics

    SciTech Connect

    Wu, S.

    1986-01-01

    This book is an overview of sintering science and its application to zirconia materials including CaO, MgO, and Y/sub 2/O/sub 3/-CeO/sub 2/ doped materials. This book is a reference for first-time exposure to zirconia materials technology, particularly densification.

  5. ZIRCONIA-BASED MIXED POTENTIAL CARBON MONOXIDE/HYDROCARBON SENSORS WITH LANTHANUM MAGNESIUM OXIDE, AND TERBIUM-DOPED YTTRIUM STABILIZED ZIRCONIA ELECTRODES

    SciTech Connect

    E. L. BROSHA; R. MUKUNDAN; ET AL

    2000-10-01

    We have investigated the performance of dual metal oxide electrode mixed potential sensors in an engine-out, dynamometer environment. Sensors were fabricated by sputtering thin films of LaMnO{sub 3} and Tb-doped YSZ onto YSZ electrolyte. Au gauze held onto the metal oxide thin films with Au ink was used for current collection. The exhaust gas from a 4.8L, V8 engine operated in open loop, steady-state mode around stoichiometry at 1500 RPM and 50 Nm. The sensor showed a stable EMF response (with no hysteresis) to varying concentrations of total exhaust gas HC