Science.gov

Sample records for surface area zirconia

  1. Ruthenium catalysts supported on high-surface-area zirconia for the catalytic wet oxidation of N,N-dimethyl formamide.

    PubMed

    Sun, Guanglu; Xu, Aihua; He, Yu; Yang, Min; Du, Hongzhang; Sun, Chenglin

    2008-08-15

    Three weight percent ruthenium catalysts were prepared by incipient-wet impregnation of two different zirconium oxides, and characterized by BET, XRD and TPR. Their activity was evaluated in the catalytic wet oxidation (CWO) of N,N-dimethyl formamide (DMF) in an autoclave reactor. Due to a better dispersion, Ru catalyst supported on a high-surface-area zirconia (Ru/ZrO(2)-A) possessed higher catalytic properties. Due to over-oxidation of Ru particles, the catalytic activity of the both catalysts decreased during successive tests. The effect of oxygen partial pressure and reaction temperature on the DMF reactivity in the CWO on Ru/ZrO(2)-A was also investigated. 98.6% of DMF conversion was obtained through hydrothermal decomposition within 300 min at conditions of 200 degrees C and 2.0 MPa of nitrogen pressure. At 240 degrees C and 2.0 MPa of oxygen pressure 98.3% of DMF conversion was obtained within 150 min.

  2. Effects of cementation surface modifications on fracture resistance of zirconia

    PubMed Central

    Srikanth, Ramanathan; Kosmac, Tomaz; Bona, Alvaro Della; Yin, Ling; Zhang, Yu

    2015-01-01

    Objectives To examine the effects of glass infiltration (GI) and alumina coating (AC) on the indentation flexural load and four-point bending strength of monolithic zirconia. Methods Plate-shaped (12 mm × 12 mm × 1.0 mm or 1.5 mm or 2.0 mm) and bar-shaped (4 mm × 3 mm × 25 mm) monolithic zirconia specimens were fabricated. In addition to monolithic zirconia (group Z), zirconia monoliths were glass-infiltrated or alumina-coated on their tensile surfaces to form groups ZGI and ZAC, respectively. They were also glass-infiltrated on their upper surfaces, and glass-infiltrated or alumina-coated on their lower (tensile) surfaces to make groups ZGI2 and ZAC2, respectively. For comparison, porcelain-veneered zirconia (group PVZ) and monolithic lithium disilicate glass-ceramic (group LiDi) specimens were also fabricated. The plate-shaped specimens were cemented onto a restorative composite base for Hertzian indentation using a tungsten carbide spherical indenter with a radius of 3.2 mm. Critical loads for indentation flexural fracture at the zirconia cementation surface were measured. Strengths of bar-shaped specimens were evaluated in four-point bending. Results Glass infiltration on zirconia tensile surfaces increased indentation flexural loads by 32% in Hertzian contact and flexural strength by 24% in four-point bending. Alumina coating showed no significant effect on resistance to flexural damage of zirconia. Monolithic zirconia outperformed porcelain-veneered zirconia and monolithic lithium disilicate glass-ceramics in terms of both indentation flexural load and flexural strength. Significance While both alumina coating and glass infiltration can be used to effectively modify the cementation surface of zirconia, glass infiltration can further increase the flexural fracture resistance of zirconia. PMID:25687628

  3. Novel Zirconia Surface Treatments for Enhanced Osseointegration: Laboratory Characterization

    PubMed Central

    Ewais, Ola H.; Al Abbassy, Fayza; Ghoneim, Mona M.; Aboushelib, Moustafa N.

    2014-01-01

    Purpose. The aim of this study was to evaluate three novel surface treatments intended to improve osseointegration of zirconia implants: selective infiltration etching treatment (SIE), fusion sputtering (FS), and low pressure particle abrasion (LPPA). The effects of surface treatments on roughness, topography, hardness, and porosity of implants were also assessed. Materials and Methods. 45 zirconia discs (19 mm in diameter × 3 mm in thickness) received 3 different surface treatments: selective infiltration etching, low pressure particle abrasion with 30 µm alumina, and fusion sputtering while nontreated surface served as control. Surface roughness was evaluated quantitatively using profilometery, porosity was evaluated using mercury prosimetry, and Vickers microhardness was used to assess surface hardness. Surface topography was analyzed using scanning and atomic force microscopy (α = 0.05). Results. There were significant differences between all groups regarding surface roughness (F = 1678, P < 0.001), porosity (F = 3278, P < 0.001), and hardness (F = 1106.158, P < 0.001). Scanning and atomic force microscopy revealed a nanoporous surface characteristic of SIE, and FS resulted in the creation of surface microbeads, while LPPA resulted in limited abrasion of the surface. Conclusion. Within the limitations of the study, changes in surface characteristics and topography of zirconia implants have been observed after different surface treatment approaches. Thus possibilities for enhanced osseointegration could be additionally offered. PMID:25349610

  4. An in vitro evaluation of the zirconia surface treatment by mesoporous zirconia coating on its bonding to resin cement.

    PubMed

    Zhang, Yanli; Sun, Ting; Liu, Ruoyu; Feng, Xiaoli; Chen, Aijie; Shao, Longquan

    2014-01-01

    The effect of zirconia surface treatment by mesoporous zirconia coating on the microtensile bond strength (MTBS) between zirconia and resin cement was investigated in this work. 160 zirconia specimens were prepared and divided into four groups according to surface treatments: (1) airborne-particle-abrasion treatment (APA); (2) glass infiltration and hydrofluoric acid treatment (GI+HF); (3) mesoporous zirconia coating (MZ); and (4) no treatment (C). The as-prepared zirconia specimens were bonded using Panavia F2.0 and RelyX Unicem. The MTBS values were tested using a universal testing machine, and data were analyzed using ANOVA and SNK methods (a=0.05). The MTBS values obtained after GI+HF and MZ treatments were significantly higher than those obtained after APA and C treatments (P<0.05), especially for samples cemented with Panavia F2.0. The results reveal that zirconia surface treatments using GI+HF and MZ yield higher bond strength than those using APA or C, regardless of the resin cements.

  5. Identification of peptide motif that binds to the surface of zirconia.

    PubMed

    Hashimoto, Kazuhiko; Yoshinari, Masao; Matsuzaka, Kenichi; Shiba, Kiyotaka; Inoue, Takashi

    2011-01-01

    A zirconia-binding peptide motif was identified using a peptide phage display system. Yttria stabilized zirconia beads and discs were used as the target. Quartz crystal microbalance was used to monitor the binding of phages to zirconia. Starting from a library of phages displaying random sequences of 12-mer peptides, we repeated cycles of biopanning against zirconia beads. After four cycles of biopanning, we isolated a phage clone Φ#17. DNA sequencing of the corresponding portion of Φ#17 unexpectedly revealed that it displayed a 58-mer peptide (amino acid sequence: WMPSDVDINDPQGGGSRPNLHQPKPAAEAASKKKSENRKVPFYSHSWY-SSMSEDKRGW). We found that Φ#17 had a 300-fold, significantly higher binding affinity for zirconia discs than phages displaying no peptide. In quartz crystal microbalance assay, a rapid increase in energy dissipation was observed from Φ#17 but not from the control phages, indicating that Φ#17 binds to the surface of zirconia via its displayed peptide. We successfully identified a peptide motif that binds zirconia.

  6. Surface roughness of zirconia for full-contour crowns after clinically simulated grinding and polishing.

    PubMed

    Hmaidouch, Rim; Müller, Wolf-Dieter; Lauer, Hans-Christoph; Weigl, Paul

    2014-12-01

    The aim of this study was to evaluate the effect of controlled intraoral grinding and polishing on the roughness of full-contour zirconia compared to classical veneered zirconia. Thirty bar-shaped zirconia specimens were fabricated and divided into two groups (n=15). Fifteen specimens (group 1) were glazed and 15 specimens (group 2) were veneered with feldspathic ceramic and then glazed. Prior to grinding, maximum roughness depth (Rmax) values were measured using a profilometer, 5 times per specimen. Simulated clinical grinding and polishing were performed on the specimens under water coolant for 15 s and 2 N pressure. For grinding, NTI diamonds burs with grain sizes of 20 µm, 10 µm, and 7.5 µm were used sequentially. The ground surfaces were polished using NTI kits with coarse, medium and fine polishers. After each step, Rmax values were determined. Differences between groups were examined using one-way analysis of variance (ANOVA). The roughness of group 1 was significantly lower than that of group 2. The roughness increased significantly after coarse grinding in both groups. The results after glazing were similar to those obtained after fine grinding for non-veneered zirconia. However, fine-ground veneered zirconia had significantly higher roughness than venerred, glazed zirconia. No significant difference was found between fine-polished and glazed zirconia, but after the fine polishing of veneered zirconia, the roughness was significantly higher than after glazing. It can be concluded that for full-contour zirconia, fewer defects and lower roughness values resulted after grinding and polishing compared to veneered zirconia. After polishing zirconia, lower roughness values were achieved compared to glazing; more interesting was that the grinding of glazed zirconia using the NTI three-step system could deliver smooth surfaces comparable to untreated glazed zirconia surfaces.

  7. Surface roughness of zirconia for full-contour crowns after clinically simulated grinding and polishing

    PubMed Central

    Hmaidouch, Rim; Müller, Wolf-Dieter; Lauer, Hans-Christoph; Weigl, Paul

    2014-01-01

    The aim of this study was to evaluate the effect of controlled intraoral grinding and polishing on the roughness of full-contour zirconia compared to classical veneered zirconia. Thirty bar-shaped zirconia specimens were fabricated and divided into two groups (n=15). Fifteen specimens (group 1) were glazed and 15 specimens (group 2) were veneered with feldspathic ceramic and then glazed. Prior to grinding, maximum roughness depth (Rmax) values were measured using a profilometer, 5 times per specimen. Simulated clinical grinding and polishing were performed on the specimens under water coolant for 15 s and 2 N pressure. For grinding, NTI diamonds burs with grain sizes of 20 µm, 10 µm, and 7.5 µm were used sequentially. The ground surfaces were polished using NTI kits with coarse, medium and fine polishers. After each step, Rmax values were determined. Differences between groups were examined using one-way analysis of variance (ANOVA). The roughness of group 1 was significantly lower than that of group 2. The roughness increased significantly after coarse grinding in both groups. The results after glazing were similar to those obtained after fine grinding for non-veneered zirconia. However, fine-ground veneered zirconia had significantly higher roughness than venerred, glazed zirconia. No significant difference was found between fine-polished and glazed zirconia, but after the fine polishing of veneered zirconia, the roughness was significantly higher than after glazing. It can be concluded that for full-contour zirconia, fewer defects and lower roughness values resulted after grinding and polishing compared to veneered zirconia. After polishing zirconia, lower roughness values were achieved compared to glazing; more interesting was that the grinding of glazed zirconia using the NTI three-step system could deliver smooth surfaces comparable to untreated glazed zirconia surfaces. PMID:25059249

  8. Comparison of peri-implant bone formation around injection-molded and machined surface zirconia implants in rabbit tibiae.

    PubMed

    Kim, Hong-Kyun; Woo, Kyung Mi; Shon, Won-Jun; Ahn, Jin-Soo; Cha, Seunghee; Park, Young-Seok

    2015-01-01

    The aim of this study was to compare osseointegration and surface characteristics of zirconia implants made by the powder injection molding (PIM) technique against those made by the conventional milling procedure in rabbit tibiae. Surface characteristics of 2 types of implants were evaluated. Sixteen rabbits received 2 types of external hex implants with similar geometry, either machined zirconia implants or PIM zirconia implants, in the tibiae. Removal torque tests and histomorphometric analyses were performed. The roughness of the PIM zirconia implants was higher than that of machined zirconia implants. The PIM zirconia implants exhibited significantly higher bone-implant contact and removal torque values than the machined zirconia implants (p<0.001). The osseointegration of the PIM zirconia implant is promising, and PIM, using the roughened mold etching technique, can produce substantially rougher surfaces on zirconia implants.

  9. Influence of surface modification techniques on shear bond strength between different zirconia cores and veneering ceramics

    PubMed Central

    Rismanchian, Mansour; Savabi, Omid; Ashtiani, Alireza Hashemi

    2011-01-01

    PURPOSE Veneering porcelain might be delaminated from underlying zirconia-based ceramics. The aim of this study was the evaluation of the effect of different surface treatments and type of zirconia (white or colored) on shear bond strength (SBS) of zirconia core and its veneering porcelain. MATERIALS AND METHODS Eighty zirconia disks (40 white and 40 colored; 10 mm in diameter and 4 mm thick) were treated with three different mechanical surface conditioning methods (Sandblasting with 110 µm Al2O3 particle, grinding, sandblasting and liner application). One group had received no treatment. These disks were veneered with 3 mm thick and 5 mm diameter Cercon Ceram Kiss porcelain and SBS test was conducted (cross-head speed = 1 mm/min). Two and one way ANOVA, Tukey's HSD Past hoc, and T-test were selected to analyzed the data (α=0.05). RESULTS In this study, the factor of different types of zirconia ceramics (P=.462) had no significant effect on SBS, but the factors of different surface modification techniques (P=.005) and interaction effect (P=.018) had a significant effect on SBS. Within colored zirconia group, there were no significant differences in mean SBS among the four surface treatment subgroups (P=0.183). Within white zirconia group, "Ground group" exhibited a significantly lower SBS value than "as milled" or control (P=0.001) and liner (P=.05) groups. CONCLUSION Type of zirconia did not have any effect on bond strength between zirconia core and veneer ceramic. Surface treatment had different effects on the SBS of the different zirconia types and grinding dramatically decreased the SBS of white zirconia-porcelain. PMID:22259706

  10. Effect of Zirconia Dental Implant Surfaces on Bone Integration: A Systematic Review and Meta-Analysis.

    PubMed

    Hafezeqoran, Ali; Koodaryan, Roodabeh

    2017-01-01

    Background. The information available about osseointegration and the bone to implant interaction of zirconia implants with various surface modifications is still far from sufficient. Objective. The purpose of this systematic review and meta-analysis was to evaluate and compare zirconia dental implants with different surface topographies, with a focus on bone to implant contact and removal torque. Methods. The systematic review of the extracted publications was performed to compare the bone to implant contact (BIC) with removal torque (RT) values of titanium dental implants and machined and surfaced modified zirconia implants. Results. A total of fifteen articles on BIC and RT values were included in the quantitative analysis. No significant difference in the BIC values was observed between titanium and machined zirconia implants (p = 0.373; 95% CI: -0.166 to 0.443). However, a significantly better BIC values were observed for acid etched zirconia implants compared with those of titanium implants (p = 0.032; 95% CI: 0.068 to 1.461). Unmodified zirconia implants showed favorable BIC values compared to modified-surface zirconia implants (p = 0.021; 95% CI: -0.973 to -0.080). Conclusion. Acid etched zirconia implants may serve as a possible substitute for successful osseointegration.

  11. Effect of Zirconia Dental Implant Surfaces on Bone Integration: A Systematic Review and Meta-Analysis

    PubMed Central

    2017-01-01

    Background. The information available about osseointegration and the bone to implant interaction of zirconia implants with various surface modifications is still far from sufficient. Objective. The purpose of this systematic review and meta-analysis was to evaluate and compare zirconia dental implants with different surface topographies, with a focus on bone to implant contact and removal torque. Methods. The systematic review of the extracted publications was performed to compare the bone to implant contact (BIC) with removal torque (RT) values of titanium dental implants and machined and surfaced modified zirconia implants. Results. A total of fifteen articles on BIC and RT values were included in the quantitative analysis. No significant difference in the BIC values was observed between titanium and machined zirconia implants (p = 0.373; 95% CI: −0.166 to 0.443). However, a significantly better BIC values were observed for acid etched zirconia implants compared with those of titanium implants (p = 0.032; 95% CI: 0.068 to 1.461). Unmodified zirconia implants showed favorable BIC values compared to modified-surface zirconia implants (p = 0.021; 95% CI: −0.973 to −0.080). Conclusion. Acid etched zirconia implants may serve as a possible substitute for successful osseointegration. PMID:28299337

  12. Formation of metastable tetragonal zirconia nanoparticles: Competitive influence of the dopants and surface state

    SciTech Connect

    Gorban, Oksana; Synyakina, Susanna; Volkova, Galina; Gorban, Sergey; Konstantiova, Tetyana; Lyubchik, Svetlana

    2015-12-15

    The effect of the surface modification of the nanoparticles of amorphous and crystalline partially stabilized zirconia by fluoride ions on stability of the metastable tetragonal phase was investigated. Based on the DSC, titrimetry and FTIR spectroscopy data it was proven that surface modification of the xerogel resulted from an exchange of the fluoride ions with the basic OH groups. The effect of the powder pre-calcination temperature before modification on the formation of metastable tetragonal phase in partially stabilized zirconia was investigated. It was shown that the main factor of tetragonal zirconia stabilization is the state of nanoparticles surface at pre-crystallization temperatures.

  13. Effects of surface treatment on bond strength between dental resin agent and zirconia ceramic.

    PubMed

    Moradabadi, Ashkan; Roudsari, Sareh Esmaeily Sabet; Yekta, Bijan Eftekhari; Rahbar, Nima

    2014-01-01

    This paper presents the results of an experimental study to understand the dominant mechanism in bond strength between dental resin agent and zirconia ceramic by investigating the effects of different surface treatments. Effects of two major mechanisms of chemical and micromechanical adhesion were evaluated on bond strength of zirconia to luting agent. Specimens of yttrium-oxide-partially-stabilized zirconia blocks were fabricated. Seven groups of specimens with different surface treatment were prepared. 1) zirconia specimens after airborne particle abrasion (SZ), 2) zirconia specimens after etching (ZH), 3) zirconia specimens after airborne particle abrasion and simultaneous etching (HSZ), 4) zirconia specimens coated with a layer of a Fluorapatite-Leucite glaze (GZ), 5) GZ specimens with additional acid etching (HGZ), 6) zirconia specimens coated with a layer of salt glaze (SGZ) and 7) SGZ specimens after etching with 2% HCl (HSGZ). Composite cylinders were bonded to airborne-particle-abraded surfaces of ZirkonZahn specimens with Panavia F2 resin luting agent. Failure modes were examined under 30× magnification and the effect of surface treatments was analyzed by scanning electron microscopy (SEM) and atomic force microscopy (AFM). SZ and HSZ groups had the highest and GZ and SGZ groups had the lowest mean shear bond strengths among all groups. Mean shear bond strengths were significantly decreased by applying a glaze layer on zirconia surfaces in GZ and SGZ groups. However, bond strengths were improved after etching process. Airborne particle abrasion resulted in higher shear bond strengths compared to etching treatment. Modes of failure varied among different groups. Finally, it is concluded that micromechanical adhesion was a more effective mechanism than chemical adhesion and airborne particle abrasion significantly increased mean shear bond strengths compared with another surface treatments.

  14. Wear performance of bovine tooth enamel against translucent tetragonal zirconia polycrystals after different surface treatments.

    PubMed

    Hara, Mai; Takuma, Yusuke; Sato, Toru; Koyama, Taku; Yoshinari, Masao

    2014-01-01

    The wear performances of bovine tooth enamel (BTE) against translucent tetragonal zirconia polycrystals (TZP) compared to that of feldspar porcelain and the influence of surface treatments of translucent TZP were investigated by the two-body wear test. Translucent TZP and feldspar porcelain were used as hemisphere abrader specimens with a radius of curvature of 5 mm; flat BTE surfaces were used as substrate specimens. The cross-sectional area of the worn surfaces of the substrates and the wear volume of the antagonist abraders were measured. Surface roughness, hardness and coefficient of friction as well as SEM observations and EPMA analyses were also performed to investigate the underlying mechanism of wear. The results suggested that BTE is less susceptible to wear when translucent TZP is used as the antagonist in contrast to the use of feldspar porcelain, and that surface treatment of the TZP abraders significantly influenced the wear of BTE substrates.

  15. Influence of Surface Properties on Adhesion Forces and Attachment of Streptococcus mutans to Zirconia In Vitro

    PubMed Central

    Yu, Pei; Wang, Chuanyong; Zhou, Jinglin; Jiang, Li

    2016-01-01

    Zirconia is becoming a prevalent material in dentistry. However, any foreign bodies inserted may provide new niches for the bacteria in oral cavity. The object of this study was to explore the effect of surface properties including surface roughness and hydrophobicity on the adhesion and biofilm formation of Streptococcus mutans (S. mutans) to zirconia. Atomic force microscopy was employed to determine the zirconia surface morphology and the adhesion forces between the S. mutans and zirconia. The results showed that the surface roughness was nanoscale and significantly different among tested groups (P < 0.05): Coarse (23.94 ± 2.52 nm) > Medium (17.00 ± 3.81 nm) > Fine (11.89 ± 1.68 nm). The contact angles of the Coarse group were the highest, followed by the Medium and the Fine groups. Increasing the surface roughness and hydrophobicity resulted in an increase of adhesion forces and early attachment (2 h and 4 h) of S. mutans on the zirconia but no influence on the further development of biofilm (6 h~24 h). Our findings suggest that the surface roughness in nanoscale and hydrophobicity of zirconia had influence on the S. mutans initial adhesion force and early attachment instead of whole stages of biofilm formation. PMID:27975061

  16. Influence of Surface Properties on Adhesion Forces and Attachment of Streptococcus mutans to Zirconia In Vitro.

    PubMed

    Yu, Pei; Wang, Chuanyong; Zhou, Jinglin; Jiang, Li; Xue, Jing; Li, Wei

    2016-01-01

    Zirconia is becoming a prevalent material in dentistry. However, any foreign bodies inserted may provide new niches for the bacteria in oral cavity. The object of this study was to explore the effect of surface properties including surface roughness and hydrophobicity on the adhesion and biofilm formation of Streptococcus mutans (S. mutans) to zirconia. Atomic force microscopy was employed to determine the zirconia surface morphology and the adhesion forces between the S. mutans and zirconia. The results showed that the surface roughness was nanoscale and significantly different among tested groups (P < 0.05): Coarse (23.94 ± 2.52 nm) > Medium (17.00 ± 3.81 nm) > Fine (11.89 ± 1.68 nm). The contact angles of the Coarse group were the highest, followed by the Medium and the Fine groups. Increasing the surface roughness and hydrophobicity resulted in an increase of adhesion forces and early attachment (2 h and 4 h) of S. mutans on the zirconia but no influence on the further development of biofilm (6 h~24 h). Our findings suggest that the surface roughness in nanoscale and hydrophobicity of zirconia had influence on the S. mutans initial adhesion force and early attachment instead of whole stages of biofilm formation.

  17. Microshear bond strength evaluation of surface pretreated zirconia ceramics bonded to dentin

    PubMed Central

    Anand, Shenbagakuttalam; Ebenezar, Ambrose Vedamanickam Rajesh; Anand, Nirupa; Rajkumar, Kothandaraman; Mahalaxmi, Sekar; Srinivasan, Narasimhan

    2015-01-01

    Objectives: To comparatively assess the micro shear bond strength (MSBS) of dentin bonded surface pre-treated zirconia ceramics. Materials and Methods: Zirconia blocks were sectioned into 50 cubical blocks. The blocks were further categorized into five groups (n = 10 each). Group I: No treatment was performed on zirconia samples; Group II: The zirconia samples were sand-blasted; Group III: Group II + etched with 9.8% of hydrofluoric (HF) acid for 60 s; Group IV: The sandblasted zirconia samples were selectively infiltrated with low fusing porcelain; and Group V: Group IV + etched using 9.8% HF acid gel. The zirconia specimens were then bonded to dentin samples, and the samples were tested for MSBS evaluation using universal testing machine. Results: The MSBS of all the four experimental groups shows greater value than group I. Among the experimental groups, group V and group IV do not show any statistical significant difference, whereas the mean MSBS of groups IV and V were statistically greater than group III and group II. However, groups I, II, and III do not show any statistical significant difference in mean MSBS values between them. Conclusion: Selective infiltration etching of zirconia ceramics provides the highest bond strength with resin cement. PMID:26038654

  18. Microstructured zirconia surfaces modulate osteogenic marker genes in human primary osteoblasts.

    PubMed

    Bergemann, Claudia; Duske, Kathrin; Nebe, J Barbara; Schöne, André; Bulnheim, Ulrike; Seitz, Hermann; Fischer, Jens

    2015-01-01

    In dentistry, zirconia has been used since the early 1990s for endodontic posts, more recently for implant abutments and frameworks for fixed dental prostheses. Zirconia is biocompatible and mechanically strong enough to serve as implant material for oral implants. Although several zirconia implant systems are available, currently the scientific and clinical data for zirconia implants are not sufficient to recommend them for routine clinical use. Here the influence of microstructured yttria-stabilized zirconia (YZ) on human primary osteoblast (HOB) behavior was determined. YZ surfaces were treated by sandblasting (YZ-S), acid etching (YZ-SE) and additionally heat treatment (YZ-SEH). Morphological changes of HOB were determined by scanning electron microscopy. Actin cytoskeleton was investigated by laser scanning microscopy and analyzed by novel actin quantification software. Differentiation of HOB was determined by real time RT-PCR. Improved mechanical interlocking of primary HOB into the porous microstructure of the acid etched and additionally heat treated YZ-surfaces correlates with drastically increased osteocalcin (OCN) gene expression. In particular, OCN was considerably elevated in primary HOB after 3 days on YZ-SE (13-fold) as well as YZ-SEH (12-fold) surfaces. Shorter actin filaments without any favored orientation on YZ-SE and YZ-SEH surfaces are associated with higher roughness (Ra) values. Topographically modified yttria-stabilized zirconia is a likely material for dental implants with cell stimulating properties achieving or actually exceeding those of titanium.

  19. Behavior of osteoblastic cells cultured on titanium and structured zirconia surfaces

    PubMed Central

    Depprich, Rita; Ommerborn, Michelle; Zipprich, Holger; Naujoks, Christian; Handschel, Jörg; Wiesmann, Hans-Peter; Kübler, Norbert R; Meyer, Ulrich

    2008-01-01

    Background Osseointegration is crucial for the long-term success of dental implants and depends on the tissue reaction at the tissue-implant interface. Mechanical properties and biocompatibility make zirconia a suitable material for dental implants, although surface processings are still problematic. The aim of the present study was to compare osteoblast behavior on structured zirconia and titanium surfaces under standardized conditions. Methods The surface characteristics were determined by scanning electron microscopy (SEM). In primary bovine osteoblasts attachment kinetics, proliferation rate and synthesis of bone-associated proteins were tested on different surfaces. Results The results demonstrated that the proliferation rate of cells was significantly higher on zirconia surfaces than on titanium surfaces (p < 0.05; Student's t-test). In contrast, attachment and adhesion strength of the primary cells was significant higher on titanium surfaces (p < 0.05; U test). No significant differences were found in the synthesis of bone-specific proteins. Ultrastructural analysis revealed phenotypic features of osteoblast-like cells on both zirconia and titanium surfaces. Conclusion The study demonstrates distinct effects of the surface composition on osteoblasts in culture. Zirconia improves cell proliferation significantly during the first days of culture, but it does not improve attachment and adhesion strength. Both materials do not differ with respect to protein synthesis or ultrastructural appearance of osteoblasts. Zirconium oxide may therefore be a suitable material for dental implants. PMID:19063728

  20. Impact of surface roughness of gypsum materials on adaptation of zirconia cores

    PubMed Central

    Kim, Ki-Baek; Kim, Sa-Hak

    2015-01-01

    PURPOSE The present study investigated the influences of various gypsum materials on the precision of fit of CAD/CAM-fabricated prostheses and analyzed their correlation with surface roughness. MATERIALS AND METHODS The master model of the mandibular right first molar was replicated, and four experimental groups based on two types of Type IV stone (GC Fujirock EP, Die keen) and two types of scannable stone (Aesthetic-Basegold, Everest Rock) were created to include a total of 40 specimens, 10 in each group. The surface roughness of the working models for the respective experimental groups was measured. Once the zirconia cores had been fabricated, the marginal and internal fits were measured with a digital microscope using the silicone replica technique. The mean and standard deviation of the respective points of measurement were computed and analyzed through the one-way ANOVA and Tukey's HSD test. The correlation between surface roughness and the precision of fit of the zirconia core was analyzed using the Pearson correlation analysis (α=.05). RESULTS The zirconia cores fabricated from the scannable stone working models exhibited a superior precision of fit as compared to those fabricated from the Type IV stone working models. The correlation analysis results showed a clear positive correlation between surface roughness and the precision of fit of zirconia cores in all of the experimental groups (P<.05). CONCLUSION The results confirmed that the surface roughness of dental working models has a decisive influence on the precision of fit of zirconia cores. PMID:26140171

  1. Microstructure, bioactivity and osteoblast behavior of monoclinic zirconia coating with nanostructured surface.

    PubMed

    Wang, Guocheng; Meng, Fanhao; Ding, Chuanxian; Chu, Paul K; Liu, Xuanyong

    2010-03-01

    A monoclinic zirconia coating with a nanostructural surface was prepared on the Ti-6Al-4V substrate by an atmospheric plasma-spraying technique, and its microstructure and composition, as well as mechanical and biological properties, were investigated to explore potential application as a bioactive coating on bone implants. X-ray diffraction, transmission electron microscopy, scanning electron microscopy and Raman spectroscopy revealed that the zirconia coating was composed of monoclinic zirconia which was stable at low temperature, and its surface consists of nano-size grains 30-50 nm in size. The bond strength between the coating and the Ti-6Al-4V substrate was 48.4 + or - 6.1 MPa, which is higher than that of plasma-sprayed HA coatings. Hydrothermal experiments indicated that the coating was stable in a water environment and the phase composition and Vickers hardness were independent of the hydrothermal treatment time. Bone-like apatite is observed to precipitate on the surface of the coating after soaking in simulated body fluid for 6 days, indicating excellent bioactivity in vitro. The nanostructured surface composed of monoclinic zirconia is believed to be crucial to its bioactivity. Morphological observation and the cell proliferation test demonstrated that osteoblast-like MG63 cells could attach to, adhere to and proliferate well on the surface of the monoclinic zirconia coating, suggesting possible applications in hard tissue replacements.

  2. Bonding of Metal Orthodontic Attachments to Sandblasted Porcelain and Zirconia Surfaces.

    PubMed

    Mehta, Amitoj S; Evans, Carla A; Viana, Grace; Bedran-Russo, Ana; Galang-Boquiren, Maria Therese S

    2016-01-01

    This study evaluates tensile bond strength (TBS) of metal orthodontic attachments to sandblasted feldspathic porcelain and zirconia with various bonding protocols. Thirty-six (36) feldspathic and 36 zirconia disc samples were prepared, glazed, embedded in acrylic blocks and sandblasted, and divided into three groups according to one or more of the following treatments: hydrofluoric acid 4% (HF), Porcelain Conditioner silane primer, Reliance Assure® primer, Reliance Assure plus® primer, and Z Prime™ plus zirconia primer. A round traction hook was bonded to each sample. Static tensile bond strength tests were performed in a universal testing machine and adhesive remnant index (ARI) scoring was done using a digital camera. One-way ANOVA and Pearson chi-square tests were used to analyze TBS (MPa) and ARI scores. No statistically significant mean differences were found in TBS among the different bonding protocols for feldspathic and zirconia, p values = 0.369 and 0.944, respectively. No statistically significant distribution of ARI scores was found among the levels of feldspathic, p value = 0.569. However, statistically significant distribution of ARI scores was found among the levels of zirconia, p value = 0.026. The study concluded that silanization following sandblasting resulted in tensile bond strengths comparable to other bonding protocols for feldspathic and zirconia surface.

  3. Bonding of Metal Orthodontic Attachments to Sandblasted Porcelain and Zirconia Surfaces

    PubMed Central

    2016-01-01

    This study evaluates tensile bond strength (TBS) of metal orthodontic attachments to sandblasted feldspathic porcelain and zirconia with various bonding protocols. Thirty-six (36) feldspathic and 36 zirconia disc samples were prepared, glazed, embedded in acrylic blocks and sandblasted, and divided into three groups according to one or more of the following treatments: hydrofluoric acid 4% (HF), Porcelain Conditioner silane primer, Reliance Assure® primer, Reliance Assure plus® primer, and Z Prime™ plus zirconia primer. A round traction hook was bonded to each sample. Static tensile bond strength tests were performed in a universal testing machine and adhesive remnant index (ARI) scoring was done using a digital camera. One-way ANOVA and Pearson chi-square tests were used to analyze TBS (MPa) and ARI scores. No statistically significant mean differences were found in TBS among the different bonding protocols for feldspathic and zirconia, p values = 0.369 and 0.944, respectively. No statistically significant distribution of ARI scores was found among the levels of feldspathic, p value = 0.569. However, statistically significant distribution of ARI scores was found among the levels of zirconia, p value = 0.026. The study concluded that silanization following sandblasting resulted in tensile bond strengths comparable to other bonding protocols for feldspathic and zirconia surface. PMID:27747233

  4. Spontaneous Rippling and Subsequent Polymer Molding on Yttria-Stabilized Zirconia (110) Surfaces.

    PubMed

    Ansari, Haris M; Niu, Zhiyuan; Ge, Chen; Dregia, Suliman A; Akbar, Sheikh A

    2017-02-28

    Spontaneous nanoripple formation on (110) surfaces of yttria-stabilized zirconia, YSZ-(110), is achieved by diffusional surface doping with rare-earth oxides. Periodic arrays of parallel nanobars separated by channels (period ∼100 nm) grow out of the dopant sources, covering relatively wide areas of the surface (∼10 μm). The nanobars mound up on the surface by diffusion, exhibiting morphological uniformity and alignment, with their long axis lying parallel to the [11̅0] direction in the YSZ-(110) surface. The process for forming these nanobar arrays can be as simple as sprinkling of rare-earth oxide powder (dopant source) on YSZ-(110) surface and annealing in a high temperature air furnace. However, higher control on dopant dispersion on the surface is demonstrated with other techniques, including photolithography and inkjet printing. The ripple arrays extend anisotropically on the (110) surface, obeying the parabolic growth law, and showing principal values of the rate constant along [11̅0] (maximum) and [001] (minimum), as expected from the symmetry of the (110) surface. The self-patterned ceramic substrates are well-suited for pattern transfer by replica molding, as illustrated by single-step molding with polydimethylsiloxane (PDMS), which is a widely used biomaterial in cell-culture studies.

  5. Surface characterization of acidic ceria-zirconia prepared by direct sulfation

    NASA Astrophysics Data System (ADS)

    Azambre, B.; Zenboury, L.; Weber, J. V.; Burg, P.

    2010-05-01

    Acidic ceria-zirconia (SCZ) solid acid catalysts with a nominal surface density of ca 2 SO 42-/nm 2 were prepared by a simple route consisting in soaking high specific surface area Ce xZr 1- xO 2 (with x = 0.21 and 0.69) mixed oxides solutions in 0.5 M sulphuric acid. Characterizations by TPD-MS, TP-DRIFTS and FT-Raman revealed that most of surface structures generated by sulfation are stable at least up to 700 °C under inert atmosphere and consist mainly as isolated sulfates located on defects or crystal planes and to a lesser extent as polysulfates. Investigations by pyridine adsorption/desorption have stated that: SCZ possess both strong Brønsted (B) and Lewis (L) acid sites, some of them being presumably superacidic; the B/L site ratio was found to be more dependent on the temperature and hydration degree than on the composition of the ceria-zirconia. By contrast, the reactivity of the parent Ce xZr 1- xO 2 materials towards pyridine is mostly driven by redox properties resulting in the formation of Py-oxide with the participation of Lewis acid sites of moderate strength ( cus Ce x+ and Zr x+ cations). Basicity studies by CO 2 adsorption/desorption reveal that SCZ surfaces are solely acidic whereas the number and strength of Lewis basic sites increases with the Ce content for the parent Ce xZr 1- xO 2 materials.

  6. Bottom-up engineering of the surface roughness of nanostructured cubic zirconia to control cell adhesion.

    PubMed

    Singh, A V; Ferri, M; Tamplenizza, M; Borghi, F; Divitini, G; Ducati, C; Lenardi, C; Piazzoni, C; Merlini, M; Podestà, A; Milani, P

    2012-11-30

    Nanostructured cubic zirconia is a strategic material for biomedical applications since it combines superior structural and optical properties with a nanoscale morphology able to control cell adhesion and proliferation. We produced nanostructured cubic zirconia thin films at room temperature by supersonic cluster beam deposition of nanoparticles produced in the gas phase. Precise control of film roughness at the nanoscale is obtained by operating in a ballistic deposition regime. This allows one to study the influence of nanoroughness on cell adhesion, while keeping the surface chemistry constant. We evaluated cell adhesion on nanostructured zirconia with an osteoblast-like cell line using confocal laser scanning microscopy for detailed morphological and cytoskeleton studies. We demonstrated that the organization of cytoskeleton and focal adhesion formation can be controlled by varying the evolution of surface nanoroughness.

  7. The effect of various sandblasting conditions on surface changes of dental zirconia and shear bond strength between zirconia core and indirect composite resin

    PubMed Central

    Su, Naichuan; Yue, Li; Liao, Yunmao; Liu, Wenjia; Zhang, Hai; Li, Xin

    2015-01-01

    PURPOSE To measure the surface loss of dental restorative zirconia and the short-term bond strength between an indirect composite resin (ICR) and zirconia ceramic after various sandblasting processes. MATERIALS AND METHODS Three hundred zirconia bars were randomly divided into 25 groups according to the type of sandblasting performed with pressures of 0.1, 0.2, 0.4 and 0.6 MPa, sandblasting times of 7, 14 and 21 seconds, and alumina powder sizes of 50 and 110 µm. The control group did not receive sandblasting. The volume loss and height loss on zirconia surface after sandblasting and the shear bond strength (SBS) between the sandblasted zirconia and ICR after 24-h immersion were measured for each group using multivariate analysis of variance (ANOVA) and Least Significance Difference (LSD) test (α=.05). After sandblasting, the failure modes of the ICR/zirconia surfaces were observed using scanning electron microscopy. RESULTS The volume loss and height loss were increased with higher sandblasting pressure and longer sandblasting treatment, but they decreased with larger powder size. SBS was significantly increased by increasing the sandblasting time from 7 seconds to 14 seconds and from 14 seconds to 21 seconds, as well as increasing the size of alumina powder from 50 µm to 110 µm. SBS was significantly increased from 0.1 MPa to 0.2 MPa according to the size of alumina powder. However, the SBSs were not significantly different with the sandblasting pressure of 0.2, 0.4 and 0.6 MPa. The possibilities of the combination of both adhesive failure and cohesive failure within the ICR were higher with the increases in bonding strength. CONCLUSION Based on the findings of this study, sandblasting with alumina particles at 0.2 MPa, 21 seconds and the powder size of 110 µm is recommended for dental applications to improve the bonding between zirconia core and ICR. PMID:26140173

  8. SEM observation and wettability of variously processed and fractured surface of dental zirconia

    NASA Astrophysics Data System (ADS)

    Tarumi, Naoyoshi; Uo, Motohiro; Yamaga, Eiji; Watari, Fumio

    2012-12-01

    Current dental zirconia has several problems in clinical application such as chipping, fracture and detachment. To reduce these problems the surface after various treatments was analyzed by SEM observation, contact angle measurement and surface roughness measurement, and compared. The surface after mirror polishing was smooth. Porcelain layering was smooth except large formed grooves by bubbles. After sandblast and tribochemical treatments, the surfaces showed several micron-sized caving with micron to submicron-level irregularities. Sandblast and tribochemical treatments with the lager roughness had the smaller water contact angle than silicone wheel polishing. Clinically fractured surface of zirconia showed a more complex structure than manually fractured surface, which may be due to the various mode of stress to be imposed repetitively to various direction.

  9. Effect of liner and porcelain application on zirconia surface structure and composition

    PubMed Central

    Alghazzawi, Tariq F; Janowski, Gregg M

    2016-01-01

    The purpose of this study was to determine if there is an effect of liner and porcelain application (layering and pressing techniques) on the surface of yttria-stabilized tetragonal zirconia polycrystals (Y-TZP), which were exposed to permutations of liner, layered porcelain, and pressed porcelain. Scanning electron microscope (SEM)/energy dispersive spectroscope (EDS) was used to identify changes in composition and microstructure after removing liner and porcelain with hydrofluoric acid. Simulated aging was also conducted to determine the effect of liner and porcelain on low-temperature degradation. The control group had a typical equiaxed grain structure, referred to as unaffected. When covered with liner or porcelain, some areas changed in structure and composition and were termed affected. The frequency of affected structure decreased when liner was covered with either layered porcelain or pressed porcelain. There were statistical differences (P<0.05) in the composition between affected and unaffected for zirconium (layered porcelain with liner: affected=60% (0.8%) (m/m), unaffected=69% (4%), layered porcelain without liner: affected=59% (3%), unaffected=65% (3%)) and oxygen (layered porcelain with liner: affected=35% (2%), unaffected=26% (4%), layered porcelain without liner: affected=35% (3%), unaffected=30% (2%)). However, there were statistical differences (P<0.05) in the composition for zirconium and oxygen of the aged layered porcelain without liner only. The liner should not be used before porcelain application, especially when using the layering technique for zirconia restorations. Furthermore, pressing should be considered the technique of choice over layering. PMID:27445089

  10. pH control of the structure, composition, and catalytic activity of sulfated zirconia

    SciTech Connect

    Ivanov, Vladimir K.; Baranchikov, Alexander Ye.; Kopitsa, Gennady P.; Lermontov, Sergey A.; Yurkova, Lyudmila L.; Gubanova, Nadezhda N.; Ivanova, Olga S.; Lermontov, Anatoly S.; Rumyantseva, Marina N.; Vasilyeva, Larisa P.; Sharp, Melissa; Pranzas, P. Klaus; Tretyakov, Yuri D.

    2013-02-15

    We report a detailed study of structural and chemical transformations of amorphous hydrous zirconia into sulfated zirconia-based superacid catalysts. Precipitation pH is shown to be the key factor governing structure, composition and properties of amorphous sulfated zirconia gels and nanocrystalline sulfated zirconia. Increase in precipitation pH leads to substantial increase of surface fractal dimension (up to {approx}2.7) of amorphous sulfated zirconia gels, and consequently to increase in specific surface area (up to {approx}80 m{sup 2}/g) and simultaneously to decrease in sulfate content and total acidity of zirconia catalysts. Complete conversion of hexene-1 over as synthesized sulfated zirconia catalysts was observed even under ambient conditions. - Graphical abstract: Surface fractal dimension of amorphous sulfated zirconia and specific surface area and catalytic activity of crystalline sulfated zirconia as a function of precipitation pH. Highlights: Black-Right-Pointing-Pointer Structural transformation of amorphous hydrous zirconia into sulfated zirconia is studied. Black-Right-Pointing-Pointer Precipitation pH controls surface fractal dimension of amorphous zirconia gels. Black-Right-Pointing-Pointer Precipitation pH is the key factor governing properties of sulfated zirconia.

  11. Zirconia Implants in Esthetic Areas: 4-Year Follow-Up Evaluation Study

    PubMed Central

    Borgonovo, Andrea Enrico; Censi, Rachele; Vavassori, Virna; Arnaboldi, Oscar; Maiorana, Carlo

    2015-01-01

    Objectives. The aim is to evaluate the survival and success rates, as well as the marginal bone loss (MBL) and periodontal indexes of zirconia implants positioned in the esthetic jaw areas. Materials and Method. 13 patients were selected and 20 one-piece zirconia implants were used for the rehabilitation of single tooth or partially edentulous ridge in the esthetic jaw areas. Six months after surgery and then once a year, a clinical-radiographic evaluation was performed in order to estimate peri-implant tissue health and marginal bone loss. Results. The survival and success rates were 100%. The average marginal bone loss from baseline to 48 months after surgery was +2.1 mm. Four years after surgery, the median and the mode for visible Plaque Index and Bleeding On Probing resulted 1 whereas Probing Pocket Depth amounted to 3 mm (SD = ±0.49 mm). Conclusion. One-piece zirconia dental implants are characterized by high biocompatibility, low plaque adhesion, and absence of microgap that can be related to the clinical success of these implants even in the esthetic areas. PMID:26124836

  12. A comparative study of the surface structure, acidity, and catalytic performance of tungstated zirconia prepared from crystalline zirconia or amorphous zirconium oxyhydroxide.

    PubMed

    Lebarbier, Vanessa; Clet, Guillaume; Houalla, Marwan

    2006-07-20

    Tungstated zirconias prepared from W deposition on zirconium oxyhydroxide are reportedly active for alkane isomerization, whereas solids synthesized by impregnation of zirconia are inactive. The origin of the differences between the two preparations is not fully understood. The present paper examines the influence of W surface density and the nature of the support on the surface structure, development of the acidity, and catalytic performance of WO(x)()/ ZrO(2) catalysts. Two series of catalysts containing W surface densities up to 5.2 at. W/nm(2) were prepared by pore volume impregnation of two different supports: zirconium oxyhydroxide and predominantly tetragonal zirconia (65% tetragonal, 35% monoclinic). The texture and structure of the catalysts were investigated by BET measurements, X-ray diffraction, Raman and infrared spectroscopy. The catalytic activity was tested for 2-propanol dehydration and n-hexane isomerization. For catalysts obtained by impregnation of Zr oxyhydroxide, Raman results showed that W was present as a surface phase. Infrared spectra indicated an increase in the degree of polymerization of W species with increasing W surface density. The development of the acidity was monitored by lutidine adsorption and desorption at 523 K, followed by infrared spectroscopy. The results indicated the presence of a threshold of W surface density at 1.3 at. W/ nm(2) for the detection of these acid sites, followed by a progressive increase in their abundance with increasing W surface density. The development of Brønsted acidity correlated with the evolution of the infrared bands attributed to "extensively" polymerized W species. A direct relationship was observed between the abundance of Brønsted acid sites and the catalytic activity for 2-propanol dehydration. For n-hexane isomerization, compared to 2-propanol dehydration, a higher threshold of W surface densities (3.4 at. W/ nm(2)) for the development of activity was observed. The difference was

  13. Modifying zirconia solid electrolyte surface property to enhance oxide transport

    SciTech Connect

    Liaw, B.Y.; Song, S.Y.

    1996-12-31

    Bismuth-strontium-calcium-copper oxide (Bi{sub 2}Sr{sub 2}CaCu{sub 2}O{sub 8}, BSCCO) is known for its high T{sub c} superconducting behavior and mixed conducting property. The applicability of similar high T{sub c} cuprates for intermediate-temperature solid oxide fuel cell (SOFC) application has been studied recently. We investigated the electrochemical behavior of several Ag{vert_bar}BSCCO{vert_bar}10 mol% yttria-stabilized zirconia (YSZ){vert_bar}Ag and Ag{vert_bar}YSZ{vert_bar}Ag cells using complex impedance spectroscopy. A highly uniform and porous microstructure was observed at the interface of the YSZ and BSCCO. The ionic conductivity determined from the Nyquest plots in the temperature range of 200-700{degrees}C agrees with the values reported in the literature. The specific resistance of the BSCCO{vert_bar}YSZ interface was also determined to be lower than those of the conventional manganite electrode, suggesting that BSCCO seems attractive for cathode applications in SOFC.

  14. Effect of Surface Treatment with Carbon Dioxide (CO2) Laser on Bond Strength between Cement Resin and Zirconia

    PubMed Central

    Kasraei, Shahin; Atefat, Mohammad; Beheshti, Maryam; Safavi, Nassimeh; Mojtahedi, Maryam; Rezaei-Soufi, Loghman

    2014-01-01

    Introduction: Since it is not possible to form an adequate micromechanical bond between resin cement and zirconia ceramics using common surface treatment techniques, laser pretreatment has been suggested for zirconia ceramic surfaces. The aim of this study was to evaluate the effect of Carbon Dioxide (CO2) Laser treatment on shear bond strength (SBS) of resin cement to zirconia ceramic. Methods: In this in vitro study thirty discs of zirconia with a diameter of 6 mm and a thickness of 2 mm were randomly divided into two groups of 15. In the test group the zirconia disc surfaces were irradiated by CO2 laser with an output power of 3 W and energy density of 265.39 j/cm2. Composite resin discs were fabricated by plastic molds, measuring 3 mm in diameter and 2 mm in thickness and were cemented on zirconia disk surfaces with Panavia F2.0 resin cement (Kuraray Co. Ltd, Osaka, Japan). Shear bond strength was measured by a universal testing machine at a crosshead speed of 0.5 mm/min. The fracture type was assessed under a stereomicroscope at ×40. Surface morphologies of two specimens of the test group were evaluated under SEM before and after laser pretreatment. Data was analyzed by paired t-test (p value < 0.05). Results: The mean SBS values of the laser and control groups were 12.12 ± 3.02 and 5.97 ± 1.14 MPa, respectively. Surface treatment with CO2 laser significantly increased SBS between resin cement and zirconia ceramic (p value = 0.001). Conclusion: Under the limitations of this study, surface treatment with CO2 laser increased the SBS between resin cement and the zirconia ceramic. PMID:25653809

  15. A DFT study of Ni clusters deposition on titania and zirconia (101) surfaces

    NASA Astrophysics Data System (ADS)

    Tosoni, Sergio; Chen, Hsin-Yi Tiffany; Pacchioni, Gianfranco

    2016-04-01

    Density functional calculations are employed to simulate the deposition of an isolated Ni atom and a Ni10 particle on the stoichiometric and reduced anatase TiO2 (101) and tetragonal ZrO2 (101) surfaces. The main purpose of this work is to study the modification of the electronic structure of the oxide induced by the metal, aiming at the understanding of the physical properties of new catalysts for biomass conversion. When the adsorption of a Ni atom takes place on stoichiometric surfaces, no major charge transfer is observed. On reduced titania, and more pronouncedly on reduced zirconia, the Ni atom is negatively charged, provided that the vacancy is in direct contact with the adsorbed metal atom. For Ni10, on titania the bonding is dominated by the hybridization of the metal and the oxide states but we did not find evidence for a direct reduction of the oxide via formation of Ti3 + states. For Ni10 on zirconia, the metal particle is positively charged on the stoichiometric surface and negatively charged on the reduced one but, again, there is no indication of a direct reduction of the oxide. Finally, the reverse oxygen spillover is considered as a possible route to reduce the oxide support. The result is that Ni10 promotes oxygen spillover on titania almost spontaneously, while on zirconia this process is thermodynamically unfavourable.

  16. Mechanical properties of zirconia after different surface treatments and repeated firings

    PubMed Central

    Demir, Necla; Kara, Özlem; Ozturk, A. Nilgun; Özel, Faruk

    2014-01-01

    PURPOSE This study investigated the influence of surface conditioning procedures and repeated firings on monoclinic content and strength of zirconia before cementation. MATERIALS AND METHODS Sintered bar-shaped zirconia specimens were subjected to no surface treatment (control), air abrasion, or grinding (n=21). Their roughness was evaluated using a profilometer, and microscope analysis was performed on one specimen of each group. Then, 2 or 10 repeated firings (n=10) were executed, the monoclinic content of specimens was analyzed by X-ray diffraction, and a three-point flexural strength test was performed. Surface roughness values were compared using one-way analysis of variance (ANOVA) and Tukey honestly significant difference (HSD) tests, the monoclinic content values were tested using Kruskal-Wallis and Mann-Whitney U tests, and the flexural strength values were tested using two-way ANOVA and Tukey HSD tests (P=.05). Spearman's correlation test was performed to define relationships among measured parameters. RESULTS Surface-treated specimens were rougher than untreated specimens and had a higher monoclinic content (P<.005), and the relationship between roughness and monoclinic content was significant (P<.000). Neither surface treatment nor firing significantly affected the flexural strength, but Weibull analysis showed that for the air-abraded samples the characteristic strength was significantly lower after the 10th firing than after the 2nd firing. CONCLUSION After firing, a negligible amount of monoclinic content remained on the zirconia surfaces, and rougher surfaces had higher monoclinic contents than untreated surfaces. Multiple firings could be performed if necessary, but the fracture probability could increase after multiple firings for rougher surfaces. PMID:25551006

  17. Influence of Heat Treatment and Veneering on the Storage Modulus and Surface of Zirconia Ceramic

    PubMed Central

    Siavikis, Georgius; Behr, Michael; van der Zel, Jef M; Feilzer, Albert J; Rosentritt, Martin

    2011-01-01

    Objectives: Glass-ceramic veneered zirconia is used for the application as fixed partial dentures. The aim of this investigation was to evaluate whether the heat treatment during veneering, the application of glass-ceramic for veneering or long term storage has an influence on the storage modulus of zirconia. Methods: Zirconia bars (Cercon, DeguDent, G; 0.5x2x20 mm) were fabricated and treated according to veneering conditions. Besides heating regimes between 680°C and 1000°C (liner bake and annealing), sandblasting (Al2O3) or steam cleaning were used. The bars were investigated after 90 days storage in water and acid. For investigating the influence of veneering, the bars were veneered in press- or layer technique. Dynamic mechanical analysis (DMA) in a three-point-bending design was performed to determine the storage modulus between 25°C and 200°C at a frequency of 1.66 Hz. All specimens were loaded on top and bottom (treatment on pressure or tensile stress side). Scanning electron microscopy (SEM) was used for evaluating the superficial changes of the zirconia surface due to treatment. Statistical analysis was performed using Mann Whitney U-test (α=0.05). Results: Sintered zirconia provided a storage modulus E’ of 215 (203/219) GPa and tan δ of 0.04 at 110°C. A 10%-decrease of E’ was found up to 180°C. The superficial appearance changed due to heating regime. Sandblasting reduced E’ to 213 GPa, heating influenced E’ between 205 GPa (liner bake 1) and 222 GPa (dentin bake 1). Steam cleaning, annealing and storage changed E’ between 4 GPa and 22 GPa, depending on the side of loading. After veneering, strong E’-reduction was found down to 84 GPa and 125 GPa. Conclusions: Veneering of zirconia with glass-ceramic in contrast to heat treating during veneering procedure had a strong influence on the modulus. The application of the glass-ceramic caused a stronger decrease of the storage modulus. PMID:21494388

  18. Effect of Nd: YAG laser irradiation on surface properties and bond strength of zirconia ceramics.

    PubMed

    Liu, Li; Liu, Suogang; Song, Xiaomeng; Zhu, Qingping; Zhang, Wei

    2015-02-01

    This study investigated the effect of neodymium-doped yttrium aluminum garnet (Nd: YAG) laser irradiation on surface properties and bond strength of zirconia ceramics. Specimens of zirconia ceramic pieces were divided into 11 groups according to surface treatments as follows: one control group (no treatment), one air abrasion group, and nine laser groups (Nd: YAG irradiation). The laser groups were divided by applying with different output power (1, 2, or 3 W) and irradiation time (30, 60, or 90 s). Following surface treatments, the morphological characteristics of ceramic pieces was observed, and the surface roughness was measured. All specimens were bonded to resin cement. After, stored in water for 24 h and additionally aged by thermocycling, the shear bond strength was measured. Dunnett's t test and one-way ANOVA were performed as the statistical analyses for the surface roughness and the shear bond strength, respectively, with α = .05. Rougher surface of the ceramics could be obtained by laser irradiation with higher output power (2 and 3 W). However, cracks and defects were also found on material surface. The shear bond strength of laser groups was not obviously increased, and it was significantly lower than that of air abrasion group. No significant differences of the shear bond strength were found among laser groups treated with different output power or irradiation time. Nd: YAG laser irradiation cannot improve the surface properties of zirconia ceramics and cannot increase the bond strength of the ceramics. Enhancing irradiation power and extending irradiation time cannot induce higher bond strength of the ceramics and may cause material defect.

  19. Shear Bond Strength of the Repair Composite Resin to Zirconia Ceramic by Different Surface Treatment

    PubMed Central

    Arami, Sakineh; Hasani Tabatabaei, Masoumeh; Namdar, Fatemeh; Safavi, Nassimeh; Chiniforush, Nasim

    2014-01-01

    Introduction: The purpose of this study is the evaluation of the amount of surface roughness (Ra) of Zirconia Ceramic following different surface treatments as well as the assessment of its shear bond strength to composite resin. Methods: 40 sintered zirconia ceramic block samples were randomly divided in 4 groups of 10 and underwent the following surface treatments: a) Control group without treatment b) Air abrasion with Al2O3 particles (50um) c) Er:YAG laser with 2W power for 10s d) Nd:YAG laser with 1.5W power for 2min Then the mean surface roughness (Ra) was evaluated by profilometer. In the next step, Alloy primer was used on a section of 9mm2 on the samples following the manufacturer’s instructions. After that Clearfil AP-X composite resin in cylinder shape with an internal diameter and height of 3mm were cured on the sections mentioned. At the end, all samples were tested to assess the shear bond strength by the Universal Testing Machine at a speed of 0.5mm/min until fracture occurred. The mean shear bond strengths were calculated and statistically analyzed by One Way ANOVA. Results: ANOVA analysis showed that roughness (Ra) was significantly different between the groups (P≤0.05). Ra was higher in the Nd:YAG group compared to the other groups (P≤0.05). The lower Ra was related to the control group. Air abrasion group showed highest amounts of shear bond strength and Nd:YAG laser group demonstrated lower amounts of shear bond strength (P≤0.05). Conclusion: Various surface treatments are differently effective on bond strength. Air abrasion is the most effective method to condition zirconia ceramic surfaces. PMID:25653817

  20. Oxygen exchange measurements on zirconia-yttria electrolyte surfaces modified by various dopants

    SciTech Connect

    Tannhauser, D.S.; Kilner, J.A.; Steele, B.C.H.

    1983-10-01

    Yttria stabilized zirconia (YSZ) has a number of practical applications as electrolyte membrane. Current interest is focused on three main devices: oxygen monitors, high temperature fuel cells, and water electrolyzers. Little is known about factors which affect the interchange of oxygen between the ambient gas and the oxide surface. Surface perfection and purity, as well as crystalline orientation, may all play a role. In view of the growing requirement for devices to operate at low temperatures (approx. 500 C), where the surface exchange becomes very slow, it is important to understand this process. Recent experiments have suggested that surface treatment of zirconia with CeO2 may accelerate reaction kinetics at electrodes. Another series of experiments by Verkerk et al has suggested that in the low temperature regime Bi2O3 - Er2O3 has much faster transfer rate for oxygen than YSZ. Consequently, a series of experiments have been started to investigate the effects of chemical treatments on the exchange of oxygen between the surface of YSZ single crystals and oxygen in the gas phase.

  1. Bond strength of veneer ceramic and zirconia cores with different surface modifications after microwave sintering

    PubMed Central

    Saka, Muhammet

    2013-01-01

    PURPOSE To evaluate the effects of surface treatments on shear bond strength (SBS) between microwave and conventionally sintered zirconia core/veneers. MATERIALS AND METHODS 96 disc shaped Noritake Alliance zirconia specimens were fabricated using YenaDent CAM unit and were divided in 2 groups with respect to microwave or conventional methods (n=48/group). Surface roughness (Ra) evaluation was made with a profilometer on randomly selected microwave (n=10) and conventionally sintered (n=10) cores. Specimens were then assessed into 4 subgroups according to surface treatments applied (n=12/group). Groups for microwave (M) and conventionally (C) sintered core specimens were as follows; MC,CC: untreated (control group), M1,C1:Al2O3 sandblasting, M2,C2:liner, M3,C3:Al2O3 sandblasting followed by liner. Veneer ceramic was fired on zirconia cores and specimens were thermocycled (6000 cycles between 5°-55℃). All specimens were subjected to SBS test using a universal testing machine at 0.5 mm/min, failure were evaluated under an optical microscope. Data were statistically analyzed using Shapiro Wilk, Levene, Post-hoc Tukey HSD and Student's t tests, Two-Way-Variance-Analysis and One-Way-Variance-Analysis (α=.05). RESULTS Conventionally sintered specimens (1.06 ± 0.32 µm) showed rougher surfaces compared to microwave sintered ones (0.76 ± 0.32 µm)(P=.046), however, no correlation was found between SBS and surface roughness (r=-0.109, P=.658). The statistical comparison of the shear bond strengths of C3 and C1 group (P=.015); CC and MC group (P=.004) and C3 and M3 group presented statistically higher (P=.005) values. While adhesive failure was not seen in any of the groups, cohesive and combined patterns were seen in all groups. CONCLUSION Based on the results of this in-vitro study, Al2O3- sandblasting followed by liner application on conventionally sintered zirconia cores may be preferred to enhance bond strength. PMID:24353890

  2. Bond strength to high-crystalline content zirconia after different surface treatments.

    PubMed

    de Souza, Grace M Dias; Silva, Nelson R F A; Paulillo, Luis A M S; De Goes, Mario F; Rekow, E Dianne; Thompson, Van P

    2010-05-01

    The aim of this study was to evaluate the effect of primers, luting systems and aging on bond strength to zirconium oxide substrates. Eighteen zirconia discs (19.5 x 4 mm) were polished and treated (n = 3) either with a MDP primer (Md) or with a MDP and VBATDT primer (MV). In the control group (n = 3) no surface chemical treatment was performed. Zirconia specimens were cemented to prepolymerized composite discs utilizing resin cements - RelyX Unicem or Panavia 21 (RU and Pa, respectively). After 24 h, samples were sectioned for microtensile testing and returned to water at 37 degrees C for two different periods before being tested: 72 h or 60 days + thermocycling (5-55 degrees C/5000 cycles). Bond strength testing was performed at 1 mm/min. Values in MPa were analyzed through ANOVA and Tukey's Studentized Range (HSD) (p > 0.05). The application of MV primer resulted in the highest bond strength (22.77 MPa), statistically superior to Md primer (12.78 MPa), and control groups presented the lowest values (9.17 MPa). When luting systems were compared, RU promoted the highest bond strength (16.07 MPa) in comparison with Pa (13.75 MPa). The average bond strength decrease after aging (9.35 MPa) when compared with initial values (20.46 MPa). The results presented by this in vitro study suggest that a chemical surface treatment based on the MDP and VBATDT combination may improve bond strength between zirconia and luting system, without any previous mechanical treatment, depending on the luting system used. This chemical treatment may result in a reliable alternative to achieve adequate and durable bond strength.

  3. Effect of surface treatment on the micro-shear bond strength to zirconia

    PubMed Central

    Tashkandi, Esam

    2009-01-01

    The constant quest for finding the ultimate esthetic dental restorative material has led to numerous alternatives. These materials, in addition to possessing optical properties simulating natural teeth, should also have physical properties that can withstand the harsh oral environment. Due to their greater toughness, zirconium oxide materials have been used as a core material for all-ceramic restorations. Objective The objective of this study was to evaluate the resin-composite micro-shear bond strength to zirconia using different techniques of surface treatment. Materials and methods Fully sintered zirconia (LAVA, 3M-ESPE, Seefeld, Germany) discs were used in combination with resin-composite (Filtek Supreme, 3M-ESPE, Seefeld, Germany) discs and divided into four groups of surface treatments. The micro-shear bond strength was measured by applying an axial load on the bonded interface until failure occurred. Failure load (N) was determined and the samples were examined under a SEM and the failure type was identified. One-way analysis of variance (ANOVA) was used to analyze the data with the level of significance α = 0.05. Results Data analysis revealed significant difference between the different tested surface treatments with the group using sandblasting and coated with an experimental primer showing the highest failure load and a cohesive fracture pattern. Conclusion Within the limitations of this in vitro study the use of an experimental primer achieved a better bond strength in combination with air-abrasion particles. PMID:23960468

  4. pH control of the structure, composition, and catalytic activity of sulfated zirconia

    NASA Astrophysics Data System (ADS)

    Ivanov, Vladimir K.; Baranchikov, Alexander Ye.; Kopitsa, Gennady P.; Lermontov, Sergey A.; Yurkova, Lyudmila L.; Gubanova, Nadezhda N.; Ivanova, Olga S.; Lermontov, Anatoly S.; Rumyantseva, Marina N.; Vasilyeva, Larisa P.; Sharp, Melissa; Pranzas, P. Klaus; Tretyakov, Yuri D.

    2013-02-01

    We report a detailed study of structural and chemical transformations of amorphous hydrous zirconia into sulfated zirconia-based superacid catalysts. Precipitation pH is shown to be the key factor governing structure, composition and properties of amorphous sulfated zirconia gels and nanocrystalline sulfated zirconia. Increase in precipitation pH leads to substantial increase of surface fractal dimension (up to ˜2.7) of amorphous sulfated zirconia gels, and consequently to increase in specific surface area (up to ˜80 m2/g) and simultaneously to decrease in sulfate content and total acidity of zirconia catalysts. Complete conversion of hexene-1 over as synthesized sulfated zirconia catalysts was observed even under ambient conditions.

  5. Catastrophic failure of a monolithic zirconia prosthesis.

    PubMed

    Chang, Jae-Seung; Ji, Woon; Choi, Chang-Hoon; Kim, Sunjai

    2015-02-01

    Recently, monolithic zirconia restorations have received attention as an alternative to zirconia veneered with feldspathic porcelain to eliminate chipping failures of veneer ceramics. In this clinical report, a patient with mandibular edentulism received 4 dental implants in the interforaminal area, and a screw-retained monolithic zirconia prosthesis was fabricated. The patient also received a maxillary complete removable dental prosthesis over 4 anterior roots. At the 18-month follow-up, all of the zirconia cylinders were seen to be fractured, and the contacting abutment surfaces had lost structural integrity. The damaged abutments were replaced with new abutments, and a new prosthesis was delivered with a computer-assisted design and computer-assisted manufacturing fabricated titanium framework with denture teeth and denture base resins. At the 6-month recall, the patient did not have any problems. Dental zirconia has excellent physical properties; however, care should be taken to prevent excessive stresses on the zirconia cylinders when a screw-retained zirconia restoration is planned as a definitive prosthesis.

  6. Morphology, proliferation, and gene expression of gingival fibroblasts on Laser-Lok, titanium, and zirconia surfaces.

    PubMed

    Esfahanizadeh, Nasrin; Motalebi, Sara; Daneshparvar, Niloufar; Akhoundi, Nasrin; Bonakdar, Shahin

    2016-07-01

    Soft tissue seal plays a critical role in long-term success of dental implants, and the effects of implant surface treatments such as laser ablation have been a topic of particular interest in this respect. Considering the existing controversy regarding soft tissue behavior in contact with implant surfaces, this study sought to assess the morphology, proliferation, and gene expression of human gingival fibroblasts (HGFs) on different abutment surfaces. In this in vitro, experimental study, HGFs were cultured on 45 discs (Laser-Lok, titanium, and zirconia). Cell morphology, proliferation rate, and interleukin 10 (IL-10), tumor necrosis factor alpha (TNFα), fibronectin, and integrin gene expressions were assessed by electron microscopy, methyl thiazol tetrazolium (MTT) assay, and real-time polymerase chain reaction (PCR), respectively. Data were analyzed using ANOVA and the Kruskal-Wallis H test. Fibroblast attachment was noted in all the three groups. Spindle-shaped cells with pseudopod-like processes were more frequently seen in the Laser-Lok group. Cell proliferation was significantly higher in the Laser-Lok group compared to those in the other groups (P = 0.0002). Significant differences were found in the expression of IL-10, TNFα, fibronectin, and integrin genes among the groups (P < 0.01). Within the limitations of this study, HGFs on Laser-Lok surfaces had a more mature morphology and greater proliferation and differentiation as compared to those on zirconia and titanium surfaces. This indicates better attachment of these cells to laser-modified surfaces, creating a more efficient soft tissue seal around dental implants.

  7. Characterization of three commercial Y-TZP ceramics produced for their high-translucency, high-strength and high-surface area

    PubMed Central

    Tong, Hui; Tanaka, Carina B.; Kaizer, Marina R.; Zhang, Yu

    2015-01-01

    Developing yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) with high strength and translucency could significantly widen the clinical indications of monolithic zirconia restorations. This study investigates the mechanical and optical properties of three Y-TZP ceramics: High-Translucency, High-Strength and High-Surface Area. The four-point bending strengths (mean ± standard error) for the three Y-TZP ceramics (n = 10) were 990 ± 39, 1416 ± 33 and 1076 ± 32 MPa for High-Translucency, High-Strength and High-Surface Area, respectively. The fracture toughness values (mean ± standard error) for the three zirconias (n = 10) were 3.24 ± 0.10, 3.63 ± 0.12 and 3.21 ± 0.14 MPa m1/2 for High-Translucency, High-Strength and High-Surface Area, respectively. Both strength and toughness values of High-Strength zirconia were significantly higher than High-Surface Area and High-Translucency zirconias. Translucency parameter values of High-Translucency zirconia were considerably higher than High-Strength and High-Surface Area zirconias. However, all three zirconias became essentially opaque when their thickness reached 1 mm or greater. Our findings suggest that there exists a delicate balance between mechanical and optical properties of the current commercial Y-TZP ceramics. PMID:26664123

  8. Surface treatment with a fractional CO2 laser enhances shear bond strength of resin cement to zirconia

    PubMed Central

    Alirezaei, Mehrnoosh

    2016-01-01

    Aims: The present study investigated the effect of different surface treatments on shear bond strength (SBS) of resin cement to zirconia. Materials and methods: Ninety zirconia blocks were prepared and divided into 6 groups of 15 by treatment. Group 1 served as the control group, whereas groups 2 and 3 were treated with air abrasion and a universal primer (Monobond plus), respectively. The remaining zirconia copings were treated with a fractional CO2 laser for 10 seconds using 10 W/10 mJ (group 4), 10 w/14 mJ (group 5) or 20 W/10 mJ (group 6). A luting cement (Clearfil SA) was bonded to the treated zirconia surfaces and cured for 40 seconds. SBS was measured with a universal testing machine and the type of bond failure was determined. Results: There was a statistically significant difference in SBS among the study groups (p<0.001). The highest SBS values were observed in the groups treated with the fractional CO2 laser at settings of 20 W/10 mJ (28.1 MPa) or 10 W/14 mJ (27.4 MPa), followed by the specimens treated with the universal primer (22.8 MPa). The control specimens exhibited the lowest SBS (9.4 MPa) among the study groups (p<0.05). There was no significant difference in the distribution of failure modes among the groups (p=0.871). Conclusions: The application of fractional CO2 laser can improve bond strength of resin cement to zirconia ceramic, and thus it could be considered as an appropriate alternative to conventional methods of zirconia surface treatment. PMID:27141151

  9. Effects of Different Surface Treatment Methods and MDP Monomer on Resin Cementation of Zirconia Ceramics an In Vitro Study

    PubMed Central

    Tanış, Merve Çakırbay; Akçaboy, Cihan

    2015-01-01

    Introduction: Resin cements are generally preferred for cementation of zirconia ceramics. Resin bonding of zirconia ceramics cannot be done with the same methods of traditional ceramics because zirconia is a silica-free material. In recent years, many methods have been reported in the literature to provide the resin bonding of zirconia ceramics. The purpose of this in vitro study is to evaluate effects of different surface treatments and 10-metacryloxydecyl dihydrogen phosphate (MDP) monomer on shear bond strength between zirconia and resin cement. Methods: 120 zirconia specimens were treated as follows: Group I: sandblasting, group II: sandblasting + tribochemical silica coating + silane, group III: sandblasting + Nd:YAG (neodymium: yttrium-aluminum-garnet) laser. One specimen from each group was evaluated under scanning electron microscope (SEM). Specimens in each group were bonded either with conventional resin cement Variolink II or with a MDP containing resin cement Panavia F2.0. Subgroups of bonded specimens were stored in distilled water (37°C) for 24 hours or 14 days. Following water storage shear bond strength test was performed at a crosshead speed of 1 mm/min in a universal test machine. Then statistical analyses were performed. Results: Highest shear bond strength values were observed in group II. No significant difference between group I and III was found when Panavia F2.0 resin cement was used. When Variolink II resin cement was used group III showed significantly higher bond strength than group I. In group I, Panavia F2.0 resin cement showed statistically higher shear bond strength than Variolink II resin cement. In group II no significant difference was found between resin cements. No significant difference was found between specimens stored in 37°C distilled water for 24 hours and 14 days. In group I surface irregularities with sharp edges and grooves were observed. In group II less roughened surface was observed with silica particles. In group

  10. Effects of grinding on properties of Mg-PSZ ceramics prepared by the surface enrichment of zirconia powders

    SciTech Connect

    Deb, S.; Das, S.R.

    1995-10-01

    Commercial grade zirconia powders of mean particle size of 3.21 microns were super-ground in wet condition in alcoholic medium in a Planetary Ball-Mill for 12-hours using a zirconia pot as well as balls, in order to avoid contaminations from the grinding media. Sedigraph analysis data show the mean particle sizes within the range of 0.4 to 0.2 micron. The super-ground zirconia powders were then treated with appropriate acid and alkali solutions in order to enrich the surfaces of zirconia powders. The chemical analysis reports depict the enrichment phenomena of the processed zirconia powders. Magnesium oxide of different mole percentages (3 to 9%) have been incorporated to the above super-ground and enriched zirconia powder and green specimens were prepared by pressing with a suitable pressure of 200 MPa to yield the green compaction density of 3.06 gm/cm{sup 3}. The compacted green specimens were sintered without pressure at 1,480 C in air followed by normal cooling. X-ray diffraction patterns of the above sintered and cooled specimens have confirmed the formation of Mg-PSZ ceramics with 40% tetragonal phase. The sintered PSZ-products have shown very good surface properties but at the cost of transverse rupture strength. The effects of grinding were observed on the above Mg-PSZ ceramics which exhibit very little change in the tetragonal phase even after 30-minutes of grinding with a 60-mesh diamond wheel at a normal pressure of 4 kg/cm{sup 2}.

  11. Comparison of the surface roughness of feldspathic porcelain polished with a novel alumina-zirconia paste or diamond paste.

    PubMed

    Yamockul, Suparaksa; Thamrongananskul, Niyom; Poolthong, Suchit

    2016-01-01

    This study compared the surface roughness of feldspathic porcelain polished with newly developed alumina-zirconia pastes or diamond paste. Porcelain discs were prepared and polished with sandpaper using a polishing-machine. The surface roughness (Ra) of each sample was measured using a profilometer. The samples were randomly divided into 6 groups (n=10). The control group was polished with diamond paste (DP), and the five remaining groups were polished with the newly developed alumina-zirconia paste with the following ratios of glycerin:alumina:zirconia by weight: 1:0.5:0.5 (Z0.5), 1:0.5:0.75 (Z0.75), 1:0.5:1 (Z1), 1:0.5:1.5 (Z1.5), and 1:0.5:2 (Z2). The specimens were polished for 120 s. The Ra values were determined again and the surface morphology of the porcelain samples was analyzed using SEM. The Ra values decreased as the amount of zirconia in the polishing paste increased, except for the Z2 group. The surface roughness as observed by SEM showed a correlation with the Ra values.

  12. Bond strength of three luting agents to zirconia ceramic - Influence of surface treatment and thermocycling

    PubMed Central

    ATTIA, Ahmed

    2011-01-01

    Objective This in vitro study aimed to evaluate the influence of different surface treatments, 3 luting agents and thermocycling on microtensile bond strength (µTBS) to zirconia ceramic. Material and Methods A total of 18 blocks (5x5x4 mm) were fabricated from zirconia ceramic (ICE Zirkonia) and duplicated into composite blocks (Alphadent). Ceramic blocks were divided into 3 groups (n=6) according to the following surface treatments: airborne-particle abrasion (AA), silica-coating, (SC) (CoJet) and silica coating followed by silane application (SCSI) (ESPE Sil). Each group was divided into 3 subgroups (n=2) according to the 3 luting agents used. Resin-modified glass-ionomer cement (RMGIC, Ketac Cem Plus), self-adhesive resin cement (UN, RelyX Unicem) and adhesive resin cement (ML, MultiLink Automix) were used for bonding composite and zirconia blocks. Each bonding assembly was cut into microbars (10 mm long and 1±0.1 mm2). Seven specimens of each subgroup were stored in water bath at 37ºC for 1 week. The o ther 7 specimens were stored in water bath at 37ºC for 30 days then thermocycled (TC) for 7,500 cycles. µTBS values were recorded for each specimen using a universal testing machine. Statistical analyses were performed using a 3-way ANOVA model followed by serial 1-way ANOVAs. Comparison of means was performed with Tukey's HSD test at (α=0.05). Results µTBS ranged from 16.8 to 31.8 MPa after 1 week and from 7.3 to 16.4 MPa after 30 days of storage in water and thermocycling. Artificial aging significantly decreased µTBS (p<0.05). Considering surface treatment, SCSI significantly increased µTBS (p<0.05) compared to SC and AA. Resin cements (UN and ML) demonstrated significantly higher µTBS (p<0.05) compared to RMGIC cement. Conclusions Silica coating followed by silane application together with adhesive resin cements significantly increased µTBS, while thermocycling significantly decreased µTBS. PMID:21710091

  13. Surface modification of zirconia with polydopamine to enhance fibroblast response and decrease bacterial activity in vitro: A potential technique for soft tissue engineering applications.

    PubMed

    Liu, Mingyue; Zhou, Jianfeng; Yang, Yang; Zheng, Miao; Yang, Jianjun; Tan, Jianguo

    2015-12-01

    The quality of soft-tissue integration plays an important role in the short- and long-term success of dental implants. The aim of the present study was to provide a surface modification approach for zirconia implant abutment materials and to evaluate its influence on fibroblast behavior and oral bacteria adhesion, which are the two main factors influencing the quality of peri-implant soft-tissue seal. In this study, polydopamine (PDA)-coated zirconia was prepared and the surface characteristics were evaluated using scanning electron microscopy, atomic force microscopy, a contact-angle-measuring device, X-ray photoelectron spectroscopy, and Raman spectroscopy. The responses of human gingival fibroblasts (HGFs) to PDA-coated zirconia; i.e., adhesion, proliferation, morphology, protein synthesis, and gene expression, were analyzed. Additionally, the adhesion of Streptococcus gordonii and Streptococcus mutans to zirconia after PDA coating was assessed by scanning electron microscopy and live/dead staining. The material surface analyses suggested the successful coating of PDA onto the zirconia surface. The PDA coating significantly increased cell adhesion and proliferation compared with pristine zirconia. HGFs exhibited a high degree of spreading and secreted a high level of collagen type I on PDA-modified disks. Upregulation of integrin α5, β1, β3 and fibronectin was noted in HGFs cultured on PDA-coated zirconia. The number of adherent bacteria decreased significantly on zirconia after PDA coating. In summary, our result suggest that PDA is able to modify the surface of zirconia, influence HGFs' behavior and reduce bacterial adhesion. Therefore, this surface modification approach holds great potential for improving soft-tissue integration around zirconia abutments in clinical application.

  14. Current status of zirconia restoration.

    PubMed

    Miyazaki, Takashi; Nakamura, Takashi; Matsumura, Hideo; Ban, Seiji; Kobayashi, Taira

    2013-10-01

    During the past decade, zirconia-based ceramics have been successfully introduced into the clinic to fabricate fixed dental prostheses (FDPs), along with a dental computer-aided/computer-aided manufacturing (CAD/CAM) system. In this article (1) development of dental ceramics, (2) the current status of dental CAD/CAM systems, (3) CAD/CAM and zirconia restoration, (4) bond between zirconia and veneering ceramics, (5) bond of zirconia with resin-based luting agents, (6) surface finish of zirconia restoration and antagonist enamel wear, and (7) clinical evaluation of zirconia restoration are reviewed. Yttria partially stabilized tetragonal zirconia polycrystalline (Y-TZP) showed better mechanical properties and superior resistance to fracture than other conventional dental ceramics. Furthermore, ceria-stabilized tetragonal zirconia polycrystalline and alumina nanocomposites (Ce-TZP/A) had the highest fracture toughness and had resistance to low-temperature aging degradation. Both zirconia-based ceramics have been clinically available as an alternative to the metal framework for fixed dental prostheses (FDPs). Marginal adaptation of zirconia-based FDPs is acceptable for clinical application. The most frequent clinical complication with zirconia-based FDPs was chipping of the veneering porcelain that was affected by many factors. The mechanism for the bonding between zirconia and veneering ceramics remains unknown. There was no clear evidence of chemical bonding and the bond strength between zirconia and porcelain was lower than that between metal and porcelain. There were two alternatives proposed that might avoid chipping of veneering porcelains. One was hybrid-structured FDPs comprising CAD/CAM-fabricated porcelain parts adhering to a CAD/CAM fabricated zirconia framework. Another option was full-contour zirconia FDPs using high translucent zirconia. Combined application of silica coating and/or silane coupler, and 10-methacryloyloxydecyl dihydrogen phosphate is

  15. High surface area calcite

    NASA Astrophysics Data System (ADS)

    Schultz, L. N.; Andersson, M. P.; Dalby, K. N.; Müter, D.; Okhrimenko, D. V.; Fordsmand, H.; Stipp, S. L. S.

    2013-05-01

    Calcite (CaCO3) is important in many fields—in nature, because it is a component of aquifers, oil reservoirs and prospective CO2 storage sites, and in industry, where it is used in products as diverse as paper, toothpaste, paint, plastic and aspirin. It is difficult to obtain high purity calcite with a high surface area but such material is necessary for industrial applications and for fundamental calcite research. Commercial powder is nearly always contaminated with growth inhibitors such as sugars, citrate or pectin and most laboratory synthesis methods deliver large precipitates, often containing vaterite or aragonite. To address this problem, we (i) adapted the method of carbonating a Ca(OH)2 slurry with CO2 gas to develop the first simple, cheap, safe and reproducible procedure using common laboratory equipment, to obtain calcite that reproducibly had a surface area of 14-17 m2/g and (ii) conducted a thorough characterization of the product. Scanning electron microscopy (SEM) revealed nanometer scale, rhombohedral crystals. X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and infrared spectroscopy (IR) confirmed highly crystalline, pure calcite that more closely resembles the dimensions of the biogenic calcite produced by algae in coccoliths than other methods for synthesizing calcite. We suggest that this calcite is useful when purity and high surface area are important.

  16. Modulation of human dermal microvascular endothelial cell and human gingival fibroblast behavior by micropatterned silica coating surfaces for zirconia dental implant applications.

    PubMed

    Laranjeira, Marta S; Carvalho, Ângela; Pelaez-Vargas, Alejandro; Hansford, Derek; Ferraz, Maria Pia; Coimbra, Susana; Costa, Elísio; Santos-Silva, Alice; Fernandes, Maria Helena; Monteiro, Fernando Jorge

    2014-04-01

    Dental ceramic implants have shown superior esthetic behavior and the absence of induced allergic disorders when compared to titanium implants. Zirconia may become a potential candidate to be used as an alternative to titanium dental implants if surface modifications are introduced. In this work, bioactive micropatterned silica coatings were produced on zirconia substrates, using a combined methodology of sol-gel processing and soft lithography. The aim of the work was to compare the in vitro behavior of human gingival fibroblasts (HGFs) and human dermal microvascular endothelial cells (HDMECs) on three types of silica-coated zirconia surfaces: flat and micropatterned (with pillars and with parallel grooves). Our results showed that cells had a higher metabolic activity (HGF, HDMEC) and increased gene expression levels of fibroblast-specific protein-1 (FSP-1) and collagen type I (COL I) on surfaces with pillars. Nevertheless, parallel grooved surfaces were able to guide cell growth. Even capillary tube-like networks of HDMEC were oriented according to the surface geometry. Zirconia and silica with different topographies have shown to be blood compatible and silica coating reduced bacteria adhesion. All together, the results indicated that microstructured bioactive coating seems to be an efficient strategy to improve soft tissue integration on zirconia implants, protecting implants from peri-implant inflammation and improving long-term implant stabilization. This new approach of micropatterned silica coating on zirconia substrates can generate promising novel dental implants, with surfaces that provide physical cues to guide cells and enhance their behavior.

  17. Modulation of human dermal microvascular endothelial cell and human gingival fibroblast behavior by micropatterned silica coating surfaces for zirconia dental implant applications

    PubMed Central

    Laranjeira, Marta S; Carvalho, Ângela; Pelaez-Vargas, Alejandro; Hansford, Derek; Ferraz, Maria Pia; Coimbra, Susana; Costa, Elísio; Santos-Silva, Alice; Fernandes, Maria Helena; Monteiro, Fernando Jorge

    2014-01-01

    Dental ceramic implants have shown superior esthetic behavior and the absence of induced allergic disorders when compared to titanium implants. Zirconia may become a potential candidate to be used as an alternative to titanium dental implants if surface modifications are introduced. In this work, bioactive micropatterned silica coatings were produced on zirconia substrates, using a combined methodology of sol–gel processing and soft lithography. The aim of the work was to compare the in vitro behavior of human gingival fibroblasts (HGFs) and human dermal microvascular endothelial cells (HDMECs) on three types of silica-coated zirconia surfaces: flat and micropatterned (with pillars and with parallel grooves). Our results showed that cells had a higher metabolic activity (HGF, HDMEC) and increased gene expression levels of fibroblast-specific protein-1 (FSP-1) and collagen type I (COL I) on surfaces with pillars. Nevertheless, parallel grooved surfaces were able to guide cell growth. Even capillary tube-like networks of HDMEC were oriented according to the surface geometry. Zirconia and silica with different topographies have shown to be blood compatible and silica coating reduced bacteria adhesion. All together, the results indicated that microstructured bioactive coating seems to be an efficient strategy to improve soft tissue integration on zirconia implants, protecting implants from peri-implant inflammation and improving long-term implant stabilization. This new approach of micropatterned silica coating on zirconia substrates can generate promising novel dental implants, with surfaces that provide physical cues to guide cells and enhance their behavior. PMID:27877662

  18. Modulation of human dermal microvascular endothelial cell and human gingival fibroblast behavior by micropatterned silica coating surfaces for zirconia dental implant applications

    NASA Astrophysics Data System (ADS)

    Laranjeira, Marta S.; Carvalho, Ângela; Pelaez-Vargas, Alejandro; Hansford, Derek; Ferraz, Maria Pia; Coimbra, Susana; Costa, Elísio; Santos-Silva, Alice; Fernandes, Maria Helena; Monteiro, Fernando Jorge

    2014-04-01

    Dental ceramic implants have shown superior esthetic behavior and the absence of induced allergic disorders when compared to titanium implants. Zirconia may become a potential candidate to be used as an alternative to titanium dental implants if surface modifications are introduced. In this work, bioactive micropatterned silica coatings were produced on zirconia substrates, using a combined methodology of sol-gel processing and soft lithography. The aim of the work was to compare the in vitro behavior of human gingival fibroblasts (HGFs) and human dermal microvascular endothelial cells (HDMECs) on three types of silica-coated zirconia surfaces: flat and micropatterned (with pillars and with parallel grooves). Our results showed that cells had a higher metabolic activity (HGF, HDMEC) and increased gene expression levels of fibroblast-specific protein-1 (FSP-1) and collagen type I (COL I) on surfaces with pillars. Nevertheless, parallel grooved surfaces were able to guide cell growth. Even capillary tube-like networks of HDMEC were oriented according to the surface geometry. Zirconia and silica with different topographies have shown to be blood compatible and silica coating reduced bacteria adhesion. All together, the results indicated that microstructured bioactive coating seems to be an efficient strategy to improve soft tissue integration on zirconia implants, protecting implants from peri-implant inflammation and improving long-term implant stabilization. This new approach of micropatterned silica coating on zirconia substrates can generate promising novel dental implants, with surfaces that provide physical cues to guide cells and enhance their behavior.

  19. Synthesis and catalytic activity of polysaccharide templated nanocrystalline sulfated zirconia

    SciTech Connect

    Sherly, K. B.; Rakesh, K.

    2014-01-28

    Nanoscaled materials are of great interest due to their unique enhanced optical, electrical and magnetic properties. Sulfate-promoted zirconia has been shown to exhibit super acidic behavior and high activity for acid catalyzed reactions. Nanocrystalline zirconia was prepared in the presence of polysaccharide template by interaction between ZrOCl{sub 2}⋅8H{sub 2}O and chitosan template. The interaction was carried out in aqueous phase, followed by the removal of templates by calcination at optimum temperature and sulfation. The structural and textural features were characterized by powder XRD, TG, SEM and TEM. XRD patterns showed the peaks of the diffractogram were in agreement with the theoretical data of zirconia with the catalytically active tetragonal phase and average crystalline size of the particles was found to be 9 nm, which was confirmed by TEM. TPD using ammonia as probe, FTIR and BET surface area analysis were used for analyzing surface features like acidity and porosity. The BET surface area analysis showed the sample had moderately high surface area. FTIR was used to find the type species attached to the surface of zirconia. UV-DRS found the band gap of the zirconia was found to be 2.8 eV. The benzylation of o-xylene was carried out batchwise in atmospheric pressure and 433K temperature using sulfated zirconia as catalyst.

  20. Synthesis and catalytic activity of polysaccharide templated nanocrystalline sulfated zirconia

    NASA Astrophysics Data System (ADS)

    Sherly, K. B.; Rakesh, K.

    2014-01-01

    Nanoscaled materials are of great interest due to their unique enhanced optical, electrical and magnetic properties. Sulfate-promoted zirconia has been shown to exhibit super acidic behavior and high activity for acid catalyzed reactions. Nanocrystalline zirconia was prepared in the presence of polysaccharide template by interaction between ZrOCl2ṡ8H2O and chitosan template. The interaction was carried out in aqueous phase, followed by the removal of templates by calcination at optimum temperature and sulfation. The structural and textural features were characterized by powder XRD, TG, SEM and TEM. XRD patterns showed the peaks of the diffractogram were in agreement with the theoretical data of zirconia with the catalytically active tetragonal phase and average crystalline size of the particles was found to be 9 nm, which was confirmed by TEM. TPD using ammonia as probe, FTIR and BET surface area analysis were used for analyzing surface features like acidity and porosity. The BET surface area analysis showed the sample had moderately high surface area. FTIR was used to find the type species attached to the surface of zirconia. UV-DRS found the band gap of the zirconia was found to be 2.8 eV. The benzylation of o-xylene was carried out batchwise in atmospheric pressure and 433K temperature using sulfated zirconia as catalyst.

  1. Surface modification of yttria stabilized zirconia via polydopamine inspired coating for hydroxyapatite biomineralization

    NASA Astrophysics Data System (ADS)

    Zain, Norhidayu Muhamad; Hussain, Rafaqat; Kadir, Mohammed Rafiq Abdul

    2014-12-01

    Yttria stabilized zirconia (YSZ) has been widely used as biomedical implant due to its high strength and enhanced toughening characteristics. However, YSZ is a bioinert material which constrains the formation of chemical bonds with bone tissue following implantation. Inspired by the property of mussels, the surface of YSZ ceramics was functionalized by quinone-rich polydopamine to facilitate the biomineralization of hydroxyapatite. YSZ discs were first immersed in 2 mg/mL of stirred or unstirred dopamine solution at either 25 or 37 °C. The samples were then incubated in 1.5 simulated body fluid (SBF) for 7d. The effect of coating temperature for stirred and unstirred dopamine solutions during substrate grafting was investigated on the basis of chemical compositions, wettability and biomineralization of hydroxyapatite on the YSZ functionalized surface. The results revealed that the YSZ substrate grafted at 37 °C in stirred solution of dopamine possessed significantly improved hydrophilicity (water contact angle of 44.0 ± 2.3) and apatite-mineralization ability (apatite ratio of 1.78). In summary, the coating temperature and stirring condition during grafting procedure affected the chemical compositions of the films and thus influenced the formation of apatite layer on the substrate during the biomineralization process.

  2. Surface Roughness Prediction Model using Zirconia Toughened Alumina (ZTA) Turning Inserts: Taguchi Method and Regression Analysis

    NASA Astrophysics Data System (ADS)

    Mandal, Nilrudra; Doloi, Biswanath; Mondal, Biswanath

    2016-01-01

    In the present study, an attempt has been made to apply the Taguchi parameter design method and regression analysis for optimizing the cutting conditions on surface finish while machining AISI 4340 steel with the help of the newly developed yttria based Zirconia Toughened Alumina (ZTA) inserts. These inserts are prepared through wet chemical co-precipitation route followed by powder metallurgy process. Experiments have been carried out based on an orthogonal array L9 with three parameters (cutting speed, depth of cut and feed rate) at three levels (low, medium and high). Based on the mean response and signal to noise ratio (SNR), the best optimal cutting condition has been arrived at A3B1C1 i.e. cutting speed is 420 m/min, depth of cut is 0.5 mm and feed rate is 0.12 m/min considering the condition smaller is the better approach. Analysis of Variance (ANOVA) is applied to find out the significance and percentage contribution of each parameter. The mathematical model of surface roughness has been developed using regression analysis as a function of the above mentioned independent variables. The predicted values from the developed model and experimental values are found to be very close to each other justifying the significance of the model. A confirmation run has been carried out with 95 % confidence level to verify the optimized result and the values obtained are within the prescribed limit.

  3. Thermocycling effect on microshear bond strength to zirconia ceramic using Er:YAG and tribochemical silica coating as surface conditioning.

    PubMed

    Gomes, Ana Luísa; Ramos, João Carlos; Santos-del Riego, Sérgio; Montero, Javier; Albaladejo, Alberto

    2015-02-01

    The purpose of this study is to evaluate the thermocycling effect on the microshear bond strength (μSBS) of different self-adhesive resin cements to zirconia using tribochemical silica coating Rocatec™ (ROC) and Er:YAG as surface conditioners. Two hundred forty square-like zirconia samples were polished and randomly assigned in four groups according surface treatment applied as follows: (1) no treatment (NT), (2) silica coating with ROC, 3) Er:YAG laser irradiation (LAS: 2.940 nm, 200 mJ; 10 Hz), and (4) laser followed by Rocatec™ (LAROC). Each group was divided into two subgroups according the resin tested as follows: (A) BiFix SE (BIF) and (B) Clearfil SA (CLE). After 24 h, half of the specimens from each subgroup were tested. The other half was stored and thermocycled (5-55 °C/5,000 cycles). A μSBS test was performed using a universal testing machine (cross head speed = 0.5 mm/min). Failure modes were recorded and observed by scanning electronic microscopy. Data was analyzed with ANOVA, Student's t test, and chi-square tests, and linear regression was performed (p < 0.05). Before thermocycling, both cements showed higher μSBS results with ROC and LAROC. After aging, (1) all BIF specimens evidenced severely decreased adhesion with mostly adhesive failures and (2) CLE maintained the initial results in ROC and LAROC groups, performing better with ROC. Thermocycling did not negatively influence the resin-zirconia μSBS results in the self-adhesive resin cement containing 10-MDP when used on zirconia surface coated with silica, independently of previous Er:YAG surface treatment.

  4. Synthesis and characterization of mesoporous zirconia and aluminated mesoporous zirconia

    NASA Astrophysics Data System (ADS)

    Zhao, Elizabeth Sun

    Synthesis of mesoporous zirconia has been performed by slowly hydrolyzing zirconium propoxide in the presence of anionic surfactants: namely, dodecyl phosphate or sulfate (P12 and Sf12) and hexadecyl sulfonate (So16) The zirconia. outgassed at 140--150°C has T-plot surface areas higher than 400 M2/g. This outgassing does not remove the surfactant. After calcination in air at 500°C and combustion of the surfactant, the mesoporous volume is reduced by a factor of about 2, whereas the pore wall material crystallizes in the tetragonal phase. The high-resolution electron microscopic study reveals the presence of a disorganized network of polygonal pores structure. It is suggested that the chemistry of the hydrolysis solution is instrumental in determining the pore structure. A schematic model in which the surfactant is a scaffold component is suggested in order to explain these results and the fixation of PO4, or SO4 in the walls may help to preserve the porous structure. It is very different from the templating mechanism. From the density obtained from phase transition temperature, and from the mesoporous volume (N2 adsorption), the thickness of the wall can be calculated as well as the pseudo-length of the pores. From the thickness, the T-plot area can be recalculated and agrees well with the measured T-plot surface area for the sample calcined at 500°C. Around 900°C, the walls become thicker and crystallizes into monoclinic zirconia without pore structure. In order to try to modify, the acidity of the mesoporous sulfated and oxo-phosphated zirconia, they were doped with aluminum. The sulfated zirconia only has a coating layer of amorphous alumina, while the phosphated zirconia has aluminum in the lattice and the alumina coat. A maximum ratio of Al/Zr ˜ 0.04 can be reached in the lattice. The introduction of aluminum into the lattice prevents the crystallization of the oxo-phosphate at 900°C, and helps to preserve the surface area and porosity of the sulfated

  5. Deformation characteristics of the near-surface layers of zirconia ceramics implanted with aluminum ions

    NASA Astrophysics Data System (ADS)

    Ghyngazov, S. A.; Vasiliev, I. P.; Frangulyan, T. S.; Chernyavski, A. V.

    2015-10-01

    The effect of ion treatment on the phase composition and mechanical properties of the near-surface layers of zirconium ceramic composition 97 ZrO2-3Y2O3 (mol%) was studied. Irradiation of the samples was carried out by accelerated ions of aluminum with using vacuum-arc source Mevva 5-Ru. Ion beam had the following parameters: the energy of the accelerated ions E = 78 keV, the pulse current density Ji = 4mA / cm2, current pulse duration equal τ = 250 mcs, pulse repetition frequency f = 5 Hz. Exposure doses (fluence) were 1016 и 1017 ion/cm2. The depth distribution implanted ions was studied by SIMS method. It is shown that the maximum projected range of the implanted ions is equal to 250 nm. Near-surface layers were investigated by X-ray diffraction (XRD) at fixed glancing incidence angle. It is shown that implantation of aluminum ions into the ceramics does not lead to a change in the phase composition of the near-surface layer. The influence of implanted ions on mechanical properties of ceramic near-surface layers was studied by the method of dynamic nanoindentation using small loads on the indenter P=300 mN. It is shown that in ion- implanted ceramic layer the processes of material recovery in the deformed region in the unloading mode proceeds with higher efficiency as compared with the initial material state. The deformation characteristics of samples before and after ion treatment have been determined from interpretation of the resulting P-h curves within the loading and unloading sections by the technique proposed by Oliver and Pharr. It was found that implantation of aluminum ions in the near-surface layer of zirconia ceramics increases nanohardness and reduces the Young's modulus.

  6. Effect of different surface treatments on shear bond strength of zirconia to three resin cements

    NASA Astrophysics Data System (ADS)

    Dadjoo, Nisa

    Statement of problem: There are no standard guidelines for material selection to obtain acceptable bonding to high-strength zirconium oxide ceramic. Studies suggest resin cements in combination with MDP-containing primer is a reasonable choice, however, the other cements cannot be rejected and need further investigation. Objective: The purpose of this in vitro study was the evaluation of the shear bond strength of three composite resin cements to zirconia ceramic after using different surface conditioning methods. Materials and methods: One hundred and twenty sintered Y-TZP ceramic (IPS e.max ZirCAD) squares (8 x 8 x 4 mm) were embedded in acrylic molds, then divided into three groups (n=40) based on the type of cement used. Within each group, the specimens were divided into four subgroups (n=10) and treated as follows: (1) Air abrasion with 50microm aluminum oxide (Al2O 3) particles (ALO); (2) Air abrasion + Scotchbond Universal adhesive (SBU); (3) Air abrasion + Monobond Plus (MBP); (4) Air abrasion + Z-Prime Plus (ZPP). Composite cylinders were used as carriers to bond to conditioned ceramic using (1) RelyX Ultimate adhesive resin cement (RX); (2) Panavia SA self-adhesive resin cement (PSA); (3) Calibra esthetic cement (CAL). The bonded specimens were submerged in distilled water and subjected to 24-hour incubation period at 37°C. All specimens were stressed in shear at a constant crosshead speed of 0.5 mm/min until failure. Statistical analysis was performed by ANOVA. The bond strength values (MPa), means and standard deviations were calculated and data were analyzed using analysis of variance with Fisher's PLSD multiple comparison test at the 0.05 level of significance. The nature of failure was recorded. Results: The two-way ANOVA showed Panavia SA to have the highest strength at 44.3 +/- 16.9 MPa (p<0.05). The combination of Scotchbond Universal surface treatment with Panavia SA cement showed statistically higher bond strength (p=0.0054). The highest bond

  7. Effects of different surface treatments on bond strength between resin cements and zirconia ceramics.

    PubMed

    Erdem, A; Akar, G C; Erdem, A; Kose, T

    2014-01-01

    This study compares the bond strength of resin cement and yttrium-stabilized tetragonal zirconia polycrystalline (Y-TZP) ceramic with different surface conditioning methods. Two hundred presintered Y-TZP ceramic specimens were prepared, sintered (4 × 4 × 4 mm), and randomly assigned to four equal groups as control (C, no conditioning); airborne particle abraded (APA, air abrasion with 11 μm Al2O3); tribochemical silica coating/silane coupling system (TSC, Rocatec, air abrasion with 110 μm Al2O3, 30 μm silica-coated Al2O3 and silane); and laser (L, Er:YAG laser irradiation treated at a power setting of 200 mJ). After specimen preparation, composite resin cylinders were prepared and cemented with resin cements (Clearfil Esthetic, Panavia F 2.0, Rely X-U100, Super Bond C&B, and Multilink Automix) on the ceramic surfaces and kept in an incubator at 37°C for 60 days. All specimens were tested for shear bond strength with a universal testing machine, and fractured surfaces were evaluated by environmental scanning electron microscopy. Statistical analysis was performed using Kruskal-Wallis and Mann-Whitney U-tests (α=0.05). The bond strengths for C and L groups were not significantly different according to adhesive resin cement. APA and TSC resulted in increased bond strength for Panavia F 2.0 and Rely X-U100 resin cements. Additionally, TSC presented higher bond strength with Multilink Automix. Adhesive fracture between the ceramic and resin cement was the most common failure. Complete cohesive fracture at the ceramic or composite cylinders was not observed. Regardless of the adhesive resin cement used, laser treatment did not improve resin bond strength.

  8. Composite Nafion/sulfonated zirconia membranes: effect of the filler surface properties on proton transport characteristics

    PubMed Central

    D’Epifanio, Alessandra; Navarra, Maria Assunta; Weise, F. Christoph; Mecheri, Barbara; Farrington, Jaime; Licoccia, Silvia; Greenbaum, Steve

    2009-01-01

    Due to their strong acidity and water affinity, sulfated zirconia nanoparticles were evaluated as inorganic additives in the formation of composite Nafion-based membranes. Two types of sulfated zirconia were obtained according to the preparation experimental conditions. Sulfated zirconia-doped Nafion membranes were prepared by a casting procedure. The properties of the composite membranes were compared with those of an unfilled Nafion membrane obtained by the same preparation method. The water uptake, measured at room temperature in a wide relative humidity range, was higher for the composite membranes, this confirming the hydrophilic nature of the selected additives. The membrane doped by zirconia particles having the highest sulphate group concentration showed the highest water diffusion coefficient in the whole range of temperature and relative humidity investigated due to the presence of SO42− providing extra acid sites for water diffusion. The proton diffusivity calculated from impedance spectroscopy measurements was compared with water self diffusion coefficients measured by NMR Spectroscopy. The difference between proton and water diffusivity became significant only at high humidification levels, highlighting the role of water in the intermolecular proton transfer mechanism. Finally, great improvements were found when using the composite membrane as electrolyte in a fuel cell working at very low relative humidity. PMID:20209115

  9. Evaluation of translucency of monolithic zirconia and framework zirconia materials

    PubMed Central

    Tuncel, İlkin; Üşümez, Aslıhan

    2016-01-01

    PURPOSE The opacity of zirconia is an esthetic disadvantage that hinders achieving natural and shade-matched restorations. The aim of this study was to evaluate the translucency of non-colored and colored framework zirconia and monolithic zirconia. MATERIALS AND METHODS The three groups tested were: non-colored framework zirconia, colored framework zirconia with the A3 shade according to Vita Classic Scale, and monolithic zirconia (n=5). The specimens were fabricated in the dimensions of 15×12×0.5 mm. A spectrophotometer was used to measure the contrast ratio, which is indicative of translucency. Three measurements were made to obtain the contrast ratios of the materials over a white background (L*w) and a black background (L*b). The data were analyzed using the one-way analysis of variance and Tukey HSD tests. One specimen from each group was chosen for scanning electron microscope analysis. The determined areas of the SEM images were divided by the number of grains in order to calculate the mean grain size. RESULTS Statistically significant differences were observed among all groups (P<.05). Non-colored zirconia had the highest translucency with a contrast ratio of 0.75, while monolithic zirconia had the lowest translucency with a contrast ratio of 0.8. The mean grain sizes of the non-colored, colored, and monolithic zirconia were 233, 256, and 361 nm, respectively. CONCLUSION The translucency of the zirconia was affected by the coloring procedure and the grain size. Although monolithic zirconia may not be the best esthetic material for the anterior region, it may serve as an alternative in the posterior region for the bilayered zirconia restorations. PMID:27350851

  10. Enhanced structural stability of nanoporous zirconia under irradiation of He

    SciTech Connect

    Yang, Tengfei; Huang, Xuejun; Wang, Chenxu; Zhang, Yanwen; Xue, Jianming; Yan, Sha; Wang, Yuguang

    2012-01-01

    This work reports a greatly enhanced tolerance for He irradiation-induced swelling in nanocrystalline zirconia film with interconnected nanoporous structure (hereinafter referred as to NC-C). Compared to bulk yttria-stabilized zirconia (YSZ) and another nanocrystalline zirconia film only with discrete nano voids (hereinafter referred as to NC-V), the NC-C film reveals good tolerance for irradiation of high-fluence He. No appreciable surface blistering can be found even at the highest fluence of 6 1017 cm2 in NCC film. From TEM analysis of as-irradiated samples, the enhanced tolerance for volume swelling in NCC film is attributed to the enhanced diffusion mechanism of deposited He via widely distributed nano channels. Furthermore, the growth of grain size is quite small for both nanocrystalline zirconia films after irradiation, which is ascribed to the decreasing of area of grain boundary due to loose structure and low energy of primary knock-on atoms for He ions.

  11. Effect of Different Surface Treatments on Repair Micro-shear Bond Strength of Silica- and Zirconia-filled Composite Resins

    PubMed Central

    Joulaei, Mohammad; Bahari, Mahmoud; Ahmadi, Anahid; Savadi Oskoee, Siavash

    2012-01-01

    Background and aims Effect of surface treatments on repair bond strength of aged composite resins might be different due to their dissimilar fillers. The aim was to evaluate the effect of different surface treatments on repair micro-shear bond strength (µSBS) of silica- (Spectrum TPH) and zirconia-filled (Filtek Z250) composite resins. Materials and methods Twenty-seven composite resin blocks were made from each type of composite resin: Z250 and Spectrum TPH. After aging, blocks of each type were randomly divided into three groups according to surface treatments: alloy primer, silane, and only surface roughening. Subsequently, each group was further subdivided into 3 subgroups based on the adhesive system used: Single Bond, Clearfil SE Bond, and Margin Bond. Four composite resin columns were added on each block. After thermocycling, µSBStest were done at cross head speed of 0.5 mm/min. Data was analysed using multifactor ANOVA, one-way ANOVA and a post-hoc Bonferroni tests (α = 0.05). Results Analysis of data showed that the effect of composite resin type was not significant (p > 0.05), but the effects of the type of surface treatment (p = 0.01) and the type of adhesive system (p = 0.01) were significant on repair µSBS. In addition, the cumulative effect of the composite type-surface treatment and the composite type with the type of adhesive system were not statistically significant (p > 0.05). However, the cumulative effects of the adhesive system-surface treatment (p = 0.03) and the composite type-the adhesive system-surface treatments (p = 0.002) were significant. Conclusion Although repair µSBS values of both silica- and zirconia-filled composite resins were similar, use of different combinations of surface treatments and adhesive systems affected their repair µSBS differently. PMID:23277859

  12. Surface quality of yttria-stabilized tetragonal zirconia polycrystal in CAD/CAM milling, sintering, polishing and sandblasting processes.

    PubMed

    Alao, Abdur-Rasheed; Stoll, Richard; Song, Xiao-Fei; Miyazaki, Takashi; Hotta, Yasuhiro; Shibata, Yo; Yin, Ling

    2017-01-01

    This paper studied the surface quality (damage, morphology, and phase transformation) of yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) in CAD/CAM milling, and subsequent polishing, sintering and sandblasting processes applied in dental restorations. X-ray diffraction and scanning electron microscopy (SEM) were used to scan all processed surfaces to determine phase transformations and analyse surface damage morphology, respectively. The average surface roughness (Ra) and maximum roughness (Rz) for all processed surfaces were measured using desk-top SEM-assisted morphology analytical software. X-ray diffraction patterns prove the sintering-induced monoclinic-tetragonal phase transformation while the sandblasting-induced phase transformation was not detected. The CAD/CAM milling of pre-sintered Y-TZP produced very rough surfaces with extensive fractures and cracks. Simply polishing or sintering of milled pre-sintered surfaces did not significantly improve their surface roughness (ANOVA, p>0.05). Neither sintering-polishing of the milled surfaces could effectively improve the surface roughness (ANOVA, p>0.05). The best surface morphology was produced in the milling-polishing-sintering process, achieving Ra=0.21±0.03µm and Rz=1.73±0.04µm, which meets the threshold for bacterial retention. Sandblasting of intaglios with smaller abrasives was recommended as larger abrasive produced visible surface defects. This study provides technical insights into process selection for Y-TZP to achieve the improved restorative quality.

  13. A sol-powder coating technique for fabrication of yttria stabilised zirconia

    SciTech Connect

    Wattanasiriwech, Darunee . E-mail: darunee@mfu.ac.th; Wattanasiriwech, Suthee; Stevens, Ron

    2006-08-10

    Yttria stabilised zirconia has been prepared using a simple sol-powder coating technique. The polymeric yttria sol, which was prepared using 1,3 propanediol as a network modifier, was homogeneously mixed with nanocrystalline zirconia powder and it showed a dual function: as a binder which promoted densification and a phase modifier which stabilised zirconia in the tetragonal and cubic phases. Thermal analysis and X-ray diffraction revealed that the polymeric yttria sol which decomposed at low temperature into yttrium oxide could change the m {sup {yields}} t phase transformation behaviour of the zirconia, possibly due to the small particle size and very high surface area of both yttria and zirconia particles allowing rapid alloying. The sintered samples exhibited three crystalline phases: monoclinic, tetragonal and cubic, in which cubic and tetragonal are the major phases. The weight fractions of the individual phases present in the selected specimens were determined using quantitative Rietveld analysis.

  14. Synthesis and surface characterization of alumina-silica-zirconia nanocomposite ceramic fibres on aluminium at room temperature

    NASA Astrophysics Data System (ADS)

    Mubarak Ali, M.; Raj, V.

    2010-04-01

    Alumina-silica-zirconia nanocomposite (ASZNC) ceramic fibres were synthesized by conventional anodization route. Scanning Electron Microscopy (SEM), Atomic Force microscopy (AFM), X-Ray Diffraction (XRD) and Energy Dispersive X-Ray spectroscopy (EDAX) were used to characterize the morphology and crystalloid structure of ASZNC fibres. Current density (DC) is one of the important parameters to get the alumina-silica-zirconia nanocomposite (ASZNC) ceramic fibres by this route. Annealing of the films exhibited a drastic change in the properties due to improved crystallinity. The root mean square roughness of the sample observed from atomic force microscopic analysis is about 71.5 nm which is comparable to the average grain size of the coatings which is about 72 nm obtained from X-Ray diffraction. The results indicate that, the ASZNC fibres are arranged well in the nanostructure. The thickness of the coating increased with the anodizing time, but the coatings turned rougher and more porous. At the initial stage the growth of ceramic coating increases inwards to the metal substrate and outwards to the coating surface simultaneously. Subsequently, it mainly grows towards the metal substrate and the density of the ceramic coating increases gradually, which results in the decrease of the total thickness as anodizing time increases. This new approach of preparing ASZNC ceramic fibres may be important in applications ranging from gas sensors to various engineering materials.

  15. Study of the catalysis and surface chemistry occurring at nickel/zirconia anodes in solid oxide fuel cells running on natural gas

    NASA Astrophysics Data System (ADS)

    Finnerty, C. M.; Cunningham, R. H.; Ormerod, R. M.

    Nickel-based/yttria-stabilised zirconia anodes for solid oxide fuel cells (SOFCs) running on natural gas have been developed which show increased resistance towards carbon deposition and improved durability. Surface carbon formed on the anodes during reforming has been characterised using temperature programmed oxidation (TPO). The influence of anode composition and formulation, pre-treatment method, operating temperature and methane/steam ratio have been studied. Doping the nickel/zirconia anode with small quantities of molybdenum leads to a substantial reduction in the amount of carbon deposited. As current is drawn from the SOFC increased methane conversion occurs together with reduced carbon deposition.

  16. Influence of starting precursors and synthesis methods on the physiochemical properties of zirconia

    SciTech Connect

    Gaydhankar, T.R.; Jha, R.K.; Nikalje, M.D.; Waghmare, K.J.

    2014-07-01

    Graphical abstract: Crystallite size of tetragonal phase of the zirconia samples prepared using different synthesis parameters and precursors as a function of calcination temperature. Surface area values of the zirconia samples calcined at 500 and 700 °C are in given brackets. - Highlights: • Zirconia prepared with modified sol–gel method is less stable compared with zirconia prepared by precipitation method. • Optimized synthesis conditions shifted the glow exotherm to higher temperature range indicating better thermal stability. • Tetragonal-zirconia could be synthesized in cost-effective manner using zirconium oxy-nitrate. • In our studies no co-relation between the surface area and crystallite size was observed. - Abstract: Under identical and judiciously pre-optimized synthesis conditions, the influence of different combinations of zirconium sources and/or post treatment conditions on structural properties, thermal stability, phase composition and morphology of zirconia has been investigated. High surface area tetragonal zirconia could be synthesized in a cost-effective manner from 1 M solution of zirconium oxy-nitrate at pH 11 using aqueous ammonia solution as a precipitant when calcined at 400 °C for 3 h. Irrespective of the preparation method, pH and starting precursor, zirconia samples prepared without digestion contained dominant monoclinic phase with some traces of tetragonal phase when calcined at 700 °C. Even though there is linear decrease in surface area with increase in the crystallite size for each sample as a function of calcination temperature, no co-relation between the surface area and crystallite size could be achieved. SEM images show agglomerated and irregular shape particles between 10 to 20 μm.

  17. The wetting characteristics and surface tension of some Ni-based alloys on yttria, hafnia, alumina, and zirconia substrates

    NASA Technical Reports Server (NTRS)

    Kanetkar, C. S.; Kacar, A. S.; Stefanescu, D. M.

    1988-01-01

    The surface tension and wetting characteristics of four commercial Ni-based alloys (UD718, Waspaloy, UD720, and UD520), pure Ni, and three special alloys (Ni-20 percent Cr, Ni-20 percent Cr-1 percent Al, and Ni-20 percent Cr-4 percent Al) on various ceramic substrates (including alumina, zirconia, hafnia, and yttria) were investigated using sessile drop experiments. Most of the systems studied exhibited a nonwetting behavior. Wetting improved with holding time at a given temperature to the point that some systems, such as Ni-20Cr on alumina, Ni-20Cr-4Al on alumina and on yttria, became marginally wetting. Wetting characteristics were apparently related to constitutional undercooling, which in turn could be affected by the metal dissolving some of the substrate during measurements.

  18. Silica coating of zirconia by silicon nitride hydrolysis on adhesion promotion of resin to zirconia.

    PubMed

    Lung, Christie Ying Kei; Liu, Dan; Matinlinna, Jukka Pekka

    2015-01-01

    In this study, the effect of silica coating on zirconia by silicon nitride hydrolysis in resin zirconia bonding was investigated. The silica coated zirconia samples were prepared in silicon nitride dispersion at 90 °C under different immersion times followed by a thermal treatment at 1400 °C. Four test groups were prepared: 1) zirconia samples treated by sandblasting, 2) zirconia samples treated by immersion in silicon nitride dispersion for 6 h, 3) zirconia samples treated by immersion in silicon nitride dispersion for 24 h and 4) zirconia samples treated by immersion in silicon nitride dispersion for 48 h. The coatings were characterized by SEM, EDX, XRD and Raman. The resin zirconia bond strengths of the four test groups were evaluated under three storage conditions: dry storage, water storage in deionized water at 37 °C for 30 days and thermo-cycling for 6000 cycles between 5.0 and 55.0 °C. Surface morphology and composition of zirconia were changed after surface treatments. Phase transformation was observed for zirconia surface by sandblasting treatment but was not observed for zirconia surface treated with silicon nitride hydrolysis. Significant differences in bond strengths were found under different surface treatments (p<0.001) and under three storage conditions (p<0.005). The highest bond strength values were obtained by sandblasting treatment.

  19. Conformal nanocoating of zirconia nanoparticles by atomic layer deposition in a fluidized bed reactor.

    PubMed

    Hakim, Luis F; George, Steven M; Weimer, Alan W

    2005-07-01

    Primary zirconia nanoparticles were conformally coated with alumina ultrathin films using atomic layer deposition (ALD) in a fluidized bed reactor. Alternating doses of trimethylaluminium and water vapour were performed to deposit Al(2)O(3) nanolayers on the surface of 26 nm zirconia nanoparticles. Transmission Fourier transform infrared spectroscopy was performed ex situ. Bulk Al(2)O(3) vibrational modes were observed for coated particles after 50 and 70 cycles. Coated nanoparticles were also examined with transmission electron microscopy, high-resolution field emission scanning electron microscopy and energy dispersive spectroscopy. Analysis revealed highly conformal and uniform alumina nanofilms throughout the surface of zirconia nanoparticles. The particle size distribution and surface area of the nanoparticles are not affected by the coating process. Primary nanoparticles are coated individually despite their high aggregation tendency during fluidization. The dynamic aggregation behaviour of zirconia nanoparticles in the fluidized bed plays a key role in the individual coating of nanoparticles.

  20. A facile approach to the synthesis of non-porous and microporous sub-micron spherical zirconia and alumina-zirconia solid solution.

    PubMed

    Ghotbi, Mohammad Yeganeh; Nasiri, Vida; Rafiee, Mehdi

    2013-01-01

    Amorphous monodisperse sub-micron spherical zirconia and alumina/zirconia solid solution particles were prepared by hydrolysis of zirconium and aluminum salts in ethanol. The heat-treatment process of the amorphous materials in air atmosphere at 500°C for 2h leaded to the production of non-porous zirconia and alumina/zirconia solid solution in tetragonal phase. The alkaline etching process of the as-prepared alumina/zirconia solid solution resulted in the formation of mono-modal microporous material with specific surface area of 125.0 m(2) g(-1) in comparison with 2. 9m(2) g(-1) for the parent material. Thermal analysis of the solid solution revealed that the incorporation of aluminum ions in the zirconia structure has decreased the phase transformation temperature from amorphous to crystalline structure. Moreover, optical study confirmed the presence of oxygen vacancy defect by substitution of tetravalent cations, Zr(4+) by trivalent cations, Al(3+) in zirconia lattice.

  1. Surface and Mechanical Characterization of Dental Yttria-Stabilized Tetragonal Zirconia Polycrystals (3Y-TZP) After Different Aging Processes.

    PubMed

    Pinto, Palena A; Colas, Guillaume; Filleter, Tobin; De Souza, Grace M

    2016-12-01

    Yttria-stabilized tetragonal zirconia polycrystals (3Y-TZP) is a ceramic material used in indirect dental restorations. However, phase transformation at body temperature may compromise the material's mechanical properties, affecting the clinical performance of the restoration. The effect of mastication on 3Y-TZP aging has not been investigated. 3Y-TZP specimens (IPS E-max ZirCAD and Z5) were aged in three different modes (n=13): no aging (control), hydrothermal aging (HA), or chewing simulation (CS). Mechanical properties and surface topography were analyzed. Analysis of variance showed that neither aging protocol (p=0.692) nor material (p=0.283) or the interaction between them (p=0.216) had a significant effect on flexural strength, values ranged from 928.8 MPa (IPSHA) to 1,080.6 MPa (Z5HA). Nanoindentation analysis showed that material, aging protocol, and the interaction between them had a significant effect (p<0.001) on surface hardness and reduced Young's modulus. The compositional analysis revealed similar yttrium content for all the experimental conditions (aging: p=0.997; material: p=0.248; interaction material×aging: p=0.720). Atomic force microscopy showed an effect of aging protocols on phase transformation, with samples submitted to CS exhibiting features compatible with maximized phase transformation, such as increased volume of the material microstructure at the surface leading to an increase in surface roughness.

  2. Gelcast zirconia-alumina composites

    SciTech Connect

    Omatete, O.O.; Bleier, A.; Westmoreland, C.G.; Young, A.C.

    1991-01-01

    Near net-shaped parts of zirconia-alumina composites have been successfully formed by gelcasting, a technique which utilizes in situ polymerization of acrylamide monomers. The high solids loading required for gelcasting ({approximately}50 vol %) was obtained by controlling the pH-dependent stability of the aqueous zirconia-alumina suspensions. A strong correspondence was found among the surface charges on the particles, colloidal stability, and the maximum solids loading. 14 refs., 3 figs., 2 tabs.

  3. Preliminary studies on the effects of in situ synthesized polycrystalline particulates on the bonding strength of resin to zirconia ceramic surface

    NASA Astrophysics Data System (ADS)

    Tian, Yueming; Zhang, Lingling; Zhang, Zutai; Ding, Ning; Liu, Yan; Tian, Guozhong

    2015-12-01

    To develop a novel zirconia surface modification method to improve the shear bond strength of resin cement. Yttrium-stabilized tetragonal zirconia (Y-TZP) discs were cut from prefabricated ceramic blocks and polished through 1200-grit SiC abrasive. Based on the immersion time of zirconia disc in HF solution, zirconia samples were divided into four groups. Then, put samples to CaCl2 solution, dipped in NaOH solution from 20 °C to 80 °C in a water bath, kept at 80 °C for 2 h. After final sintering, surface appearance and chemical components were characterized with scanning electron microscopy (SEM), energy dispersive spectrometry (EDS) and X-ray diffraction (XRD), respectively. The surface roughness of discs was measured as well. Shear bond strength of zirconia to resin cement was tested and the failure mode was analyzed. Three point bending tests were done to determine the flexural strength of samples. The statistical analysis was also done for all above data. ZrO2 polycrystalline particulates were in situ synthesized on the surface of zirconia substrates. The Ra values of the four groups were 0.27 ± 0.05 μm, 0.89 ± 0.34 μm, 1.04 ± 0.41 μm and 1.41 ± 0.38 μm, respectively. The treated group was statistically significant different from the control group (p < 0.05). Shear bond strength values of the four groups were 7.88 ± 1.94 MPa, 11.87 ± 3.7 MPa, 17.84 ± 6.21 MPa and 16.27 ± 5.87 MPa, respectively, and those of I5 and I7 were statistically different from that of C (p < 0.05). The failure mode was mainly adhesive in group C and mixed in I5. Three point bending strength values of the four groups were 730.21 ± 56.91 MPa, 689.81 ± 73.75 MPa, 704.25 ± 91.44 MPa and 702.28 ± 86.05 MPa, respectively, without statistically significant difference between each other (p > 0.05). In the conclusion, in situ synthesized polycrystalline particulates on zirconium ceramic surface can effectively improve the bonding strength of resin, avoid micro cracks and

  4. Textural and structural properties and surface acidity characterization of mesoporous silica-zirconia molecular sieves

    NASA Astrophysics Data System (ADS)

    Rodríguez-Castellón, E.; Jiménez-López, A.; Maireles-Torres, P.; Jones, D. J.; Rozière, J.; Trombetta, M.; Busca, G.; Lenarda, M.; Storaro, L.

    2003-11-01

    Homogeneous mesoporous zirconium-containing MCM-41 type silica were prepared by supramolecular templating and their textural and structural properties were studied using powder X-ray diffraction, N 2 porosimetry, atomic force microscopy, EXAFS, XPS, and UV-VIS-NIR diffuse reflectance spectroscopy. Their acid properties were also studied by using IR spectroscopy and by the use of catalytic tests such as the decomposition of isopropanol and the isomerization of 1-butene. The materials prepared show a good degree of crystallinity with a regular ordering of the pores into a hexagonal arrangement and high thermal stability. The specific surface area of the prepared materials decreases as the zirconium content rises. Zirconium atoms are in coordination 7 to 8 and located at the surface of the pores such that a high proportion of the oxygen atoms bonded to zirconium corresponds to surface non-condensed oxygen atoms. Both facts are responsible for the acid properties of the solids that show weak Brønsted and medium strong Lewis acidity.

  5. Study on the neotype zirconia's implant coated nanometer hydroxyapatite ceramics

    NASA Astrophysics Data System (ADS)

    Zhu, J. W.; Yang, D. W.

    2007-07-01

    In recent years, biologic ceramics is a popular material of implants and bioactive surface modification of dental implant became a research emphasis, which aims to improve bioactivity of implants materials and acquire firmer implants-bone interface. The zirconia ceramic has excellent mechanical properties and nanometer HA ceramics is a bioceramic well known for its bioactivity, therefore, nanometer HA ceramics coating on zirconia, allows combining the excellent mechanical properties of zirconia substrates with its bioactivity. This paper shows a new method for implant shape design and bioactive modification of dental implants surface. Zirconia's implant substrate was prepared by sintered method, central and lateral tunnels were drilled in the zirconia hollow porous cylindrical implants by laser processing. The HA powders and needle-like HA crystals were made by a wet precipitation and calcining method. Its surface was coated with nanometer HA ceramics which was used brush HA slurry and vacuum sintering. Mechanical testing results revealed that the attachment strength of nanometer HA ceramics coated zirconia samples is high. SEM and interface observation after inserted experiment indicated that calcium and phosphor content increased and symmetrically around coated implant-bone tissue interface. A significantly higher affinity index was demonstrated in vivo by histomorphometric evaluation in coated versus uncoated implants. SEM analysis demonstrated better bone adhesion to the material in coated implant at any situation. In addition, the hollow porous cylindrical implant coated with nanometer HA ceramics increase the interaction of bone and implant, the new bone induced into the surface of hollow porous cylindrical implant and through the most tunnels filled into central hole. The branch-like structure makes the implant and bone a body, which increased the contact area and decreased elastic ratio. Therefore, the macroscopical and microcosmic nested structure of

  6. Proliferation and osteogenic differentiation of human mesenchymal stem cells on zirconia and titanium with different surface topography.

    PubMed

    Hirano, Tomoki; Sasaki, Hodaka; Honma, Shinya; Furuya, Yoshitaka; Miura, Tadashi; Yajima, Yasutomo; Yoshinari, Masao

    2015-01-01

    The purpose of this study was to elucidate behavior of human mesenchymal stem cells (hMSCs) on yttria stabilized tetragonal zirconia polycrystals (TZP) and commercial pure titanium (CpTi) with different surface topography. Mirror-polished (MS), sandblasted with 150-μm alumina (SB150) and SB150 acid-etched (SB150E) were prepared on TZP and CpTi. Proliferation, osteogenic differentiation of hMSCs was evaluated. The scanning electron microscopy showed that micro- and nano-topographies were created on both TZP and CpTi SB150E surfaces. The proliferation ability, ALP activity, expression of Runx2 on the both SB150E specimens was significantly higher than those on the other specimens. These results suggested that creation of micro- and nano-topographies on TZP and CpTi by blast and acid-etching may offer a promising method for enhancing the proliferation and differentiation of hMSCs in clinical application.

  7. Investigation of the oxygen exchange mechanism on Pt|yttria stabilized zirconia at intermediate temperatures: Surface path versus bulk path

    PubMed Central

    Opitz, Alexander K.; Lutz, Alexander; Kubicek, Markus; Kubel, Frank; Hutter, Herbert; Fleig, Jürgen

    2011-01-01

    The oxygen exchange kinetics of platinum on yttria-stabilized zirconia (YSZ) was investigated by means of geometrically well-defined Pt microelectrodes. By variation of electrode size and temperature it was possible to separate two temperature regimes with different geometry dependencies of the polarization resistance. At higher temperatures (550–700 °C) an elementary step located close to the three phase boundary (TPB) with an activation energy of ∼1.6 eV was identified as rate limiting. At lower temperatures (300–400 °C) the rate limiting elementary step is related to the electrode area and exhibited a very low activation energy in the order of 0.2 eV. From these observations two parallel pathways for electrochemical oxygen exchange are concluded. The nature of these two elementary steps is discussed in terms of equivalent circuits. Two combinations of parallel rate limiting reaction steps are found to explain the observed geometry dependencies: (i) Diffusion through an impurity phase at the TPB in parallel to diffusion of oxygen through platinum – most likely along Pt grain boundaries – as area-related process. (ii) Co-limitation of oxygen diffusion along the Pt|YSZ interface and charge transfer at the interface with a short decay length of the corresponding transmission line (as TPB-related process) in parallel to oxygen diffusion through platinum. PMID:22210951

  8. Investigation of the oxygen exchange mechanism on Pt|yttria stabilized zirconia at intermediate temperatures: Surface path versus bulk path.

    PubMed

    Opitz, Alexander K; Lutz, Alexander; Kubicek, Markus; Kubel, Frank; Hutter, Herbert; Fleig, Jürgen

    2011-11-30

    The oxygen exchange kinetics of platinum on yttria-stabilized zirconia (YSZ) was investigated by means of geometrically well-defined Pt microelectrodes. By variation of electrode size and temperature it was possible to separate two temperature regimes with different geometry dependencies of the polarization resistance. At higher temperatures (550-700 °C) an elementary step located close to the three phase boundary (TPB) with an activation energy of ∼1.6 eV was identified as rate limiting. At lower temperatures (300-400 °C) the rate limiting elementary step is related to the electrode area and exhibited a very low activation energy in the order of 0.2 eV. From these observations two parallel pathways for electrochemical oxygen exchange are concluded.The nature of these two elementary steps is discussed in terms of equivalent circuits. Two combinations of parallel rate limiting reaction steps are found to explain the observed geometry dependencies: (i) Diffusion through an impurity phase at the TPB in parallel to diffusion of oxygen through platinum - most likely along Pt grain boundaries - as area-related process. (ii) Co-limitation of oxygen diffusion along the Pt|YSZ interface and charge transfer at the interface with a short decay length of the corresponding transmission line (as TPB-related process) in parallel to oxygen diffusion through platinum.

  9. Bacterial adhesion and biofilm formation on yttria-stabilized, tetragonal zirconia and titanium oral implant materials with low surface roughness - an in situ study.

    PubMed

    Al-Ahmad, Ali; Karygianni, Lamprini; Schulze Wartenhorst, Max; Bächle, Maria; Hellwig, Elmar; Follo, Marie; Vach, Kirstin; Han, Jung-Suk

    2016-04-19

    Bacterially-driven mucosal inflammation and the development of periimplantitis can lead to oral implant failure. In this study, initial bacterial adhesion after 2 h and biofilm formation after 1 day and 3 days were analyzed in situ on novel 3 mol% yttria-stabilized tetragonal zirconia polycrystal samples (Zr; 3Y-TZP), as well as on alumina and niobium co-doped yttria-stabilized tetragonal zirconia samples (Al-Zr; Al2O3/Y(Nb)-TZP). Pure titanium implant material (Ti) and bovine enamel slabs (BES) served as controls. The initially adherent oral bacteria were determined by DAPI-staining. Biofilm thickness, surface covering grade and content of oral streptococci within the biofilm were measured by fluorescence in situ hybridization. No significant differences between the ceramic and titanium surfaces were detectable for either initial bacterial adhesion or the oral streptococci content of the in situ biofilm. The values of oral biofilm thickness on the implant surfaces were almost doubled after three days compared to the first day of oral exposure. Nevertheless, the biofilm thickness values among the different implant surfaces and controls did not differ significantly for any time point of measurement after 1 day or 3 days of biofilm formation. Significant differences in the covering grade were only detected between day 1 and day 3 for each tested implant material group. The content of oral streptococci increased significantly in parallel with the increase of biofilm age from day 1 to day 3. In conclusion, oral implant zirconia surfaces with low surface roughness are comparable to titanium surfaces with regard to initial bacterial adhesion and biofilm formation.

  10. Enamel wear opposing polished and aged zirconia.

    PubMed

    Burgess, J O; Janyavula, S; Lawson, N C; Lucas, T J; Cakir, D

    2014-01-01

    Aging of dental zirconia roughens its surface through low temperature degradation. We hypothesized that age-related roughening of zirconia crowns may cause detrimental wear to the enamel of an opposing tooth. To test our hypothesis, we subjected artificially aged zirconia and reference specimens to simulated mastication in a wear device and measured the wear of an opposing enamel cusp. Additionally, the roughness of the pretest surfaces was measured. The zirconia specimens, artificially aged by autoclave, showed no significant increase in roughness compared to the nonaged specimens. Furthermore, no significant difference in material or opposing enamel wear between the aged and nonaged zirconia was seen. All zirconia specimens showed less material and opposing enamel wear than the enamel to enamel control or veneering porcelain specimens. Scanning electron micrographs showed relatively smooth surfaces of aged and nonaged zirconia following wear testing. The micrographs of the veneering ceramic showed sharp fractured edges and fragments of wear debris. Zirconia may be considered a wear-friendly material for restorations opposing enamel, even after simulated aging.

  11. Transformation of β-Ni(OH)2 to NiO nano-sheets via surface nanocrystalline zirconia coating: Shape and size retention

    NASA Astrophysics Data System (ADS)

    Cheng, Ming-Yao; Hwang, Bing-Joe

    2007-01-01

    Shape and size of the synthesized NiO nano-sheets were retained during transformation of sheet-like β-Ni(OH)2 to NiO at elevated temperatures via nano-sized zirconia coating on the surface of β-Ni(OH)2. The average grain size was 6.42 nm after 600 °C treatment and slightly increased to 10 nm after 1000 °C treatment, showing effective sintering retardation between NiO nano-sheets. The excellent thermal stability revealed potential application at elevated temperatures, especially for high temperature catalysts and solid-state electrochemical devices.

  12. On the interfacial fracture resistance of resin-bonded zirconia and glass-infiltrated graded zirconia

    PubMed Central

    Chai, Herzl; Kaizer, Marina; Chughtai, Asima; Tong, Hui; Tanaka, Carina; Zhang, Yu

    2015-01-01

    Objective A major limiting factor for the widespread use of zirconia in prosthetic dentistry is its poor resin-cement bonding capabilities. We show that this deficiency can be overcome by infiltrating the zirconia cementation surface with glass. Current methods for assessing the fracture resistance of resin-ceramic bonds are marred by uneven stress distribution at the interface, which may result in erroneous interfacial fracture resistance values. We have applied a wedge-loaded double-cantilever-beam testing approach to accurately measure the interfacial fracture resistance of adhesively bonded zirconia-based restorative materials. Methods The interfacial fracture energy GC was determined for adhesively bonded zirconia, graded zirconia and feldspathic ceramic bars. The bonding surfaces were subjected to sandblasting or acid etching treatments. Baseline GC was measured for bonded specimens subjected to 7 days hydration at 37 °C. Long-term GC was determined for specimens exposed to 20,000 thermal cycles between 5 and 55 °C followed by 2-month aging at 37 °C in water. The test data were interpreted with the aid of a 2D finite element fracture analysis. Results The baseline and long-term GC for graded zirconia was 2–3 and 8 times that for zirconia, respectively. More significantly, both the baseline and long-term GC of graded zirconia were similar to those for feldspathic ceramic. Significance The interfacial fracture energy of feldspathic ceramic and graded zirconia was controlled by the fracture energy of the resin cement while that of zirconia by the interface. GC for the graded zirconia was as large as for feldspathic ceramic, making it an attractive material for use in dentistry. PMID:26365987

  13. Synthesis of mesoporous zirconia using an amphoteric surfactant

    SciTech Connect

    Kim, A.Y.; Bruinsma, P.J.; Chen, Y.L.; Liu, J.

    1996-12-31

    An amphoteric surfactant, cocamidopropyl betaine, was used for the synthesis of mesoporous zirconia. The carboxylate functionality of the surfactant permitted strong bonding with soluble zirconium species, while the quaternary ammonium group ensured large headgroup area and high solubility under acidic conditions. An amphoteric co-template [betaine, or (carboxymethyl)trimethylammonium hydroxide] improved uniformity of the hexagonal mesophase. Transmission electron microscopy (TEM) of the as-synthesized zirconium sulfate mesophase indicated hexagonal mesostructure, and low-angle X-ray diffraction (XRD) showed a 41 {angstrom} primary d-spacing and two higher order reflections of a hexagonal lattice. High surface area zirconia was produced by controlled base treatment of the hexagonal mesophase with sodium hydroxide, followed by calcination. TEM and XRD indicated that the mesostructure was stable to 350 C.

  14. Synthesis and characterization of nanophase zirconia : reverse micelle method and neutron scattering study.

    SciTech Connect

    Li, X.

    1998-11-23

    Zirconia is an important transition-metal oxide for catalytic applications. It has been widely used in automotive exhaust treatment, methanol synthesis, isomerization, alkylation, etc. [1]. Nanophase materials have unique physiochemical properties such as quantum size effects, high surface area, uniform morphology, narrow size distribution, and improvement of sintering rates[2]. Microemulsion method provides the means for controlling the microenvironment under which specific chemical reactions may occur in favoring the formation of homogeneous, nanometer-size particles. In this paper, we report the synthesis of nanophase zirconia and the characterization of the microemulsions as well as the powders by small- and wide-angle neutron scattering techniques.

  15. Nanosilica coating for bonding improvements to zirconia

    PubMed Central

    Chen, Chen; Chen, Gang; Xie, Haifeng; Dai, Wenyong; Zhang, Feimin

    2013-01-01

    Resin bonding to zirconia cannot be established from standard methods that are currently utilized in conventional silica-based dental ceramics. The solution–gelatin (sol–gel) process is a well developed silica-coating technique used to modify the surface of nonsilica-based ceramics. Here, we use this technique to improve resin bonding to zirconia, which we compared to zirconia surfaces treated with alumina sandblasting and tribochemical silica coating. We used the shear bond strength test to examine the effect of the various coatings on the short-term resin bonding of zirconia. Furthermore, we employed field emission scanning electron microscopy, energy-dispersive X-ray spectroscopy, atomic force microscopy, and Fourier transform infrared spectroscopy to characterize the zirconia surfaces. Water–mist spraying was used to evaluate the durability of the coatings. To evaluate the biological safety of the experimental sol–gel silica coating, we conducted an in vitro Salmonella typhimurium reverse mutation assay (Ames mutagenicity test), cytotoxicity tests, and in vivo oral mucous membrane irritation tests. When compared to the conventional tribochemical silica coating, the experimental sol–gel silica coating provided the same shear bond strength, higher silicon contents, and better durability. Moreover, we observed no apparent mutagenicity, cytotoxicity, or irritation in this study. Therefore, the sol–gel technique represents a promising method for producing silica coatings on zirconia. PMID:24179333

  16. Air-particle abrasion on zirconia ceramic using different protocols: effects on biaxial flexural strength after cyclic loading, phase transformation and surface topography.

    PubMed

    Souza, Rodrigo O A; Valandro, Luiz F; Melo, Renata M; Machado, João P B; Bottino, Marco A; Ozcan, Mutlu

    2013-10-01

    This study evaluated the effect of different air-particle abrasion protocols on the biaxial flexural strength and structural stability of zirconia ceramics. Zirconia ceramic specimens (ISO 6872) (Lava, 3M ESPE) were obtained (N=336). The specimens (N=118, n=20 per group) were randomly assigned to one of the air-abrasion protocols: Gr1: Control (as-sintered); Gr2: 50 µm Al2O3 (2.5 bar); Gr3: 50 µm Al2O3 (3.5 bar); Gr4: 110 µm Al2O3(2.5 bar); Gr5: 110 µm Al2O3 (3.5 bar); Gr6: 30 µm SiO2 (2.5 bar) (CoJet); Gr7: 30 µm SiO2(3.5 bar); Gr8: 110 µm SiO2 (2.5 bar) (Rocatec Plus); and Gr9: 110 µm SiO2 (3.5 bar) (duration: 20 s, distance: 10 mm). While half of the specimens were tested immediately, the other half was subjected to cyclic loading in water (100,000 cycles; 50 N, 4 Hz, 37 °°C) prior to biaxial flexural strength test (ISO 6872). Phase transformation (t→m), relative amount of transformed monoclinic zirconia (FM), transformed zone depth (TZD) and surface roughness were measured. Particle type (p=0.2746), pressure (p=0.5084) and cyclic loading (p=0.1610) did not influence the flexural strength. Except for the air-abraded group with 110 µm Al2O3 at 3.5 bar, all air-abrasion protocols increased the biaxial flexural strength (MPa) (Controlnon-aged: 1,030 ± 153, Controlaged: 1,138 ± 138; Experimentalnon-aged: 1,307 ± 184-1,554 ± 124; Experimentalaged: 1,308 ± 118-1,451 ± 135) in both non-aged and aged conditions, respectively. Surface roughness (Ra) was the highest with 110 µm Al2O3(0.84 µm. FM values ranged from 0% to 27.21%, higher value for the Rocatec Plus (110 µm SiO2) and 110 µm Al2O3 groups at 3.5 bar pressure. TZD ranged between 0 and 1.43 µm, with the highest values for Rocatec Plus and 110 µm Al2O3 groups at 3.5 bar pressure.

  17. The surface area of soil organic matter

    USGS Publications Warehouse

    Chiou, C.T.; Lee, J.-F.; Boyd, S.A.

    1990-01-01

    The previously reported surface area for soil organic matter (SOM) of 560-800 m2/g as determined by the ethylene glycol (EG) retention method was reexamined by the standard BET method based on nitrogen adsorption at liquid nitrogen temperature. Test samples consisted of two high organic content soils, a freeze-dried soil humic acid, and an oven-dried soil humic acid. The measured BET areas for these samples were less than 1 m2/g, except for the freeze-dried humic acid. The results suggest that surface adsorption of nonionic organic compounds by SOM is practically insignificant in comparison to uptake by partition. The discrepancy between the surface areas of SOM obtained by BET and EG methods was explained in terms of the 'free surface area' and the 'apparent surface area' associated with these measurements.The previously reported surface area for soil organic matter (SOM) of 560-800 m2/g as determined by the ethylene glycol (EG) retention method was reexamined by the standard BET method based on nitrogen adsorption at liquid nitrogen temperature. Test samples consisted of two high organic content soils, a freeze-dried soil humic acid, and an oven-dried soil humic acid. The measured BET areas for these samples were less than 1 m2/g, except for the freeze-dried humic acid. The results suggest that surface adsorption of nonionic organic compounds by SOM is practically insignificant in comparison to uptake by partition. The discrepancy between the surface areas of SOM obtained by BET and EG methods was explained in terms of the 'free surface area' and the 'apparent surface area' associated with these measurements.

  18. Preparation of mesoporous zirconia microspheres as inert matrix

    NASA Astrophysics Data System (ADS)

    Guo, Ting; Wang, Chen; Lv, Jinlong; Liang, Tongxiang

    2016-12-01

    Mesoporous zirconia microspheres, with a diameter of 900 μm, were prepared as an inert accelerator driven system (ADS) transmutation element matrix by the sol-gel method. The purpose of mesopores is to improve the adsorption capacity of inert matrix fuel (IMF) for minor actinides. The study indicated that the mesoporous zirconia performance was improved after the microspheres were hydrothermally treated at 150 °C, the specific surface area increased from 28.29 m2/g to 61.28 m2/g, and hydrothermal treatment avoided the cracking of the microspheres. Pre-decomposition of the organics during the hydrothermal process stabilized the mesoporous structure. The average pore diameter of mesoporous microsphere was 14.3 nm.

  19. Templated electrochemical deposition of zirconia thin films on "recordable CDs.".

    PubMed

    Yu, Hua-Zhong; Rowe, Aaron W; Waugh, Damien M

    2002-11-15

    In this paper, we describe a practical method of using gold films constructed from recordable compact disks (CD-Rs) as simple, inexpensive, and micropatterned conductive substrates for the fabrication of inorganic material microstructures. Extending from their application for the fabrication of self-assembled monolayers (SAMs) reported recently, bare and SAM-modified CD-R gold substrates have been used for template-directed electrodeposition of zirconia (ZrO2) thin films (i.e., the controlled formation of zirconia thin films on the different areas of the prefabricated, micrometer mountain-valley CD-R gold substrate surfaces). The present results demonstrate that the variation of the functional groups of the selected SAMs combined with electrodynamic control can be very successful to "customize" the formation and microstructure of functional inorganic thin films, which hold promise for modern technological applications.

  20. Phase stability of zirconia at nanoscale.

    NASA Astrophysics Data System (ADS)

    Sabiryanov, Renat; Mei, W. N.

    2004-03-01

    There are three phases of ZrO2, namely cubic, tetragonal and monoclinic. Cubic phase of zirconia is usually stabilized by various dopants such as yttria and magnesia. However, it has been observed that these stablizers are indeed the source failure of doped ZrO2 in both orthopaedics and in ZrO2 used in high temperature applications. Recently, the cubic zirconia was fabricated as granular media with the grain sizes less than 17nm. We examine the phase stability in zirconia nanoparticles using first principle electronic structure method. We observe considerable relaxation of lattice in the monoclinic phase near the surface. This effect combined with surface tension and possibly vacancies in nanostructures are sources of stability of cubic zirconia at nanoscale. We performed calculation of the surface tension calculations for the pure (001) surface. The uniform compressive strain is applied in the plane of the slab to find the elastic response of the system. The slab is allowed to relax in the perpendicular direction. Uniform compressive strain in the plane of the slab causes increase in the distance between Zr and O layers for (001) surface (as a solid tends to preserve the volume). For cubic it gives -0.65N/m, while for monoclinic -0.48N/m. Furthermore, the solid-gas surface tension is a fundamental physical/chemical property of a solid, which affects its wetting properties. Therefore, cubic zirconia is more suitable to design the material combining wettability, ductility and hardness.

  1. Aluminum doped zirconia nanopowders: Wet-chemical synthesis and structural analysis by Rietveld refinement

    SciTech Connect

    Srdic, Vladimir V. Rakic, Srdan; Cvejic, Zeljka

    2008-10-02

    Alumina/zirconia nanopowders, with up to 20 mol% Al{sub 2}O{sub 3}, were prepared by wet-chemical synthesis technique, using controlled hydrolysis of alkoxides. The as-synthesized powders are amorphous, have very high specific surface area and the corresponding particle size smaller than 4 nm. Amorphous powders with 0, 10 and 20 mol% Al{sub 2}O{sub 3} crystallize at 460, 692 and 749 deg. C, respectively, as a single-phase tetragonal zirconia, without any traces of alumina phases. Rietvled refinement of X-ray diffraction data, used for the detailed structural analysis of annealed nanopowders, showed that the high-temperature zirconia phase is stabilized due to the formation of ZrO{sub 2}/Al{sub 2}O{sub 3} solid solutions. High solubility of alumina in the tetragonal zirconia (up to 28.6 at% Al{sup 3+}) and stabilization of tetragonal zirconia solid solution up to high temperature (as high as 1150 deg. C) were also confirmed.

  2. Initial bacterial adhesion on resin, titanium and zirconia in vitro

    PubMed Central

    Lee, Byung-Chul; Jung, Gil-Yong; Kim, Dae-Joon

    2011-01-01

    PURPOSE The aim of this in vitro study was to investigate the adhesion of initial colonizer, Streptococcus sanguis, on resin, titanium and zirconia under the same surface polishing condition. MATERIALS AND METHODS Specimens were prepared from Z-250, cp-Ti and 3Y-TZP and polished with 1 µm diamond paste. After coating with saliva, each specimen was incubated with Streptococcus sanguis. Scanning electron microscope, crystal violet staining and measurement of fluorescence intensity resulting from resazurin reduction were performed for quantifying the bacterial adhesion. RESULTS Surface of resin composite was significantly rougher than that of titanium and zirconia, although all tested specimens are classified as smooth. The resin specimens showed lower value of contact angle compared with titanium and zirconia specimens, and had hydrophilic surfaces. The result of scanning electron microscopy demonstrated that bound bacteria were more abundant on resin in comparison with titanium and zirconia. When total biofilm mass determined by crystal violet, absorbance value of resin was significantly higher than that of titanium or zirconia. The result of relative fluorescence intensities also demonstrated that the highest fluorescence intensity was found on the surface of resin. Absorbance value and fluorescence intensity on titanium was not significantly different from those on zirconia. CONCLUSION Resin specimens showed the roughest surface and have a significantly higher susceptibility to adhere Streptococcus sanguis than titanium and zirconia when surfaces of each specimen were polished under same condition. There was no significant difference in bacteria adhesion between titanium and zirconia in vitro. PMID:21814616

  3. Surface area coefficients for airship envelopes

    NASA Technical Reports Server (NTRS)

    Diehl, W S

    1922-01-01

    In naval architecture, it is customary to determine the wetted surface of a ship by means of some formula which involves the principal dimensions of the design and suitable constants. These formulas of naval architecture may be extended and applied to the calculation of the surface area of airship envelopes by the use of new values of the constants determined for this purpose. Surface area coefficients were calculated from the actual dimensions, surfaces, and volumes of 52 streamline bodies, which form a series covering the entire range of shapes used in the present aeronautical practice.

  4. Structural and Chemical Analysis of the Zirconia-Veneering Ceramic Interface.

    PubMed

    Inokoshi, M; Yoshihara, K; Nagaoka, N; Nakanishi, M; De Munck, J; Minakuchi, S; Vanmeensel, K; Zhang, F; Yoshida, Y; Vleugels, J; Naert, I; Van Meerbeek, B

    2016-01-01

    The interfacial interaction of veneering ceramic with zirconia is still not fully understood. This study aimed to characterize morphologically and chemically the zirconia-veneering ceramic interface. Three zirconia-veneering conditions were investigated: 1) zirconia-veneering ceramic fired on sandblasted zirconia, 2) zirconia-veneering ceramic on as-sintered zirconia, and 3) alumina-veneering ceramic (lower coefficient of thermal expansion [CTE]) on as-sintered zirconia. Polished cross-sectioned ceramic-veneered zirconia specimens were examined using field emission gun scanning electron microscopy (Feg-SEM). In addition, argon-ion thinned zirconia-veneering ceramic interface cross sections were examined using scanning transmission electron microscopy (STEM)-energy dispersive X-ray spectrometry (EDS) at high resolution. Finally, the zirconia-veneering ceramic interface was quantitatively analyzed for tetragonal-to-monoclinic phase transformation and residual stress using micro-Raman spectroscopy (µRaman). Feg-SEM revealed tight interfaces for all 3 veneering conditions. High-resolution transmission electron microscopy (HRTEM) disclosed an approximately 1.0-µm transformed zone at sandblasted zirconia, in which distinct zirconia grains were no longer observable. Straight grain boundaries and angular grain corners were detected up to the interface of zirconia- and alumina-veneering ceramic with as-sintered zirconia. EDS mapping disclosed within the zirconia-veneering ceramic a few nanometers thick calcium/aluminum-rich layer, touching the as-sintered zirconia base, with an equally thick silicon-rich/aluminum-poor layer on top. µRaman revealed t-ZrO2-to-m-ZrO2 phase transformation and residual compressive stress at the sandblasted zirconia surface. The difference in CTE between zirconia- and the alumina-veneering ceramic resulted in residual tensile stress within the zirconia immediately adjacent to its interface with the veneering ceramic. The rather minor chemical

  5. Multilayered thermal insulation formed of zirconia bonded layers of zirconia fibers and metal oxide fibers and method for making same

    DOEpatents

    Wrenn, Jr., George E.; Holcombe, Jr., Cressie E.

    1988-01-01

    A multilayered thermal insulating composite is formed of a first layer of zirconia-bonded zirconia fibers for utilization near the hot phase or surface of a furnace or the like. A second layer of zirconia-bonded metal oxide fibers is attached to the zirconia fiber layer by a transition layer formed of intermingled zirconia fibers and metal oxide fibers. The thermal insulation is fabricated by vacuum molding with the layers being sequentially applied from aqueous solutions containing the fibers to a configured mandrel. A portion of the solution containing the fibers forming the first layer is intermixed with the solution containing the fibers of the second layer for forming the layer of mixed fibers. The two layers of fibers joined together by the transition layer are saturated with a solution of zirconium oxynitrate which provides a zirconia matrix for the composite when the fibers are sintered together at their nexi.

  6. Multilayered thermal insulation formed of zirconia bonded layers of zirconia fibers and metal oxide fibers and method for making same

    DOEpatents

    Wrenn, G.E. Jr.; Holcombe, C.E. Jr.

    1988-09-13

    A multilayered thermal insulating composite is formed of a first layer of zirconia-bonded zirconia fibers for utilization near the hot phase or surface of a furnace or the like. A second layer of zirconia-bonded metal oxide fibers is attached to the zirconia fiber layer by a transition layer formed of intermingled zirconia fibers and metal oxide fibers. The thermal insulation is fabricated by vacuum molding with the layers being sequentially applied from aqueous solutions containing the fibers to a configured mandrel. A portion of the solution containing the fibers forming the first layer is intermixed with the solution containing the fibers of the second layer for forming the layer of mixed fibers. The two layers of fibers joined together by the transition layer are saturated with a solution of zirconium oxynitrate which provides a zirconia matrix for the composite when the fibers are sintered together at their nexi.

  7. Zirconia in dental implantology: A review

    PubMed Central

    Apratim, Abhishek; Eachempati, Prashanti; Krishnappa Salian, Kiran Kumar; Singh, Vijendra; Chhabra, Saurabh; Shah, Sanket

    2015-01-01

    Background: Titanium has been the most popular material of choice for dental implantology over the past few decades. Its properties have been found to be most suitable for the success of implant treatment. But recently, zirconia is slowly emerging as one of the materials which might replace the gold standard of dental implant, i.e., titanium. Materials and Methods: Literature was searched to retrieve information about zirconia dental implant and studies were critically analyzed. PubMed database was searched for information about zirconia dental implant regarding mechanical properties, osseointegration, surface roughness, biocompatibility, and soft tissue health around it. The literature search was limited to English language articles published from 1975 to 2015. Results: A total of 45 papers met the inclusion criteria for this review, among the relevant search in the database. Conclusion: Literature search showed that some of the properties of zirconia seem to be suitable for making it an ideal dental implant, such as biocompatibility, osseointegration, favourable soft tissue response and aesthetics due to light transmission and its color. At the same time, some studies also point out its drawbacks. It was also found that most of the studies on zirconia dental implants are short-term studies and there is a need for more long-term clinical trials to prove that zirconia is worth enough to replace titanium as a biomaterial in dental implantology. PMID:26236672

  8. Fabrication of zirconia composite membrane by in-situ hydrothermal technique and its application in separation of methyl orange.

    PubMed

    Kumar, R Vinoth; Ghoshal, Aloke Kumar; Pugazhenthi, G

    2015-11-01

    The main objective of the work was preparation of zirconia membrane on a low cost ceramic support through an in-situ hydrothermal crystallization technique for the separation of methyl orange dye. To formulate the zirconia film on the ceramic support, hydrothermal reaction mixture was prepared using zirconium oxychloride as a zirconia source and ammonia as a precursor. The synthesized zirconia powder was characterized by X-ray diffractometer (XRD), N2 adsorption/desorption isotherms, Thermogravimetric analysis (TGA), Fourier transform infrared analysis (FTIR), Energy-dispersive X-ray (EDX) analysis and particle size distribution (PSD) to identify the phases and crystallinity, specific surface area, pore volume and pore size distribution, thermal behavior, chemical composition and size of the particles. The porosity, morphological structure and pure water permeability of the prepared zirconia membrane, as well as ceramic support were investigated using the Archimedes' method, Field emission scanning electron microscopy (FESEM) and permeability. The specific surface area, pore volume, pore size distribution of the zirconia powder was found to be 126.58m(2)/g, 3.54nm and 0.3-10µm, respectively. The porosity, average pore size and pure water permeability of the zirconia membrane was estimated to be 42%, 0.66µm and 1.44×10(-6)m(3)/m(2)skPa, respectively. Lastly, the potential of the membrane was investigated with separation of methyl orange by means of flux and rejection as a function of operating pressure and feed concentration. The rejection was found to decrease with increasing the operating pressure and increases with increasing feed concentrations. Moreover, it showed a high ability to reject methyl orange from aqueous solution with a rejection of 61% and a high permeation flux of 2.28×10(-5)m(3)/m(2)s at operating pressure of 68kPa.

  9. Damage maps of veneered zirconia under simulated mastication.

    PubMed

    Kim, J-W; Kim, J-H; Janal, M N; Zhang, Y

    2008-12-01

    Zirconia-based restorations often fracture from chipping and/or delamination of the porcelain veneers. We hypothesized that veneer chipping/delamination is a result of the propagation of near-contact-induced partial cone cracks on the occlusal surface under mastication. Masticatory loading involves the opposing tooth sliding along the cuspal inner incline surface with an applied biting force. To test this hypothesis, we cemented flat porcelain-veneered zirconia plates onto dental composites and cyclically loaded them (contact-slide-liftoff) at an inclination angle as a simplified model of zirconia-based restorations under occlusion. In light of in situ observation of damage evolution in a transparent glass/zirconia/polycarbonate trilayer, post mortem damage evaluation of porcelain/zirconia/composite trilayers by a sectioning technique revealed that deep-penetrating occlusal surface partial cone fracture is the predominant fracture mode of porcelain veneers. Clinical relevance is discussed.

  10. Damage Maps of Veneered Zirconia under Simulated Mastication

    PubMed Central

    Kim, Jae-Won; Kim, Joo-Hyung; Janal, Malvin N.; Zhang, Yu

    2016-01-01

    Zirconia based restorations often fracture from chipping and/or delamination of the porcelain veneers. We hypothesize that veneer chipping/delamination is a result of the propagation of near-contact induced partial cone cracks on the occlusal surface under mastication. Masticatory loading involves the opposing tooth sliding along the cuspal inner incline surface with an applied biting force. To test this hypothesis, flat porcelain veneered zirconia plates were cemented to dental composites and cyclically loaded (contact–slide–liftoff) at an inclination angle as a simplified model of zirconia based restorations under occlusion. In the light of in-situ observation of damage evolution in a transparent glass/zirconia/polycarbonate trilayer, postmortem damage evaluation of porcelain/zirconia/composite trilayers using a sectioning technique revealed that deep penetrating occlusal surface partial cone fracture is the predominant fracture mode of porcelain veneers. Clinical relevance is discussed. PMID:19029080

  11. Fabrication and characterization of dense zirconia and zirconia-silica ceramic nanofibers.

    PubMed

    Xu, Xiaoming; Guo, Guangqing; Fan, Yuwei

    2010-09-01

    The objective of this study was to prepare dense zirconia-yttria (ZY), zirconia-silica (ZS) and zirconia-yttria-silica (ZYS) nanofibers as reinforcing elements for dental composites. Zirconium (IV) propoxide, yttrium nitrate hexahydrate, and tetraethyl orthosilicate (TEOS) were used as precursors for the preparation of zirconia, yttria, and silica sols. A small amount (1-1.5 wt%) of polyethylene oxide (PEO) was used as a carry polymer. The sols were preheated at 70 degrees C before electrospinning and their viscosity was measured with a viscometer at different heating time. The gel point was determined by viscosity-time (eta-t) curve. The ZY, ZS and ZYS gel nanofibers were prepared using a special reactive electrospinning device under the conditions near the gel point. The as-prepared gel nanofibers had diameters between 200 and 400 nm. Dense (nonporous) ceramic nanofibers of zirconia-yttria (96/4), zirconia-silica (80/20) and zirconia-yttria-silica (76.8/3.2/20) with diameter of 100-300 nm were obtained by subsequent calcinations at different temperatures. The gel and ceramic nanofibers obtained were characterized by scanning electron microscope (SEM), high-resolution field-emission scanning electron microscope (FE-SEM), thermogravimetric analyzer (TGA), differential scanning calorimeter (DSC), Fourier transform infrared spectrometer (FT-IR), and X-ray diffraction (XRD). SEM micrograph revealed that ceramic ZY nanofibers had grained structure, while ceramic ZS and ZYS nanofibers had smooth surfaces, both showing no visible porosity under FE-SEM. Complete removal of the polymer PEO was confirmed by TGA/DSC and FT-IR. The formation of tetragonal phase of zirconia and amorphous silica was proved by XRD. In conclusion, dense zirconia-based ceramic nanofibers can be fabricated using the new reactive sol-gel electrospinning technology with minimum organic polymer additives.

  12. Surface moisture estimation in urban areas

    NASA Astrophysics Data System (ADS)

    Jiang, Yitong

    Surface moisture is an important parameter because it modifies urban microclimate and surface layer meteorology. The primary objectives of this paper are: 1) to analyze the impact of surface roughness from buildings on surface moisture in urban areas; and 2) to quantify the impact of surface roughness resulting from urban trees on surface moisture. To achieve the objectives, two hypotheses were tested: 1) the distribution of surface moisture is associated with the structural complexity of buildings in urban areas; and 2) The distribution and change of surface moisture is associated with the distribution and vigor of urban trees. The study area is Indianapolis, Indiana, USA. In the part of the morphology of urban trees, Warren Township was selected due to the limitation of tree inventory data. To test the hypotheses, the research design was made to extract the aerodynamic parameters, such as frontal areas, roughness length and displacement height of buildings and trees from Terrestrial and Airborne LiDAR data, then to input the aerodynamic parameters into the urban surface energy balance model. The methodology was developed for comparing the impact of aerodynamic parameters from LiDAR data with the parameters that were derived empirically from land use and land cover data. The analytical procedures are discussed below: 1) to capture the spatial and temporal variation of surface moisture, daily and hourly Land Surface Temperature (LST) were downscaled from 4 km to 1 km, and 960 m to 30 m, respectively, by regression between LST and various components that impact LST; 2) to estimate surface moisture, namely soil moisture and evapotranspiration (ET), land surfaces were classified into soil, vegetation, and impervious surfaces, using Linear Spectral Mixture Analysis (LSMA); 3) aerodynamic parameters of buildings and trees were extracted from Airborne and Terrestrial LiDAR data; 4) the Temperature-Vegetation-Index (TVX) method, and the Two-Source-Energy-Balance (TSEB

  13. Synthesis and atomic level in situ redox characterization in ceria and ceria zirconia

    NASA Astrophysics Data System (ADS)

    Wang, Ruigang

    2007-12-01

    Nanocrystalline ceria-based oxides are widely used in automotive three-way catalytic converters to reduce the emissions of carbon monoxide, nitrogen oxides, and unburned hydrocarbons. The primary function of ceria-based oxides in the catalytic process is to adjust the local oxygen partial pressure and maintain an air-to-fuel ratio near the stoichiometric value (˜14.5) required for the optimal catalyst performance for carbon monoxide, hydrocarbon oxidation, and nitrogen oxides reduction. In this dissertation, a study of the relationship between the nanoscale structure, chemistry, and the redox behavior on high surface area ceria and ceria zirconia is presented. Precipitation and spray freezing methods were used to synthesize nanocrystalline ceria and ceria zirconia solid solution powders respectively. The effect of thermal treatments in oxidizing and reducing atmospheres on the reducibility of the materials has been systematically investigated. X-ray diffraction and thermogravimetric analysis were used to characterize the average structure and reducibility. In situ environmental transmission electron microscope was exploited to visualize the dynamic changes during redox processes at the atomic level. This resulted in the identification of the nanoscale structure and chemistry for the most active nanoparticles in these oxides. The correlation between ex situ macroscopic redox properties and in situ redox behavior of individual nanoparticles is demonstrated. The addition of zirconia to ceria clearly enhances the reducibility and thermal stability of ceria. A fundamental difference between ceria and ceria zirconia during in situ redox processes is related to oxygen vacancy ordering. Ceria showed oxygen vacancy ordering during reduction, whereas ceria zirconia did not. It is suggested that the absence of oxygen vacancy ordering might be a fundamental factor for improved redox properties of ceria zirconia compared with pure ceria. The 50% ceria-50% zirconia solid

  14. Ionic Conductivity of Mesostructured Yttria-Stabilized Zirconia Thin Films with Cubic Pore Symmetry—On the Influence of Water on the Surface Oxygen Ion Transport.

    PubMed

    Elm, Matthias T; Hofmann, Jonas D; Suchomski, Christian; Janek, Jürgen; Brezesinski, Torsten

    2015-06-10

    Thermally stable, ordered mesoporous thin films of 8 mol % yttria-stabilized zirconia (YSZ) were prepared by solution-phase coassembly of chloride salt precursors with an amphiphilic diblock copolymer using an evaporation-induced self-assembly process. The resulting material is of high quality and exhibits a well-defined three-dimensional network of pores averaging 24 nm in diameter after annealing at 600 °C for several hours. The wall structure is polycrystalline, with grains in the size range of 7 to 10 nm. Using impedance spectroscopy, the total electrical conductivity was measured between 200 and 500 °C under ambient atmosphere as well as in dry atmosphere for oxygen partial pressures ranging from 1 to 10(-4) bar. Similar to bulk YSZ, a constant ionic conductivity is observed over the whole oxygen partial pressure range investigated. In dry atmosphere, the sol-gel derived films have a much higher conductivity, with different activation energies for low and high temperatures. Overall, the results indicate a strong influence of the surface on the transport properties in cubic fluorite-type YSZ with high surface-to-volume ratio. A qualitative defect model which includes surface effects (annihilation of oxygen vacancies as a result of water adsorption) is proposed to explain the behavior and sensitivity of the conductivity to variations in the surrounding atmosphere.

  15. Enhanced Biological Behavior of In Vitro Human Gingival Fibroblasts on Cold Plasma-Treated Zirconia

    PubMed Central

    Zheng, Miao; Yang, Yang; Liu, Xiao-Qiang; Liu, Ming-Yue; Zhang, Xiao-Fei; Wang, Xin; Li, He-Ping; Tan, Jian-Guo

    2015-01-01

    Objective To evaluate whether atmospheric-pressure dielectric-barrier-discharge plasma treatment of zirconia enhances its biocompatibility with human gingival fibroblasts. Materials and Methods The zirconia disks were divided into four groups and treated using helium atmospheric-pressure dielectric-barrier-discharge plasmas for 30, 60 or 90 s or left untreated. The surface morphology, wettability and chemical elements were analyzed. Fibroblasts density, morphology, morphometry and attachment-related genes expression were measured at different time points from 3 to 72 h. Results After plasma treatment, the surface morphology and roughness remained the same, while the contact angle decreased from 78.31° to 43.71°, and the surface C/O ratio decreased from 3.17 to 0.89. The surficial areas and perimeters of HGFs were increased two-fold in the treated groups at 3 h. Fibroblasts density increased on treated disks at all time points, especially the ones treated for 60 s. Attachment-related genes in the groups treated for 30 and 60 s were significantly higher at 3 and 24 h. Conclusion The helium atmospheric-pressure dielectric-barrier-discharge plasma treatment enhances the biological behavior of fibroblasts on zirconia by increasing the expression of attachment-related genes within 24 h and promoting the cell density during longer culture times. Wettability of zirconia, an important physicochemical property, has a vital influence on the cell behaviors. PMID:26461253

  16. Physicochemical properties, cytotoxicity, and antimicrobial activity of sulphated zirconia nanoparticles

    PubMed Central

    Mftah, Ae; Alhassan, Fatah H; Al-Qubaisi, Mothanna Sadiq; El Zowalaty, Mohamed Ezzat; Webster, Thomas J; Sh-eldin, Mohammed; Rasedee, Abdullah; Taufiq-Yap, Yun Hin; Rashid, Shah Samiur

    2015-01-01

    Nanoparticle sulphated zirconia with Brønsted acidic sites were prepared here by an impregnation reaction followed by calcination at 600°C for 3 hours. The characterization was completed using X-ray diffraction, thermal gravimetric analysis, Fourier transform infrared spectroscopy, Brunner-Emmett-Teller surface area measurements, scanning electron microscopy with energy dispersive X-ray spectroscopy, and transmission electron microscopy. Moreover, the anticancer and antimicrobial effects were investigated for the first time. This study showed for the first time that the exposure of cancer cells to sulphated zirconia nanoparticles (3.9–1,000 μg/mL for 24 hours) resulted in a dose-dependent inhibition of cell growth, as determined by (4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assays. Similar promising results were observed for reducing bacteria functions. In this manner, this study demonstrated that sulphated zirconia nanoparticles with Brønsted acidic sites should be further studied for a wide range of anticancer and antibacterial applications. PMID:25632233

  17. Contact damage in an yttria stabilized zirconia: implications.

    PubMed

    Zhou, J; Mah, J; Shrotriya, P; Mercer, C; Soboyejo, W O

    2007-01-01

    This paper presents the results of a combined experimental and computational study of contact damage in a 3 mole% yttria partially stabilized zirconia (3-YSZ) that is relevant to hip implants and dental restorations. Contact-induced loading in real applications is idealized using Hertzian contact model to explain plasticity phenomena and failure mechanisms observed under monotonic and cyclic loading. Under monotonic loading, the elastic moduli increase with increasing loading levels. Under cyclic loading, the ceramic specimens fail with progressive cone cracking. X-ray analyses reveal that stress-induced phase transformation (from tetragonal to monoclinic phases) occurs under cyclic contact loading above the critical load levels (approximately 8.5 kN). Furthermore, when the cyclic loading level (5.0 kN) is less than a critical load levels (7.5 kN) that is required to induce surface cone cracks, significant plastic damage is observed in the subsurface zone underneath the contact area. These suggest that the cyclic contact loading induce both plastic damage and tetragonalto-monoclinic phase transformation in the 3-YSZ, leading to significant degradation in long-term strength. The implications of the results are discussed for the design of zirconia femoral heads in total hip replacements and zirconia crowns in dental restoration.

  18. Comparative evaluation of shear bond strengths of veneering porcelain to base metal alloy and zirconia substructures before and after aging – An in vitro study

    PubMed Central

    Sreekala, Laju; Narayanan, Mahesh; Eerali, Sunil M.; Eerali, Susil M.; Varghese, Joju; Zainaba Fathima, A. l.

    2015-01-01

    Objective: The aim of this study was to evaluate and compare the shear bond strength of veneering porcelain to base metal alloy and zirconia substructures before and after aging. Scanning electron microscopy (SEM) was used to determine the failure pattern. Materials and Methods: Twenty rectangular blocks (9 mm length × 4 mm height × 4 mm width) of base metal alloy (Bellabond plus, Bego, Germany) and zirconia (Will ceramZ zirconia K block) were fabricated for shear bond strength test. Surface of the base metal alloy block (4 mm × 4 mm area) was veneered with corresponding veneering porcelain (Ivoclar, IPS classic, vivadent). Similarly, surface of the zirconia rectangular block (4 mm × 4 mm) was veneered with corresponding veneering ceramic (Cercon ceram kiss, Degudent). Out of forty rectangular porcelain veneered core specimen, ten porcelain veneered base metal alloy specimen and ten porcelain veneered zirconia specimen were immersed in water at 37°C for one month to simulate the oral environment. Results: On comparison, the highest shear bond strength value was obtained in porcelain veneered base metal alloy before aging group followed by porcelain veneered base metal alloy after aging group, Porcelain veneered zirconia before aging group, porcelain veneered zirconia after aging group. SEM analysis revealed predominantly cohesive failure of veneering ceramic in all groups. Conclusion: Porcelain veneered base metal alloy samples showed highest shear bond strength than porcelain veneered zirconia samples. Study concluded that aging had an influence on shear bond strength. Shear bond strength was found to be decreasing after aging. SEM analysis revealed cohesive failure of veneering ceramic in all groups suggestive of higher bond strength of the interface than cohesive strength of ceramic. Hence, it was concluded that veneering ceramic was the weakest link. PMID:26942121

  19. Volumes and surface areas of pendular rings

    USGS Publications Warehouse

    Rose, W.

    1958-01-01

    A packing of spheres is taken as a suitable model of porous media. The packing may be regular and the sphere size may be uniform, but in general, both should be random. Approximations are developed to give the volumes and surface areas of pendular rings that exist at points of sphere contact. From these, the total free volume and interfacial specific surface area are derived as expressive of the textural character of the packing. It was found that the log-log plot of volumes and surface areas of pendular rings vary linearly with the angle made by the line joining the sphere centers and the line from the center of the largest sphere to the closest edge of the pendular ring. The relationship, moreover, was found not to be very sensitive to variation in the size ratio of the spheres in contact. It also was found that the addition of pendular ring material to various sphere packings results in an unexpected decrease in the surface area of the boundaries that confine the resulting pore space. ?? 1958 The American Institute of Physics.

  20. Osmosis and Surface Area to Volume Ratio.

    ERIC Educational Resources Information Center

    Barrett, D. R. B.

    1984-01-01

    Describes an experiment designed to help students understand the concepts of osmosis and surface area to volume ratio (SA:VOL). The task for students is to compare water uptake in different sizes of potato cubes and relate differences to their SA:VOL ratios. (JN)

  1. Homogeneous precipitation synthesis and electrical properties of scandia stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Xu, Gang; Zhang, Yawen; Liao, Chunsheng; Yan, Chunhua

    2001-12-01

    Homogeneous precipitation employing urea was utilized to prepare ultrafine and weakly-agglomerated 8 mol% scandia-stabilized zirconia (8ScSZ) powders. Their crystal structure, particle and electrical properties were investigated by scanning electron microscopy, high resolution transmission electron microscopy, X-ray diffraction, thermo-gravimetry and differential thermal analysis, BET surface area analysis, and impedance spectroscopy, respectively. 8ScSZ polycrystals in a pure cubic phase were obtained after sintering at a low temperature of 600 °C. Elevating sintering temperature can increase the oxide ion conductivity, especially the grain boundary conductivity.

  2. Hydrothermal synthesis and characterization of zirconia based catalysts

    SciTech Connect

    Caillot, T. Salama, Z.; Chanut, N.; Cadete Santos Aires, F.J.; Bennici, S.; Auroux, A.

    2013-07-15

    In this work, three equimolar mixed oxides ZrO{sub 2}/CeO{sub 2}, ZrO{sub 2}/TiO{sub 2}, ZrO{sub 2}/La{sub 2}O{sub 3} and a reference ZrO{sub 2} have been synthesized by hydrothermal method. The structural and surface properties of these materials have been fully characterized by X-ray diffraction, transmission electron microscopy, surface area measurement, chemical analysis, XPS, infrared spectroscopy after adsorption of pyridine and adsorption microcalorimetry of NH{sub 3} and SO{sub 2} probe molecules. All investigated mixed oxides are amphoteric and possess redox centers on their surface. Moreover, hydrothermal synthesis leads to catalysts with higher surface area and with better acid–base properties than classical coprecipitation method. Both Lewis and Brønsted acid sites are present on the surface of the mixed oxides. Compared to the other samples, the ZrO{sub 2}/TiO{sub 2} material appears to be the best candidate for further application in acid–base catalysis. - Graphical abstract: Mesoporous amorphous phase with a high surface area of titania zirconia mixed oxide obtained by hydrothermal preparation. - Highlights: • Three zirconia based catalysts and a reference were prepared by hydrothermal synthesis. • Mixed oxides present larger surface areas than the reference ZrO{sub 2}. • ZrO{sub 2}/TiO{sub 2} catalyst presents a mesoporous structure with high surface area. • ZrO{sub 2}/TiO{sub 2} catalyst presents simultaneously strong acidic and basic properties.

  3. Double aberration-corrected TEM/STEM of tungstated zirconia nanocatalysts for the synthesis of paracetamol

    NASA Astrophysics Data System (ADS)

    Yoshida, K.; Shiju, N. R.; Brown, D. R.; Boyes, E. D.; Gai, P. L.

    2010-07-01

    We report highly active tungstated zirconia nanocatalysts for the synthesis of paracetamol by Beckmann rearrangement of 4-hydroxyacetophenone oxime. Double aberration-corrected (2AC)-TEM/STEM studies were performed in a JEOL 2200FS FEG TEM/STEM at the 1 Angstrom (1 Å = 0.1 nanometer) level. Observations at close to zero defocus were carried out using the AC-TEM as well as AC-STEM including high angle annular dark field (HAADF) imaging, from the same areas of the catalyst crystallites. The studies from the same areas have revealed the location and the nanostructure of the polytungstate species (clusters) and the nanograins of zirconia. The AC (S)TEM was crucial to observe the nanostructure and location of polytungstate clusters on the zirconia grains. Polytungstate clusters as small as 0.5 nm have been identified using the HAADF-STEM. The nanostructures of the catalyst and the W surface density have been correlated with paracetamol reaction studies. The results demonstrate the nature of active sites and high activity of the tungstated zirconia nanocatalyst, which is an environmentally clean alternative to the current homogeneous process.

  4. Nonhydrolytic sol-gel approach to facile creation of surface-bonded zirconia organic-inorganic hybrid coatings for sample preparation. Ι. Capillary microextraction of catecholamine neurotransmitters.

    PubMed

    Alhendal, Abdullah; Mengis, Stephanie; Matthews, Jacob; Malik, Abdul

    2016-10-14

    Nonhydrolytic sol-gel (NHSG) route was used for the creation of novel zirconia-polypropylene oxide (ZrO2-PPO) sol-gel hybrid sorbents in the form of surface coatings for the extraction and preconcentration of catecholamine neurotransmitters and molecules structurally related to their deaminated metabolites. In comparison to other sorbents made of inorganic transition metal oxides, the presented hybrid organic-inorganic sorbents facilitated reversible sorption properties that allowed for efficient desorption of the extracted analytes by LC-MS compatible mobile phases. The presented sol-gel hybrid sorbents effectively overcame the major drawbacks of traditional silica- or polymer-based sorbents by providing superior pH stability (pH range: 0-14), and a variety of intermolecular interactions. Nonaqueous sol-gel treatment of PPO with ZrCl4 was employed for the derivatization of the terminal hydroxyl groups on PPO, providing zirconium trichloride-containing end groups characterized by enhanced sol-gel reactivity. NHSG ZrO2-PPO sorbent provided excellent microextraction performance for catecholamines, low detection limits (5.6-9.6pM), high run-to-run reproducibility (RSD 0.6-5.1%), high desorption efficiency (95.0-99.5%) and high enrichment factors (∼1480-2650) for dopamine and epinephrine, respectively, extracted from synthetic urine samples. The presented sol-gel sorbents provided effective alternative to conventional extraction media providing unique physicochemical characteristics and excellent extraction capability.

  5. The effect of zirconia thickness on the biaxial flexural strength of zirconiaceramic bilayered discs.

    PubMed

    Sinmazisik, Gulden; Tarcin, Bilge; Demirbas, Bulent; Gulmez, Turgut; Bor, Emire; Ozer, Fusun

    2015-01-01

    The aim of this study was to assess the effect of zirconia core thickness on the biaxial flexural strength values of zirconia-porcelain bilayered discs. A total of 60 discs with 0.3, 0.4, and 0.5 mm thickness were obtained from a fully sintered zirconia block. A 1.5-mm thick layer of veneer porcelain was fired on the zirconia specimens and biaxial flexural strength tests were performed on the bilayered discs. In each group, the loading surface was the veneer porcelain in half of the specimens (core in tension) and the zirconia core surface in the other half (core in compression). The zirconia core thickness had no effect on the biaxial flexural strength of zirconiaporcelain bilayered discs when the core was in tension (p>0.05). Whereas, when the core was in compression, an increase in the zirconia core thickness resulted in an increase in the biaxial flexural strength (p<0.05).

  6. Direct silanization of zirconia for increased biointegration.

    PubMed

    Caravaca, Carlos; Shi, Liu; Balvay, Sandra; Rivory, Pascaline; Laurenceau, Emmanuelle; Chevolot, Yann; Hartmann, Daniel; Gremillard, Laurent; Chevalier, Jérôme

    2016-12-01

    High-performance bioinert ceramics such as zirconia have been used for biomedical devices since the early seventies. In order to promote osseointegration, the historical solution has been to increase the specific surface of the implant through roughness. Nevertheless these treatments on ceramics may create defects at the surface, exposing the material to higher chances of early failure. In zirconia, such treatments may also affect the stability of the surface. More recently, the interest of improving osseointegration of implants has moved the research focus towards the actual chemistry of the surface. Inspired by this, we have adapted the current knowledge and techniques of silica functionalization and applied it to successfully introduce 3-aminopropyldimethylethoxy silane (APDMES) directly on the surface of zirconia (3Y-TZP). We used plasma of oxygen to clean the surface and promote hydroxylation of the surface to increase silane density. The samples were extensively characterized by means of X-ray photoelectron spectroscopy (XPS) and contact angle, mechanically tested and its cytotoxicity was evaluated through cell adhesion and proliferation tests. Additionally, aging was studied to discard negative effects of the treatment on the stability of the tetragonal phase. No adverse effect was found on the mechanical response of treated samples. In addition, plasma-treated samples exhibited an unexpectedly higher resistance to aging. Finally, silane density was 35% lower than the one reported in literature for silica. However cells displayed a qualitatively higher spreading in opposition to the rounder appearance of cells on untreated zirconia. These results lay the foundations for the next generation of zirconia implants with biologically friendlier surfaces.

  7. Human body surface area: a theoretical approach.

    PubMed

    Wang, Jianfeng; Hihara, Eiji

    2004-04-01

    Knowledge of the human body surface area has important applications in medical practice, garment design, and other engineering sizing. Therefore, it is not surprising that several expressions correlating body surface area with direct measurements of body mass and length have been reported in the literature. In the present study, based on the assumption that the exterior shape of the human body is the result of convex and concave deformations from a basic cylinder, we derive a theoretical equation minimizing body surface area (BSA) at a fixed volume (V): BSA=(9pi VL)(0.5), where L is the reference length of the body. Assuming a body density value of 1,000 kg.m(-3), the equation becomes BSA=(BM.BH/35.37)(0.5), where BSA is in square meters, BM is the body mass in kilograms, and BH is the body height in meters. BSA values calculated by means of this equation fall within +/-7% of the values obtained by means of the equations available in the literature, in the range of BSA from children to adults. It is also suggested that the above equation, which is obtained by minimizing the outer body surface at a fixed volume, implies a fundamental relation set by the geometrical constraints governing the growth and the development of the human body.

  8. Zirconia solubility in boroaluminosilicate glass

    SciTech Connect

    Raman, S.V.; Bopp, R.; Batcheller, T.A.; Yan, Q.

    1995-12-31

    In the Idaho Chemical Processing Plant (ICPP) waste streams, zirconia is often the waste load limiting species. It modifies the glass network, enhances durability, increases viscosity and induces crystallization. The limits of its dissolution in boroaluminosilicate glass, with magnesia and soda additions were experimentally determined. A ternary compositional surface is evolved to present the isothermal regimes of liquid, liquid + zircon, liquid + forsterite, and liquid phase sintered ceramic. The potential of partitioning the transuranics, transition elements and solutes in these regimes is discussed. The visible Raman spectroscopic results are presented to elucidate the dependence among glass composition, structure and chemical durability.

  9. Mesoporous ZrO2 fibers with enhanced surface area and the application as recyclable absorbent

    NASA Astrophysics Data System (ADS)

    Yu, Zhichao; Liu, Benxue; Zhou, Haifeng; Feng, Cong; Wang, Xinqiang; Yuan, Kangkang; Gan, Xinzhu; Zhu, Luyi; Zhang, Guanghui; Xu, Dong

    2017-03-01

    Highly crystalline mesoporous zirconia fibers with high surface area have been prepared by the use of electrospinning combined with precursors method. The obtained precursor fibers were treated in water steam and directly in air at different temperature respectively. Compared with the direct calcination in air, the water steam cannot only promote the crystallization of ZrO2 but also effectively remove off the organics and prevent the pore structure collapse. Moreover, through adding hydrochloric acid to modify the solution pH value, the obtained t-ZrO2 fibers treated in water steam at 300 °C have high surface area and large pore volume of 232.70 m2 g-1 and 0.36 cm3 g-1. The formation mechanism of the mesostucture was studied and the schematic was represented. Compared with the previous reports of mesoporous ZrO2 fibers, the as-synthesized materials exhibited the high crystallinity, large surface area and the long-range order mesostructure.The adsorption of Congo red indicates that the samples have a high adsorption capacity of 103.46 mg g-1 and long-periodic repeated availability.

  10. Zirconia: cementation of prosthetic restorations. Literature review

    PubMed Central

    GARGARI, M.; GLORIA, F.; NAPOLI, E.; PUJIA, A.M.

    2011-01-01

    SUMMARY Aim of the work Aim of the work was to execute a review of the international literature about the cementation of zirconia restorations, analyzing the properties of the cements most commonly used in clinical activities. Materials and methods It was performed, through PubMed, a bibliographic search on the international literature of the last 10 years using the following limits: studies in English, in vitro studies, randomized clinical trial, reviews, meta-analysis, guide-lines. Were excluded from the search: descriptive studies, case reports, discussion articles, opinion’s leader. Results From studies results that common surface treatments (silanization, acid etching) are ineffective on zirconia because it has an inert surface without glassy component (on which this surface treatments act primarily), instead the sandblasting at 1atm with aluminium oxide (Al2O3) results significantly effective for the resulting roughening that increase the surface energy and the wettability of the material. Furthermore it has been shown that zinc phosphate-based cements, Bis-GMA-based and glass-ionomer cements can’t guarantee a stable long-term adhesion, instead resin cements containing phosphate monomer 10-methacryloyloxyidecyl-dihyidrogenphosphate (MDP) have shown higher adhesion and stability values than the other cements. In particular, it has seen that bond strength of zirconia copings on dentin, using MDP-based cement, is about 6,9MPa; this value is comparable to that obtained with gold copings cementation. Conclusions Analyzed studies have led to the following conclusions: sandblasting with aluminium oxide (Al2O3) is the best surface treatment to improve adhesion between resin cements and zirconia; resin cements containing phosphate ester monomers 10-methacryloyloxyidecyl-dihyidrogenphosphate (MDP) have shown in the studies an higher bond strength and stability after ageing treatment; the best procedure for cementing zirconia restorations results the combination of

  11. Clinical assessment of enamel wear caused by monolithic zirconia crowns.

    PubMed

    Stober, T; Bermejo, J L; Schwindling, F S; Schmitter, M

    2016-08-01

    The purpose of this study was to measure enamel wear caused by antagonistic monolithic zirconia crowns and to compare this with enamel wear caused by contralateral natural antagonists. Twenty monolithic zirconia full molar crowns were placed in 20 patients. Patients with high activity of the masseter muscle at night (bruxism) were excluded. For analysis of wear, vinylpolysiloxane impressions were prepared after crown incorporation and at 6-, 12-, and 24-month follow-up. Wear of the occlusal contact areas of the crowns, of their natural antagonists, and of two contralateral natural antagonists (control teeth) was measured by use of plaster replicas and a 3D laser-scanning device. Differences of wear between the zirconia crown antagonists and the control teeth were investigated by means of two-sided paired Student's t-tests and linear regression analysis. After 2 years, mean vertical loss was 46 μm for enamel opposed to zirconia, 19-26 μm for contralateral control teeth and 14 μm for zirconia crowns. Maximum vertical loss was 151 μm for enamel opposed to zirconia, 75-115 μm for control teeth and 60 μm for zirconia crowns. Statistical analysis revealed significant differences between wear of enamel by zirconia-opposed teeth and by control teeth. Gender, which significantly affected wear, was identified as a possible confounder. Monolithic zirconia crowns generated more wear of opposed enamel than did natural teeth. Because of the greater wear caused by other dental ceramics, the use of monolithic zirconia crowns may be justified.

  12. Surface analysis and shear bond strength of zirconia on resin cements after non-thermal plasma treatment and/or primer application for metallic alloys.

    PubMed

    Vechiato-Filho, Aljomar José; Matos, Adaias Oliveira; Landers, Richard; Goiato, Marcelo Coelho; Rangel, Elidiane Cipriano; De Souza, Grace Mendonça; Barão, Valentim Adelino Ricardo; Dos Santos, Daniela Micheline

    2017-03-01

    There is no established protocol for bonding zirconia (Y-TZP) with resin cements. Non-thermal plasma (NTP) may be an alternative for the clinical problems related to adhesion. The purpose of the present study was to characterize the surface of Y-TZP exposed to methane (CH4) NTP or coated with a layer of primer for metal alloys and the association between the two methods and to evaluate the effect of NTP treatment on bond strength between Y-TZP and two resin cements. A total of 235 Y-TZP discs (8×2mm) were distributed into five groups: Co (no surface treatment), Pr (primer), NTP (methane plasma), Pr+NTP and NTP+Pr. The effect of the treatment type on the surface free energy, morphology, topography and chemical composition of the Y-TZP discs was investigated. The discs were cemented to composite resin substrates using Panavia F2.0 or RelyX U200. Shear bond strength (n=10) analyses were performed (1mm/min) before and after thermocycling (5-55°C, 2000cycles) on the bonded specimens. The data were analyzed with one and three-way ANOVAs and Bonferroni tests (α=0.05). NTP reduced the surface energy and roughness of the Y-TZP discs. SEM-EDS and XPS analyses showed the presence of the organic thin film, which significantly improved the bond strength results when Rely X U200 was used, whereas the primer treatment was more effective with Panavia F2.0. Thermocycling significantly reduced the bond strength results of the NTP and Pr+NTP groups cemented with Rely X U200 and the Pr and NTP+Pr groups cemented with Panavia F2.0. Nonthermal plasma improves the bond strength between Rely X U200 and Y-TZP and also seems to have water-resistant behavior, whereas Panavia F2.0 showed better results when associated with primer.

  13. Characterization of surface runoff in urban areas.

    PubMed

    Choe, J S; Bang, K W; Lee, J H

    2002-01-01

    Water quality measurements of surface runoff have been carried out in selected residential and industrial zones in urban areas, in which yearly mean precipitation is 1,225 mm. The concentrations of constituents in the surface runoff were measured at sampling sites categorized by land use type in the residential zone, and by industry type in the industrial zone. The water quality constituents of BOD5, COD, SS, NO3-N, TKN, PO4-P, TP, n-Hexane extracts, Cr, Cu, Pb and Fe were analyzed. The event mean concentrations (EMCs) of COD, SS, TKN and TP in the residential zone were 313 mg/L, 279 mg/L, 8.45 mg/L, 1.98 mg/L, and those in the industrial zone were 80 mg/L, 106 mg/L, 5.07 mg/L, and 1.93 mg/L, respectively. Cumulative load curves were created to analyze the first-flushing effect of each pollutant related to the pollutant, the rainfall event, and the land use type. No general relationship between the cumulative load and runoff has been established. The degree of first-flushing effect by constituents was in the following order; TKN>COD>SS>HEM>TP>PO4-P. The correlations between SS and other constituents were analyzed to evaluate the efficiency of the physical treatment process to control the surface runoff in urban areas. Based on the correlation of constituents with SS, high treatment efficiency of SS, heavy metals, organic matter, and TP was expected. The unit pollutant loading rates of COD, SS, TKN, TP, Cr and Pb in the residential zone were 2,392, 2,130, 64.6, 15.1, 0.31, and 1.83 kg/ha/yr, and those in the industrial zone were 612, 812, 38.7, 14.8, 0.51 and 0.82 kg/ha/yr, respectively.

  14. Damage areas on selected LDEF aluminum surfaces

    NASA Technical Reports Server (NTRS)

    Coombs, Cassandra R.; Atkinson, Dale R.; Allbrooks, Martha K.; Watts, Alan J.; Hennessy, Corey J.; Wagner, John D.

    1993-01-01

    With the U.S. about to embark on a new space age, the effects of the space environment on a spacecraft during its mission lifetime become more relevant. Included among these potential effects are degradation and erosion due to micrometeoroid and debris impacts, atomic oxygen and ultraviolet light exposure as well as material alteration from thermal cycling, and electron and proton exposure. This paper focuses on the effects caused by micrometeoroid and debris impacts on several LDEF aluminum plates from four different bay locations: C-12, C-10, C-01, and E-09. Each plate was coated with either a white, black, or gray thermal paint. Since the plates were located at different orientations on the satellite, their responses to the hypervelocity impacts varied. Crater morphologies range from a series of craters, spall zones, domes, spaces, and rings to simple craters with little or no spall zones. In addition, each of these crater morphologies is associated with varying damage areas, which appear to be related to their respective bay locations and thus exposure angles. More than 5% of the exposed surface area examined was damaged by impact cratering and its coincident effects (i.e., spallation, delamination and blow-off). Thus, results from this analysis may be significant for mission and spacecraft planners and designers.

  15. Synthesis of Yttria-Stabilized Zirconia Aerogels by a Non-Alkoxide Sol-Gel Route

    SciTech Connect

    Chervin, C N; Clapsaddle, B J; Chiu, H W; Gash, A E; Satcher, Jr., J H; Kauzlarich, S M

    2005-02-11

    Homogeneous, nanocrystalline powders of yttria-stabilized zirconia were prepared using a nonalkoxide sol-gel method. Monolithic gels, free of precipitation, were prepared by addition of propylene oxide to aqueous solutions of Zr{sup 4+} and Y{sup 3+} chlorides at room temperature. The gels were dried with supercritical CO{sub 2}(l), resulting in amorphous aerogels that crystallized into cubic stabilized ZrO{sub 2} following calcination at 500 C. The aerogels and resulting crystalline products were characterized using in-situ temperature profile X-ray diffraction, thermal analysis, transmission electron microscopy (TEM), scanning electron microscopy (SEM), and nitrogen adsorption/desorption analysis. TEM and N{sub 2} adsorption/desorption analysis of an aerogel indicated a porous network structure with a high surface area (409 m{sup 2}/g). The crystallized yttria-stabilized zirconia maintained high surface area (159 m{sup 2}/g) upon formation of homogeneous, nanoparticles ({approx}10 nm). Ionic conductivity at 1000 C of sintered YSZ (1500 C, 3 hours) prepared by this method, was 0.13 {+-} 0.02 {Omega}{sup -1} cm{sup -1}. Activation energies for the conduction processes from 1000-550 C and 550-400 C, were 0.95 {+-} 0.09 and 1.12 {+-} 0.05 eV, respectively. This is the first reported synthesis and characterization of yttria-stabilized zirconia via an aerogel precursor.

  16. Resin bonding of metal brackets to glazed zirconia with a porcelain primer

    PubMed Central

    Lee, Jung-Hwan; Lee, Milim; Kim, Kyoung-Nam

    2015-01-01

    Objective The aims of this study were to compare the shear bond strength between orthodontic metal brackets and glazed zirconia using different types of primer before applying resin cement and to determine which primer was more effective. Methods Zirconia blocks were milled and embedded in acrylic resin and randomly assigned to one of four groups: nonglazed zirconia with sandblasting and zirconia primer (NZ); glazed zirconia with sandblasting, etching, and zirconia primer (GZ); glazed zirconia with sandblasting, etching, and porcelain primer (GP); and glazed zirconia with sandblasting, etching, zirconia primer, and porcelain primer (GZP). A stainless steel metal bracket was bonded to each target surface with resin cement, and all specimens underwent thermal cycling. The shear bond strength of the specimens was measured by a universal testing machine. A scanning electron microscope, three-dimensional optical surface-profiler, and stereoscopic microscope were used to image the zirconia surfaces. The data were analyzed with one-way analyses of variance and the Fisher exact test. Results Group GZ showed significantly lower shear bond strength than did the other groups. No statistically significant differences were found among groups NZ, GP, and GZP. All specimens in group GZ showed adhesive failure between the zirconia and resin cement. In groups NZ and GP, bonding failed at the interface between the resin cement and bracket base or showed complex adhesive and cohesive failure. Conclusions Porcelain primer is the more appropriate choice for bonding a metal bracket to the surface of a full-contour glazed zirconia crown with resin cement. PMID:26629476

  17. Orthodontic bracket bonding to glazed full-contour zirconia

    PubMed Central

    Kwak, Ji-Young; Jung, Hyo-Kyung; Choi, Il-Kyung

    2016-01-01

    Objectives This study evaluated the effects of different surface conditioning methods on the bond strength of orthodontic brackets to glazed full-zirconia surfaces. Materials and Methods Glazed zirconia (except for the control, Zirkonzahn Prettau) disc surfaces were pre-treated: PO (control), polishing; BR, bur roughening; PP, cleaning with a prophy cup and pumice; HF, hydrofluoric acid etching; AA, air abrasion with aluminum oxide; CJ, CoJet-Sand. The surfaces were examined using profilometry, scanning electron microscopy, and electron dispersive spectroscopy. A zirconia primer (Z-Prime Plus, Z) or a silane primer (Monobond-S, S) was then applied to the surfaces, yielding 7 groups (PO-Z, BR-Z, PP-S, HF-S, AA-S, AA-Z, and CJ-S). Metal bracket-bonded specimens were stored in water for 24 hr at 37℃, and thermocycled for 1,000 cycles. Their bond strengths were measured using the wire loop method (n = 10). Results Except for BR, the surface pre-treatments failed to expose the zirconia substructure. A significant difference in bond strengths was found between AA-Z (4.60 ± 1.08 MPa) and all other groups (13.38 ± 2.57 - 15.78 ± 2.39 MPa, p < 0.05). For AA-Z, most of the adhesive remained on the bracket. Conclusions For bracket bonding to glazed zirconia, a simple application of silane to the cleaned surface is recommended. A zirconia primer should be used only when the zirconia substructure is definitely exposed. PMID:27200278

  18. Efficacy of various cleaning solutions on saliva-contaminated zirconia for improved resin bonding

    PubMed Central

    Kim, Da-Hye; Son, Jun-Sik; Jeong, Seong-Hwa; Kim, Young-Kyung

    2015-01-01

    PURPOSE This study aimed to investigate the efficacy of cleaning solutions on saliva-contaminated zirconia in comparison to air-abrasion in terms of resin bonding. MATERIALS AND METHODS For saliva-contaminated airabraded zirconia, seven cleaning methods)-no contamination (NC), water-spray rinsing (WS), additional airabrasion (AA), and cleaning with four solutions (Ivoclean [IC]; 1.0 wt% sodium dodecyl sulfate [SDS], 1.0 wt% hydrogen peroxide [HP], and 1.0 wt% sodium hypochlorite [SHC])-were tested. The zirconia surfaces for each group were characterized using various analytical techniques. Three bonded resin (Panavia F 2.0) cylinders (bonding area: 4.5 mm2) were made on one zirconia disk specimen using the Ultradent jig method [four disks (12 cylinders)/group; a total of 28 disks]. After 5,000 thermocycling, all specimens were subjected to a shear bond strength test with a crosshead speed of 1.0 mm/minute. The fractured surfaces were observed using an optical and scanning electron microscope (SEM). RESULTS Contact angle measurements showed that groups NC, AA, IC, and SHC had hydrophilic surfaces. The X-ray photoelectron spectroscopy (XPS) analysis showed similar elemental distributions between group AA and groups IC and SHC. Groups IC and SHC showed statistically similar bond strengths to groups NC and AA (P>.05), but not groups SDS and HP (P<.05). For groups WS, SDS, and HP, blister-like bubble formations were observed on the surfaces under SEM. CONCLUSION Within the limitations of this in vitro study, some of the cleaning solutions (IC or SHC) were effective in removing saliva contamination and enhancing the resin bond strength. PMID:25932305

  19. Effect of zirconia on the physicochemical properties of copper (II) imidazolate frameworks

    NASA Astrophysics Data System (ADS)

    Shaharun, Maizatul S.; Shaharun, Salina; Al-Shaibani, Asem

    2016-11-01

    Copper(II) bis(imidazolate) and copper(II)-zirconia(IV) bimetallic imidazolate were synthesized by metal oxides in aqueous solutions using acid catalyst procedure. The metal imidazolate frameworks were characterized by fourier transform infrared spectra (FTIR), transmission electron microscopy (TEM), ultraviolet-visible spectroscopy (UV-Vis) and N2 adsorption-desorption. The addition of ZrO2 increased the surface area and porosity of the metal organic frameworks. The modification of the copper(II) bis(imidazolate) with addition of ZrO2 enhances the visible light absorbance. The band gap of copper(II)-zirconia(II) bimetallic imidazolate is increased to 2.40 eV with more absorbance in the visible region compared to copper(II) bis(imidazolate).

  20. Body surface area formulae: an alarming ambiguity

    PubMed Central

    Redlarski, Grzegorz; Palkowski, Aleksander; Krawczuk, Marek

    2016-01-01

    Body surface area (BSA) plays a key role in several medical fields, including cancer chemotherapy, transplantology, burn treatment and toxicology. BSA is often a major factor in the determination of the course of treatment and drug dosage. A series of formulae to simplify the process have been developed. Because easy-to-identify, yet general, body coefficient results of those formulae vary considerably, the question arises as to whether the choice of a particular formula is valid and safe for patients. Here we show that discrepancies between most of the known BSA formulae can reach 0.5 m2 for the standard adult physique. Although many previous studies have demonstrated that certain BSA formulae provide an almost exact fit with the patients examined, all of these studies have been performed on a limited and isolated group of people. Our analysis presents a broader perspective, considering 25 BSA formulae. The analysis revealed that the choice of a particular formula is a difficult task. Differences among calculations made by the formulae are so great that, in certain cases, they may considerably affect patients’ mortality, especially for people with an abnormal physique or for children. PMID:27323883

  1. Body surface area formulae: an alarming ambiguity.

    PubMed

    Redlarski, Grzegorz; Palkowski, Aleksander; Krawczuk, Marek

    2016-06-21

    Body surface area (BSA) plays a key role in several medical fields, including cancer chemotherapy, transplantology, burn treatment and toxicology. BSA is often a major factor in the determination of the course of treatment and drug dosage. A series of formulae to simplify the process have been developed. Because easy-to-identify, yet general, body coefficient results of those formulae vary considerably, the question arises as to whether the choice of a particular formula is valid and safe for patients. Here we show that discrepancies between most of the known BSA formulae can reach 0.5 m(2) for the standard adult physique. Although many previous studies have demonstrated that certain BSA formulae provide an almost exact fit with the patients examined, all of these studies have been performed on a limited and isolated group of people. Our analysis presents a broader perspective, considering 25 BSA formulae. The analysis revealed that the choice of a particular formula is a difficult task. Differences among calculations made by the formulae are so great that, in certain cases, they may considerably affect patients' mortality, especially for people with an abnormal physique or for children.

  2. Nitrogen-doped zirconia: A comparison with cation stabilized zirconia

    SciTech Connect

    Lee, Jong-Sook . E-mail: jong-sook.lee@fkf.mpg.de; Lerch, Martin; Maier, Joachim

    2006-01-15

    The conductivity behavior of nitrogen-doped zirconia is compared with that of zirconia doped with lower-valent cations and discussed in the framework of defect-defect interactions. While nominally introducing the same number of vacancies as yttrium, nitrogen dopants introduced in the anion sublattice of zirconia lead to substantially different defect kinetics and energetics. Compared to the equivalent yttrium doping nitrogen doping in the Y-Zr-O-N system substantially increases the activation energy and correspondingly decreases the conductivity at temperatures below 500{sup -}bar C in the vacancy range below 4mol%. The comparison of N-doped zirconia and zirconia systems doped with size-matched cation stabilizers, such as Sc, Yb and Y, shows that elastically driven vacancy-vacancy ordering interactions can phenomenologically account for the temperature- and composition-dependence. It is striking that materials with superior high-temperature conductivities due to weak dopant-vacancy interactions undergo severe deterioration at low temperature due to the strong vacancy-ordering. The analysis also explains qualitatively similar effects of Y co-doping in Yb-, Sc-, and N-doped zirconia. Small amount of Y in N-doped zirconia as well as in Sc-doped zirconia appears to hinder the formation of the long-range ordered phase and thus enhance the conductivity substantially.

  3. Biaxial flexural strength of bilayered zirconia using various veneering ceramics

    PubMed Central

    Chantranikul, Natravee

    2015-01-01

    PURPOSE The aim of this study was to evaluate the biaxial flexural strength (BFS) of one zirconia-based ceramic used with various veneering ceramics. MATERIALS AND METHODS Zirconia core material (Katana) and five veneering ceramics (Cerabien ZR; CZR, Lava Ceram; LV, Cercon Ceram Kiss; CC, IPS e.max Ceram; EM and VITA VM9; VT) were selected. Using the powder/liquid layering technique, bilayered disk specimens (diameter: 12.50 mm, thickness: 1.50 mm) were prepared to follow ISO standard 6872:2008 into five groups according to veneering ceramics as follows; Katana zirconia veneering with CZR (K/CZR), Katana zirconia veneering with LV (K/LV), Katana zirconia veneering with CC (K/CC), Katana zirconia veneering with EM (K/EM) and Katana zirconia veneering with VT (K/VT). After 20,000 thermocycling, load tests were conducted using a universal testing machine (Instron). The BFS were calculated and analyzed with one-way ANOVA and Tukey HSD (α=0.05). The Weibull analysis was performed for reliability of strength. The mode of fracture and fractured surface were observed by SEM. RESULTS It showed that K/CC had significantly the highest BFS, followed by K/LV. BFS of K/CZR, K/EM and K/VT were not significantly different from each other, but were significantly lower than the other two groups. Weibull distribution reported the same trend of reliability as the BFS results. CONCLUSION From the result of this study, the BFS of the bilayered zirconia/veneer composite did not only depend on the Young's modulus value of the materials. Further studies regarding interfacial strength and sintering factors are necessary to achieve the optimal strength. PMID:26576251

  4. Phase transformation of zirconia ceramics by hydrothermal degradation.

    PubMed

    Kawai, Yohei; Uo, Motohiro; Wang, Yongming; Kono, Sayaka; Ohnuki, Somei; Watari, Fumio

    2011-01-01

    Zirconia has found wide application in dentistry because of its high mechanical strength and superior esthetic properties. However, zirconia degradation caused by phase transformation occurring in a hydrothermal environment is of concern. In the present study, phase transformation and microstructure of tetragonal zirconia polycrystal partially stabilized with yttrium oxide (Y-TZP) and alumina-toughened zirconia (ATZ) sintered at different temperatures were estimated. On grazing angle X-ray diffraction analysis, ATZ showed less phase transformation to the monoclinic phase during hydrothermal treatment and this transformation appeared to occur within a few micrometers below the surface. At a higher sintering temperature the monoclinic phase content of ATZ was found to be lesser than that of Y-TZP, indicating that the alumina in ATZ was effective in suppressing hydrothermal degradation. Examination by transmission electron microscopy and studying of electron backscatter diffraction patterns indicated that grain growth in ATZ was slightly suppressed compared with that in Y-TZP at higher sintering temperatures. The present study demonstrated the effect of adding alumina to zirconia for suppressing hydrothermal degradation and studied the effect of this addition on grain growth in zirconia.

  5. Sintering additives for zirconia ceramics

    SciTech Connect

    Wu, S.

    1986-01-01

    This book is an overview of sintering science and its application to zirconia materials including CaO, MgO, and Y/sub 2/O/sub 3/-CeO/sub 2/ doped materials. This book is a reference for first-time exposure to zirconia materials technology, particularly densification.

  6. Shear bond strength of indirect composite material to monolithic zirconia

    PubMed Central

    2016-01-01

    PURPOSE This study aimed to evaluate the effect of surface treatments on bond strength of indirect composite material (Tescera Indirect Composite System) to monolithic zirconia (inCoris TZI). MATERIALS AND METHODS Partially stabilized monolithic zirconia blocks were cut into with 2.0 mm thickness. Sintered zirconia specimens were divided into different surface treatment groups: no treatment (control), sandblasting, glaze layer & hydrofluoric acid application, and sandblasting + glaze layer & hydrofluoric acid application. The indirect composite material was applied to the surface of the monolithic zirconia specimens. Shear bond strength value of each specimen was evaluated after thermocycling. The fractured surface of each specimen was examined with a stereomicroscope and a scanning electron microscope to assess the failure types. The data were analyzed using one-way analysis of variance (ANOVA) and Tukey LSD tests (α=.05). RESULTS Bond strength was significantly lower in untreated specimens than in sandblasted specimens (P<.05). No difference between the glaze layer and hydrofluoric acid application treated groups were observed. However, bond strength for these groups were significantly higher as compared with the other two groups (P<.05). CONCLUSION Combined use of glaze layer & hydrofluoric acid application and silanization are reliable for strong and durable bonding between indirect composite material and monolithic zirconia. PMID:27555895

  7. Surface atmospheric extremes (Launch and transportation areas)

    NASA Technical Reports Server (NTRS)

    1972-01-01

    The effects of extreme values of surface and low altitude atmospheric parameters on space vehicle design, tests, and operations are discussed. Atmospheric extremes from the surface to 150 meters for geographic locations of interest to NASA are given. Thermal parameters (temperature and solar radiation), humidity, pressure, and atmospheric electricity (lighting and static) are presented. Weather charts and tables are included.

  8. 30 CFR 56.17001 - Illumination of surface working areas.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 30 Mineral Resources 1 2011-07-01 2011-07-01 false Illumination of surface working areas. 56.17001... § 56.17001 Illumination of surface working areas. Illumination sufficient to provide safe working conditions shall be provided in and on all surface structures, paths, walkways, stairways, switch...

  9. 30 CFR 57.17001 - Illumination of surface working areas.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 30 Mineral Resources 1 2011-07-01 2011-07-01 false Illumination of surface working areas. 57.17001... Illumination § 57.17001 Illumination of surface working areas. Illumination sufficient to provide safe working conditions shall be provided in and on all surface structures, paths, walkways, stairways, switch...

  10. 30 CFR 57.17001 - Illumination of surface working areas.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Illumination of surface working areas. 57.17001... Illumination § 57.17001 Illumination of surface working areas. Illumination sufficient to provide safe working conditions shall be provided in and on all surface structures, paths, walkways, stairways, switch...

  11. 30 CFR 56.17001 - Illumination of surface working areas.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Illumination of surface working areas. 56.17001... NONMETAL MINE SAFETY AND HEALTH SAFETY AND HEALTH STANDARDS-SURFACE METAL AND NONMETAL MINES Illumination § 56.17001 Illumination of surface working areas. Illumination sufficient to provide safe...

  12. Effect of zirconia on the physicochemical properties of Cu/ZnO/Al2O3 catalyst

    NASA Astrophysics Data System (ADS)

    Shaharun, Maizatul S.; Shaharun, Salina; Zabidi, Noor A. M.; Taha, Mohd F.

    2012-09-01

    Catalytic hydrogenation of CO2 to liquid fuel using copper based catalyst is an attractive way to recycle and utilize CO2. Zirconia-promoted copper-zinc oxide/alumina catalysts (CZAZ) were prepared by the co-precipitation method. The catalyst was characterized by temperature-programmed reduction (TPR), field emission scanning electron microscopy-energy dispersive analysis (FESEM-EDX) and N2 adsorption-desorption. The results showed that addition of ZrO2 reduced the surface area and porosity of the catalyst. The reducibility of the metal oxides formed after calcination of catalyst samples was also affected due to change in metal-support interaction. However the addition of zirconia led to a better dispersion of the active metal on the surface of support material.

  13. Corrosion behavior of zirconia in acidulated phosphate fluoride

    PubMed Central

    Thomas, Anie; Sridhar, Sathyanarayanan; Aghyarian, Shant; Watkins-curry, Pilanda; Chan, Julia Y.; Pozzi, Alessandro; Rodrigues, Danieli C.

    2016-01-01

    ABSTRACT Objective The corrosion behavior of zirconia in acidulated phosphate fluoride (APF) representing acidic environments and fluoride treatments was studied. Material and Methods Zirconia rods were immersed in 1.23% and 0.123% APF solutions and maintained at 37°C for determined periods of time. Surfaces of all specimens were imaged using digital microscopy and scanning electron microscopy (SEM). Sample mass and dimensions were measured for mass loss determination. Samples were characterized by powder X-ray diffraction (XRD) to detect changes in crystallinity. A biosensor based on electrochemical impedance spectroscopy (EIS) was used to detect ion dissolution of material into the immersion media. Results Digital microscopy revealed diminishing luster of the materials and SEM showed increased superficial corrosion of zirconia submerged in 1.23% APF. Although no structural change was found, the absorption of salts (sodium phosphate) onto the surface of the materials bathed in 0.123% APF was significant. EIS indicated a greater change of impedance for the immersion solutions with increasing bathing time. Conclusion Immersion of zirconia in APF solutions showed deterioration limited to the surface, not extending to the bulk of the material. Inferences on zirconia performance in acidic oral environment can be elucidated from the study. PMID:27008257

  14. Surface area and travel time relationships in aquifer treatment systems.

    PubMed

    Fox, Peter; Makam, Roshan

    2009-11-01

    Soil aquifer treatment (SAT) and bank filtration use natural attenuation processes to purify water for subsequent use. Soil aquifer treatment may constitute both unsaturated and saturated flow conditions, while bank filtration systems are primarily saturated flow. This analysis focuses on the saturated zone, where the majority of residence time occurs, in both SAT and bank filtration systems. Sustainable removal mechanisms during subsurface flow are primarily surface-mediated and therefore depend on surface area. By analyzing saturated subsurface flow hydraulics in granular media, a relationship between surface area and travel time was developed. For saturated subsurface flow, the ratio of surface area-to-travel time varied by approximately a factor of 3, for common aquifer materials subject to identical hydraulic gradients. Because travel time criteria often are used to regulate SAT and bank filtration systems, these criteria also may determine the surface area and associated surface-mediated reactions for water purification. The ratio of surface area-to-travel time increases with increasing hydraulic gradient, implying that surface area is relatively constant for specific travel times, even if the hydraulic gradient changes; however, the increasing hydraulic gradient will increase the distance from the recharge zone to the recovery well. Therefore, travel time assessments based on maximum possible hydraulic gradients increase surface area and could provide a conservative limit for surface-mediated reactions. This analysis demonstrates that travel time criteria for SAT and bank filtration systems indirectly provide a minimum surface area that may support sustainable removal mechanisms.

  15. Microwave technique applied to the hydrothermal synthesis and sintering of calcia stabilized zirconia nanoparticles

    NASA Astrophysics Data System (ADS)

    Rizzuti, Antonino; Corradi, Anna; Leonelli, Cristina; Rosa, Roberto; Pielaszek, Roman; Lojkowski, Witold

    2010-01-01

    This study is focused on the synthesis of zirconia nanopowders stabilized by 6%mol calcia prepared under hydrothermal conditions using microwave technology. Sodium hydroxide-based hydrolysis of zirconyl chloride solution containing calcium nitrate followed by microwave irradiation at the temperature of 220 °C for 30 min was sufficient to obtain white powders of crystalline calcia stabilized zirconia. By means of X-ray diffraction and transmission electron microscopy, it was shown that tetragonal zirconia nanocrystallites with a size of ca 7 nm and diameter/standard deviation ratio of 0.10 were formed. The effects of the [Ca2+] and [NaOH] as well as temperature and time of microwave irradiation on the density and specific surface area were evaluated. Sintering test of the tetragonal nanopowders at 1,300 °C in air was performed in a monomode microwave applicator. The sample was sintered to the density of 95% and the grain size, analyzed by field emission scanning electron microscopy, was in the range from 90 to 170 nm.

  16. Synthesis of nanocrystalline zirconia by amorphous citrate route: structural and thermal (HTXRD) studies

    SciTech Connect

    Bhagwat, Mahesh; Ramaswamy, Veda

    2004-09-01

    Nanocrystalline zirconia powder with a fairly narrow particle size distribution has been synthesized by the amorphous citrate route. The sample obtained has a high BET surface area of 89 m{sup 2} g{sup -1}. Rietveld refinement of the powder X-ray diffraction (XRD) profile of the zirconia sample confirms stabilization of zirconia in the tetragonal phase with around 8% monoclinic impurity. The data show the presence of both anionic as well as cationic vacancies in the lattice. Crystallite size determined from XRD is 8 nm and is in close agreement with the particle size determined by TEM. The in situ high temperature-X-ray diffraction (HTXRD) study revealed high thermal stability of the mixture till around 1023 K after which the transformation of tetragonal phase into the monoclinic phase has been seen as a function of temperature till 1473 K. This transformation is accompanied by an increase in the crystallite size of the sample from 8 to 55 nm. The thermal expansion coefficients are 9.14 x 10{sup -6} K{sup -1} along 'a'- and 15.8 x 10{sup -6} K{sup -1} along 'c'-axis. The lattice thermal expansion coefficient in the temperature range 298-1623 K is 34.6 x 10{sup -6} K{sup -1}.

  17. Surface atmospheric extremes (launch and transportation areas)

    NASA Technical Reports Server (NTRS)

    1974-01-01

    Criteria are provided on atmospheric extremes from the surface to 150 meters for geographical locations of interest to NASA. Thermal parameters (temperature and solar radiation), humidity, precipitation, pressure, and atmospheric electricity (lightning and static) are presented. Available data are also provided for the entire continental United States for use in future space programs.

  18. Phonon anharmonicity of monoclinic zirconia and yttrium-stabilized zirconia

    DOE PAGES

    Li, Chen W.; Smith, Hillary L.; Lan, Tian; ...

    2015-04-13

    Inelastic neutron scattering measurements on monoclinic zirconia (ZrO2) and 8 mol% yttrium-stabilized zirconia were performed at temperatures from 300 to 1373 ωK. We reported temperature-dependent phonon densities of states (DOS) and Raman spectra obtained at elevated temperatures. First-principles lattice dynamics calculations with density functional theory gave total and partial phonon DOS curves and mode Grüneisen parameters. These mode Grüneisen parameters were used to predict the experimental temperature dependence of the phonon DOS with partial success. However, substantial anharmonicity was found at elevated temperatures, especially for phonon modes dominated by the motions of oxygen atoms. Yttrium-stabilized zirconia (YSZ) was somewhat moremore » anharmonic and had a broader phonon spectrum at low temperatures, owing in part to defects in its structure. YSZ also has a larger vibrational entropy than monoclinic zirconia.« less

  19. Phonon anharmonicity of monoclinic zirconia and yttrium-stabilized zirconia

    SciTech Connect

    Li, Chen W.; Smith, Hillary L.; Lan, Tian; Niedziela, Jennifer L.; Munoz, Jorge A.; Keith, J. Brian; Mauger, L.; Abernathy, Douglas L; Fultz, B.

    2015-04-13

    Inelastic neutron scattering measurements on monoclinic zirconia (ZrO2) and 8 mol% yttrium-stabilized zirconia were performed at temperatures from 300 to 1373 ωK. We reported temperature-dependent phonon densities of states (DOS) and Raman spectra obtained at elevated temperatures. First-principles lattice dynamics calculations with density functional theory gave total and partial phonon DOS curves and mode Grüneisen parameters. These mode Grüneisen parameters were used to predict the experimental temperature dependence of the phonon DOS with partial success. However, substantial anharmonicity was found at elevated temperatures, especially for phonon modes dominated by the motions of oxygen atoms. Yttrium-stabilized zirconia (YSZ) was somewhat more anharmonic and had a broader phonon spectrum at low temperatures, owing in part to defects in its structure. YSZ also has a larger vibrational entropy than monoclinic zirconia.

  20. Effect of sandblasting, silica coating, and laser treatment on the microtensile bond strength of a dental zirconia ceramic to resin cements.

    PubMed

    Mahmoodi, Nasrin; Hooshmand, Tabassom; Heidari, Solmaz; Khoshro, Kimia

    2016-02-01

    The purpose of this in vitro study was to evaluate the effect of laser irradiation as well as other surface treatment methods on the microtensile bond strength of a dental zirconia ceramic to the two types of resin cements. Zirconia ceramic blocks (ICE Zirkon) were sintered according to the manufacturer's instructions and duplicated in resin composites. The ceramic specimens were divided into four groups according to the following surface treatments: no surface treatment (control), sandblasting with alumina, silica coating plus silanization, and Nd:YAG laser irradiation. The specimens were divided equally and then bonded with Panavia F2.0 (self-etching resin cement) and Clearfil SA Luting (self-adhesive resin cement) to the composite blocks. The bonded ceramic-composite blocks were stored in distilled water at 37 °C for 72 h, cut to prepare bar-shaped specimens with a bonding area of approximately 1 mm(2), and thermocycled for 3000 cycles between 5 and 55 °C, and the microtensile bond strengths were measured using a universal testing machine. The data were analyzed by ANOVA and Tukey post hoc test. The results showed that the self-adhesive resin cement used in this study did not improve the microtensile bond strength when the zirconia surface was sandblasted by alumina. The use of the Nd:YAG laser did not enhance the bond strength between the zirconia and both types of resin cements. In addition, silica coating of the zirconia surfaces plus silane application significantly improved the bond strength regardless of the type of resin cement utilized.

  1. Osseointegration of zirconia implants: an SEM observation of the bone-implant interface

    PubMed Central

    Depprich, Rita; Zipprich, Holger; Ommerborn, Michelle; Mahn, Eduardo; Lammers, Lydia; Handschel, Jörg; Naujoks, Christian; Wiesmann, Hans-Peter; Kübler, Norbert R; Meyer, Ulrich

    2008-01-01

    Background The successful use of zirconia ceramics in orthopedic surgery led to a demand for dental zirconium-based implant systems. Because of its excellent biomechanical characteristics, biocompatibility, and bright tooth-like color, zirconia (zirconium dioxide, ZrO2) has the potential to become a substitute for titanium as dental implant material. The present study aimed at investigating the osseointegration of zirconia implants with modified ablative surface at an ultrastructural level. Methods A total of 24 zirconia implants with modified ablative surfaces and 24 titanium implants all of similar shape and surface structure were inserted into the tibia of 12 Göttinger minipigs. Block biopsies were harvested 1 week, 4 weeks or 12 weeks (four animals each) after surgery. Scanning electron microscopy (SEM) analysis was performed at the bone implant interface. Results Remarkable bone attachment was already seen after 1 week which increased further to intimate bone contact after 4 weeks, observed on both zirconia and titanium implant surfaces. After 12 weeks, osseointegration without interposition of an interfacial layer was detected. At the ultrastructural level, there was no obvious difference between the osseointegration of zirconia implants with modified ablative surfaces and titanium implants with a similar surface topography. Conclusion The results of this study indicate similar osseointegration of zirconia and titanium implants at the ultrastructural level. PMID:18990214

  2. Cytotoxicity and physicochemical characterization of iron–manganese-doped sulfated zirconia nanoparticles

    PubMed Central

    Al-Fahdawi, Mohamed Qasim; Rasedee, Abdullah; Al-Qubaisi, Mothanna Sadiq; Alhassan, Fatah H; Rosli, Rozita; El Zowalaty, Mohamed Ezzat; Naadja, Seïf-Eddine; Webster, Thomas J; Taufiq-Yap, Yun Hin

    2015-01-01

    Iron–manganese-doped sulfated zirconia nanoparticles with both Lewis and Brønsted acidic sites were prepared by a hydrothermal impregnation method followed by calcination at 650°C for 5 hours, and their cytotoxicity properties against cancer cell lines were determined. The characterization was carried out using X-ray diffraction, thermogravimetric analysis, Fourier transform infrared spectroscopy, Brauner–Emmett–Teller (BET) surface area measurements, X-ray fluorescence, X-ray photoelectron spectroscopy, zeta size potential, and transmission electron microscopy (TEM). The cytotoxicity of iron–manganese-doped sulfated zirconia nanoparticles was determined using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assays against three human cancer cell lines (breast cancer MDA-MB231 cells, colon carcinoma HT29 cells, and hepatocellular carcinoma HepG2 cells) and two normal human cell lines (normal hepatocyte Chang cells and normal human umbilical vein endothelial cells [HUVECs]). The results suggest for the first time that iron–manganese-doped sulfated zirconia nanoparticles are cytotoxic to MDA-MB231 and HepG2 cancer cells but have less toxicity to HT29 and normal cells at concentrations from 7.8 μg/mL to 500 μg/mL. The morphology of the treated cells was also studied, and the results supported those from the cytotoxicity study in that the nanoparticle-treated HepG2 and MDA-MB231 cells had more dramatic changes in cell morphology than the HT29 cells. In this manner, this study provides the first evidence that iron–manganese-doped sulfated zirconia nanoparticles should be further studied for a wide range of cancer applications without detrimental effects on healthy cell functions. PMID:26425082

  3. Simple Heat Treatment of Zirconia Ceramic Pre-Treated with Silane Primer to Improve Resin Bonding.

    PubMed

    Ha, Jung-Yun; Son, Jun Sik; Kim, Kyo-Han; Kwon, Tae-Yub

    2015-01-01

    Establishing a strong resin bond to dental zirconia ceramic remains difficult. Previous studies have shown that the conventional application of silane does not work well with zirconia. This paper reports that a silane pre-treatment of dental zirconia ceramic combined with subsequent heat treatment has potential as an adhesive cementation protocol for improving zirconia-resin bonding. Among the various concentrations (0.1 to 16 vol%) of experimental γ-methacryloxypropyltrimethoxysilane (γ-MPTS) primers assessed, the 1% solution was found to be the most effective in terms of the shear bond strength of the resin cement to dental zirconia ceramic. A high shear bond strength (approx. 30 MPa) was obtained when zirconia specimens were pre-treated with this primer and then heat-treated in a furnace for 60 min at 150 degrees C. Heat treatment appeared to remove the hydrophilic constituents from the silane film formed on the zirconia ceramic surface and accelerate the condensation reactions between the silanol groups of the hydrolyzed silane molecules at the zirconia/resin interface, finally making a more desirable surface for bonding with resin. This estimation was supported by Fourier transform infrared spectroscopy of the silanes prepared in this study.

  4. Why Do We Need the Derivative for the Surface Area?

    ERIC Educational Resources Information Center

    Hristova, Yulia; Zeytuncu, Yunus E.

    2016-01-01

    Surface area and volume computations are the most common applications of integration in calculus books. When computing the surface area of a solid of revolution, students are usually told to use the frustum method instead of the disc method; however, a rigorous explanation is rarely provided. In this note, we provide one by using geometric…

  5. Ultrasonic cleaning of silica-coated zirconia influences bond strength between zirconia and resin luting material.

    PubMed

    Nishigawa, Goro; Maruo, Yukinori; Irie, Masao; Oka, Morihiko; Yoshihara, Kumiko; Minagi, Shogo; Nagaoka, Noriyuki; Yoshida, Yasuhiro; Suzuki, Kazuomi

    2008-11-01

    The purpose of this study was to evaluate how ultrasonic cleaning of silica-coated zirconia surfaces would influence the latter's bond strength to resin luting material. Forty zirconia specimens were divided into four groups: one air abrasion group and three silica-coated groups. Silica-coated specimens were cleaned with distilled water using an ultrasonic cleaner after tribochemical silica coating and then divided into three groups according to cleaning durations: 1 minute, 5 minutes, or without cleaning. Following which, resin luting material was polymerized against the specimens. After storage in water for 24 hours, the specimens were subjected to shear bond strength test. Shear bond strength of silica-coated group without cleaning was significantly higher than the other three groups, but there were no statistically significant differences among the three latter groups. SEM images suggested visible differences among the treatment methods. With EDXS analysis, it was revealed that ultrasonic cleaning decreased the silica content on the treated surfaces. Therefore, results showed that ultrasonic cleaning of tribochemically silica-coated zirconia surfaces decreased the adhesion efficacy to resin luting material.

  6. Contamination of dental zirconia before final firing: effects on mechanical properties.

    PubMed

    Ban, Seiji; Okuda, Yuji; Noda, Makoto; Tsuruki, Jiro; Kawai, Tatsushi; Kono, Hiroshi

    2013-01-01

    Plate-like specimens were prepared, using a diamond saw, from Cercon -a pre-sintered yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) block. These specimens were treated with 10 kinds of dental materials which acted as contaminants, and then sintered at 1,350°C or 1,450°C. After the final firing, specimens were subjected to a three-point flexural test and Vickers hardness test. Their surfaces were also characterized by scanning electron microscopy and X-ray diffractometry. Phosphorus-containing contaminants reduced the three-point flexural strength and hardness of final sintered zirconia due to the formation of YPO4 and phase transformation from tetragonal to monoclinic zirconia. Gypsum also reduced both mechanical properties due to the formation of CaZrO3 and phase transformation from tetragonal to cubic zirconia. Other contaminants showed no adverse effects on the mechanical properties of final sintered zirconia.

  7. Preparation of Zirconia Supported Basic Nanocatalyst: A Physicochemical and Kinetic Study of Biodiesel Production from Soybean Oil.

    PubMed

    Patil, Pramod; Pratap, Amit

    2016-01-01

    Zirconia supported cadmium oxide basic nanocatalyst was prepared by simple co-precipitation method using aq. ammonia as precipitating reagent. The catalyst was characterised by X-ray diffraction, scanning electron microscopy (SEM) and transmission electron microscopy technique (TEM), Brunauer-Emmet-Teller surface area measurement (BET), temperature program desorption (TPD-CO2) etc. The transesterificaton of soybean oil with methanol into biodiesel was catalysed by employing zirconia supported nanocatalyst. Kinetics of transesterificaton of oil was studied and obeyed the pseudo first order equation. While, the activation energy (Ea) for the transesterification of oil was found to be 41.18 kJ mol(-1). The 97% yield of biodiesel was observed using 7% catalyst loading (with respect of oil), 1:40 molar ratio of oil to methanol at 135°C.

  8. Sulfated zirconia as a proton conductor for fuel cells: Stability to hydrolysis and influence on catalysts

    NASA Astrophysics Data System (ADS)

    Tominaka, Satoshi; Momma, Toshiyuki; Scrosati, Bruno; Osaka, Tetsuya

    Sulfated zirconia is an inorganic solid superacid having sulfate groups covalently bonded to its surface. In this work, sulfated zirconia is synthesized by a solvent-free method to obtain it in the nanoparticle form. This nanostructured sulfated zirconia has been evaluated in terms of (i) chemical stability to hydrolysis and to hydrogen peroxide by thermogravimetric analysis, and (ii) influences on Pt catalyst activity by cyclic voltammetry using sulfated-zirconia dispersion as a supporting electrolyte solution. The results demonstrate that our sulfated zirconia is stable almost perfectly to hydrolysis but partly decomposed by a Fenton reagent containing hydrogen peroxide and Fe 2+. In addition, we show that oxygen reduction activity of Pt catalyst in a sulfated-zirconia dispersion is comparatively high (specific activity at 0.9 V vs. RHE, i 0.9: ca. 17 μA cm -2) compared to that in a 0.5 M sulfuric acid solution (i 0.9: ca. 15 μA cm -2). Finally, we demonstrate that sulfated zirconia does not influence hydrogen oxidation reaction. These results lead us to conclude that sulfated zirconia is a promising proton conductor for fuel cells.

  9. Attention to surfaces modulates motion processing in extrastriate area MT.

    PubMed

    Wannig, Aurel; Rodríguez, Valia; Freiwald, Winrich A

    2007-05-24

    In the visual system, early atomized representations are grouped into higher-level entities through processes of perceptual organization. Here we present neurophysiological evidence that a representation of a simple object, a surface defined by color and motion, can be the unit of attentional selection at an early stage of visual processing. Monkeys were cued by the color of a fixation spot to attend to one of two transparent random-dot surfaces, one red and one green, which occupied the same region of space. Motion of the attended surface drove neurons in the middle temporal (MT) visual area more strongly than physically identical motion of the non-attended surface, even though both occurred within the spotlight of attention. Surface-based effects of attention persisted even without differential surface coloring, but attentional modulation was stronger with color. These results show that attention can select surface representations to modulate visual processing as early as cortical area MT.

  10. MOISTURE AND SURFACE AREA MEASUREMENTS OF PLUTONIUM-BEARING OXIDES

    SciTech Connect

    Crowder, M.; Duffey, J.; Livingston, R.; Scogin, J.; Kessinger, G.; Almond, P.

    2009-09-28

    To ensure safe storage, plutonium-bearing oxides are stabilized at 950 C for at least two hours in an oxidizing atmosphere. Stabilization conditions are expected to decompose organic impurities, convert metals to oxides, and result in moisture content below 0.5 wt%. During stabilization, the specific surface area is reduced, which minimizes readsorption of water onto the oxide surface. Plutonium oxides stabilized according to these criteria were sampled and analyzed to determine moisture content and surface area. In addition, samples were leached in water to identify water-soluble chloride impurity content. Results of these analyses for seven samples showed that the stabilization process produced low moisture materials (< 0.2 wt %) with low surface area ({le} 1 m{sup 2}/g). For relatively pure materials, the amount of water per unit surface area corresponded to 1.5 to 3.5 molecular layers of water. For materials with chloride content > 360 ppm, the calculated amount of water per unit surface area increased with chloride content, indicating hydration of hygroscopic salts present in the impure PuO{sub 2}-containing materials. The low moisture, low surface area materials in this study did not generate detectable hydrogen during storage of four or more years.

  11. Fracture Strength of Aged Monolithic and Bilayer Zirconia-Based Crowns.

    PubMed

    Lameira, Deborah Pacheco; Buarque e Silva, Wilkens Aurélio; Andrade e Silva, Frederico; De Souza, Grace M

    2015-01-01

    The purpose of this study was to evaluate the effect of design and surface finishing on fracture strength of yttria-tetragonal zirconia polycrystal (Y-TZP) crowns in monolithic (1.5 mm thickness) and bilayer (0.8 mm zirconia coping and 0.7 mm porcelain veneer) configuration after artificial aging. Bovine incisors received crown preparation and Y-TZP crowns were manufactured using CAD/CAM technique, according to the following groups (n = 10): Polished monolithic zirconia crowns (PM); Glazed monolithic zirconia crowns (GM); Bi-layer crowns (BL). Crowns were cemented with resin cement, submitted to artificial aging in a chewing simulator (2.5 million cycles/80 N/artificial saliva/37 °C), and tested for fracture strength. Two remaining crowns referring to PM and GM groups were submitted to a chemical composition analysis to measure the level of yttrium after aging. One-way ANOVA and Tukey's test (P = .05) indicated that monolithic zirconia crowns presented similar fracture strength (PM = 3476.2 N ± 791.7; GM = 3561.5 N ± 991.6), which was higher than bilayer crowns (2060.4 N ± 810.6). There was no difference in the yttrium content among the three surfaces evaluated in the monolithic crowns. Thus, monolithic zirconia crowns present higher fracture strength than bilayer veneered zirconia after artificial aging and surface finishing does not affect their fracture strength.

  12. The Zirconia Ceramic: Strengths and Weaknesses

    PubMed Central

    Daou, Elie E.

    2014-01-01

    Metal ceramic restorations were considered the gold standard as reliable materials. Increasing demand for esthetics supported the commercialization of new metal free restorations. A growing demand is rising for zirconia prostheses. Peer-reviewed articles published till July 2013 were identified through a Medline (Pubmed and Elsevier). Emphasizing was made on zirconia properties and applications. Zirconia materials are able to withstand posterior physiologic loads. Although zirconia cores are considered as reliable materials, these restorations are not problem free. PMID:24851138

  13. Effect of various intraoral repair systems on the shear bond strength of composite resin to zirconia

    PubMed Central

    Han, In-Hae; Kang, Dong-Wan; Chung, Chae-Heon; Choe, Han-Cheol

    2013-01-01

    PURPOSE This study compared the effect of three intraoral repair systems on the bond strength between composite resin and zirconia core. MATERIALS AND METHODS Thirty zirconia specimens were divided into three groups according to the repair method: Group I- CoJet™ Repair System (3M ESPE) [chairside silica coating with 30 µm SiO2 + silanization + adhesive]; Group II- Ceramic Repair System (Ivoclar Vivadent) [etching with 37% phosphoric acid + Zirconia primer + adhesive]; Group III- Signum Zirconia Bond (Heraus) [Signum Zirconia Bond I + Signum Zirconia Bond II]. Composite resin was polymerized on each conditioned specimen. The shear bond strength was tested using a universal testing machine, and fracture sites were examined with FE-SEM. Surface morphology and wettability after surface treatments were examined additionally. The data of bond strengths were statistically analyzed with one-way ANOVA and Tamhane post hoc test (α=.05). RESULTS Increased surface roughness and the highest wettability value were observed in the CoJet sand treated specimens. The specimens treated with 37% phosphoric acid and Signum Zirconia Bond I did not show any improvement of surface irregularity, and the lowest wettability value were found in 37% phosphoric acid treated specimens. There was no significant difference in the bond strengths between Group I (7.80 ± 0.76 MPa) and III (8.98 ± 1.39 MPa). Group II (3.21 ± 0.78 MPa) showed a significant difference from other groups (P<.05). CONCLUSION The use of Intraoral silica coating system and the application of Signum Zirconia Bond are effective for increasing the bond strength of composite resin to zirconia. PMID:24049565

  14. From Zirconium Nanograins to Zirconia Nanoneedles

    PubMed Central

    Zalnezhad, E.; Hamouda, A. M. S.; Jaworski, J.; Do Kim, Young

    2016-01-01

    Combinations of three simple techniques were utilized to gradually form zirconia nanoneedles from zirconium nanograins. First, a physical vapor deposition magnetron sputtering technique was used to deposit pure zirconium nanograins on top of a substrate. Second, an anodic oxidation was applied to fabricate zirconia nanotubular arrays. Finally, heat treatment was used at different annealing temperatures in order to change the structure and morphology from nanotubes to nanowires and subsequently to nanoneedles in the presence of argon gas. The size of the pure zirconium nanograins was estimated to be approximately 200–300 nm. ZrO2 nanotubular arrays with diameters of 70–120 nm were obtained. Both tetragonal and monoclinic ZrO2 were observed after annealing at 450 °C and 650 °C. Only a few tetragonal peaks appeared at 850 °C, while monoclinic ZrO2 was obtained at 900 °C and 950 °C. In assessing the biocompatibility of the ZrO2 surface, the human cell line MDA-MB-231 was found to attach and proliferate well on surfaces annealed at 850 °C and 450 °C; however, the amorphous ZrO2 surface, which was not heat treated, did not permit extensive cell growth, presumably due to remaining fluoride. PMID:27623486

  15. Shear bond strength of veneering porcelain to porous zirconia.

    PubMed

    Nakamura, Takashi; Sugano, Tsuyoshi; Usami, Hirofumi; Wakabayashi, Kazumichi; Ohnishi, Hiroshi; Sekino, Tohru; Yatani, Hirofumi

    2014-01-01

    In this study, two types of porous zirconia and dense zirconia were used. The flexural strength of non-layered zirconia specimens and those of the layered zirconia specimens with veneering porcelain were examined. Furthermore, the shear bond strength of veneering porcelain to zirconia was examined. The flexural strength of the non-layered specimens was 1,220 MPa for dense zirconia and 220 to 306 MPa for porous zirconia. The flexural strength of the layered specimens was 360 MPa for dense zirconia and 132 to 156 MPa for porous zirconia, when a load was applied to the porcelain side. The shear bond strength of porcelain veneered to dense zirconia was 27.4 MPa and that of porcelain veneered to porous zirconia was 33.6 to 35.1 MPa. This suggests that the veneering porcelain bonded strongly to porous zirconia although porous zirconia has a lower flexural strength than dense zirconia.

  16. Residual stress of free-standing membranes of yttria-stabilized zirconia for micro solid oxide fuel cell applications.

    PubMed

    Tarancón, Albert; Sabaté, Neus; Cavallaro, Andrea; Gràcia, Isabel; Roqueta, Jaume; Garbayo, Iñigo; Esquivel, Juan P; Garcia, Gemma; Cané, Carles; Santiso, José

    2010-02-01

    The present study is devoted to analyze the compatibility of yttria-stabilized zirconia thin films prepared by pulsed laser deposition and metalorganic chemical vapor deposition techniques, with microfabrication processes based on silicon technologies for micro solid oxide fuel cells applications. Deposition of yttria-stabilized zirconia on Si/SiO2/Si3N4 substrates was optimized for both techniques in order to obtain high density and homogeneity, as well as a good crystallinity for film thicknesses ranging from 60 to 240 nm. In addition, stabilized zirconia free-standing membranes were fabricated from the deposited films with surface areas between 50 x 50 microm2 and 820 x 820 microm2. Particular emphasis was made on the analysis of the effect of the nature of the deposition technique and the different design and fabrication parameters (membrane area, thickness and substrate deposition temperature) on the residual stress of the membranes in order to control their thermomechanical stability for application as electrolyte in micro solid oxide fuel cells.

  17. Morphological and textural characterization of vanadium oxide supported on zirconia by ionic exchange

    NASA Astrophysics Data System (ADS)

    Gazzoli, Delia; De Rossi, Sergio; Ferraris, Giovanni; Valigi, Mario; Ferrari, Luisa; Selci, Stefano

    2008-12-01

    Zirconia-supported vanadium oxide samples containing vanadium up to 6.8 wt.% were prepared by ionic exchange using aqueous solution of peroxovanadate complexes and hydrous zirconium oxide. The samples, heated at 823 K for 5 h in air, were studied by several techniques, including X-ray diffraction, surface area determinations, diffuse reflectance spectroscopy (UV-vis), Raman spectroscopy, pore size distribution measurements and atomic force microscopy. The results showed that the preparation procedure applied leads to good vanadium dispersion. The interaction between the anchored surface species and the support affects some ZrO 2 properties, including texture and phase transition. Depending on the vanadium loading, several species formed. In the most diluted sample small polyvanadate entities predominate, whereas at increasing vanadium loading (up to about 6 V atoms nm -2) more condensed species formed yielding granular-type surface aggregates. At higher loading, granular-type particles and large flat structures, due to amorphous two- or three-dimensional polyvanadate species and ZrV 2O 7-like structures developed. Treatments with an ammonia solution specified that only a fraction of the vanadium species (in a polymeric form) interacts with the zirconia surface. Atomic force microscopy directly imaged the formation of vanadium aggregates (superimposed to the interacting species) at increasing vanadium content and their removal by the ammonia leaching.

  18. Determination of Reactive Surface Area of Melt Glass

    SciTech Connect

    Bourcier,W.L.; Roberts, S.; Smith, D.K.; Hulsey, S.; Newton,L.; Sawvel, A.; Bruton, C.; Papelis, C.; Um, W.; Russell, C. E.; Chapman,J.

    2000-10-01

    A comprehensive investigation of natural and manmade silicate glasses, and nuclear melt glass was undertaken in order to derive an estimate of glass reactive surface area. Reactive surface area is needed to model release rates of radionuclides from nuclear melt glass in the subsurface. Because of the limited availability of nuclear melt glasses, natural volcanic glass samples were collected which had similar textures and compositions as those of melt glass. A flow-through reactor was used to measure the reactive surface area of the analog glasses in the presence of simplified NTS site ground waters. A measure of the physical surface area of these glasses was obtained using the BET gas-adsorption method. The studies on analog glasses were supplemented by measurement of the surface areas of pieces of actual melt glass using the BET method. The variability of the results reflect the sample preparation and measurement techniques used, as well as textural heterogeneity inherent to these samples. Based on measurements of analog and actual samples, it is recommended that the hydraulic source term calculations employ a range of 0.001 to 0.01 m{sup 2}/g for the reactive surface area of nuclear melt glass.

  19. Unique developmental trajectories of cortical thickness and surface area.

    PubMed

    Wierenga, Lara M; Langen, Marieke; Oranje, Bob; Durston, Sarah

    2014-02-15

    There is evidence that the timing of developmental changes in cortical volume and thickness varies across the brain, although the processes behind these differences are not well understood. In contrast to volume and thickness, the regional developmental trajectories of cortical surface area have not yet been described. The present study used a combined cross-sectional and longitudinal design with 201 MRI-scans (acquired at 1.5-T) from 135 typically developing children and adolescents. Scans were processed using FreeSurfer software and the Desikan-Killiany atlas. Developmental trajectories were estimated using mixed model regression analysis. Within most regions, cortical thickness showed linear decreases with age, whereas both cortical volume and surface area showed curvilinear trajectories. On average, maximum surface area occurred later in development than maximum volume. Global gender differences were more pronounced in cortical volume and surface area than in average thickness. Our findings suggest that developmental trajectories of surface area and thickness differ across the brain, both in their pattern and their timing, and that they also differ from the developmental trajectory of global cortical volume. Taken together, these findings indicate that the development of surface area and thickness is driven by different processes, at least in part.

  20. Quantifying object and material surface areas in residences

    SciTech Connect

    Hodgson, Alfred T.; Ming, Katherine Y.; Singer, Brett C.

    2005-01-05

    The dynamic behavior of volatile organic compounds (VOCs) in indoor environments depends, in part, on sorptive interactions between VOCs in the gas phase and material surfaces. Since information on the types and quantities of interior material surfaces is not generally available, this pilot-scale study was conducted in occupied residences to develop and demonstrate a method for quantifying surface areas of objects and materials in rooms. Access to 33 rooms in nine residences consisting of bathrooms, bedroom/offices and common areas was solicited from among research group members living in the East San Francisco Bay Area. A systematic approach was implemented for measuring rooms and objects from 300 cm{sup 2} and larger. The ventilated air volumes of the rooms were estimated and surface area-to-volume ratios were calculated for objects and materials, each segregated into 20 or more categories. Total surface area-to-volume ratios also were determined for each room. The bathrooms had the highest total surface area-to-volume ratios. Bedrooms generally had higher ratios than common areas consisting of kitchens, living/dining rooms and transitional rooms. Total surface area-to-volume ratios for the 12 bedrooms ranged between 2.3 and 4.7 m{sup 2} m{sup -3}. The importance of individual objects and materials with respect to sorption will depend upon the sorption coefficients for the various VOC/materials combinations. When combined, the highly permeable material categories, which may contribute to significant interactions, had a median ratio of about 0.5 m{sup 2} m{sup -3} for all three types of rooms.

  1. On the interfacial fracture of porcelain/zirconia and graded zirconia dental structures.

    PubMed

    Chai, Herzl; Lee, James J-W; Mieleszko, Adam J; Chu, Stephen J; Zhang, Yu

    2014-08-01

    Porcelain fused to zirconia (PFZ) restorations are widely used in prosthetic dentistry. However, their susceptibility to fracture remains a practical problem. The failure of PFZ prostheses often involves crack initiation and growth in the porcelain, which may be followed by fracture along the porcelain/zirconia (P/Z) interface. In this work, we characterized the process of fracture in two PFZ systems, as well as a newly developed graded glass-zirconia structure with emphases placed on resistance to interfacial cracking. Thin porcelain layers were fused onto Y-TZP plates with or without the presence of a glass binder. The specimens were loaded in a four-point-bending fixture with the thin porcelain veneer in tension, simulating the lower portion of the connectors and marginal areas of a fixed dental prosthesis (FDP) during occlusal loading. The evolution of damage was observed by a video camera. The fracture was characterized by unstable growth of cracks perpendicular to the P/Z interface (channel cracks) in the porcelain layer, which was followed by stable cracking along the P/Z interface. The interfacial fracture energy GC was determined by a finite-element analysis taking into account stress-shielding effects due to the presence of adjacent channel cracks. The resulting GC was considerably less than commonly reported values for similar systems. Fracture in the graded Y-TZP samples occurred via a single channel crack at a much greater stress than for PFZ. No delamination between the residual glass layer and graded zirconia occurred in any of the tests. Combined with its enhanced resistance to edge chipping and good esthetic quality, graded Y-TZP emerges as a viable material concept for dental restorations.

  2. Synthesis and Corrosion Study of Zirconia-Coated Carbonyl Iron Particles

    SciTech Connect

    Shen, R.; Shafrir, S.N.; Miao, C.; Wang, M.; Lambropoulos, J.C.; Jacobs, S.D.; Yang, H.

    2010-01-07

    This paper describes the surface modification of micrometer-sized magnetic carbonyl iron particles (CI) with zirconia from zirconium(IV) butoxide using a sol–gel method. Zirconia shells with various thicknesses and different grain sizes and shapes are coated on the surface of CI particles by changing the reaction conditions, such as the amounts of zirconia sol, nitric acid, and CI particles. A silica adhesive layer made from 3-aminopropyl trimethoxysilane (APTMS) can be introduced first onto the surface of CI particles in order to adjust both the size and the shape of zirconia crystals, and thus the roughness of the coating. The microanalyses on these coated particles are studied by field-emission scanning electron microscopy (FE-SEM) and X-ray-diffraction (XRD). Accelerated acid corrosion and air oxidation tests indicate that the coating process dramatically improved oxidation and acid corrosion resistances, which are critical issues in various applications of CI magnetic particles.

  3. Adhesion/cementation to zirconia and other non-silicate ceramics: Where are we now?

    PubMed Central

    Thompson, Jeffrey Y; Stoner, Brian R.; Piascik, Jeffrey R.; Smith, Robert

    2010-01-01

    Non-silicate ceramics, especially zirconia, have become a topic of great interest in the field of prosthetic and implant dentistry. A clinical problem with use of zirconia-based components is the difficulty in achieving suitable adhesion with intended synthetic substrates or natural tissues. Traditional adhesive techniques used with silica-based ceramics do not work effectively with zirconia. Currently, several technologies are being utilized clinically to address this problem, and other approaches are under investigation. Most focus on surface modification of the inert surfaces of high strength ceramics. The ability to chemically functionalize the surface of zirconia appears to be critical in achieving adhesive bonding. This review will focus on currently available approaches as well as new advanced technologies to address this problem. PMID:21094526

  4. Minimal adhesion surface area in tangentially loaded digital contacts.

    PubMed

    Terekhov, Alexander V; Hayward, Vincent

    2011-09-02

    The stick-to-slip transition of a fingertip in contact with a planar surface does not occur instantaneously. As the tangential load increases, portions of the skin adhere while others slip, giving rise to an evolution of the contact state, termed partial slip. We develop a quasi-static model that predicts that if the coefficient of kinetic friction is larger than the coefficient of static friction, then the stuck surface area diminishes as the tangential load increases until reaching a 'minimal adhesion surface area' where it vanishes abruptly. This phenomenon was observed in recently measured finger-slip image data (André et al., 2011) that were processed by an optic flow detection algorithm. We examined the results of 10 trials. Four of them exhibited the minimal adhesion surface area phenomenon, four of them did not, and two were inconclusive.

  5. A framework for predicting surface areas in microporous coordination polymers.

    PubMed

    Schnobrich, Jennifer K; Koh, Kyoungmoo; Sura, Kush N; Matzger, Adam J

    2010-04-20

    A predictive tool termed the linker to metal cluster (LiMe) ratio is introduced as a method for understanding surface area in microporous coordination polymers (MCPs). Calibrated with geometric accessible surface area computations, the LiMe ratio uses molecular weight of building block components to indicate the maximum attainable surface area for a given linker and metal cluster combination. MOF-5 and HKUST-1 are used as prototypical structures to analyze MCPs with octahedral M(4)O(CO(2)R)(6) and paddlewheel M(2)(CO(2)R)(4) metal clusters. Insight into the effects of linker size, geometry, number of coordinating groups, and framework interpenetration is revealed through the LiMe ratio analysis of various MCPs. Experimental surface area deviation provides indication that a material may suffer from incomplete guest removal, structural collapse, or interpenetration. Because minimal data input are required, the LiMe ratio surface area analysis is suggested as a quick method for experimental verification as well as a guide for the design of new materials.

  6. The effect of melt infiltration of borosilicate glass on biaxial flexural strength of porcelain-veneered zirconia

    NASA Astrophysics Data System (ADS)

    Joo, Kyu Ji; Song, Kyung Woo; Jung, Jong Hyun; Ahn, Hyo Jin; Park, Il Song; Lee, Min Ho; Bae, Tae Sung

    2011-08-01

    To evaluate the effect of melt infiltration on the biaxial flexural strength of porcelain-bonded zirconia, borosilicate glasses were used in this study. Presintered yttria-stabilized tetragonal zirconia polycrystals (Y-TZP) blocks were milled and used for disc specimens. Prior to veneering of porcelain, the infiltration of borosilicate glass on zirconia was performed at 1,100 °C for 1 h. After a biaxial flexural test with the crosshead speed of 0.1 mm/min, fractured surfaces and interfaces between zirconia and veneer porcelain were observed with a Scanning Electron Microscope (SEM). The fracture strength of sintered zirconia and veneer porcelain was significantly increased by the melt infiltration of borosilicate glass (P < 0.05). The melt infiltration process of borosilicate glass greatly improved the Weibull modulus of sintered zirconia. However, the Weibull modulus of porcelain increased slightly. The sintered zirconia group showed a smooth fracture surface containing many pores, but the glass-infiltrated zirconia group showed a rough fracture surface.

  7. Effect of Time and Temperature on Transformation Toughened Zirconias.

    DTIC Science & Technology

    1987-06-01

    TTZ) and tetragonal airconia polycrystal ( TZP ), as well as sirconla toughened alumina (ZTA), among others. Zirconia based materials are of interest due... zirconia case, two ftctors that affect the analysis are the difficulty in resolving the tetragonal (101) and cubic (111) peaks when copper radiation is...The materials were magnesia stabilized transforma- tion toughened zirconia , yttria stabilized tetragonal zirconia polycrystal, and zirconia toughened

  8. Observed Asteroid Surface Area in the Thermal Infrared

    NASA Astrophysics Data System (ADS)

    Nugent, C. R.; Mainzer, A.; Masiero, J.; Wright, E. L.; Bauer, J.; Grav, T.; Kramer, E.; Sonnett, S.

    2017-02-01

    The rapid accumulation of thermal infrared observations and shape models of asteroids has led to increased interest in thermophysical modeling. Most of these infrared observations are unresolved. We consider what fraction of an asteroid’s surface area contributes the bulk of the emitted thermal flux for two model asteroids of different shapes over a range of thermal parameters. The resulting observed surface in the infrared is generally more fragmented than the area observed in visible wavelengths, indicating high sensitivity to shape. For objects with low values of the thermal parameter, small fractions of the surface contribute the majority of thermally emitted flux. Calculating observed areas could enable the production of spatially resolved thermal inertia maps from non-resolved observations of asteroids.

  9. High surface area electrode for high efficient microbial electrosynthesis

    NASA Astrophysics Data System (ADS)

    Nie, Huarong; Cui, Mengmeng; Lu, Haiyun; Zhang, Tian; Russell, Thomas; Lovley, Derek

    2012-02-01

    Microbial electrosynthesis, a process in which microorganisms directly accept electrons from an electrode to convert carbon dioxide and water into multi carbon organic compounds, affords a novel route for the generation of valuable products from electricity or even wastewater. The surface area of the electrode is critical for high production. A biocompatible, highly conductive, three-dimensional cathode was fabricated from a carbon nanotube textile composite to support the microorganism to produce acetate from carbon dioxide. The high surface area and macroscale porous structure of the intertwined CNT coated textile ?bers provides easy microbe access. The production of acetate using this cathode is 5 fold larger than that using a planar graphite electrode with the same volume. Nickel-nanowire-modified carbon electrodes, fabricated by microwave welding, increased the surface area greatly, were able to absorb more bacteria and showed a 1.5 fold increase in performance

  10. Evolution of the surface area of a snow layer

    SciTech Connect

    Hanot, L.; Domine, F.

    1999-12-01

    Atmospheric trace gases can partition between the atmosphere and the snow surface. Because snow has a large surface-to-volume ratio, an important interaction potential between ice and atmospheric trace gases exists. Quantifying this partitioning requires the knowledge of the surface area (SA) of snow. Eleven samples were taken from a 50 cm thick snow fall at Col de Porte, near Grenoble (French Alps) between January 20 and February 4, 1998. Fresh snow and 3, 8, and 15-day-old snow were sampled at three different depths. Surface hoar, formed after the fall, was also sampled. Air and surface snow temperature, snow density, and snow fall rate were measured. Snow temperature always remained below freezing. Snow SA was measured using methane adsorption at 77.15 K. Values ranged from 2.25 m{sup 2}/g for fresh snow to 0.25 m{sup 2}/g for surface hoar and surface snow after 15 days. These values are much too high to be explained by the macroscopic aspect of snow crystals, and microstructures such as small rime droplets must have been present. Large decrease in SA with time were observed. The first meter of snowpack had a total surface area of about 50,000 m{sup 2} per m{sup 2} of ground. Reduction in SA will lead to the emission of adsorbed species by the snowpack, with possible considerable increase in atmospheric concentrations.

  11. Comparison of the osteogenic potential of titanium- and modified zirconia-based bioceramics.

    PubMed

    Cho, Young-Dan; Shin, Ji-Cheol; Kim, Hye-Lee; Gerelmaa, Myagmar; Yoon, Hyung-In; Ryoo, Hyun-Mo; Kim, Dae-Joon; Han, Jung-Suk

    2014-03-13

    Zirconia is now favored over titanium for use in dental implant materials because of its superior aesthetic qualities. However, zirconia is susceptible to degradation at lower temperatures. In order to address this issue, we have developed modified zirconia implants that contain tantalum oxide or niobium oxide. Cells attached as efficiently to the zirconia implants as to titanium-based materials, irrespective of surface roughness. Cell proliferation on the polished surface was higher than that on the rough surfaces, but the converse was true for the osteogenic response. Cells on yttrium (Y)/tantalum (Ta)- and yttrium (Y)/niobium (Nb)-stabilized tetragonal zirconia polycrystals (TZP) discs ((Y, Ta)-TZP and (Y, Nb)-TZP, respectively) had a similar proliferative potential as those grown on anodized titanium. The osteogenic potential of MC3T3-E1 pre-osteoblast cells on (Y, Ta)-TZP and (Y, Nb)-TZP was similar to that of cells grown on rough-surface titanium. These data demonstrate that improved zirconia implants, which are resistant to temperature-induced degradation, retain the desirable clinical properties of structural stability and support of an osteogenic response.

  12. Comparison of the Osteogenic Potential of Titanium and Modified Zirconia-Based Bioceramics

    PubMed Central

    Cho, Young-Dan; Shin, Ji-Cheol; Kim, Hye-Lee; Gerelmaa, Myagmar; Yoon, Hyung-In; Ryoo, Hyun-Mo; Kim, Dae-Joon; Han, Jung-Suk

    2014-01-01

    Zirconia is now favored over titanium for use in dental implant materials because of its superior aesthetic qualities. However, zirconia is susceptible to degradation at lower temperatures. In order to address this issue, we have developed modified zirconia implants that contain tantalum oxide or niobium oxide. Cells attached as efficiently to the zirconia implants as to titanium-based materials, irrespective of surface roughness. Cell proliferation on the polished surface was higher than that on the rough surfaces, but the converse was true for the osteogenic response. Cells on yttrium oxide (Y2O3)/tantalum oxide (Ta2O5)- and yttrium oxide (Y2O3)/niobium oxide (Nb2O5)-containing tetragonal zirconia polycrystals (TZP) discs ((Y, Ta)-TZP and (Y, Nb)-TZP, respectively) had a similar proliferative potential as those grown on anodized titanium. The osteogenic potential of MC3T3-E1 pre-osteoblast cells on (Y, Ta)-TZP and (Y, Nb)-TZP was similar to that of cells grown on rough-surface titanium. These data demonstrate that improved zirconia implants, which are resistant to temperature-induced degradation, retain the desirable clinical properties of structural stability and support of an osteogenic response. PMID:24633198

  13. Sintering behavior and mechanical properties of zirconia compacts fabricated by uniaxial press forming

    PubMed Central

    Oh, Gye-Jeong; Yun, Kwi-Dug; Lee, Kwang-Min; Lim, Hyun-Pil

    2010-01-01

    PURPOSE The purpose of this study was to compare the linear sintering behavior of presintered zirconia blocks of various densities. The mechanical properties of the resulting sintered zirconia blocks were then analyzed. MATERIALS AND METHODS Three experimental groups of dental zirconia blocks, with a different presintering density each, were designed in the present study. Kavo Everest® ZS blanks (Kavo, Biberach, Germany) were used as a control group. The experimental group blocks were fabricated from commercial yttria-stabilized tetragonal zirconia powder (KZ-3YF (SD) Type A, KCM. Corporation, Nagoya, Japan). The biaxial flexural strengths, microhardnesses, and microstructures of the sintered blocks were then investigated. The linear sintering shrinkages of blocks were calculated and compared. RESULTS Despite their different presintered densities, the sintered blocks of the control and experimental groups showed similar mechanical properties. However, the sintered block had different linear sintering shrinkage rate depending on the density of the presintered block. As the density of the presintered block increased, the linear sintering shrinkage decreased. In the experimental blocks, the three sectioned pieces of each block showed the different linear shrinkage depending on the area. The tops of the experimental blocks showed the lowest linear sintering shrinkage, whereas the bottoms of the experimental blocks showed the highest linear sintering shrinkage. CONCLUSION Within the limitations of this study, the density difference of the presintered zirconia block did not affect the mechanical properties of the sintered zirconia block, but affected the linear sintering shrinkage of the zirconia block. PMID:21165274

  14. Electrochemical capacitors utilizing low surface area carbon fiber

    SciTech Connect

    Lipka, S.M.

    1997-12-01

    The performance of electrochemical capacitors containing different commercial carbon fibers is reviewed. High specific capacitances (ca. 300 F/g) are obtained with low surface area carbon fiber (<1 m2/g) using a proprietary activation process. Capacitance is primarily achieved through pseudocapacitance resulting from surface functional groups. The performance of these devices is dependent on the type of carbon fiber, its carbon content, aspect ratio and microstructure. These devices can achieve high cycle life (ca. 100k) without significant loss in capacitance.

  15. Effective surface areas of coals measured by dye adsorption

    SciTech Connect

    Spitzer, D.P.

    1988-01-01

    The primary interest has been to examine adsorption behavior especially at short contact times, ten minutes to an hour, to determine whether such measurements might give useful data on effective surface areas - i.e., the surface that would be accessible to reagents within times comparable to those typical of most coal processing. Accordingly, most of the emphasis is on the effect of time on adsorption, rather than on traditional adsorption isotherms. Although most literature on cationic dye adsorption (mostly on carbons) uses methylene blue, it happened that the authors originally used safranin O instead because this dye was reported to be useful in distinguishing oxidized coals from fresh coals. Many of their experiments were repeated using methylene blue (in water), with very similar results. It was noted early that swelling of coals in water was common, especially for more oxidized or lower rank coals, and adsorption experiments were also done in another solvent, namely methanol. This produced quite striking differences for some coals. Coal surfaces that are readily accessible to adsorption by safranin are found to correlate well with N/sub 2/ surface areas, with adsorption of 1.0 mg safranin per gram of coal corresponding to essentially a surface area of 1.0 m/sup 2//g. Highly oxidized coals were found to swell considerably in water, with correspondingly increased adsorption. Areas of such coals can be estimated by adsorption of safranin from methanol solutions.

  16. High surface area carbon and process for its production

    DOEpatents

    Romanos, Jimmy; Burress, Jacob; Pfeifer, Peter; Rash, Tyler; Shah, Parag; Suppes, Galen

    2016-12-13

    Activated carbon materials and methods of producing and using activated carbon materials are provided. In particular, biomass-derived activated carbon materials and processes of producing the activated carbon materials with prespecified surface areas and pore size distributions are provided. Activated carbon materials with preselected high specific surface areas, porosities, sub-nm (<1 nm) pore volumes, and supra-nm (1-5 nm) pore volumes may be achieved by controlling the degree of carbon consumption and metallic potassium intercalation into the carbon lattice during the activation process.

  17. Large area, surface discharge pumped, vacuum ultraviolet light source

    DOEpatents

    Sze, Robert C.; Quigley, Gerard P.

    1996-01-01

    Large area, surface discharge pumped, vacuum ultraviolet (VUV) light source. A contamination-free VUV light source having a 225 cm.sup.2 emission area in the 240-340 nm region of the electromagnetic spectrum with an average output power in this band of about 2 J/cm.sup.2 at a wall-plug efficiency of approximately 5% is described. Only ceramics and metal parts are employed in this surface discharge source. Because of the contamination-free, high photon energy and flux, and short pulse characteristics of the source, it is suitable for semiconductor and flat panel display material processing.

  18. Large area, surface discharge pumped, vacuum ultraviolet light source

    DOEpatents

    Sze, R.C.; Quigley, G.P.

    1996-12-17

    Large area, surface discharge pumped, vacuum ultraviolet (VUV) light source is disclosed. A contamination-free VUV light source having a 225 cm{sup 2} emission area in the 240-340 nm region of the electromagnetic spectrum with an average output power in this band of about 2 J/cm{sup 2} at a wall-plug efficiency of approximately 5% is described. Only ceramics and metal parts are employed in this surface discharge source. Because of the contamination-free, high photon energy and flux, and short pulse characteristics of the source, it is suitable for semiconductor and flat panel display material processing. 3 figs.

  19. Fracture resistance of zirconia-composite veneered crowns in comparison with zirconia-porcelain crowns.

    PubMed

    Alsadon, Omar; Patrick, David; Johnson, Anthony; Pollington, Sarah; Wood, Duncan

    2017-02-11

    The objectives were to evaluate the fracture resistance and stress concentration in zirconia/composite veneered crowns in comparison to zirconia/porcelain crowns using occlusal fracture resistance and by stress analysis using finite element analysis method. Zirconia substructures were divided into two groups based on the veneering material. A static load was applied occlusally using a ball indenter and the load to fracture was recorded in Newtons (N). The same crown design was used to create 3D crown models and evaluated using FEA. The zirconia/composite crowns subjected to static occlusal load showed comparable results to the zirconia/porcelain crowns. Zirconia/composite crowns showed higher stress on the zirconia substructure at 63.6 and 50.9 MPa on the zirconia substructure veneered with porcelain. In conclusion, zirconia/composite crowns withstood high occlusal loads similar to zirconia/porcelain crowns with no significant difference. However, the zirconia/composite crowns showed higher stress values than the zirconia/porcelain crowns at the zirconia substructure.

  20. Determining Surface Roughness in Urban Areas Using Lidar Data

    NASA Technical Reports Server (NTRS)

    Holland, Donald

    2009-01-01

    An automated procedure has been developed to derive relevant factors, which can increase the ability to produce objective, repeatable methods for determining aerodynamic surface roughness. Aerodynamic surface roughness is used for many applications, like atmospheric dispersive models and wind-damage models. For this technique, existing lidar data was used that was originally collected for terrain analysis, and demonstrated that surface roughness values can be automatically derived, and then subsequently utilized in disaster-management and homeland security models. The developed lidar-processing algorithm effectively distinguishes buildings from trees and characterizes their size, density, orientation, and spacing (see figure); all of these variables are parameters that are required to calculate the estimated surface roughness for a specified area. By using this algorithm, aerodynamic surface roughness values in urban areas can then be extracted automatically. The user can also adjust the algorithm for local conditions and lidar characteristics, like summer/winter vegetation and dense/sparse lidar point spacing. Additionally, the user can also survey variations in surface roughness that occurs due to wind direction; for example, during a hurricane, when wind direction can change dramatically, this variable can be extremely significant. In its current state, the algorithm calculates an estimated surface roughness for a square kilometer area; techniques using the lidar data to calculate the surface roughness for a point, whereby only roughness elements that are upstream from the point of interest are used and the wind direction is a vital concern, are being investigated. This technological advancement will improve the reliability and accuracy of models that use and incorporate surface roughness.

  1. Bonding of Resin Cement to Zirconia with High Pressure Primer Coating

    PubMed Central

    Wang, Ying-jie; Jiao, Kai; Liu, Yan; Zhou, Wei; Shen, Li-juan; Fang, Ming; Li, Meng; Zhang, Xiang; Tay, Franklin R.; Chen, Ji-hua

    2014-01-01

    Objectives To investigate the effect of air-drying pressure during ceramic primer coating on zirconia/resin bonding and the surface characteristics of the primed zirconia. Methods Two ceramic primers (Clearfil Ceramic Primer, CCP, Kuraray Medical Inc. and Z-Prime Plus, ZPP, Bisco Inc.) were applied on the surface of air-abraded zirconia (Katana zirconia, Noritake) and dried at 4 different air pressures (0.1–0.4 MPa). The primed zirconia ceramic specimens were bonded with a resin-based luting agent (SA Luting Cement, Kuraray). Micro-shear bond strengths of the bonded specimens were tested after 3 days of water storage or 5,000× thermocycling (n = 12). Failure modes of the fractured specimens were examined with scanning electron miscopy. The effects of air pressure on the thickness of the primer layers and the surface roughness (Sa) of primed zirconia were evaluated using spectroscopic ellipsometry (n = 6), optical profilometry and environmental scanning electron microscopy (ESEM) (n = 6), respectively. Results Clearfil Ceramic Primer air-dried at 0.3 and 0.4 MPa, yielding significantly higher µSBS than gentle air-drying subgroups (p<0.05). Compared to vigorous drying conditions, Z-Prime Plus air-dried at 0.2 MPa exhibited significantly higher µSBS (p<0.05). Increasing air-drying pressure reduced the film thickness for both primers. Profilometry measurements and ESEM showed rougher surfaces in the high pressure subgroups of CCP and intermediate pressure subgroup of ZPP. Conclusion Air-drying pressure influences resin/zirconia bond strength and durability significantly. Higher air-drying pressure (0.3-0.4 MPa) for CCP and intermediate pressure (0.2 MPa) for ZPP are recommended to produce strong, durable bonds between resin cement and zirconia ceramics. PMID:24992678

  2. Sol-gel synthesis and catalytic properties of sulfated zirconia catalysts

    SciTech Connect

    Li, B.; Gonzalez, R.D.

    1996-09-01

    Sulfated zirconia catalysts were prepared using a sol-gel method with zirconium n-propoxide as the alkoxide precursor and a water/alkoxide ratio of 40. The strength of the sulfuric acid solution used to activate the zirconia was found to be an important variable in the synthesis of the superacid catalyst. A maximum both in the BET surface area and in the activity observed in the isomerization of n-butane was observed when 0.5 N H{sub 2}SO{sub 4} was used. Rehydration in air following calcination at 600 C requires that excess moisture be removed prior to reaction. The deactivation rate of the sample could be reduced by introducing H{sub 2} into the feed. A TGA-mass spectroscopy study of the deactivated catalysts shows two SO{sub 2} desorption maxima at 600 and 900 C. The SO{sub 2} desorption maximum at 600 C is coincident with a CO{sub 2} maximum at the same temperature. These results are interpreted in terms of an organo-sulfur complex on the surface of the deactivated catalyst.

  3. Estimating 3-dimensional colony surface area of field corals

    EPA Science Inventory

    Colony surface area is a critical descriptor for biological and physical attributes of reef-building (scleractinian, stony) corals. The three-dimensional (3D) size and structure of corals are directly related to many ecosystem values and functions. Most methods to estimate colony...

  4. Increasing biochar surface area: effects of various milling

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Biochar produced from corn stover is a renewable, plentiful source of carbon that is a potential substitute for carbon black as rubber composite filler and also as binder/filter media for water or beverage purification applications. However, to be successful in these applications, the surface area o...

  5. Increasing biochar surface area: Optimization of ball milling parameters

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Biochar produced from corn stover is a renewable, plentiful source of carbon that is a potential substitute for carbon black as rubber composite filler and also as binder/filter media for water or beverage purification applications. However, to be successful in these applications, the surface area o...

  6. Interface Surface Area Tracking for the Conservative Level Set Method

    NASA Astrophysics Data System (ADS)

    Firehammer, Stephanie; Desjardins, Olivier

    2015-11-01

    One key question in liquid-gas flows is how to model the interface between phases in a way that is mass, momentum, and energy conserving. The accurate conservative level set (ACLS) method of Desjardins et al. provides a tool for tracking a liquid-gas interface with minimal mass conservation issues; however, it does not explicitly compute the interface surface area and thus nothing can be said a priori about the balance between kinetic energy and surface energy. This work examines an equation for the transport of interface surface area density, which can be written in terms of the gradient of the volume fraction. Furthermore this presentation will outline a numerical method for jointly transporting a conservative level set and surface area density. Finally, we will explore oppportunities for energy conservation via the accurate exchange of energy between the flow field and the interface through surface tension, with test cases to show the results of our extended ACLS method. Funding from the National Science Foundation is gratefully acknowledged.

  7. Effect of milling temperatures on surface area, surface energy and cohesion of pharmaceutical powders.

    PubMed

    Shah, Umang V; Wang, Zihua; Olusanmi, Dolapo; Narang, Ajit S; Hussain, Munir A; Tobyn, Michael J; Heng, Jerry Y Y

    2015-11-10

    Particle bulk and surface properties are influenced by the powder processing routes. This study demonstrates the effect of milling temperatures on the particle surface properties, particularly surface energy and surface area, and ultimately on powder cohesion. An active pharmaceutical ingredient (API) of industrial relevance (brivanib alaninate, BA) was used to demonstrate the effect of two different, but most commonly used milling temperatures (cryogenic vs. ambient). The surface energy of powders milled at both cryogenic and room temperatures increased with increasing milling cycles. The increase in surface energy could be related to the generation of surface amorphous regions. Cohesion for both cryogenic and room temperature milled powders was measured and found to increase with increasing milling cycles. For cryogenic milling, BA had a surface area ∼ 5× higher than the one obtained at room temperature. This was due to the brittle nature of this compound at cryogenic temperature. By decoupling average contributions of surface area and surface energy on cohesion by salinization post-milling, the average contribution of surface energy on cohesion for powders milled at room temperature was 83% and 55% at cryogenic temperature.

  8. Sol-gel derived bioactive coating on zirconia: Effect on flexural strength and cell proliferation.

    PubMed

    Shahramian, Khalil; Leminen, Heidi; Meretoja, Ville; Linderbäck, Paula; Kangasniemi, Ilkka; Lassila, Lippo; Abdulmajeed, Aous; Närhi, Timo

    2016-09-07

    The purpose of this study was to evaluate the effect of sol-gel derived bioactive coatings on the biaxial flexural strength and fibroblast proliferation of zirconia, aimed to be used as an implant abutment material. Yttrium stabilized zirconia disc-shaped specimens were cut, ground, sintered, and finally cleansed ultrasonically in each of acetone and ethanol for 5 minutes. Three experimental groups (n = 15) were fabricated, zirconia with sol-gel derived titania (TiO2 ) coating, zirconia with sol-gel derived zirconia (ZrO2 ) coating, and non-coated zirconia as a control. The surfaces of the specimens were analyzed through images taken using a scanning electron microscope (SEM), and a non-contact tapping mode atomic force microscope (AFM) was used to record the surface topography and roughness of the coated specimens. Biaxial flexural strength values were determined using the piston-on-three ball technique. Human gingival fibroblast proliferation on the surface of the specimens was evaluated using AlamarBlue assay™. Data were analyzed using a one-way analysis of variance (ANOVA) followed by Tukey's post-hoc test. Additionally, the biaxial flexural strength data was also statistically analyzed with the Weibull distribution. The biaxial flexural strength of zirconia specimens was unaffected (p > 0.05). Weibull modulus of TiO2 coated and ZrO2 coated groups (5.7 and 5.4, respectively) were lower than the control (8.0). Specimens coated with ZrO2 showed significantly lower fibroblast proliferation compared to other groups (p < 0.05). In conclusion, sol-gel derived coatings have no influence on the flexural strength of zirconia. ZrO2 coated specimens showed significantly lower cell proliferation after 12 days than TiO2 coated or non-coated control. © 2016 Wiley Periodicals, Inc. J Biomed Mater Res Part B: Appl Biomater, 2016.

  9. Reliability and properties of ground Y-TZP-zirconia ceramics.

    PubMed

    Luthardt, R G; Holzhüter, M; Sandkuhl, O; Herold, V; Schnapp, J D; Kuhlisch, E; Walter, M

    2002-07-01

    Yttria-stabilized zirconia ceramics is a high-performance material with excellent biocompatibility and mechanical properties, which suggest its suitability for posterior fixed partial dentures. The hypothesis under examination is that the strength and reliability of Y-TZP zirconia ceramics are affected by the inner surface grinding of crowns, and vary with the grinding parameter. Flexural strength, surface roughness, and fracture toughness were determined on samples machined by face and peripheral grinding with varied feed velocities and cutting depths. Results have been compared with those on lapped samples. Analysis of variance and Weibull parameter were used for statistical analysis. It was found that inner surface grinding significantly reduces the strength and reliability of Y-TZP zirconia compared with the lapped control sample. Co-analysis of flexural strength, Weibull parameter, and fracture toughness showed counteracting effects of surface compressive stress and grinding-introduced surface flaws. In conclusion, grinding of Y-TZP needs to be optimized to achieve the CAD/CAM manufacture of all-ceramic restorations with improved strength and reliability.

  10. Experimental and DFT studies of initiation processes for butane isomerization over sulfated-zirconia catalysts

    SciTech Connect

    Hong, Z.; Watwe, R.M.; Natal-Santiago, M.A.; Hill, J.M.; Dumesic, J.A.; Fogash, K.B.; Kim, B.; Masqueda-Jimenez, B.I.

    1998-09-10

    Reaction kinetics studies were conducted of isobutane and n-butane isomerization at 423 K over sulfated-zirconia, with the butane feeds purified of olefins. Dihydrogen evolution was observed during butane isomerization over fresh catalysts, as well as over catalysts selectively poisoned by preadsorbed ammonia. Butane isomerization over sulfated-zirconia can be viewed as a surface chain reaction comprised of initiation, propagation, and termination steps. The primary initiation step in the absence of feed olefins is considered to be the dehydrogenation of butane over sulfated-zirconia, generating butenes which adsorb onto acid sites to form protonated olefinic species associated with the conjugate base form of the acid sites. Quantum-chemical calculations, employing density-functional theory, suggest that the dissociative adsorption of dihydrogen, isobutylene hydrogenation, and dissociative adsorption of isobutane are feasible over the sulfated-zirconia cluster, and these reactions take place over Zr-O sites.

  11. Excess surface area in bioelectrochemical systems causes ion transport limitations

    PubMed Central

    Harrington, Timothy D.; Babauta, Jerome T.; Davenport, Emily K.; Renslow, Ryan S.; Beyenal, Haluk

    2014-01-01

    We investigated ion transport limitations on 3D graphite felt electrodes by growing Geobacter sulfurreducens biofilms with advection to eliminate external mass transfer limitations. We characterized ion transport limitations by: 1) showing that serially increasing NaCl concentration up to 200 mM increased current linearly up to a total of +273% vs. 0 mM NaCl under advective conditions, 2) growing the biofilm with a starting concentration of 200 mM NaCl, which led to a maximum current increase of 400% vs. current generation without NaCl, and 3) showing that un-colonized surface area remained even after steady-state current was reached. After accounting for iR effects, we confirmed that the excess surface area existed despite a non-zero overpotential at the electrode surface. The fact that the biofilm was constrained from colonizing and producing further current under these conditions confirmed the biofilms under study here were ion transport-limited. Our work demonstrates that the use of high surface area electrodes may not increase current density when the system design allows ion transport limitations to become dominant. PMID:25421463

  12. Surface area and conductivity of polyaniline synthesized under UV irradiation

    NASA Astrophysics Data System (ADS)

    Budi, S.; Fitri, E.; Paristiowati, M.; Cahyana, U.; Pusparini, E.; Nasbey, H.; Imaddudin, A.

    2017-02-01

    This paper reports our study on the synthesis of high electrical conductivity and surface area polyaniline using oxidative polymerization under UV light irradiation. The formation of emeraldine structures of polyaniline was revealed by major absorption bands of FTIR (Fourier transform infrared spectroscopy) spectra attributed to C-N stretching, C=C stretching in the benzenoid ring, C=C stretching in the quinoid ring and QNH+B stretching. XRD (X-ray diffractometer) measurements confirmed typical diffraction patterns with a crystallinity of 13% and 16% for polyaniline prepared under non-stirred and stirred reaction, respectively. SEM (Scanning electron microscope) studies showed more uniform morphology of polyaniline was obtained with stirring reaction process compare to those prepared without stirring. Surface analysis using SAA (surface area analyzer) showed that pure polyaniline with the relatively high surface area of ca.28 m2/g was successfully prepared in this work. Based on four point probe measurement, the prepared polyaniline possesses high conductivity which is important in electrode application.

  13. A fast pairwise evaluation of molecular surface area.

    PubMed

    Vasilyev, Vladislav; Purisima, Enrico O

    2002-05-01

    A fast and general analytical approach was developed for the calculation of the approximate van der Waals and solvent-accessible surface areas. The method is based on three basic ideas: the use of the Lorentz transformation formula, a rigid-geometry approximation, and a single fitting parameter that can be refitted on the fly during a simulation. The Lorentz transformation equation is used for the summation of the areas of an atom buried by its neighboring contacting atoms, and implies that a sum of the buried pairwise areas cannot be larger than the surface area of the isolated spherical atom itself. In a rigid-geometry approximation we numerically calculate and keep constant the surface of each atom buried by the atoms involved in 1-2 and 1-3 interactions. Only the contributions from the nonbonded atoms (1-4 and higher interactions) are considered in terms of the pairwise approximation. The accuracy and speed of the method is competitive with other pairwise algorithms. A major strength of the method is the ease of parametrization.

  14. Tropical cyclone rainfall area controlled by relative sea surface temperature

    PubMed Central

    Lin, Yanluan; Zhao, Ming; Zhang, Minghua

    2015-01-01

    Tropical cyclone rainfall rates have been projected to increase in a warmer climate. The area coverage of tropical cyclones influences their impact on human lives, yet little is known about how tropical cyclone rainfall area will change in the future. Here, using satellite data and global atmospheric model simulations, we show that tropical cyclone rainfall area is controlled primarily by its environmental sea surface temperature (SST) relative to the tropical mean SST (that is, the relative SST), while rainfall rate increases with increasing absolute SST. Our result is consistent with previous numerical simulations that indicated tight relationships between tropical cyclone size and mid-tropospheric relative humidity. Global statistics of tropical cyclone rainfall area are not expected to change markedly under a warmer climate provided that SST change is relatively uniform, implying that increases in total rainfall will be confined to similar size domains with higher rainfall rates. PMID:25761457

  15. In-vitro bioactivity of zirconia doped borosilicate glasses

    SciTech Connect

    Samudrala, Rajkumar; Azeem, P. Abdul E-mail: drazeem2002@yahoo.com

    2015-06-24

    Glass composition 31B{sub 2}O{sub 3}-20SiO{sub 2}-24.5Na{sub 2}O-(24.5-x) CaO-xZrO{sub 2} x=1,2,3,4,5 were prepared by melt-quenching Technique. The formation of hydroxyapatite layer on the surface of glasses after immersion in simulated body fluid (SBF) was explored through XRD, Fourier transform infrared (FTIR) and Scanning electron microscopy (SEM-EDX) analyses. In this report, we observed that hydroxyapatite formation for 5days of immersion time. Also observed that with increasing the immersion time up to 15days, higher amount of hydroxyapatite layer formation on the surface of glasses. The varying composition of zirconia in glass samples influences shown by XRD, FTIR studies. The present results indicate that, in-vitro bioactivity of glasses decreased with increasing zirconia incorporation.

  16. Alumina-Reinforced Zirconia Composites

    NASA Technical Reports Server (NTRS)

    Choi, Sung R.; Bansal, Narottam P.

    2003-01-01

    Alumina-reinforced zirconia composites, used as electrolyte materials for solid oxide fuel cells, were fabricated by hot pressing 10 mol percent yttria-stabilized zirconia (10-YSZ) reinforced with two different forms of alumina particulates and platelets each containing 0 to 30 mol percent alumina. Major mechanical and physical properties of both particulate and platelet composites including flexure strength, fracture toughness, slow crack growth, elastic modulus, density, Vickers microhardness, thermal conductivity, and microstructures were determined as a function of alumina content either at 25 C or at both 25 and 1000 C. Flexure strength and fracture toughness at 1000 C were maximized with 30 particulate and 30 mol percent platelet composites, respectively, while resistance to slow crack growth at 1000 C in air was greater for 30 mol percent platelet composite than for 30 mol percent particulate composites.

  17. Electrical conductivity of zirconia and yttrium-doped zirconia from Indonesian local zircon as prospective material for fuel cells

    NASA Astrophysics Data System (ADS)

    Apriany, Karima; Permadani, Ita; Syarif, Dani G.; Soepriyanto, Syoni; Rahmawati, Fitria

    2016-02-01

    In this research, zirconium dioxide, ZrO2, was synthesized from high-grade zircon sand that was founded from Bangka Island, Sumatra, Indonesia. The zircon sand is a side product of Tin mining plant industry. The synthesis was conducted by caustic fusion method with considering definite stoichiometric mole at every reaction step. Yttrium has been doped into the prepared zirconia by solid state reaction. The prepared materials were then being analyzed by X-ray diffraction equipped with Le Bail refinement to study its crystal structure and cell parameters. Electrical conductivity was studied through impedance measurement at a frequency range of 20 Hz- 5 MHz. Morphological analysis was conducted through Scanning Electron Microscopy (SEM) equipped with Energy Dispersive X-ray (EDX) for elemental analysis. The results show that the prepared yttrium stabilized zirconia, YSZ, was crystallized in the cubic structure with a space group of P42/NMC. The sintered zirconia and yttrium stabilized zirconia at 8 mol% of yttrium ions (8YSZ) show dense surface morphology with a grain size less than 10 pm. Elemental analysis on the sintered zirconia and 8YSZ show that sintering at 1500°C could eliminate the impurities, and the purity became 81.30%. Impedance analysis shows that ZrO2 provide grain and grain boundary conductivity meanwhile 8YSZ only provide grain mechanism. The yttrium doping enhanced the conductivity up to 1.5 orders. The ionic conductivity of the prepared 8YSZ is categorized as a good material with conductivity reach 7.01 x10-3 at 700 °C. The ionic conductivities are still lower than commercial 8YSZ at various temperature. It indicates that purity of raw material might significantly contribute to the electrical conductivity.

  18. Zirconia-molybdenum disilicide composites

    DOEpatents

    Petrovic, John J.; Honnell, Richard E.

    1991-01-01

    Compositions of matter comprised of molybdenum disilicide and zirconium oxide in one of three forms: pure, partially stabilized, or fully stabilized and methods of making the compositions. The stabilized zirconia is crystallographically stabilized by mixing it with yttrium oxide, calcium oxide, cerium oxide, or magnesium oxide and it may be partially stabilized or fully stabilized depending on the amount of stabilizing agent in the mixture.

  19. Influence of the monoclinic and tetragonal zirconia phases on the water gas shift reaction. A theoretical study.

    PubMed

    Cerón, María Luisa; Herrera, Barbara; Araya, Paulo; Gracia, Francisco; Toro-Labbé, Alejandro

    2013-07-01

    We present a theoretical study of the water gas shift reaction taking place on zirconia surfaces modeled by monoclinic and tetragonal clusters. In order to understand the charge transfer between the active species, in this work we analyze the influence of the geometry of monoclinic and tetragonal zirconia using reactivity descriptors such as electronic chemical potential (μ), charge transfer (ΔN) and molecular hardness (η). We have found that the most preferred surface is tetragonal zirconia (tZrO2) indicating also that low charge transfer systems will generate less stable intermediates, that will allow to facilitate desorption process.

  20. High Surface Area Nanoporous Polymers for Reversible HydrogenStorage

    SciTech Connect

    Germain, Jonathan; Hradil, Jiri; Frechet, Jean M.J.; Svec,Frantisek

    2006-06-29

    Hydrogen adsorption using a series of nanoporous synthetic polymers has been studied. Promising results were obtained during the screening of commercially available porous polymer beads; of the polymers considered, hypercrosslinked Hypersol-Macronet MN200 resin exhibited the highest adsorption capacity for hydrogen. This initial success triggered the development of our own high surface area hypercrosslinked materials. Subjecting gel-type and macroporous vinylbenzyl chloride-based precursors swollen in dichloroethane to a Friedel-Crafts reaction catalyzed by iron trichloride afforded beads with surface areas of 1 930 and 1 300 m{sup 2}/g, respectively, as calculated using the BET equation. The former polymer reversibly stores up to 1.5 wt % H{sub 2} at a pressure of 0.12 MPa and a temperature of 77.3 K. The initial heat of adsorption of hydrogen molecules onto this polymer is 6.6 kJ/mol.

  1. High Surface Area Inorganic Membrane for Water Removal

    SciTech Connect

    2008-12-01

    This factsheet describes a research project whose objective is to demonstrate the fabrication and performance advantages of minichannel planar membrane modules made of porous metallic supports of surface area packing density one order of magnitude higher than the conventional membrane tube. The new, transformational, ceramic/metallic, hybrid membrane technology will be used for water/ethanol separations and reduce energy consumption by >20% over distillation and adsorption.

  2. Comparison of shear bond strength of orthodontic brackets using various zirconia primers

    PubMed Central

    Lee, Ji-Yeon; Kim, Jin-Seok

    2015-01-01

    Objective The aim of this study was to compare the shear bond strength (SBS) of orthodontic brackets bonded to zirconia surfaces using three different zirconia primers and one silane primer, and subjected to thermocycling. Methods We designed 10 experimental groups following the surface treatment and thermocycling. The surface was treated with one of the following method: no-primer (NP), Porcelain Conditioner (PC), Z-PRIME Plus (ZP), Monobond Plus (MP) and Zirconia Liner Premium (ZL) (n=20). Then each group was subdivided to non-thermocycled and thermocycled groups (NPT, PC, ZPT, MPT, ZLT) (n=10). Orthodontic brackets were bonded to the specimens using Transbond™ XT Paste and light cured for 15 s at 1,100 mW/cm2. The SBS was measured at a 1 mm/min crosshead speed. The failure mode was assessed by examination with a stereomicroscope and the amount of bonding resin remaining on the zirconia surface was scored using the modified adhesive remnant index (ARI). Results The SBS of all experimental groups decreased after thermocycling. Before thermocycling, the SBS was ZL, ZP ≥ MP ≥ PC > NP but after thermocycling, the SBS was ZLT ≥ MPT ≥ ZPT > PCT = NPT (p > 0.05). For the ARI score, both of the groups lacking primer (NP and NPT) displayed adhesive failure modes, but the groups with zirconia primers (ZP, ZPT, MP, MPT, ZL, and ZLT) were associated with mixed failure modes. Conclusions Surface treatment with a zirconia primer increases the SBS relative to no-primer or silane primer application between orthodontic brackets and zirconia prostheses. PMID:26258062

  3. Excess Surface Area in Bioelectrochemical Systems Causes ion Transport Limitations

    SciTech Connect

    Harrington, Timothy D.; Babauta, Jerome T.; Davenport, Emily K.; Renslow, Ryan S.; Beyenal, Haluk

    2015-05-01

    We investigated ion transport limitations on 3D graphite felt electrodes by growing Geobacter sulfurreducens biofilms with advection to eliminate external mass transfer limitations. We characterized ion transport limitations by: (i) showing that serially increasing NaCl concentration up to 200mM increased current linearly up to a total of þ273% vs. 0mM NaCl under advective conditions; (ii) growing the biofilm with a starting concentration of 200mM NaCl, which led to a maximum current increase of 400% vs. current generation without NaCl, and (iii) showing that un-colonized surface area remained even after steadystate current was reached. After accounting for iR effects, we confirmed that the excess surface area existed despite a non-zero overpotential. The fact that the biofilm was constrained from colonizing and producing further current under these conditions confirmed the biofilms under study here were ion transport-limited. Our work demonstrates that the use of high surface area electrodes may not increase current density when the system design allows ion transport limitations to become dominant.

  4. Solvothermal synthesis of ceria nanoparticles with large surface areas

    SciTech Connect

    Hosokawa, S.; Shimamura, K.; Inoue, M.

    2011-11-15

    Highlights: {yields} Thermal decomposition of Ce(C{sub 7}H{sub 15}COO){sub 3}.xH{sub 2}O synthesized by solvothermal method. {yields} CeO{sub 2} having an extremely large surface area of 180 m{sup 2}/g. {yields} High catalytic activity of Ru catalyst supported on the CeO{sub 2} having high surface area. -- Abstract: Ceria nanoparticles were obtained by the calcination of precursors synthesised via the solvothermal reaction of cerium acetate. The CeO{sub 2} samples obtained by the thermal decomposition of Ce(C{sub 7}H{sub 15}COO){sub 3}.xH{sub 2}O synthesised by solvothermal reaction in 1,4-butanediol in the presence of octanoic acid had an extremely large surface area of 180 m{sup 2}/g. The Ru catalyst supported on this CeO{sub 2} sample showed a high catalytic activity for benzyl alcohol oxidation.

  5. Excess surface area in bioelectrochemical systems causes ion transport limitations.

    PubMed

    Harrington, Timothy D; Babauta, Jerome T; Davenport, Emily K; Renslow, Ryan S; Beyenal, Haluk

    2015-05-01

    We investigated ion transport limitations on 3D graphite felt electrodes by growing Geobacter sulfurreducens biofilms with advection to eliminate external mass transfer limitations. We characterized ion transport limitations by: (i) showing that serially increasing NaCl concentration up to 200 mM increased current linearly up to a total of +273% vs. 0 mM NaCl under advective conditions; (ii) growing the biofilm with a starting concentration of 200 mM NaCl, which led to a maximum current increase of 400% vs. current generation without NaCl, and (iii) showing that un-colonized surface area remained even after steady-state current was reached. After accounting for iR effects, we confirmed that the excess surface area existed despite a non-zero overpotential. The fact that the biofilm was constrained from colonizing and producing further current under these conditions confirmed the biofilms under study here were ion transport-limited. Our work demonstrates that the use of high surface area electrodes may not increase current density when the system design allows ion transport limitations to become dominant.

  6. Facile synthesis of high surface area molybdenum nitride and carbide

    SciTech Connect

    Roy, Aaron; Serov, Alexey; Artyushkova, Kateryna; Brosha, Eric L.; Atanassov, Plamen; Ward, Tim L.

    2015-08-15

    The synthesis of high surface area γ-Mo{sub 2}N and α-Mo{sub 2}C is reported (116 and 120 m{sup 2}/g) without the temperature programmed reduction of MoO{sub 3}. γ-Mo{sub 2}N was prepared in an NH{sub 3}-free synthesis using forming gas (7 at% H{sub 2}, N{sub 2}-balance) as the reactive atmosphere. Three precursors were studied ((NH{sub 4}){sub 6}Mo{sub 7}O{sub 24}·4H{sub 2}O, (NH{sub 4}){sub 2} Mg(MoO{sub 4}){sub 2}, and MgMoO{sub 4}) along with the sacrificial support method (SSM) as a means of reducing the particle size of Mo{sub 2}N and Mo{sub 2}C. In situ X-ray diffraction (XRD) studies were carried out to identify reaction intermediates, the temperature at which various intermediates form, and the average domain size of the Mo{sub 2}N products. Materials were synthesized in bulk and further characterized by XRD, HRTEM, XPS, and BET. - Highlights: • Facile synthesis of γ-Mo2N and α-Mo2C with surface area exceeding 100 m{sup 2}/g. • Sacrificial support method was used to achieve these high surface areas. • Materials can serve as catalysts or supports in (electro)chemical processes.

  7. Determination of Glacier Surface Area Using Spaceborne SAR Imagery

    NASA Astrophysics Data System (ADS)

    Fang, L.; Maksymiuk, O.; Schmitt, M.; Stilla, U.

    2013-04-01

    Glaciers are very important climate indicators. Although visible remote sensing techniques can be used to extract glacier variations effectively and accurately, the necessary data are depending on good weather conditions. In this paper, a method for determination of glacier surface area using multi-temporal and multi-angle high resolution TerraSAR-X data sets is presented. We reduce the "data holes" in the SAR scenes affected by radar shadowing and specular backscattering of smooth ice surfaces by combining the two complementary different imaging geometries (from ascending and descending satellite tracks). Then, a set of suitable features is derived from the intensity image, the texture information generated based on the gray level co-occurrence matrix (GLCM), glacier velocity estimated by speckle tracking, and the interferometric coherence map. Furthermore, the features are selected by 10-foldcross- validation based on the feature relevance importance on classification accuracy using a Random Forests (RF) classifier. With these most relevant features, the glacier surface is discriminated from the background by RF classification in order to calculate the corresponding surface area.

  8. Estimation of surface runoff and water-covered area during filling of surface microrelief depressions

    NASA Astrophysics Data System (ADS)

    Hansen, B.

    2000-05-01

    During the filling of surface microrelief depressions the precipitation excess (precipitation minus infiltration and interception) is divided between surface storage and runoff, i.e. runoff starts before the surface depressions are filled. Information on the division of precipitation excess is needed for modelling surface runoff during the filling of surface depressions. Furthermore, information on the surface of the area covered with water is needed for calculating infiltration of water stored in soil surface depressions. Thirty-two soil surface microreliefs were determined in Danish erosion study plots. The slope was c. 10% for all plots. Data were treated initially by removing the slope, after which 20 artificial slopes (1-20%) were introduced producing 640 new data sets. Runoff during filling of the microrelief storage was calculated for each of the 640 data sets using a model developed for calculating surface storage and runoff from grid elevation measurements. Runoff started immediately after the first addition of water for all data sets. On a field scale, however, runoff has to travel some distance as overland flow and storage in smaller and larger depressions below the runoff initiation point must be taken into consideration. The runoff increases by intermittent steps. Whenever a depression starts to overflow to the border of the plot, the runoff jumps accordingly. In spite of the jumps, the distribution between surface storage and runoff was closely related to the quotient between precipitation excess and depression storage capacity. Surface area covered with water was exponentially related to the amount of water stored in surface depressions. Models for calculating surface storage and runoff from grid elevation measurements are cumbersome and require time-consuming measurements of the soil surface microrelief. Therefore, estimation from roughness indices requiring fewer measurements is desirable. New improved equations for such estimations are suggested.

  9. Nano-Engineered Cubic Zirconia for Orthopaedic Implant Applications

    NASA Astrophysics Data System (ADS)

    Namavar, F.; Rubinstein, A.; Sabirianov, R.; Thiele, G.; Sharp, J.; Pokharel, U.; Namavar, R.; Garvin, K.

    2012-02-01

    Osseointegration failure of the prosthesis prevents long-term stability, which contributes to pain, implant loosening, and infection that usually necessitates revision surgery. Cell attachment and spreading in vitro is generally mediated by adhesive proteins such as fibronectin and vitronectin. We designed and produced pure cubic zirconia (ZrO2) ceramic coatings by ion beam assisted deposition (IBAD) with nanostructures comparable to the size of proteins. Our ceramic coatings exhibit high hardness and a zero contact angle with serum. In contrast to Hydroxyapatite (HA), nano-engineered zirconia films possess excellent adhesion to all orthopaedic materials. Adhesion and proliferation experiments were performed with a bona fide mesenchymal stromal cells cell line (OMA-AD). Our experimental results indicated that nano-engineered cubic zirconia is superior in supporting growth, adhesion, and proliferation. We performed a comparative analysis of adsorption energies of the FN fragment using quantum mechanical calculations and Monte Carlo simulation on both types of surfaces: smooth and nanostructured. We have found that the initial FN fragment adsorbs significantly stronger on the nanostructured surface than on the smooth surface.

  10. Fabrication and Microstructure of Hydroxyapatite Coatings on Zirconia by Room Temperature Spray Process.

    PubMed

    Seo, Dong Seok; Chae, Hak Cheol; Lee, Jong Kook

    2015-08-01

    Hydroxyapatite coatings were fabricated on zirconia substrates by a room temperature spray process and were investigated with regards to their microstructure, composition and dissolution in water. An initial hydroxyapatite powder was prepared by heat treatment of bovine-bone derived powder at 1100 °C for 2 h, while dense zirconia substrates were fabricated by pressing 3Y-TZP powder and sintering it at 1350 °C for 2 h. Room temperature spray coating was performed using a slit nozzle in a low pressure-chamber with a controlled coating time. The phase composition of the resultant hydroxyapatite coatings was similar to that of the starting powder, however, the grain size of the hydroxyapatite particles was reduced to about 100 nm due to their formation by particle impaction and fracture. All areas of the coating had a similar morphology, consisting of reticulated structure with a high surface roughness. The hydroxyapatite coating layer exhibited biostability in a stimulated body fluid, with no severe dissolution being observed during in vitro experimentation.

  11. Biomechanical and histological evaluation of the osseointegration capacity of two types of zirconia implant

    PubMed Central

    Han, Jian-min; Hong, Guang; Lin, Hong; Shimizu, Yoshinaka; Wu, Yuhan; Zheng, Gang; Zhang, Hongyu; Sasaki, Keiichi

    2016-01-01

    The purpose of this study was to evaluate the biomechanical and histological behavior of a ceria-stabilized zirconia–alumina nanocomposite (NanoZr) in comparison with that of 3 mol% yttria-stabilized tetragonal zirconia polycrystalline (3Y-TZP) in Sprague Dawley rats. Cylindrical NanoZr and 3Y-TZP implants (diameter 1 mm, length 2 mm) were used. Implant-surface morphology and surface roughness were determined by scanning white-light interferometry and scanning electron microscopy, respectively. The cylindrical zirconia implants were placed at the distal edge of the femur of Sprague Dawley rats. At weeks 2, 4, and 8, the interfacial shear strength between implant and bone was measured by push-in test. Histological analysis was performed using hard-tissue sections. Bone–implant contact (BIC), the thickness of new bone around the implant within the bone marrow area, and osteoclast numbers were evaluated. The average surface roughness of 3Y-TZP (Sa 0.788 μm) was significantly higher than that of NanoZr (Sa 0.559 μm). The shear strengths of 3Y-TZP and NanoZr were similar at 2 weeks, but at 4 and 8 weeks the shear strength of NanoZr was higher than that of 3Y-TZP. The average BIC values within the bone marrow area for 3Y-TZP and NanoZr were 25.26% and 31.51% at 2 weeks, 46.78% and 38% at 4 weeks, and 47.88% and 56.81% at 8 weeks, respectively. The average BIC values within the cortical area were 38.86% and 58.42% at 2 weeks, 66.82% and 57.74% at 4 weeks, and 79.91% and 78.97% at 8 weeks, respectively. The mean BIC value did not differ significantly between the two zirconia materials at any time point. The NanoZr implants were biocompatible, capable of establishing close BIC, and may be preferred for metal-free dental implants. PMID:27994456

  12. Unique sharp photoluminescence of size-controlled sonochemically synthesized zirconia nanoparticles.

    PubMed

    Manoharan, Divinah; Loganathan, Aswaghosh; Kurapati, Vishista; Nesamony, Victor Jaya

    2015-03-01

    The present study explores the features of tetragonally stabilized polycrystalline zirconia nanophosphors prepared by a sonochemistry based synthesis from zirconium oxalate precursor complex. The sonochemically prepared pristine zirconia, 3 mol%, 5 mol% and 8 mol% yttrium doped zirconia nanophosphors were characterized using thermo-gravimetric analysis (TGA), X-ray diffraction (XRD), Raman spectroscopy, field emission scanning electron microscopy (FE-SEM) with energy dispersive X-ray spectroscopy (EDS), transmission electron microscopy (TEM), diffuse reflectance spectroscopy (DRS) and photoluminescence spectroscopy (PL). The reaction mechanism of formation of zirconia nanophosphors is discussed in detail. The probable sonochemical formation mechanism is being proposed. Stabilization of tetragonal phase of pristine zirconia even at room temperature was effectively established by controlling the particle size using ultrasonic waves. Improved phase purity and good surface morphology of the nanophosphors is being achieved via sonochemical route. FE-SEM micrographs reveal that the nanoparticles have uniform spherical shape and size. The narrow particle size distribution (∼15-25 nm) of the zirconia nanoparticles was found from FE-SEM statistical analysis and further confirmed by TEM. Zirconia nanophosphors exhibit a wide energy band gap and which was found to vary with yttrium dopant concentration. The highlight of the present study is the synthesis of novel nanocrystalline ZrO₂ and Y-ZrO₂ phosphor which simultaneously emits extremely sharp as well as intense UV, violet and cyan light on exciting the host atom. The yttrium ion dopant further enhances the photoluminescence property of zirconia. These nanocrystalline phosphors are likely to have remarkable optical applications as light emitting UV-LEDs, UV lasers and multi color displays.

  13. Thermal-induced residual stresses affect the fractographic patterns of zirconia-veneer dental prostheses.

    PubMed

    Belli, Renan; Petschelt, Anselm; Lohbauer, Ulrich

    2013-05-01

    Veneer fractures in dental zirconia-veneer prostheses are more frequent clinically than in conventional metal-ceramic systems. This is thought to be due to the increased residual stresses generated within the veneer during fabrication when zirconia is the infrastructure material. This investigation aimed to analyze the fractographic features of fractured zirconia-veneer dental crowns submitted to a load-to-failure test and to a more clinically relevant in vitro chewing simulation fatigue test. As-sintered and sandblasted zirconia copings were veneered with glass-ceramic with different coefficients of thermal expansion and cooled following two cooling rates, creating, this way, different levels of stresses within the veneer. Crowns with different thermal mismatch combinations and different cooling rates were hypothesized to present particular fracture patterns. A careful examination of >1000 scanning electron microscopy images of the fracture surfaces was conducted in search of characteristic fractographic markings of fracture mechanisms connected to the stress state of the veneer. Distinctive structural features could be observed between groups veneered with the two different glass-ceramics and between fractured crowns under static and cyclic loading. The presence/absence of residual stresses zones within the veneer have shown to play the major role in the fracture pattern of zirconia-veneer dental prostheses. For the fatigue crowns, the zirconia core was never exposed, either for sandblasted and as-sintered groups.

  14. Influence of post and core materials on distortion around 4-unit zirconia bridge margins.

    PubMed

    Inagaki, Tasuku; Komada, Wataru; Nemoto, Reina; Yoshida, Keiichi; Miura, Hiroyuki

    2014-01-01

    The purpose of this study was to evaluate the surface strain of zirconia fixed partial denture frameworks and their abutment roots when restored with two types of post and core materials. Artificial mandibular first premolars and second molars were used as the abutment teeth. Posts and cores were of two types: resin composite with glass fiber posts (RC) and cast platinum gold alloy (MC). The cores and 4-unit zirconia frameworks were bonded to the specimens. Static loading was applied to the occlusal surfaces, and the surface strain of the frameworks and roots (distal premolar and mesial molar) was measured by strain gauge method. Premolar root showed a significantly higher magnitude of principal strain than molar root. RC showed a significantly higher magnitude of principal strain than MC. The results suggest that MC restrain the surface strain compared to RC when the missing teeth are replaced by a 4-unit zirconia framework.

  15. Zirconia in fixed prosthesis. A literature review

    PubMed Central

    Román-Rodríguez, Juan L.; Ferreiroa, Alberto; Solá-Ruíz, María F.; Fons-Font, Antonio

    2014-01-01

    Statement of problem: Evidence is limited on the efficacy of zirconia-based fixed dental prostheses. Objective: To carry out a literature review of the behavior of zirconium oxide dental restorations. Material and Methods: This literature review searched the Pubmed, Scopus, Medline and Cochrane Library databases using key search words “zirconium oxide,” “zirconia,” “non-metal restorations,” “ceramic oxides,” “veneering ceramic,” “zirconia-based fixed dental prostheses”. Both in vivo and in vitro studies into zirconia-based prosthodontic restoration behavior were included. Results: Clinical studies have revealed a high rate of fracture for porcelain-veneered zirconia-based restorations that varies between 6% and 15% over a 3- to 5-year period, while for ceramo-metallic restorations the fracture rate ranges between 4 and 10% over ten years. These results provoke uncertainty as to the long-term prognosis for this material in the oral medium. The cause of veneering porcelain fractures is unknown but hypothetically they could be associated with bond failure between the veneer material and the zirconia sub-structure. Key words:Veneering ceramic, zirconia-based ceramic restoration, crown, zirconia, tooth-supported fixed prosthesis. PMID:24596638

  16. High surface area aerogels for energy storage and efficiency

    NASA Astrophysics Data System (ADS)

    Maloney, Ryan Patrick

    ADAI are demonstrated in a third-generation prototypical thermoelectric generator for automotive waste heat recovery. The second chapter then details two different aerogel-based materials for electrochemical energy storage. It begins with lithium titanate aerogel, which takes advantage of the high surface area of the aerogel morphology to display a batt-cap behavior. This should allow the lithium titanate aerogel to perform at higher rates than would normally be expected for the bulk oxide material. Additionally, the flexibility of the sol-gel process is demonstrated through the incorporation of electrically conductive high-surface area exfoliated graphite nanoplatelets in the oxide. The last section describes the characterization of a LiMn2O 4 spinel coated carbon nanofoam in a non-aqueous electrolyte. The short diffusion path, high surface area and intimately wired architecture of the nanofoam allows the oxide to retain its capacity at significantly higher rates when compared with literature values for the bulk oxide. Additionally, the nanometric length scale improves cycle life, and the high surface area dramatically increases the insertion capacity by providing a higher concentration of surface defects. Taken together, it is clear that aerogels are an extremely attractive class of material for applications pertaining to energy and efficiency, and further research in this area will provide valuable solutions for pressing societal needs. (Abstract shortened by UMI.).

  17. Fracture Strength of Aged Monolithic and Bilayer Zirconia-Based Crowns

    PubMed Central

    Lameira, Deborah Pacheco; Silva, Wilkens Aurélio Buarque e; Silva, Frederico Andrade e; De Souza, Grace M.

    2015-01-01

    The purpose of this study was to evaluate the effect of design and surface finishing on fracture strength of yttria-tetragonal zirconia polycrystal (Y-TZP) crowns in monolithic (1.5 mm thickness) and bilayer (0.8 mm zirconia coping and 0.7 mm porcelain veneer) configuration after artificial aging. Bovine incisors received crown preparation and Y-TZP crowns were manufactured using CAD/CAM technique, according to the following groups (n = 10): Polished monolithic zirconia crowns (PM); Glazed monolithic zirconia crowns (GM); Bi-layer crowns (BL). Crowns were cemented with resin cement, submitted to artificial aging in a chewing simulator (2.5 million cycles/80 N/artificial saliva/37°C), and tested for fracture strength. Two remaining crowns referring to PM and GM groups were submitted to a chemical composition analysis to measure the level of yttrium after aging. One-way ANOVA and Tukey's test (P = .05) indicated that monolithic zirconia crowns presented similar fracture strength (PM = 3476.2 N ± 791.7; GM = 3561.5 N ± 991.6), which was higher than bilayer crowns (2060.4 N ± 810.6). There was no difference in the yttrium content among the three surfaces evaluated in the monolithic crowns. Thus, monolithic zirconia crowns present higher fracture strength than bilayer veneered zirconia after artificial aging and surface finishing does not affect their fracture strength. PMID:26576423

  18. Surface area-dependent second harmonic generation from silver nanorods.

    PubMed

    Ngo, Hoang Minh; Luong, Thanh Tuyen; Ledoux-Rak, Isabelle

    2016-08-17

    The nonlinear optical (NLO) properties of metallic nanoparticles strongly depend on their size and shape. Metallic gold nanorods have already been widely investigated, but other noble metals could also be used for nanorod fabrication towards applications in photonics. Here we report on the synthesis and NLO characterization of silver nanorods (AgNRs) with controllable localized surface plasmon resonance. We have implemented an original, one-step and seedless synthesis method, based on a spontaneous particle growth technique in the presence of polyvinylpyrrolidone (PVP) as a capping agent. Colloidal solutions of AgNRs with various aspect ratios (5.0; 6.3; 7.5; 8.2 and 9.7) have been obtained and characterized using Harmonic light scattering (HLS) at 1064 nm, in order to investigate their quadratic NLO properties. From HLS experiments, we demonstrate that hyperpolarizability (β) values of AgNRs display a strong dependence on their surface area.

  19. Fabrication of large area nanostructures with surface modified silica spheres

    NASA Astrophysics Data System (ADS)

    Kang, Kwang-Sun

    2014-03-01

    Surface modification of silica spheres with 3-(trimethoxysilyl)propylmethacrylate (TMSPM) has been performed at ambient condition. However, the FTIR spectra and field emission scanning electron microscope (FESEM) images show no evidence of the surface modification. The reaction temperatures were varied from 60 to 80 °C with various reaction periods. Small absorption shoulder of the CO stretching vibration was at 1700 cm-1, and slightly increased with the increase of the reaction time at 60 °C. The clear absorption peak appeared at 1698 cm-1 for the spheres reacted for 80 min at 70 °C and shifted toward 1720 cm-1 with the increase the reaction time. Strong absorption peak showed at 1698 cm-1 and shifted toward 1725 cm-1 with the increase of the reaction time at 80 °C. The spheres were dispersed to methanol and added photoinitiator (Irgacure-184). The solution was poured to a patterned glass substrate and exposed to the 254 nm UV-light during a self-assembly process. A large area and crack-free silica sphere film was formed. To increase the mechanical stability, a cellulose acetate solution was spin-coated to the film. The film was lift-off from the glass substrate to analyze the surface nanostructures. The surface nanostructures were maintained, and the film is stable enough to use as a mold to duplicate the nanopattern and flexible.

  20. Tuning the self-assembled monolayer formation on nanoparticle surfaces with different curvatures: Investigations on spherical silica particles and plane-crystal-shaped zirconia particles

    PubMed Central

    Feichtenschlager, Bernhard; Lomoschitz, Christoph J.; Kickelbick, Guido

    2011-01-01

    The ordering of dodecyl-chain self-assembled monolayers (SAM) on different nanoscopic surfaces was investigated by FT-IR studies. As model systems plane-crystal-shaped ZrO2 nanoparticles and spherical SiO2 nanoparticles were examined. The type of capping agent was chosen dependent on the substrate, therefore dodecylphosphonic acid and octadecylphosphonic acid were used for ZrO2 and dodecyltrimethoxysilane for SiO2 samples. The plane ZrO2 nanocrystals yielded more ordered alkyl-chain structures whereas spherical SiO2 nanoparticles showed significantly lower alkyl-chain ordering. Submicron-sized silica spheres revealed a significantly higher alkyl chain ordering, comparable to an analogously prepared SAM on a non-curved plane oxidized Si-wafer. In the case of ZrO2 nanocrystals an intense alkyl-chain alignment could be disturbed by decreasing the grafting density from the maximum of 2.1 molecules/nm2 through the variation of coupling agent concentration to lower values. Furthermore, the co-adsorption of a different coupling agent, such as phenylphosphonic acid for ZrO2 and phenyltrimethoxysilane for SiO2, resulted in a significantly lower alkyl-chain ordering for ZrO2 plane crystals and for large SiO2 spherical particles at high grafting density. An increasing amount of order-disturbing molecules leads to a gradual decrease in alkyl-chain alignment on the surface of the inorganic nanoparticles. In the case of the ZrO2 nanoparticle system it is shown via dynamic light scattering (DLS) that the mixed monolayer formation on the particle surface impacts the dispersion quality in organic solvents such as n-hexane. PMID:21549385

  1. Thermodynamic surface system of static black holes and area law

    NASA Astrophysics Data System (ADS)

    Chen, Ming; Huang, Yong-Chang

    2016-11-01

    We propose a new picture of black holes through a special holographic screen. This holographic screen contains all the degrees of freedom of a black hole. We find that this holographic screen is similar to the ordinary thermodynamic surface system. Meanwhile, through the “white-wall box” and the formula of sound velocity, we find some similarities between gravitons and photons. We further assume that such a holographic screen is a kind of Bose-Einstein condensate of gravitons. Through this assumption and those similarities, we finally get the area law of static black holes. Supported by National Natural Science Foundation of China (11275017, 11173028)

  2. Hydroetching of high surface area ceramics using moist supercritical fluids

    DOEpatents

    Fryxell, Glen; Zemanian, Thomas S.

    2004-11-02

    Aerogels having a high density of hydroxyl groups and a more uniform pore size with fewer bottlenecks are described. The aerogel is exposed to a mixture of a supercritical fluid and water, whereupon the aerogel forms a high density of hydroxyl groups. The process also relaxes the aerogel into a more open uniform internal structure, in a process referred to as hydroetching. The hydroetching process removes bottlenecks from the aerogels, and forms the hydrogels into more standard pore sizes while preserving their high surface area.

  3. High surface area graphene-supported metal chalcogenide assembly

    DOEpatents

    Worsley, Marcus A.; Kuntz, Joshua; Orme, Christine A.

    2016-04-19

    A composition comprising at least one graphene-supported assembly, which comprises a three-dimensional network of graphene sheets crosslinked by covalent carbon bonds, and at least one metal chalcogenide compound disposed on said graphene sheets, wherein the chalcogen of said metal chalcogenide compound is selected from S, Se and Te. Also disclosed are methods for making and using the graphene-supported assembly, including graphene-supported MoS.sub.2. Monoliths with high surface area and conductivity can be achieved. Lower operating temperatures in some applications can be achieved. Pore size and volume can be tuned.

  4. Metal-organic framework materials with ultrahigh surface areas

    DOEpatents

    Farha, Omar K.; Hupp, Joseph T.; Wilmer, Christopher E.; Eryazici, Ibrahim; Snurr, Randall Q.; Gomez-Gualdron, Diego A.; Borah, Bhaskarjyoti

    2015-12-22

    A metal organic framework (MOF) material including a Brunauer-Emmett-Teller (BET) surface area greater than 7,010 m.sup.2/g. Also a metal organic framework (MOF) material including hexa-carboxylated linkers including alkyne bond. Also a metal organic framework (MOF) material including three types of cuboctahedron cages fused to provide continuous channels. Also a method of making a metal organic framework (MOF) material including saponifying hexaester precursors having alkyne bonds to form a plurality of hexa-carboxylated linkers including alkyne bonds and performing a solvothermal reaction with the plurality of hexa-carboxylated linkers and one or more metal containing compounds to form the MOF material.

  5. Urban areas impact on surface water quality during rainfall events

    NASA Astrophysics Data System (ADS)

    Ferreira, C. S. S.; Soares, D.; Ferreira, A. J. D.; Costa, M. L.; Steenhuis, T. S.; Coelho, C. O. A.; Walsh, R. P. D.

    2012-04-01

    Increasing population and welfare puts water management under stress, especially in what concerns water quality. Surface water properties are strongly linked with hydrological processes and are affected by stream flow variability. Changes in some chemical substances concentrations can be ascribed to different water sources. Runoff generated in urban areas is considered the main responsible for water quality degradation inside catchments. This poster presents the methodology and first results of a study that is being developed to assess the impact of urbanization on surface water quality, during rainfall events. It focuses on the Ribeira dos Covões catchment (620 ha) located in central Portugal. Due to its proximity to the Coimbra city in central region, the urban areas sprawled during the last decades. In 2008, urban areas represented 32% of the area. Recently a highway was constructed crossing the catchment and a technological industrial park is being build-up in the headwaters. Several water samples were collected at four different locations: the catchment outlet and in three sub-catchments with distinct urbanization patterns - Espírito Santo that represents a highly urbanized area (45%) located over sandstone, Porto do Bordalo with 30% of urbanized area located over limestone, and IParque, mainly forest and just downstream the disturbed technological industrial park construction area. The samples were collected at different times during rainfall events to monitor the variability along the hydrograph. Six monitoring campaigns were performed: two in April 2011, at the end of the winter period, and the others between October and November 2011, after the dry summer. The number of samples collected per monitoring campaign is variable according with rainfall pattern. Parameters such as pH, conductivity, turbidity and total suspended sediments were immediately analyzed. The samples were then preserved, after filtered (0.45µm), and later analyzed for dissolved

  6. Nitridation under ammonia of high surface area vanadium aerogels

    SciTech Connect

    Merdrignac-Conanec, Odile . E-mail: odile.merdrignac@univ-rennes1.fr; El Badraoui, Khadija; L'Haridon, Paul

    2005-01-15

    Vanadium pentoxide gels have been obtained from decavanadic acid prepared by ion exchange on a resin from ammonium metavanadate solution. The progressive removal of water by solvent exchange in supercritical conditions led to the formation of high surface area V{sub 2}O{sub 5}, 1.6H{sub 2}O aerogels. Heat treatment under ammonia has been performed on these aerogels in the 450-900 deg. C temperature range. The oxide precursors and oxynitrides have been characterized by XRD, SEM, TGA, BET. Nitridation leads to divided oxynitride powders in which the fibrous structure of the aerogel is maintained. The use of both very low heating rates and high surface area aerogel precursors allows a higher rate and a lower threshold of nitridation than those reported in previous works. By adjusting the nitridation temperature, it has been possible to prepare oxynitrides with various nitrogen enrichment and vanadium valency states. Whatever the V(O,N) composition, the oxidation of the oxynitrides in air starts between 250 and 300 deg. C. This determines their potential use as chemical gas sensors at a maximum working temperature of 250 deg. C.

  7. High surface area, low weight composite nickel fiber electrodes

    NASA Technical Reports Server (NTRS)

    Johnson, Bradley A.; Ferro, Richard E.; Swain, Greg M.; Tatarchuk, Bruce J.

    1993-01-01

    The energy density and power density of light weight aerospace batteries utilizing the nickel oxide electrode are often limited by the microstructures of both the collector and the resulting active deposit in/on the collector. Heretofore, these two microstructures were intimately linked to one another by the materials used to prepare the collector grid as well as the methods and conditions used to deposit the active material. Significant weight and performance advantages were demonstrated by Britton and Reid at NASA-LeRC using FIBREX nickel mats of ca. 28-32 microns diameter. Work in our laboratory investigated the potential performance advantages offered by nickel fiber composite electrodes containing a mixture of fibers as small as 2 microns diameter (Available from Memtec America Corporation). These electrode collectors possess in excess of an order of magnitude more surface area per gram of collector than FIBREX nickel. The increase in surface area of the collector roughly translates into an order of magnitude thinner layer of active material. Performance data and advantages of these thin layer structures are presented. Attributes and limitations of their electrode microstructure to independently control void volume, pore structure of the Ni(OH)2 deposition, and resulting electrical properties are discussed.

  8. Nanosilver on nanostructured silica: Antibacterial activity and Ag surface area

    PubMed Central

    Sotiriou, Georgios A.; Teleki, Alexandra; Camenzind, Adrian; Krumeich, Frank; Meyer, Andreas; Panke, Sven; Pratsinis, Sotiris E.

    2013-01-01

    Nanosilver is one of the first nanomaterials to be closely monitored by regulatory agencies worldwide motivating research to better understand the relationship between Ag characteristics and antibacterial activity. Nanosilver immobilized on nanostructured silica facilitates such investigations as the SiO2 support hinders the growth of nanosilver during its synthesis and, most importantly, its flocculation in bacterial suspensions. Here, such composite Ag/silica nanoparticles were made by flame spray pyrolysis of appropriate solutions of Ag-acetate or Ag-nitrate and hexamethyldisiloxane or tetraethylorthosilicate in ethanol, propanol, diethylene glucolmonobutyl ether, acetonitrile or ethylhexanoic acid. The effect of solution composition on nanosilver characteristics and antibacterial activity against the Gram negative Escherichia coli was investigated by monitoring their recombinantly synthesized green fluorescent protein. Suspensions with identical Ag mass concentration exhibited drastically different antibacterial activity pointing out that the nanosilver surface area concentration rather than its mass or molar or number concentration determine best its antibacterial activity. Nanosilver made from Ag-acetate showed a unimodal size distribution, while that made from inexpensive Ag-nitrate exhibited a bimodal one. Regardless of precursor composition or nanosilver size distribution, the antibacterial activity of nanosilver was correlated best with its surface area concentration in solution. PMID:23730198

  9. High surface area graphene foams by chemical vapor deposition

    NASA Astrophysics Data System (ADS)

    Drieschner, Simon; Weber, Michael; Wohlketzetter, Jörg; Vieten, Josua; Makrygiannis, Evangelos; Blaschke, Benno M.; Morandi, Vittorio; Colombo, Luigi; Bonaccorso, Francesco; Garrido, Jose A.

    2016-12-01

    Three-dimensional (3D) graphene-based structures combine the unique physical properties of graphene with the opportunity to get high electrochemically available surface area per unit of geometric surface area. Several preparation techniques have been reported to fabricate 3D graphene-based macroscopic structures for energy storage applications such as supercapacitors. Although reaserch has been focused so far on achieving either high specific capacitance or high volumetric capacitance, much less attention has been dedicated to obtain high specific and high volumetric capacitance simultaneously. Here, we present a facile technique to fabricate graphene foams (GF) of high crystal quality with tunable pore size grown by chemical vapor deposition. We exploited porous sacrificial templates prepared by sintering nickel and copper metal powders. Tuning the particle size of the metal powders and the growth temperature allow fine control of the resulting pore size of the 3D graphene-based structures smaller than 1 μm. The as-produced 3D graphene structures provide a high volumetric electric double layer capacitance (165 mF cm-3). High specific capacitance (100 Fg-1) is obtained by lowering the number of layers down to single layer graphene. Furthermore, the small pore size increases the stability of these GFs in contrast to the ones that have been grown so far on commercial metal foams. Electrodes based on the as-prepared GFs can be a boost for the development of supercapacitors, where both low volume and mass are required.

  10. Nanosilver on nanostructured silica: Antibacterial activity and Ag surface area.

    PubMed

    Sotiriou, Georgios A; Teleki, Alexandra; Camenzind, Adrian; Krumeich, Frank; Meyer, Andreas; Panke, Sven; Pratsinis, Sotiris E

    2011-06-01

    Nanosilver is one of the first nanomaterials to be closely monitored by regulatory agencies worldwide motivating research to better understand the relationship between Ag characteristics and antibacterial activity. Nanosilver immobilized on nanostructured silica facilitates such investigations as the SiO2 support hinders the growth of nanosilver during its synthesis and, most importantly, its flocculation in bacterial suspensions. Here, such composite Ag/silica nanoparticles were made by flame spray pyrolysis of appropriate solutions of Ag-acetate or Ag-nitrate and hexamethyldisiloxane or tetraethylorthosilicate in ethanol, propanol, diethylene glucolmonobutyl ether, acetonitrile or ethylhexanoic acid. The effect of solution composition on nanosilver characteristics and antibacterial activity against the Gram negative Escherichia coli was investigated by monitoring their recombinantly synthesized green fluorescent protein. Suspensions with identical Ag mass concentration exhibited drastically different antibacterial activity pointing out that the nanosilver surface area concentration rather than its mass or molar or number concentration determine best its antibacterial activity. Nanosilver made from Ag-acetate showed a unimodal size distribution, while that made from inexpensive Ag-nitrate exhibited a bimodal one. Regardless of precursor composition or nanosilver size distribution, the antibacterial activity of nanosilver was correlated best with its surface area concentration in solution.

  11. Effect of cation dopants in zirconia on interfacial properties in nickel/zirconia systems: an atomistic modeling study

    NASA Astrophysics Data System (ADS)

    Iskandarov, Albert M.; Ding, Yingna; Umeno, Yoshitaka

    2017-02-01

    Cation doping is often used to stabilize the cubic or tetragonal phase of zirconia for enhanced thermomechanical and electrochemical properties. In the present paper we report a combined density functional theory (DFT) and molecular dynamics study of the effect of Sc, Y, and Ce dopants on properties of Ni/\\text{Zr}{{\\text{O}}2} interfaces and nickel sintering. First, we develop an MD model that is based on DFT data for various nickel/zirconia interfaces. Then, we employ the model to simulate Ni nanoparticles coalescing on a zirconia surface. The results show the possibility of particle migration by means of fast sliding over the surface when the work of separation is small (<1.0\\text{J} {{\\text{m}}-2} ). The sliding observed for the O-terminated Ni(1 1 1)/\\text{Zr}{{\\text{O}}2} (1 1 1) interface is not affected by dopants in zirconia because the work of separation of the doped interface stays small. The most pronounced effect of the dopants is observed for the Zr-terminated Ni(1 1 1)/\\text{Zr}{{\\text{O}}2} (1 1 1) interface, which possesses a large work of separation (4.4\\text{J} {{\\text{m}}-2} ) and thus restricts the sliding mechanism of Ni nanoparticle migration. DFT calculations for the interface revealed that dopants with a smaller covalent radius result in a larger energy barriers for Ni diffusion. We analyze this effect and discuss how it can be used to suppress nickel sintering by using the dopant selection.

  12. Fitting accuracy and fracture resistance of crowns using a hybrid zirconia frame made of both porous and dense zirconia.

    PubMed

    Nakamura, Takashi; Sugano, Tsuyoshi; Usami, Hirofumi; Wakabayashi, Kazumichi; Ohnishi, Hiroshi; Sekino, Tohru; Yatani, Hirofumi

    2015-01-01

    The purpose of this study is to evaluate the fitting accuracy and fracture resistance of crowns using a hybrid zirconia frame made of both porous and dense zirconia. Commercial semi-sintered zirconia, sintered dense zirconia and sintered hybrid zirconia were used. Sintered zirconia was milled using the CAD/CAM system, and semi-sintered zirconia was milled and sintered to fabricate molar crown frames. Completed frames were veneered with tooth-colored porcelain. The marginal and internal gaps between frames/crowns and abutments were measured. Each crown specimen was subjected to a fracture test. There were no significant differences in marginal and internal gap among all the frames and crowns. The crown with the hybrid zirconia frame had a 31-35% greater fracture load than that with the commercial or dense zirconia frame (p<0.01). This suggests that the all-ceramic crowns with a hybrid zirconia frame have a high fracture resistance.

  13. Inlay-retained zirconia fixed dental prosthesis: clinical and laboratory procedures.

    PubMed

    Monaco, Carlo; Cardelli, Paolo; Bolognesi, Michele; Scotti, Roberto; Ozcan, Mutlu

    2012-01-01

    Many treatment options are currently available for single tooth replacement, such as metal-ceramic, all-ceramic, direct or indirect fiber-reinforced composite fixed dental prostheses (FDPs) or implants. Inlay-retained FDPs could be indicated especially when adjacent teeth have preexisting restorations and where implant placement is not possible or not indicated. In such cases, indication of both metal-ceramic and fiber-reinforced composite FDPs has certain disadvantages. This paper describes the use of all-ceramic inlay-retained FDPs with zirconia frameworks, veneered with a press-on technique. The retainer margins were made of pressed ceramic to make adhesive luting possible. In deep cavities, a full contour press-on ceramic all around the retainers increased the available surface area for the adhesive approach.

  14. Alkaline nanoparticle coatings improve resin bonding of 10-methacryloyloxydecyldihydrogenphosphate-conditioned zirconia.

    PubMed

    Qian, Mengke; Lu, Zhicen; Chen, Chen; Zhang, Huaiqin; Xie, Haifeng

    Creating an alkaline environment prior to 10-methacryloyloxydecyldihydrogenphosphate (MDP) conditioning improves the resin bonding of zirconia. The present study evaluated the effects of four alkaline coatings with different water solubilities and pH values on resin bonding of MDP-conditioned zirconia. Two alkaline nanoparticle coatings were studied in particular. Thermodynamics calculations were performed to evaluate the strengths of MDP-tetragonal phase zirconia chemical bonds at different pH values. Zirconia surfaces with and without alkaline coatings were characterized by scanning electron microscope (SEM)/energy dispersive spectrometer and Fourier transform infrared spectroscopy; alkaline coatings included NaOH, Ca(OH)2, nano-MgO, and nano-Zr(OH)4. A shear bond strength (SBS) test was performed to evaluate the effects of the four alkaline coatings on bonding; the alkaline coatings were applied to the surfaces prior to conditioning the zirconia with MDP-containing primers. Gibbs free energies of the MDP-tetragonal zirconia crystal model coordination reaction in different pH environments were -583.892 (NaOH), -569.048 [Ca(OH)2], -547.393 (MgO), and -530.279 kJ/mol [Zr(OH)4]. Thermodynamic calculations indicated that the alkaline coatings improved bonding in the following order: NaOH > Ca(OH)2 > MgO > Zr(OH)4. Statistical analysis of SBS tests showed a different result. SBSs were significantly different in groups that had different alkaline coatings, but it was not influenced by different primers. All four alkaline coatings increased SBS compared to control groups. Of the four coatings, nano-Zr(OH)4 and -MgO showed higher SBS. Therefore, preparing nano-Zr(OH)4 or -MgO coatings prior to conditioning with MDP-containing primers may potentially improve resin bonding of zirconia in the clinic.

  15. Alkaline nanoparticle coatings improve resin bonding of 10-methacryloyloxydecyldihydrogenphosphate-conditioned zirconia

    PubMed Central

    Qian, Mengke; Lu, Zhicen; Chen, Chen; Zhang, Huaiqin; Xie, Haifeng

    2016-01-01

    Creating an alkaline environment prior to 10-methacryloyloxydecyldihydrogenphosphate (MDP) conditioning improves the resin bonding of zirconia. The present study evaluated the effects of four alkaline coatings with different water solubilities and pH values on resin bonding of MDP-conditioned zirconia. Two alkaline nanoparticle coatings were studied in particular. Thermodynamics calculations were performed to evaluate the strengths of MDP-tetragonal phase zirconia chemical bonds at different pH values. Zirconia surfaces with and without alkaline coatings were characterized by scanning electron microscope (SEM)/energy dispersive spectrometer and Fourier transform infrared spectroscopy; alkaline coatings included NaOH, Ca(OH)2, nano-MgO, and nano-Zr(OH)4. A shear bond strength (SBS) test was performed to evaluate the effects of the four alkaline coatings on bonding; the alkaline coatings were applied to the surfaces prior to conditioning the zirconia with MDP-containing primers. Gibbs free energies of the MDP-tetragonal zirconia crystal model coordination reaction in different pH environments were −583.892 (NaOH), −569.048 [Ca(OH)2], −547.393 (MgO), and −530.279 kJ/mol [Zr(OH)4]. Thermodynamic calculations indicated that the alkaline coatings improved bonding in the following order: NaOH > Ca(OH)2 > MgO > Zr(OH)4. Statistical analysis of SBS tests showed a different result. SBSs were significantly different in groups that had different alkaline coatings, but it was not influenced by different primers. All four alkaline coatings increased SBS compared to control groups. Of the four coatings, nano-Zr(OH)4 and -MgO showed higher SBS. Therefore, preparing nano-Zr(OH)4 or -MgO coatings prior to conditioning with MDP-containing primers may potentially improve resin bonding of zirconia in the clinic. PMID:27785013

  16. Investigation of Sea Surface Temperature (SST) anomalies over Cyprus area

    NASA Astrophysics Data System (ADS)

    Georgiou, Andreas; Akçit, Nuhcan

    2016-08-01

    The temperature of the sea surface has been identified as an important parameter of the natural environment, governing processes that occur in the upper ocean. This paper focuses on the analysis of the Sea Surface Temperature (SST) anomalies at the greater area of Cyprus. For that, SST data derived from MODerate-resolution Imaging Spectroradiometer (MODIS) instrument on board both Aqua and Terra sun synchronous satellites were used. A four year period was chosen as a first approach to address and describe this phenomenon. Geographical Information Systems (GIS) has been used as an integrated platform of analysis and presentation in addition of the support of MATLAB®. The methodology consists of five steps: (i) Collection of MODIS SST imagery, (ii) Development of the digital geo-database; (iii) Model and run the methodology in GIS as a script; (iv) Calculation of SST anomalies; and (v) Visualization of the results. The SST anomaly values have presented a symmetric distribution over the study area with an increase trend through the years of analysis. The calculated monthly and annual average SST anomalies (ASST) make more obvious this trend, with negative and positive SST changes to be distributed over the study area. In terms of seasons, the same increase trend presented during spring, summer, autumn and winter with 2013 to be the year with maximum ASST observed values. Innovative aspects comprise of straightforward integration and modeling of available tools, providing a versatile platform of analysis and semi-automation of the operation. In addition, the fine resolution maps that extracted from the analysis with a wide spatial coverage, allows the detail representation of SST and ASST respectively in the region.

  17. Grinding model and material removal mechanism of medical nanometer zirconia ceramics.

    PubMed

    Zhang, Dongkun; Li, Changhe; Jia, Dongzhou; Wang, Sheng; Li, Runze; Qi, Xiaoxiao

    2014-01-01

    Many patents have been devoted to developing medical nanometer zirconia ceramic grinding techniques that can significantly improve both workpiece surface integrity and grinding quality. Among these patents is a process for preparing ceramic dental implants with a surface for improving osseo-integration by sand abrasive finishing under a jet pressure of 1.5 bar to 8.0 bar and with a grain size of 30 µm to 250 µm. Compared with other materials, nano-zirconia ceramics exhibit unmatched biomedical performance and excellent mechanical properties as medical bone tissue and dentures. The removal mechanism of nano-zirconia materials includes brittle fracture and plastic removal. Brittle fracture involves crack formation, extension, peeling, and chipping to completely remove debris. Plastic removal is similar to chip formation in metal grinding, including rubbing, ploughing, and the formation of grinding debris. The materials are removed in shearing and chipping. During brittle fracture, the grinding-led transverse and radial extension of cracks further generate local peeling of blocks of the material. In material peeling and removal, the mechanical strength and surface quality of the workpiece are also greatly reduced because of crack extension. When grinding occurs in the plastic region, plastic removal is performed, and surface grinding does not generate grinding fissures and surface fracture, producing clinically satisfactory grinding quality. With certain grinding conditions, medical nanometer zirconia ceramics can be removed through plastic flow in ductile regime. In this study, we analyzed the critical conditions for the transfer of brittle and plastic removal in nano-zirconia ceramic grinding as well as the high-quality surface grinding of medical nanometer zirconia ceramics by ELID grinding.

  18. Surface States and Effective Surface Area on Photoluminescent P-Type Porous Silicon

    NASA Technical Reports Server (NTRS)

    Weisz, S. Z.; Porras, A. Ramirez; Resto, O.; Goldstein, Y.; Many, A.; Savir, E.

    1997-01-01

    The present study is motivated by the possibility of utilizing porous silicon for spectral sensors. Pulse measurements on the porous-Si/electrolyte system are employed to determine the surface effective area and the surface-state density at various stages of the anodization process used to produce the porous material. Such measurements were combined with studies of the photoluminescence spectra. These spectra were found to shift progressively to the blue as a function of anodization time. The luminescence intensity increases initially with anodization time, reaches a maximum and then decreases with further anodization. The surface state density, on the other hand, increases with anodization time from an initial value of about 2 x 10(exp 12)/sq cm surface to about 1013 sq cm for the anodized surface. This value is attained already after -2 min anodization and upon further anodization remains fairly constant. In parallel, the effective surface area increases by a factor of 10-30. This behavior is markedly different from the one observed previously for n-type porous Si.

  19. Directional solidification of the alumina-zirconia ceramic eutectic system

    SciTech Connect

    Boldt, Christopher

    1994-07-27

    It is possible to produce alumina-zirconia ceramic samples through existing solidification techniques. The resulting microstructures typically consist of rods of zirconia in an alumina matrix, although a lamellar structure has been noted in some cases. In nearly all cases, colony growth was present which may possibly result from grain size, repeated nucleation events, and lamellar oscillations. In the same vein, it appears that the amount of impurities within the system might be the underlying cause for the colony growth. Colony growth was diminished through impurity control as the higher purity samples exhibited colony free behavior. In addition to colony formations, faceted alumina dendrites or nonfaceted zirconia dendrites may result in the ceramic if the sample is solidified out of the coupled zone. In all cases, for larger-sized Bridgman samples, a lower limit in the eutectic spacing was noted. The solidification model which includes the kinetic effect has been developed, although the effect appears to be negligible under present experimental conditions. A spacing limit might also occur due to the result of heat flow problems. Heat flow out of the ceramic is difficult to control, often causing radial and not axial growth. This behavior is exaggerated in the presence of impurities. Thus, higher purity powders should always be used. Higher purity samples, in addition to yielding a more microstructurally uniform ceramic, also showed increased directionality. In the future, the kinetic model needs to be examined in more detail, and further research needs to be accomplished in the area of molten ceramics. Once better system constants are in place, the kinetic model will give a better indication of the behavior in the alumina-zirconia system.

  20. Sodium hydroxide catalyzed monodispersed high surface area silica nanoparticles

    PubMed Central

    Bhakta, Snehasis; Dixit, Chandra K; Bist, Itti; Jalil, Karim Abdel; Suib, Steven L; Rusling, James F

    2016-01-01

    Understanding of the synthesis kinetics and our ability to modulate medium conditions allowed us to generate nanoparticles via an ultra-fast process. The synthesis medium is kept quite simple with tetraethyl orthosilicate (TEOS) as precursor and 50% ethanol and sodium hydroxide catalyst. Synthesis is performed under gentle conditions at 20 °C for 20 min Long synthesis time and catalyst-associated drawbacks are most crucial in silica nanoparticle synthesis. We have addressed both these bottlenecks by replacing the conventional Stober catalyst, ammonium hydroxide, with sodium hydroxide. We have reduced the overall synthesis time from 20 to 1/3 h, ~60-fold decrease, and obtained highly monodispersed nanoparticles with 5-fold higher surface area than Stober particles. We have demonstrated that the developed NPs with ~3-fold higher silane can be used as efficient probes for biosensor applications. PMID:27606068

  1. High surface area ThO/sub 2/ catalyst

    DOEpatents

    Colmenares, C.A.; Somorjai, G.A.; Maj, J.J.

    1983-06-21

    A ThO/sub 2/ catalyst having a high surface area of about 80 to 125m/sup 2//g is synthesized. The compound is synthesized by simultaneously mixing an aqueous solution of ThNO/sub 3/(NO/sub 3/)/sub 4/.4H/sub 2/O with an aqueous solution of Na/sub 2/CO/sub 3/.H/sub 2/O, to produce a solution and solid ThOCO/sub 3/. The solid ThOCO/sub 3/ is separated from the solution, and then calcined at a temperature of about 225 to 300/sup 0/C for about 40 to 55 hours to produce ThO/sub 2/. The ThO/sub 2/ catalyst produced includes Na present as a substitutional cation in an amount equal to about 5 to 10 at. %.

  2. Sodium hydroxide catalyzed monodispersed high surface area silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Bhakta, Snehasis; Dixit, Chandra K.; Bist, Itti; Abdel Jalil, Karim; Suib, Steven L.; Rusling, James F.

    2016-07-01

    Understanding of the synthesis kinetics and our ability to modulate medium conditions allowed us to generate nanoparticles via an ultra-fast process. The synthesis medium is kept quite simple with tetraethyl orthosilicate (TEOS) as precursor and 50% ethanol and sodium hydroxide catalyst. Synthesis is performed under gentle conditions at 20 °C for 20 min Long synthesis time and catalyst-associated drawbacks are most crucial in silica nanoparticle synthesis. We have addressed both these bottlenecks by replacing the conventional Stober catalyst, ammonium hydroxide, with sodium hydroxide. We have reduced the overall synthesis time from 20 to 1/3 h, ∼60-fold decrease, and obtained highly monodispersed nanoparticles with 5-fold higher surface area than Stober particles. We have demonstrated that the developed NPs with ∼3-fold higher silane can be used as efficient probes for biosensor applications.

  3. Method for producing high surface area chromia materials for catalysis

    DOEpatents

    Gash, Alexander E.; Satcher, Joe; Tillotson, Thomas; Hrubesh, Lawrence; Simpson, Randall

    2007-05-01

    Nanostructured chromium(III)-oxide-based materials using sol-gel processing and a synthetic route for producing such materials are disclosed herein. Monolithic aerogels and xerogels having surface areas between 150 m.sup.2/g and 520 m.sup.2/g have been produced. The synthetic method employs the use of stable and inexpensive hydrated-chromium(III) inorganic salts and common solvents such as water, ethanol, methanol, 1-propanol, t-butanol, 2-ethoxy ethanol, and ethylene glycol, DMSO, and dimethyl formamide. The synthesis involves the dissolution of the metal salt in a solvent followed by an addition of a proton scavenger, such as an epoxide, which induces gel formation in a timely manner. Both critical point (supercritical extraction) and atmospheric (low temperature evaporation) drying may be employed to produce monolithic aerogels and xerogels, respectively.

  4. Enhancing pilot situational awareness of the airport surface movement area

    NASA Technical Reports Server (NTRS)

    Jones, D. R.; Young, S. D.

    1994-01-01

    Two studies are being conducted to address airport surface movement area safety and capacity issues by providing enhanced situational awareness information to pilots. One study focuses on obtaining pilot opinion of the Runway Status Light System (RSLS). This system has been designed to reduce the likelihood of runway incursions by informing pilots when a runway is occupied. The second study is a flight demonstration of an rate integrated system consisting of an electronic moving map in the cockpit and display of the aircraft identification to the controller. Taxi route and hold warning information will be sent to the aircraft data link for display on the electronic moving map. This paper describes the plans for the two studies.

  5. The effect of silica-coating by sol-gel process on resin-zirconia bonding.

    PubMed

    Lung, Christie Ying Kei; Kukk, Edwin; Matinlinna, Jukka Pekka

    2013-01-01

    The effect of silica-coating by sol-gel process on the bond strength of resin composite to zirconia was evaluated and compared against the sandblasting method. Four groups of zirconia samples were silica-coated by sol-gel process under varied reagent ratios of ethanol, water, ammonia and tetraethyl orthosilicate and for different deposition times. One control group of zirconia samples were treated with sandblasting. Within each of these five groups, one subgroup of samples was kept in dry storage while another subgroup was aged by thermocycling for 6,000 times. Besides shear bond testing, the surface topography and surface elemental composition of silica-coated zirconia samples were also examined using scanning electron microscopy and X-ray photoelectron spectroscopy. Comparison of silica coating methods revealed significant differences in bond strength among the Dry groups (p<0.001) and Thermocycled groups (p<0.001). Comparison of sol-gel deposition times also revealed significant differences in bond strength among the Dry groups (p<0.01) and Thermocycled groups (p<0.001). Highest bond strengths were obtained after 141-h deposition: Dry (7.97±3.72 MPa); Thermocycled (2.33±0.79 MPa). It was concluded that silica-coating of zirconia by sol-gel process resulted in weaker resin bonding than by sandblasting.

  6. Evaluation of zirconia-porcelain interface using X-ray diffraction.

    PubMed

    Alghazzawi, Tariq F; Janowski, Gregg M

    2015-09-14

    The aim of this study was to determine if accelerated aging of porcelain veneering had an effect on the surface properties specific to a tetragonal-to-monoclinic transformation (TMT) of zirconia restorations. Thirty-six zirconia samples were milled and sintered to simulate core fabrication followed by exposure to various combinations of surface treatments including as-received (control), hydrofluoric acid (HF), application of liner plus firings, application of porcelain by manual layering and pressing with firing, plus accelerated aging. The quantity of transformed tetragonal to monoclinic phases was analyzed utilized an X-ray diffractometer and one-way analysis of variance was used to analyze data. The control samples as provided from the dental laboratory after milling and sintering process had no TMT (Xm = 0). There was an effect on zirconia samples of HF application with TMT (Xm = 0.8%) and liner plus HF application with TMT (Xm = 8.7%). There was an effect of aging on zirconia samples (no veneering) with significant TMT (Xm = 70.25%). Both manual and pressing techniques of porcelain applications reduced the TMT (manual, Xm = 4.41%, pressing, Xm = 11.57%), although there was no statistical difference between them. It can be concluded that simulated applications of porcelain demonstrated the ability to protect zirconia from TMT after aging with no effect of a liner between different porcelain applications. The HF treatment also caused TMT.

  7. Biomechanical three-dimensional finite element analysis of monolithic zirconia crown with different cement type

    PubMed Central

    2015-01-01

    PURPOSE The objective of this study was to evaluate the influence of various cement types on the stress distribution in monolithic zirconia crowns under maximum bite force using the finite element analysis. MATERIALS AND METHODS The models of the prepared #46 crown (deep chamfer margin) were scanned and solid models composed of the monolithic zirconia crown, cement layer, and prepared tooth were produced using the computer-aided design technology and were subsequently translated into 3-dimensional finite element models. Four models were prepared according to different cement types (zinc phosphate, polycarboxylate, glass ionomer, and resin). A load of 700 N was applied vertically on the crowns (8 loading points). Maximum principal stress was determined. RESULTS Zinc phosphate cement had a greater stress concentration in the cement layer, while polycarboxylate cement had a greater stress concentration on the distal surface of the monolithic zirconia crown and abutment tooth. Resin cement and glass ionomer cement showed similar patterns, but resin cement showed a lower stress distribution on the lingual and mesial surface of the cement layer. CONCLUSION The test results indicate that the use of different luting agents that have various elastic moduli has an impact on the stress distribution of the monolithic zirconia crowns, cement layers, and abutment tooth. Resin cement is recommended for the luting agent of the monolithic zirconia crowns. PMID:26816578

  8. Zirconia-coated carbonyl-iron-particle-based magnetorheological fluid for polishing optical glasses and ceramics

    SciTech Connect

    Shafrir, Shai N.; Romanofsky, Henry J.; Skarlinski, Michael; Wang, Mimi; Miao, Chunlin; Salzman, Sivan; Chartier, Taylor; Mici, Joni; Lambropoulos, John C.; Shen Rui; Yang Hong; Jacobs, Stephen D.

    2009-12-10

    We report on magnetorheological finishing (MRF) spotting experiments performed on glasses and ceramics using a zirconia-coated carbonyl-iron (CI)-particle-based magnetorheological (MR) fluid. The zirconia-coated magnetic CI particles were prepared via sol-gel synthesis in kilogram quantities. The coating layer was {approx}50-100 nm thick, faceted in surface structure, and well adhered. Coated particles showed long-term stability against aqueous corrosion. ''Free'' nanocrystalline zirconia polishing abrasives were cogenerated in the coating process, resulting in an abrasive-charged powder for MRF. A viable MR fluid was prepared simply by adding water. Spot polishing tests were performed on a variety of optical glasses and ceramics over a period of nearly three weeks with no signs of MR fluid degradation or corrosion. Stable material removal rates and smooth surfaces inside spots were obtained.

  9. Electrochemical detection of DNA hybridization by using a zirconia modified renewable carbon paste electrode.

    PubMed

    Zuo, Shao-Hua; Zhang, Ling-Fan; Yuan, Hui-Hui; Lan, Min-Bo; Lawrance, Geoffrey A; Wei, Gang

    2009-02-01

    A simple, polishable and renewable DNA biosensor was fabricated based on a zirconia modified carbon paste electrode. Zirconia was mixed with graphite powder and paraffin wax to produce the paste for the electrode, and response-optimized at 56% graphite powder, 19% ZrO(2) and 25% paraffin wax. An oligonucleotide probe with a terminal 5'-phosphate group was attached to the surface of the electrode via the strong affinity of zirconia for phosphate groups. DNA immobilization and hybridization were characterized by cyclic voltammetry and differential pulse voltammetry, using methylene blue as indicator. Examination of changes in response with complementary or non-complementary DNA sequences showed that the developed biosensor had a high selectivity and sensitivity towards hybridization detection (< or =2x10(-10) M complementary DNA detectable). The surface of the biosensor can be renewed quickly and reproducibly (signal RSD+/-4.6% for five successive renewals) by a simple polishing step.

  10. Characterization of zirconia- and niobia-silica mixture coatings produced by ion-beam sputtering

    SciTech Connect

    Melninkaitis, Andrius; Tolenis, Tomas; Mazule, Lina; Mirauskas, Julius; Sirutkaitis, Valdas; Mangote, Benoit; Fu Xinghai; Zerrad, Myriam; Gallais, Laurent; Commandre, Mireille; Kicas, Simonas; Drazdys, Ramutis

    2011-03-20

    ZrO{sub 2}-SiO{sub 2} and Nb{sub 2}O{sub 5}-SiO{sub 2} mixture coatings as well as those of pure zirconia (ZrO{sub 2}), niobia (Nb{sub 2}O{sub 5}), and silica (SiO{sub 2}) deposited by ion-beam sputtering were investigated. Refractive-index dispersions, bandgaps, and volumetric fractions of materials in mixed coatings were analyzed from spectrophotometric data. Optical scattering, surface roughness, nanostructure, and optical resistance were also studied. Zirconia-silica mixtures experience the transition from crystalline to amorphous phase by increasing the content of SiO{sub 2}. This also results in reduced surface roughness. All niobia and silica coatings and their mixtures were amorphous. The obtained laser-induced damage thresholds in the subpicosecond range also correlates with respect to the silica content in both zirconia- and niobia-silica mixtures.

  11. Concerns of hydrothermal degradation in CAD/CAM zirconia.

    PubMed

    Kim, J-W; Covel, N S; Guess, P C; Rekow, E D; Zhang, Y

    2010-01-01

    Zirconia-based restorations are widely used in prosthetic dentistry; however, their susceptibility to hydrothermal degradation remains elusive. We hypothesized that CAD/CAM machining and subsequent surface treatments, i.e., grinding and/or grit-blasting, have marked effects on the hydrothermal degradation behavior of Y-TZP. CAD/CAM-machined Y-TZP plates (0.5 mm thick), both with and without subsequent grinding with various grit sizes or grit-blasting with airborne alumina particles, were subjected to accelerated aging tests in a steam autoclave. Results showed that the CAD/CAM-machined surfaces initially exhibited superior hydrothermal degradation resistance, but deteriorated at a faster rate upon prolonged autoclave treatment compared with ground and grit-blasted surfaces. The accelerated hydrothermal degradation of CAD/CAM surfaces is attributed to the CAD/CAM machining damage and the absence of surface compressive stresses in the fully sintered material. Clinical relevance for surface treatments of zirconia frameworks in terms of hydrothermal and structural stabilities is addressed.

  12. Concerns of Hydrothermal Degradation in CAD/CAM Zirconia

    PubMed Central

    Kim, J.-W.; Covel, N.S.; Guess, P.C.; Rekow, E.D.; Zhang, Y.

    2010-01-01

    Zirconia-based restorations are widely used in prosthetic dentistry; however, their susceptibility to hydrothermal degradation remains elusive. We hypothesized that CAD/CAM machining and subsequent surface treatments, i.e., grinding and/or grit-blasting, have marked effects on the hydrothermal degradation behavior of Y-TZP. CAD/CAM-machined Y-TZP plates (0.5 mm thick), both with and without subsequent grinding with various grit sizes or grit-blasting with airborne alumina particles, were subjected to accelerated aging tests in a steam autoclave. Results showed that the CAD/CAM-machined surfaces initially exhibited superior hydrothermal degradation resistance, but deteriorated at a faster rate upon prolonged autoclave treatment compared with ground and grit-blasted surfaces. The accelerated hydrothermal degradation of CAD/CAM surfaces is attributed to the CAD/CAM machining damage and the absence of surface compressive stresses in the fully sintered material. Clinical relevance for surface treatments of zirconia frameworks in terms of hydrothermal and structural stabilities is addressed. PMID:19966039

  13. Observations of Nuclear Explosive Melt Glass Textures and Surface Areas

    SciTech Connect

    Kersting, A B; Smith, D K

    2006-01-17

    This memo report summarizes our current knowledge of the appearance of melt glass formed and subsequently deposited in the subsurface after an underground nuclear test. We have collected archived pictures and melt glass samples from a variety of underground nuclear tests that were conducted at the Nevada Test Site (NTS) during the U.S. nuclear testing program. The purpose of our work is to better determine the actual variation in texture and surface area of the melt glass material. This study is motivated by our need to better determine the rate at which the radionuclides incorporated in the melt glass are released into the subsurface under saturated and partially saturated conditions. The rate at which radionuclides are released from the glass is controlled by the dissolution rate of the glass. Glass dissolution, in turn, is a strong function of surface area, glass composition, water temperature and water chemistry (Bourcier, 1994). This work feeds into an ongoing experimental effort to measure the change in surface area of analog glasses as a function of dissolution rate. The conclusions drawn from this study help bound the variation in the textures of analog glass samples needed for the experimental studies. The experimental work is a collaboration between Desert Research Institute (DRI) and Earth and Environmental Sciences-Lawrence Livermore National Laboratory (EES-LLNL). On March 4, 1999 we hosted a meeting at LLNL to present and discuss our findings. The names of the attendees appear at the end of this memo. This memo report further serves to outline and summarize the conclusions drawn from our meeting. The United States detonated over 800 underground nuclear tests at the NTS between 1951 and 1992. In an effort to evaluate the performance of the nuclear tests, drill-back operations were carried out to retrieve samples of rock in the vicinity of the nuclear test. Drill-back samples were sent to Los Alamos National Laboratory (LANL) and Lawrence Livermore

  14. The impact of built-up surfaces on land surface temperatures in Italian urban areas.

    PubMed

    Morabito, Marco; Crisci, Alfonso; Messeri, Alessandro; Orlandini, Simone; Raschi, Antonio; Maracchi, Giampiero; Munafò, Michele

    2016-05-01

    Urban areas are characterized by the very high degree of soil sealing and continuous built-up areas: Italy is one of the European countries with the highest artificial land cover rate, which causes a substantial spatial variation in the land surface temperature (LST), modifying the urban microclimate and contributing to the urban heat island effect. Nevertheless, quantitative data regarding the contribution of different densities of built-up surfaces in determining urban spatial LST changes is currently lacking in Italy. This study, which aimed to provide clear and quantitative city-specific information on annual and seasonal spatial LST modifications resulting from increased urban built-up coverage, was conducted generally throughout the whole year, and specifically in two different periods (cool/cold and warm/hot periods). Four cities (Milan, Rome, Bologna and Florence) were included in the study. The LST layer and the built-up-surface indicator were obtained via use of MODIS remote sensing data products (1km) and a very high-resolution map (5m) of built-up surfaces recently developed by the Italian National Institute for Environmental Protection and Research. The relationships between the dependent (mean daily, daytime and nighttime LST values) and independent (built-up surfaces) variables were investigated through linear regression analyses, and comprehensive built-up-surface-related LST maps were also developed. Statistically significant linear relationships (p<0.001) between built-up surfaces and spatial LST variations were observed in all the cities studied, with a higher impact during the warm/hot period than in the cool/cold ones. Daytime and nighttime LST slope patterns depend on the city size and relative urban morphology. If implemented in the existing city plan, the urban maps of built-up-surface-related LST developed in this study might be able to support more sustainable urban land management practices by identifying the critical areas (Hot

  15. Lung deposited surface area size distributions of particulate matter in different urban areas

    NASA Astrophysics Data System (ADS)

    Kuuluvainen, Heino; Rönkkö, Topi; Järvinen, Anssi; Saari, Sampo; Karjalainen, Panu; Lähde, Tero; Pirjola, Liisa; Niemi, Jarkko V.; Hillamo, Risto; Keskinen, Jorma

    2016-07-01

    Lung deposited surface area (LDSA) concentration is considered as a relevant metric for the negative health effects of aerosol particles. We report for the first time the size distributions of the LDSA measured in urban air. The measurements were carried out in the metropolitan area of Helsinki, including mobile laboratory and stationary measurements in different outdoor environments, such as traffic sites, a park area, the city center and residential areas. The main instrument in this study was an electrical low pressure impactor (ELPI), which was calibrated in the field to measure the LDSA concentration. The calibration factor was determined to be 60 μm2/(cm3 pA). In the experiments, the LDSA size distributions were found to form two modes at the traffic sites and in the city center. Both of these traffic related particle modes, the nucleation mode and the soot mode, had a clear contribution to the total LDSA concentration. The average total concentrations varied from 12 to 94 μm2/cm3, measured in the park area and at the traffic site next to a major road, respectively. The LDSA concentration was found to correlate with the mass of fine particles (PM2.5), but the relation of these two metrics varied between different environments, emphasizing the influence of traffic on the LDSA. The results of this study provide valuable information on the total concentrations and size distributions of the LDSA for epidemiological studies. The size distributions are especially important in estimating the contribution of outdoor concentrations on the concentrations inside buildings and vehicles through size-dependent penetration factors.

  16. Effects of excluded surface area and adsorbate clustering on surface adsorption of proteins. II. Kinetic models.

    PubMed Central

    Minton, A P

    2001-01-01

    Models for equilibrium surface adsorption of proteins have been recently proposed (Minton, A. P., 2000. Biophys. Chem. 86:239-247) in which negative cooperativity due to area exclusion by adsorbate molecules is compensated to a variable extent by the formation of a heterogeneous population of monolayer surface clusters of adsorbed protein molecules. In the present work this concept is extended to treat the kinetics of protein adsorption. It is postulated that clusters may grow via two distinct kinetic pathways. The first pathway is the diffusion of adsorbed monomer to the edge of a preexisting cluster and subsequent accretion. The second pathway consists of direct deposition of a monomer in solution onto the upper (solution-facing) surface of a preexisting cluster ("piggyback" deposition) and subsequent incorporation into the cluster. Results of calculations of the time course of adsorption, carried out for two different limiting models of cluster structure and energetics, show that in the absence of piggyback deposition, enhancement of the tendency of adsorbate to cluster can reduce, but not eliminate, the negative kinetic cooperativity due to surface area exclusion by adsorbate. Apparently noncooperative (Langmuir-like) and positively cooperative adsorption progress curves, qualitatively similar to those reported in several published experimental studies, require a significant fraction of total adsorption flux through the piggyback deposition pathway. According to the model developed here and in the above-mentioned reference, the formation of surface clusters should be a common concomitant of non-site-specific surface adsorption of proteins, and may provide an important mechanism for assembly of organized "protein machines" in vivo. PMID:11259279

  17. Low temperature environmental degradation of zirconia ceramics

    NASA Astrophysics Data System (ADS)

    Zhao, Zhenbo

    2005-11-01

    The low temperature environmental degradation (LTED) of yttria-stabilized tetragonal zirconia polycrystal (Y-TZP) has been prevented, or at least retarded, by using both bulk doping and surface doping methods with either cation, or anion, stabilizers. The introduction of both mullite and alumina into 3Y-TZP by a bulk-doping method was found to be effective in suppressing the tetragonal-->monoclinic transformation induced by water during hydrothermal treatment thus giving rise to better mechanical properties. The beneficial effects of alumina on the phase stability of the 3Y-TZP ceramic are considered to be due to the increase in the elastic modulus of the constraining matrix, as well as to the segregation of A12O3 at grain boundaries. The LTED transformation kinetics as determined by x-ray diffraction (XRD) and White Light Interferometer (WLI) analysis showed that the isothermal tetragonal-to-monoclinic transformation starts from the surface and has an incubation-nucleation-growth mechanism which can be described by the Johnson-Mehl-Avrami equation. The degradation of Y-TZP ceramic after hydrothermal treatment can be effectively overcome by surface doping by a solid diffusion method with tetravalent dopants: CeO2 and GeO2; with trivalent dopants: La2O 3 and Fe2O3; and with divalent dopants: CuO and MgO. For surface CeO2-, GeO2- and Fe2O 3-doping, this degradation inhibition behaviour is attributed to a localized increase in cation stabilizer content which satisfies the requirements for stabilization of the tetragonal phase. However, in each case, the stability mechanisms are different. For surface La2O3doping, surface doping overcomes the formation of La2O3 and La 2Zr2O7 since the extra La2O3 can further diffuse to the center of the 3Y-TZP ceramic. For CuO-doping, small amounts of CuO form a liquid that can act as a conduit for the re-distribution of yttria. In the case of surface MgO modification, the stabilization results from the isolated nature of the

  18. Does mineral surface area affect chemical weathering rates?

    NASA Astrophysics Data System (ADS)

    Salome Eiriksdottir, Eydis; Reynir Gislason, Sigurdur; Oelkers, Eric H.

    2010-05-01

    Iceland is a basaltic volcanic island representative of the high relief, volcanic and tectonic active islands that contribute over 45% of river suspended material to the oceans worldwide (Milliman and Syvitski, 1992). These islands have enormous mechanical and chemical weathering rates due to the combined effects of high relief, high runoff, the presence of glaciers and easily weathered volcanic rocks, and a lack of sedimentary traps. In total, Iceland delivers 0.7% of the worldwide river suspended matter flux to the ocean, which is approximately one fourth that of Africa (Tómasson, 1990). River suspended matter from volcanic islands is highly reactive in seawater and might play an important role in the global carbon cycle (Gislason et al., 2006). Thus it is important to define and understand the mechanical and chemical weathering rates of these islands. Experimental dissolution experiments performed in the laboratory suggest that chemical weathering rates should be proportional to rock-water interfacial surface area. This hypothesis is tested in the present study through a study of the chemical composition of suspended material collected from rivers located in Northeast Iceland. These rivers were selected for this study because their catchments essentially monolithic, consisting of uniform compositioned and aged basalts. Gaillardet (1999) described weathering intensities of the worlds river systems to be from 1 (low weathering intensity) to 25 (high weathering intensity). These indexes were calculated to be from 1.8 to 3.2 in rivers in NE-Iceland (Eiriksdottir et al., 2008). The surface area of sediments is inversely proportional to particle size; smaller particles have larger specific surface areas. As a result, smaller particles should weather faster. This trend is confirmed by the measured compositions of analyzed suspended material. The concentration of insoluble elements (Zr, Fe, Cu, Ni, Y) is found to increase in the suspended material, whereas the

  19. X-ray diffraction analysis of residual stress in zirconia dental composites

    NASA Astrophysics Data System (ADS)

    Allahkarami, Masoud

    Dental restoration ceramic is a complex system to be characterized. Beside its essential biocompatibility, and pleasant appearance, it requires being mechanically strong in a catastrophic loading environment. Any design is restricted with geometry boundary and material property limits. Inspired by natural teeth, a multilayer ceramic is a smart way of achieving an enhanced restoration. Bi-layers of zirconia core covered by porcelain are known as one of the best multilayer restorations. Residual stresses may be introduced into a bi-layer dental ceramic restoration during its entire manufacturing process due to thermal expansion and elastic property mismatch. It is impossible to achieve a free of residual stresses bi-layer zirconia-porcelain restoration. The idea is to take the advantage of residual stress in design in such a way to prevent the crack initiation and progression. The hypothesis is a compressive residual stress at external contact surface would be enabling the restoration to endure a greater tensile stress. Optimizing the layers thickness, manufacturing process, and validating 3D simulations require development of new techniques of thickness, residual stresses and phase transformation measurement. In the present work, a combined mirco-tomography and finite element based method were adapted for thickness measurement. Two new 2D X-ray diffraction based techniques were adapted for phase transformation area mapping and combined phase transformation and residual stress measurement. Concerning the complex geometry of crown, an efficient method for X-ray diffraction data collection mapping on a given curved surface was developed. Finally a novel method for 3D dimensional x-ray diffraction data collection and visualization were introduced.

  20. Mechanical testing of thin-walled zirconia abutments

    PubMed Central

    CANULLO, Luigi; COELHO, Paulo G.; BONFANTE, Estevam A.

    2013-01-01

    Although the use of zirconia abutments for implant-supported restorations has gained momentum with the increasing demand for esthetics, little informed design rationale has been developed to characterize their fatigue behavior under different clinical scenarios. However, to prevent the zirconia from fracturing, the use of a titanium connection in bicomponent aesthetic abutments has been suggested. Objective: Mechanical testing of customized thin-walled titanium-zirconia abutments at the connection with the implant was performed in order to characterize the fatigue behavior and the failure modes for straight and angled abutments. Material and Methods: Twenty custom-made bi-component abutments were tested according to ISO 14801:2007 either at a straight or a 25º angle inclination (n=10 each group). Fatigue was conducted at 15 Hz for 5 million cycles in dry conditions at 20ºC±5ºC. Mean values and standard deviations were calculated for each group. All comparisons were performed by t-tests assuming unequal variances. The level of statistical significance was set at p≤0.05. Failed samples were inspected in a polarized-light and then in a scanning electron microscope. Results: Straight and angled abutments mean maximum load was 296.7 N and 1,145 N, the dynamic loading mean Fmax was 237.4 N and 240.7 N, respectively. No significant differences resulted between the straight and angled bi-component abutments in both static (p=0.253) and dynamic testing (p=0.135). A significant difference in the bending moment required for fracture was detected between the groups (p=0.01). Fractures in the angled group occurred mainly at the point of load application, whereas in the straight abutments, fractures were located coronally and close to the thinly designed areas at the cervical region. Conclusion: Angled or straight thin-walled zirconia abutments presented similar Fmax under fatigue testing despite the different bending moments required for fracture. The main implication is

  1. Analysis of tetragonal to monoclinic phase transformation caused by accelerated artificial aging and the effects of microstructure in stabilized zirconia

    NASA Astrophysics Data System (ADS)

    Lucas, Thomas J.

    This investigation addresses the issue that yttria stabilized zirconia is being used as a dental biomaterial without substantial evidence of its long-term viability. Furthermore, stabilized zirconia (SZ) undergoes low temperature degradation (LTD), which can lead to roughening of the surface. A rougher exterior can lead to increased wear of the antagonist in the oral environment. Despite the LTD concerns, SZ is now widely used in restorative dentistry, including full contour crowns. A comparison of aging methods to determine the role of artificial aging on inducing the transformation has not been extensively studied. Therefore, simulations of the transformation process were investigated by comparing different methods of accelerated aging. The rejected null hypothesis is that the temperature of aging treatment will not affect the time required to cause measurable monoclinic transformation of yttria stabilized zirconia. The transformation of SZ starts at the surface and progresses inward; however, it is unclear whether the progression is constant for different aging conditions. This investigation analyzed the depth of transformation as a function of aging conditions for stabilized zirconia in the top 5-6 mum from the surface. The rejected null hypothesis is that the transformation amount is constant throughout the first six micrometers from the surface. The effects of grain size on the amount of monoclinic transformation were also investigated. This study aimed to determine if the grain size of partially stabilized zirconia affects the amount of monoclinic transformation, surface roughness, and property degradation due to aging. The rejected null hypothesis is that the grain size will not affect the amount of monoclinic transformation, thus have no effect on surface roughening or property degradation. The final part of this study addresses the wear of enamel when opposing zirconia by observing how grain size and aging affected the wear rate of an enamel antagonist

  2. Bicontinuous ceramics with high surface area from block copolymer templates.

    PubMed

    Hsueh, Han-Yu; Ho, Rong-Ming

    2012-06-05

    Mesoporous polymers with gyroid nanochannels can be fabricated from the self-assembly of degradable block copolymer, polystyrene-b-poly(L-lactide) (PS-PLLA), followed by hydrolysis of PLLA block. Well-defined polymer/ceramic nanohybrid materials with inorganic gyroid nanostructures in a PS matrix can be obtained by using the mesoporous PS as a template for sol-gel reaction. Titanium tetraisopropoxide (TTIP) is used as a precursor to give a model system for the fabrication of metal oxide nanostructures from reactive transition metal alkoxides. By controlling the rates of capillary-driven pore filling and sol-gel reaction, the templated synthesis can be well-developed. Also, by taking advantage of calcination, bicontinuous TiO(2) with controlled crystalline phase (i.e., anatase phase) can be fabricated after removal of the PS template and crystallization of TiO(2) by calcination leading to high photocatalytic efficiency. This new approach provides an easy way to fabricate high-surface-area and high-porosity ceramics with self-supporting structure and controlled crystalline phase for practical applications. As a result, a platform technology to fabricate precisely controlled polymer/ceramic nanohybrids and mesoporous ceramic materials can be established.

  3. Bond strength of resin cement to CO2 and Er:YAG laser-treated zirconia ceramic

    PubMed Central

    Kasraei, Shahin; Heidari, Bijan; Vafaee, Fariborz

    2014-01-01

    Objectives It is difficult to achieve adhesion between resin cement and zirconia ceramics using routine surface preparation methods. The aim of this study was to evaluate the effects of CO2 and Er:YAG laser treatment on the bond strength of resin cement to zirconia ceramics. Materials and Methods In this in-vitro study 45 zirconia disks (6 mm in diameter and 2 mm in thickness) were assigned to 3 groups (n = 15). In control group (CNT) no laser treatment was used. In groups COL and EYL, CO2 and Er:YAG lasers were used for pretreatment of zirconia surface, respectively. Composite resin disks were cemented on zirconia disk using dual-curing resin cement. Shear bond strength tests were performed at a crosshead speed of 0.5 mm/min after 24 hr distilled water storage. Data were analyzed by one-way ANOVA and post hoc Tukey's HSD tests. Results The means and standard deviations of shear bond strength values in the EYL, COL and CNT groups were 8.65 ± 1.75, 12.12 ± 3.02, and 5.97 ± 1.14 MPa, respectively. Data showed that application of CO2 and Er:YAG lasers resulted in a significant higher shear bond strength of resin cement to zirconia ceramics (p < 0.0001). The highest bond strength was recorded in the COL group (p < 0.0001). In the CNT group all the failures were adhesive. However, in the laser groups, 80% of the failures were of the adhesive type. Conclusions Pretreatment of zirconia ceramic via CO2 and Er:YAG laser improves the bond strength of resin cement to zirconia ceramic, with higher bond strength values in the CO2 laser treated samples. PMID:25383349

  4. 30 CFR 905.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE CALIFORNIA § 905.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  5. 30 CFR 937.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE OREGON § 937.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  6. 30 CFR 941.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE SOUTH DAKOTA § 941.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  7. 30 CFR 921.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE MASSACHUSETTS § 921.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  8. 30 CFR 921.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE MASSACHUSETTS § 921.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  9. 30 CFR 912.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE IDAHO § 912.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  10. 30 CFR 921.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE MASSACHUSETTS § 921.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  11. 30 CFR 903.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE ARIZONA § 903.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, applies to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  12. 30 CFR 947.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE WASHINGTON § 947.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  13. 30 CFR 921.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE MASSACHUSETTS § 921.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  14. 30 CFR 947.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE WASHINGTON § 947.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  15. 30 CFR 942.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE TENNESSEE § 942.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  16. 30 CFR 941.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE SOUTH DAKOTA § 941.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  17. 30 CFR 910.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE GEORGIA § 910.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  18. 30 CFR 942.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE TENNESSEE § 942.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  19. 30 CFR 903.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE ARIZONA § 903.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, applies to surface coal mining... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  20. 30 CFR 922.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE MICHIGAN § 922.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  1. 30 CFR 910.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE GEORGIA § 910.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  2. 30 CFR 905.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE CALIFORNIA § 905.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  3. 30 CFR 937.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE OREGON § 937.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  4. 30 CFR 912.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE IDAHO § 912.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  5. 30 CFR 942.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE TENNESSEE § 942.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  6. 30 CFR 947.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE WASHINGTON § 947.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  7. 30 CFR 921.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE MASSACHUSETTS § 921.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  8. 30 CFR 939.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE RHODE ISLAND § 939.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  9. 30 CFR 903.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE ARIZONA § 903.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, applies to surface coal mining... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  10. 30 CFR 942.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE TENNESSEE § 942.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  11. 30 CFR 922.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE MICHIGAN § 922.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  12. 30 CFR 941.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE SOUTH DAKOTA § 941.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  13. 30 CFR 912.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE IDAHO § 912.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  14. 30 CFR 939.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE RHODE ISLAND § 939.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  15. 30 CFR 905.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE CALIFORNIA § 905.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  16. 30 CFR 922.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE MICHIGAN § 922.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  17. 30 CFR 939.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE RHODE ISLAND § 939.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  18. 30 CFR 941.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE SOUTH DAKOTA § 941.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  19. 30 CFR 912.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE IDAHO § 912.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  20. 30 CFR 941.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE SOUTH DAKOTA § 941.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  1. 30 CFR 937.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE OREGON § 937.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  2. 30 CFR 942.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE TENNESSEE § 942.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  3. 30 CFR 939.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE RHODE ISLAND § 939.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  4. 30 CFR 937.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE OREGON § 937.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  5. 30 CFR 910.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE GEORGIA § 910.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  6. 30 CFR 910.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE GEORGIA § 910.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  7. 30 CFR 910.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE GEORGIA § 910.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  8. 30 CFR 937.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE OREGON § 937.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  9. 30 CFR 905.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE CALIFORNIA § 905.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  10. 30 CFR 947.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE WASHINGTON § 947.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  11. 30 CFR 903.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE ARIZONA § 903.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, applies to surface coal mining... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas designated unsuitable for surface...

  12. 30 CFR 912.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE IDAHO § 912.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining and... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  13. 30 CFR 903.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE ARIZONA § 903.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, applies to surface coal mining... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  14. 30 CFR 922.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE MICHIGAN § 922.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas designated unsuitable for surface...

  15. 30 CFR 947.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE WASHINGTON § 947.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  16. 30 CFR 922.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE MICHIGAN § 922.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas designated unsuitable for surface...

  17. 30 CFR 905.761 - Areas designated unsuitable for surface coal mining by act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE CALIFORNIA § 905.761 Areas designated unsuitable for surface coal mining by act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas designated unsuitable for surface...

  18. 30 CFR 939.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE RHODE ISLAND § 939.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated by Act of Congress, shall apply to surface coal mining... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas designated unsuitable for surface...

  19. Tailoring the Microstructure of Sol–Gel Derived Hydroxyapatite/Zirconia Nanocrystalline Composites

    PubMed Central

    2011-01-01

    In this study, we tailor the microstructure of hydroxyapatite/zirconia nanocrystalline composites by optimizing processing parameters, namely, introducing an atmosphere of water vapor during sintering in order to control the thermal stability of hydroxyapatite, and a modified sol–gel process that yields to an excellent intergranular distribution of zirconia phase dispersed intergranularly within the hydroxyapatite matrix. In terms of mechanical behavior, SEM images of fissure deflection and the presence of monoclinic ZrO2 content on cracked surface indicate that both toughening mechanisms, stress-induced tetragonal to monoclinic phase transformation and deflection, are active for toughness enhancement. PMID:24764458

  20. Effect of bioglass and silica coating of zirconia substrate on its bond strength to resin cement.

    PubMed

    Moezzizadeh, Maryam; Nojedehian, Hanieh; Valizadeh Haghi, Haleh

    2017-01-31

    This study aimed to assess the effect of bioglass and silica coating of zirconia substrate on its bond strength to resin cement. A total of 120 specimens were used in this in-vitro, experimental study. Zirconia discs measuring 10×7×2 mm were cut from Y-TZP zirconia blocks, sintered, cleaned and received different surface treatments of sandblasting, bioglass powder coating+etching, bioglass powder coating+etching+silanization, bioglass slurry coating+etching, bioglass slurry coating+etching+silanization, silica coating+silanization, silica coating+etching+silanization and no treatment group (control). Then the microshear bond strength testing and scanning electron microscope (SEM) analysis were done. Data were analyzed using the Mann Whitney U and the Kruskal Wallis tests. Significant differences existed in bond strength of different groups (p<0.001). The sandblasted and bioglass coated groups showed higher and the colloidal silica-coated groups showed lower bond strength compared to the control group.

  1. Mechanical Properties of a Graded Alumina-Zirconia Composite Prepared by Centrifugal Slip Casting

    SciTech Connect

    Hara, Yasuyuki; Onda, Tetsuhiko; Hayakawa, Motozo

    2008-02-15

    Compositionally graded composite of alumina-20 vol%zirconia was fabricated by using centrifugal casting incorporated with relatively thin slip. An EPMA analysis exhibited a nearly linear variation of the alumina/zirconia ratio along the centrifugal direction; zirconia tended to accumulate in the bottom section, while alumina in the top section. Such a graded structure exhibited a considerably higher flexural strength when the alumina rich surface was subjected to a tensile stress than compositionally uniform composite of the same average composition. Fracture toughness measurement across the specimen thickness by indentation method revealed that the crack lengths along the vertical and horizontal directions were different. The anisotropy of the fracture toughness was accounted for by the variation of the residual stress across the specimen thicknesss.

  2. INTERFACE RESIDUAL STRESSES IN DENTAL ZIRCONIA USING LAUE MICRO-DIFFRACTION

    SciTech Connect

    Bale, H. A.; Tamura, N.; Coelho, P.G.; Hanan, J. C.

    2009-01-01

    Due to their aesthetic value and high compressive strength, dentists have recently employed ceramics for restoration materials. Among the ceramic materials, zirconia provides high toughness and crack resistant characteristics. Residual stresses develop in processing due to factors including grain anisotropy and thermal coefficient mismatch. In the present study, polychromatic X-ray (Laue) micro-diffraction provided grain orientation and residual stresses on a clinically relevant zirconia model ceramic disk. A 0.5 mm x 0.024 mm region on zirconia was examined on a 500 nm scale for residual stresses using a focused poly-chromatic synchrotron X-ray beam. Large stresses ranging from - to + 1GPa were observed at some grains. On average, the method suggests a relatively small compressive stress at the surface between 47 and 75 MPa depending on direction.

  3. 30 CFR 903.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 903.762 Section 903.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE ARIZONA § 903.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  4. 30 CFR 937.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 937.762 Section 937.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE OREGON § 937.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  5. 30 CFR 922.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 922.762 Section 922.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE MICHIGAN § 922.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  6. 30 CFR 922.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 922.762 Section 922.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE MICHIGAN § 922.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  7. 30 CFR 912.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 912.762 Section 912.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE IDAHO § 912.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  8. 30 CFR 937.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 937.762 Section 937.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE OREGON § 937.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  9. 30 CFR 922.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 922.762 Section 922.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE MICHIGAN § 922.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  10. 30 CFR 910.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 910.762 Section 910.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE GEORGIA § 910.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  11. 30 CFR 912.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 912.762 Section 912.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE IDAHO § 912.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  12. 30 CFR 910.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 910.762 Section 910.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE GEORGIA § 910.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  13. 30 CFR 922.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 922.762 Section 922.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE MICHIGAN § 922.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  14. 30 CFR 912.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 912.762 Section 912.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE IDAHO § 912.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  15. 30 CFR 910.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 910.762 Section 910.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE GEORGIA § 910.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  16. 30 CFR 903.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 903.762 Section 903.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE ARIZONA § 903.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  17. 30 CFR 903.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 903.762 Section 903.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE ARIZONA § 903.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  18. 30 CFR 922.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 922.762 Section 922.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE MICHIGAN § 922.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  19. 30 CFR 937.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 937.762 Section 937.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE OREGON § 937.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  20. 30 CFR 910.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 910.762 Section 910.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE GEORGIA § 910.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  1. 30 CFR 912.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 912.762 Section 912.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE IDAHO § 912.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  2. 30 CFR 937.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 937.762 Section 937.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE OREGON § 937.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  3. 30 CFR 903.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 903.762 Section 903.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE ARIZONA § 903.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  4. 30 CFR 937.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 937.762 Section 937.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE OREGON § 937.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  5. 30 CFR 912.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 912.762 Section 912.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE IDAHO § 912.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  6. 30 CFR 903.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 903.762 Section 903.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE ARIZONA § 903.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  7. 30 CFR 910.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 910.762 Section 910.762 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE GEORGIA § 910.762 Criteria for designating areas as unsuitable for surface coal mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal...

  8. 30 CFR 910.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... surface coal mining operations. 910.764 Section 910.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE GEORGIA § 910.764 Process for designating areas unsuitable for surface coal mining operations. Part 764 of this chapter, State Processes for Designating Areas Unsuitable for Surface...

  9. 30 CFR 903.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... surface coal mining operations. 903.764 Section 903.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE ARIZONA § 903.764 Process for designating areas unsuitable for surface coal mining operations. Part 764 of this chapter, State Processes for Designating Areas Unsuitable for Surface...

  10. 30 CFR 905.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... surface coal mining operations. 905.764 Section 905.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE CALIFORNIA § 905.764 Process for designating areas unsuitable for surface coal mining operations. Part 764 of this chapter, State Processes for Designating Areas Unsuitable for Surface...

  11. 30 CFR 912.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... surface coal mining operations. 912.764 Section 912.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE IDAHO § 912.764 Process for designating areas unsuitable for surface coal mining operations. Part 764 of this chapter, State Processes for Designating Areas Unsuitable for Surface...

  12. Fracture resistance and failure mode of posterior fixed dental prostheses fabricated with two zirconia CAD/CAM systems

    PubMed Central

    López-Suárez, Carlos; Gonzalo, Esther; Peláez, Jesús; Rodríguez, Verónica

    2015-01-01

    Background In recent years there has been an improvement of zirconia ceramic materials to replace posterior missing teeth. To date little in vitro studies has been carried out on the fracture resistance of zirconia veneered posterior fixed dental prostheses. This study investigated the fracture resistance and the failure mode of 3-unit zirconia-based posterior fixed dental prostheses fabricated with two CAD/CAM systems. Material and Methods Twenty posterior fixed dental prostheses were studied. Samples were randomly divided into two groups (n=10 each) according to the zirconia ceramic analyzed: Lava and Procera. Specimens were loaded until fracture under static load. Data were analyzed using Wilcoxon´s rank sum test and Wilcoxon´s signed-rank test (P<0.05). Results Partial fracture of the veneering porcelain occurred in 100% of the samples. Within each group, significant differences were shown between the veneering and the framework fracture resistance (P=0.002). The failure occurred in the connector cervical area in 80% of the cases. Conclusions All fracture load values of the zirconia frameworks could be considered clinically acceptable. The connector area is the weak point of the restorations. Key words:Fixed dental prostheses, zirconium-dioxide, zirconia, fracture resistance, failure mode. PMID:26155341

  13. Determination of surface-accessible acidic hydroxyls and surface area of lignin by cationic dye adsorption.

    PubMed

    Sipponen, Mika Henrikki; Pihlajaniemi, Ville; Littunen, Kuisma; Pastinen, Ossi; Laakso, Simo

    2014-10-01

    A new colorimetric method for determining the surface-accessible acidic lignin hydroxyl groups in lignocellulose solid fractions was developed. The method is based on selective adsorption of Azure B, a basic dye, onto acidic hydroxyl groups of lignin. Selectivity of adsorption of Azure B on lignin was demonstrated using lignin and cellulose materials as adsorbents. Adsorption isotherms of Azure B on wheat straw (WS), sugarcane bagasse (SGB), oat husk, and isolated lignin materials were determined. The maximum adsorption capacities predicted by the Langmuir isotherms were used to calculate the amounts of surface-accessible acidic hydroxyl groups. WS contained 1.7-times more acidic hydroxyls (0.21 mmol/g) and higher surface area of lignin (84 m(2)/g) than SGB or oat husk materials. Equations for determining the amount of surface-accessible acidic hydroxyls in solid fractions of the three plant materials by a single point measurement were developed. A method for high-throughput characterization of lignocellulosic materials is now available.

  14. Mercury Underpotential Deposition to Determine Iridium and Iridium Oxide Electrochemical Surface Areas

    SciTech Connect

    Alia, Shaun M.; Hurst, Katherine E.; Kocha, Shyam S.; Pivovar, Bryan S.

    2016-06-02

    Determining the surface areas of electrocatalysts is critical for separating the key properties of area-specific activity and electrochemical surface area from mass activity. Hydrogen underpotential deposition and carbon monoxide oxidation are typically used to evaluate iridium (Ir) surface areas, but are ineffective on oxides and can be sensitive to surface oxides formed on Ir metals. Mercury underpotential deposition is presented in this study as an alternative, able to produce reasonable surface areas on Ir and Ir oxide nanoparticles, and able to produce similar surface areas prior to and following characterization in oxygen evolution. Reliable electrochemical surface areas allow for comparative studies of different catalyst types and the characterization of advanced oxygen evolution catalysts. Lastly, they also enable the study of catalyst degradation in durability testing, both areas of increasing importance within electrolysis and electrocatalysis.

  15. Mercury Underpotential Deposition to Determine Iridium and Iridium Oxide Electrochemical Surface Areas

    DOE PAGES

    Alia, Shaun M.; Hurst, Katherine E.; Kocha, Shyam S.; ...

    2016-06-02

    Determining the surface areas of electrocatalysts is critical for separating the key properties of area-specific activity and electrochemical surface area from mass activity. Hydrogen underpotential deposition and carbon monoxide oxidation are typically used to evaluate iridium (Ir) surface areas, but are ineffective on oxides and can be sensitive to surface oxides formed on Ir metals. Mercury underpotential deposition is presented in this study as an alternative, able to produce reasonable surface areas on Ir and Ir oxide nanoparticles, and able to produce similar surface areas prior to and following characterization in oxygen evolution. Reliable electrochemical surface areas allow for comparativemore » studies of different catalyst types and the characterization of advanced oxygen evolution catalysts. Lastly, they also enable the study of catalyst degradation in durability testing, both areas of increasing importance within electrolysis and electrocatalysis.« less

  16. Synthesis of zirconia (ZrO2) nanowires via chemical vapor deposition

    NASA Astrophysics Data System (ADS)

    Baek, M. K.; Park, S. J.; Choi, D. J.

    2017-02-01

    Monoclinic zirconia nanowires were synthesized by chemical vapor deposition using ZrCl4 powder as a starting material at 1200 °C and 760 Torr. Graphite was employed as a substrate, and an Au thin film was pre-deposited on the graphite as a catalyst. The zirconia nanostructure morphology was observed through scanning electron microscopy and transmission electron microscopy. Based on X-ray diffraction, selected area electron diffraction, and Raman spectroscopy data, the resulting crystal structure was found to be single crystalline monoclinic zirconia. The homogeneous distributions of Zr, O and Au were studied by scanning transmission electron microscopy with energy dispersive X-ray spectroscopy mapping, and there was no metal droplet at the nanowire tips despite the use of an Au metal catalyst. This result is apart from that of conventional metal catalyzed nanowires.

  17. Summertime evolution of snow specific surface area close to the surface on the Antarctic Plateau

    NASA Astrophysics Data System (ADS)

    Libois, Q.; Picard, G.; Arnaud, L.; Dumont, M.; Lafaysse, M.; Morin, S.; Lefebvre, E.

    2015-08-01

    On the Antarctic Plateau, snow specific surface area (SSA) close to the surface shows complex variations at daily to seasonal scales which affect the surface albedo and in turn the surface energy budget of the ice sheet. While snow metamorphism, precipitation and strong wind events are known to drive SSA variations, usually in opposite ways, their relative contributions remain unclear. Here, a comprehensive set of SSA observations at Dome C is analysed with respect to meteorological conditions to assess the respective roles of these factors. The results show an average two-to-three-fold SSA decrease from October to February in the topmost 10 cm, in response to the increase of air temperature and absorption of solar radiation in the snowpack during spring and summer. Surface SSA is also characterised by significant daily to weekly variations, due to the deposition of small crystals with SSA up to 100 m2 kg-1 onto the surface during snowfall and blowing snow events. To complement these field observations, the detailed snowpack model Crocus is used to simulate SSA, with the intent to further investigate the previously found correlation between inter-annual variability of summer SSA decrease and summer precipitation amount. To this end, Crocus parameterizations have been adapted to Dome C conditions, and the model was forced by ERA-Interim reanalysis. It successfully matches the observations at daily to seasonal time scales, except for few cases when snowfalls are not captured by the reanalysis. On the contrary, the inter-annual variability of summer SSA decrease is poorly simulated when compared to 14 years of microwave satellite data sensititve to the near surface SSA. A simulation with disabled summer precipitation confirms the weak influence in the model of the precipitation on metamorphism, with only 6 % enhancement. However we found that disabling strong wind events in the model is sufficient to reconciliate the simulations with the observations. This suggests

  18. Summertime evolution of snow specific surface area close to the surface on the Antarctic Plateau

    NASA Astrophysics Data System (ADS)

    Libois, Q.; Picard, G.; Arnaud, L.; Dumont, M.; Lafaysse, M.; Morin, S.; Lefebvre, E.

    2015-12-01

    On the Antarctic Plateau, snow specific surface area (SSA) close to the surface shows complex variations at daily to seasonal scales which affect the surface albedo and in turn the surface energy budget of the ice sheet. While snow metamorphism, precipitation and strong wind events are known to drive SSA variations, usually in opposite ways, their relative contributions remain unclear. Here, a comprehensive set of SSA observations at Dome C is analysed with respect to meteorological conditions to assess the respective roles of these factors. The results show an average 2-to-3-fold SSA decrease from October to February in the topmost 10 cm in response to the increase of air temperature and absorption of solar radiation in the snowpack during spring and summer. Surface SSA is also characterized by significant daily to weekly variations due to the deposition of small crystals with SSA up to 100 m2 kg-1 onto the surface during snowfall and blowing snow events. To complement these field observations, the detailed snowpack model Crocus is used to simulate SSA, with the intent to further investigate the previously found correlation between interannual variability of summer SSA decrease and summer precipitation amount. To this end, some Crocus parameterizations have been adapted to Dome C conditions, and the model was forced by ERA-Interim reanalysis. It successfully matches the observations at daily to seasonal timescales, except for the few cases when snowfalls are not captured by the reanalysis. On the contrary, the interannual variability of summer SSA decrease is poorly simulated when compared to 14 years of microwave satellite data sensitive to the near-surface SSA. A simulation with disabled summer precipitation confirms the weak influence in the model of the precipitation on metamorphism, with only 6 % enhancement. However, we found that disabling strong wind events in the model is sufficient to reconciliate the simulations with the observations. This suggests that

  19. Three-dimensional finite element analysis of zirconia all-ceramic cantilevered fixed partial dentures with different framework designs.

    PubMed

    Miura, Shoko; Kasahara, Shin; Yamauchi, Shinobu; Egusa, Hiroshi

    2017-03-17

    The purpose of this study were: to perform stress analyses using three-dimensional finite element analysis methods; to analyze the mechanical stress of different framework designs; and to investigate framework designs that will provide for the long-term stability of both cantilevered fixed partial dentures (FPDs) and abutment teeth. An analysis model was prepared for three units of cantilevered FPDs that assume a missing mandibular first molar. Four types of framework design (Design 1, basic type; Design 2, framework width expanded buccolingually by 2 mm; Design 3, framework height expanded by 0.5 mm to the occlusal surface side from the end abutment to the connector area; and Design 4, a combination of Designs 2 and 3) were created. Two types of framework material (yttrium-oxide partially stabilized zirconia and a high precious noble metal gold alloy) and two types of abutment material (dentin and brass) were used. In the framework designs, Design 1 exhibited the highest maximum principal stress value for both zirconia and gold alloy. In the abutment tooth, Design 3 exhibited the highest maximum principal stress value for all abutment teeth. In the present study, Design 4 (the design with expanded framework height and framework width) could contribute to preventing the concentration of stress and protecting abutment teeth.

  20. Fabrication and characterization of a zirconia/multi-walled carbon nanotube mesoporous composite.

    PubMed

    Wang, Zonghua; Xia, Jianfei; Xia, Yanzhi; Lu, Caiyu; Shi, Guoyu; Zhang, Feifei; Zhu, Fuqiang; Li, Yanhui; Xia, Linhua; Tang, Jie

    2013-10-01

    A zirconia/multi-walled carbon nanotube (ZrO2/MWCNT) mesoporous composite was fabricated via a simple method using a hydrothermal process with the aid of the cationic surfactant cetyltrimethylammonium bromide (CTAB). Transmission electron microscopy (TEM), N2 adsorption-desorption, Fourier transform infrared spectroscopy (FT-IR) and X-ray diffraction (XRD) techniques were used to characterize the as-made samples. The cubic ZrO2 nanocrystallites were observed to overlay the surface of MWCNTs, which resulted in the formation of a novel mesoporous-nanotube composite. On the basis of a TEM analysis of the products from controlled experiment, the role of the acid-treated MWCNTs and CTAB was proposed to explain the formation of the mesoporous-nanotube structure. The as-made composite possessed novel properties, such as a high surface area (312 m(2)·g(-1)) and a bimodal mesoporous structure (3.18 nm and 12.4 nm). It was concluded that this composite has important application value due to its one-dimensional hollow structure, excellent electric conductivity and large surface area.

  1. Oxygen separation from air using zirconia solid electrolyte membranes

    NASA Technical Reports Server (NTRS)

    Suitor, J. W.; Marner, W. J.; Schroeder, J. E.; Losey, R. W.; Ferrall, J. F.

    1988-01-01

    Air separation using a zirconia solid electrolyte membrane is a possible alternative source of oxygen. The process of zirconia oxygen separation is reviewed, and an oxygen plant concept using such separation is described. Potential cell designs, stack designs, and testing procedures are examined. Fabrication of the materials used in a zirconia module as well as distribution plate design and fabrication are examined.

  2. Molybdenum disilicide composites reinforced with zirconia and silicon carbide

    SciTech Connect

    Petrovic, J.J.

    1992-12-31

    This patent pertains to compositions consisting essentially of molybdenum disilicide, silicon carbide, and a zirconium oxide component. The silicon carbide used in the compositions is in whisker or powder form. The zirconium oxide component is pure zirconia or partially stabilized zirconia or fully stabilized zirconia. Fabrication, fracture toughness, and bend strength are covered.

  3. Molybdenum disilicide composites reinforced with zirconia and silicon carbide

    DOEpatents

    Petrovic, John J.

    1995-01-01

    Compositions consisting essentially of molybdenum disilicide, silicon carbide, and a zirconium oxide component. The silicon carbide used in the compositions is in whisker or powder form. The zirconium oxide component is pure zirconia or partially stabilized zirconia or fully stabilized zirconia.

  4. Molybdenum disilicide composites reinforced with zirconia and silicon carbide

    DOEpatents

    Petrovic, J.J.

    1995-01-17

    Compositions are disclosed consisting essentially of molybdenum disilicide, silicon carbide, and a zirconium oxide component. The silicon carbide used in the compositions is in whisker or powder form. The zirconium oxide component is pure zirconia or partially stabilized zirconia or fully stabilized zirconia.

  5. Measurement of surface cleanliness by area-of-spread

    SciTech Connect

    Harding, W.B.

    1992-02-01

    The technique of determining the amount of spreading of a small (0.5 to 5 mm{sup 3}) drop of water on a surface as a measure of the cleanliness of the surface is described. Calculation of the wetting angle of the drop from the diameter and volume of the drop is explained. Values of wetting angles for several clean and several deliberately contaminated surfaces are presented. Illustrative photomicrographs are included.

  6. Evaluation of shear bond strength between zirconia core and ceramic veneers fabricated by pressing and layering techniques: In vitro study

    PubMed Central

    Subash, M.; Vijitha, D.; Deb, Saikat; Satish, A.; Mahendirakumar, N.

    2015-01-01

    Statement of Problem: Although ceramic veneered on to zirconia core have been in use for quite some time, information regarding the comparative evaluation of the Shear bond strength of Pressable & Layered ceramic veneered on to zirconia core is limited. Purpose of study: To evaluate the shear bond strength of zirconia core and ceramic veneer fabricated by two different techniques, Layering (Noritake CZR) and Pressing (Noritake, CZR Press). Materials and Method: 20 samples of zirconia blocks were fabricated and the samples were divided into group A & B. Group A - Ceramic Veneered over zirconia core by pressing using Noritake CZR Press. Group B - Ceramic Veneered over zirconia core by layering using Noritake CZR. The veneered specimens were mounted on to the center of a PVC tube using self-cure acrylic resin leaving 3 mm of the veneered surface exposed as cantilever. Using a Universal testing machine the blocks were loaded up to failure. Result: The results were tabulated by using independent samples t-test. The mean shear bond strength for Pressed specimens was 12.458 ± 1.63(S.D) MPa and for layered specimens was 8.458 ± 0.845(S.D) MPa. Conclusion: Pressed specimens performed significantly better than the layered specimen with a P value 0.001. Clinicians and dental laboratory technicians should consider the use of pressed ceramics as an alternative to traditional layering procedures to reduce the chances of chipping or de-lamination of ceramics PMID:26538929

  7. Creep of plasma sprayed zirconia

    NASA Technical Reports Server (NTRS)

    Firestone, R. F.; Logan, W. R.; Adams, J. W.

    1982-01-01

    Specimens of plasma-sprayed zirconia thermal barrier coatings with three different porosities and different initial particle sizes were deformed in compression at initial loads of 1000, 2000, and 3500 psi and temperatures of 1100 C, 1250 C, and 1400 C. The coatings were stabilized with lime, magnesia, and two different concentrations of yttria. Creep began as soon as the load was applied and continued at a constantly decreasing rate until the load was removed. Temperature and stabilization had a pronounced effect on creep rate. The creep rate for 20% Y2O3-80% ZrO2 was 1/3 to 1/2 that of 8% Y2O3-92% ZrO2. Both magnesia and calcia stabilized ZrO2 crept at a rate 5 to 10 times that of the 20% Y2O3 material. A near proportionality between creep rate and applied stress was observed. The rate controlling process appeared to be thermally activated, with an activation energy of approximately 100 cal/gm mole K. Creep deformation was due to cracking and particle sliding.

  8. Fabrication technology to increase surface area of ionomer membrane material and its application towards high surface area electric double-layer capacitors

    NASA Astrophysics Data System (ADS)

    Chang, Alberto A.; Patel, Jasbir N.; Cordoba, Cristina; Kaminska, Bozena; Kavanagh, Karen

    2014-03-01

    An application friendly technique to increase the surface area of the ionomer membrane such as Aquivion™ has been developed. By utilizing existing micro-fabrication technologies, square pillars were fabricated onto glass and silicon substrates. In combination with a low cost heat press, the glass and silicon stamps were used to successfully hot emboss micro-features onto the ionomer membrane. Consequently, the surface area of the Aquivion™ membrane was drastically increased enabling potential improvement of sensing and energy storage technologies. Preliminary results show successful fabrication of devices with systematic higher surface area and an improved capacitance.

  9. Properties that influence the specific surface areas of carbon nanotubes and nanofibers.

    PubMed

    Birch, M Eileen; Ruda-Eberenz, Toni A; Chai, Ming; Andrews, Ronnee; Hatfield, Randal L

    2013-11-01

    Commercially available carbon nanotubes and nanofibers were analyzed to examine possible relationships between their Brunauer-Emmett-Teller specific surface areas (SSAs) and their physical and chemical properties. Properties found to influence surface area were number of walls/diameter, impurities, and surface functionalization with hydroxyl and carboxyl groups. Characterization by electron microscopy, energy-dispersive X-ray spectrometry, thermogravimetric analysis, and elemental analysis indicates that SSA can provide insight on carbon nanomaterials properties, which can differ vastly depending on synthesis parameters and post-production treatments. In this study, how different properties may influence surface area is discussed. The materials examined have a wide range of surface areas. The measured surface areas differed from product specifications, to varying degrees, and between similar products. Findings emphasize the multiple factors that influence surface area and mark its utility in carbon nanomaterial characterization, a prerequisite to understanding their potential applications and toxicities. Implications for occupational monitoring are discussed.

  10. Properties that Influence the Specific Surface Areas of Carbon Nanotubes and Nanofibers

    PubMed Central

    BIRCH, M. EILEEN; RUDA-EBERENZ, TONI A.; CHAI, MING; ANDREWS, RONNEE; HATFIELD, RANDAL L.

    2015-01-01

    Commercially available carbon nanotubes and nanofibers were analyzed to examine possible relationships between their Brunauer–Emmett–Teller specific surface areas (SSAs) and their physical and chemical properties. Properties found to influence surface area were number of walls/diameter, impurities, and surface functionalization with hydroxyl and carboxyl groups. Characterization by electron microscopy, energy-dispersive X-ray spectrometry, thermogravimetric analysis, and elemental analysis indicates that SSA can provide insight on carbon nanomaterials properties, which can differ vastly depending on synthesis parameters and post-production treatments. In this study, how different properties may influence surface area is discussed. The materials examined have a wide range of surface areas. The measured surface areas differed from product specifications, to varying degrees, and between similar products. Findings emphasize the multiple factors that influence surface area and mark its utility in carbon nanomaterial characterization, a prerequisite to understanding their potential applications and toxicities. Implications for occupational monitoring are discussed. PMID:24029925

  11. One-step synthesis of magnetite core/zirconia shell nanocomposite for high efficiency removal of phosphate from water

    NASA Astrophysics Data System (ADS)

    Wang, Zhe; Xing, Mingchao; Fang, Wenkan; Wu, Deyi

    2016-03-01

    A self-assembled magnetite core/zirconia shell (Fe3O4@ZrO2) nanoparticle material was fabricated by the one-step co-precipitation method to capture phosphate from water. Fe3O4@ZrO2 with different Fe/Zr molar ratios were obtained and characterized by XRD, TEM, BET surface area and magnetization. It was shown that, with the decreasing of Fe/Zr molar ratio, magnetization decreased whereas surface area and adsorption capacity of phosphate increased. Fe3O4@ZrO2 with the ratio of higher than 4:1 had satisfactory magnetization property (>23.65 emu/g), enabling rapid magnetic separation from water and recycle of the spent adsorbent. The Langmuir adsorption capacity of Fe3O4@ZrO2 reached 27.93-69.44 mg/g, and the adsorption was fast (90% of phosphate removal within 20 min). The adsorption decreases with increasing pH, and higher ionic strength caused slight increase in adsorption at pH > about 5.5. The presence of chloride, nitrate and sulfate anions did not bring about significant changes in adsorption. As a result, Fe3O4@ZrO2 performed well to remove phosphate from real wastewater. These results were interpreted by the ligand exchange mechanism, i.e., the direct coordination of phosphate onto zirconium by replacement of hydroxyl groups. Results suggested that phosphate reacted mainly with surface hydroxyl groups but diffusion into interior of zirconia phase also contributed to adsorption. The adsorbed phosphate could be desorbed with a NaOH treatment and the regenerated Fe3O4@ZrO2 could be repeatedly used.

  12. The adsorption of human serum albumin (HSA) on CO2 laser modified magnesia partially stabilised zirconia (MgO-PSZ).

    PubMed

    Hao, L; Lawrence, J

    2004-03-15

    Magnesia partially stabilised zirconia (MgO-PSZ), a bioinert ceramic, exhibits high mechanical strength, excellent corrosion resistance and good biocompatibility, but it does not naturally form a direct bond with bone resulting in a lack of osteointegration. The surface properties and structure of a biomaterial play an essential role in protein adsorption. As such, changes in the surface properties and structure of biomaterials may in turn alter their bioactivity. So, the fundamental reactions at the interface of biomaterials and tissue should influence their integration and bone-bonding properties. To this end, CO2 laser radiation was used to modify the surface roughness, crystal size, phase and surface energy of the MgO-PSZ. The basic mechanisms active in improving the surface energy were analysed and found to be the phase change and augmented surface area. The adsorption of human serum albumin (HSA), which is a non-cell adhesive protein, was compared on the untreated and CO2 laser modified MgO-PSZ. It was observed that the thickness of the adsorbed HSA decreased as the polar surface energy of the MgO-PSZ increased, indicating that HSA adsorbed more effectively on the hydrophobic MgO-PSZ surface than the hydrophilic surface. The current study provided important information regarding protein-biomaterial interactions and possible mechanisms behind the cell interaction and in vivo behaviour.

  13. Enamel wear caused by monolithic zirconia crowns after 6 months of clinical use.

    PubMed

    Stober, T; Bermejo, J L; Rammelsberg, P; Schmitter, M

    2014-04-01

    The purpose of this study was to evaluate enamel wear caused by monolithic zirconia crowns and to compare this with enamel wear caused by contralateral natural antagonists. Twenty monolithic zirconia crowns were placed in 20 patients requiring full molar crowns. For measurement of wear, impressions of both jaws were made at baseline after crown cementation and at 6-month follow-up. Mean and maximum wear of the occlusal contact areas of the crowns, of their natural antagonists and of the two contralateral natural antagonists were measured by the use of plaster replicas and 3D laser scanning methods. Wear differences were investigated by the use of two-sided paired Student's t-tests and by linear regression analysis. Mean vertical loss (maximum vertical loss in parentheses) was 10 (43) μm for the zirconia crowns, 33 (112) μm for the opposing enamel, 10 (58) μm for the contralateral teeth and 10 (46) μm for the contralateral antagonists. Both mean and maximum enamel wear were significantly different between the antagonists of the zirconia crowns and the contralateral antagonists. Gender and activity of the masseter muscle at night (bruxism) were identified as possible confounders which significantly affected wear. Under clinical conditions, monolithic zirconia crowns seem to be associated with more wear of opposed enamel than are natural teeth. With regard to wear behaviour, clinical application of monolithic zirconia crowns is justifiable because the amount of antagonistic enamel wear after 6 months is comparable with, or even lower than, that caused by other ceramic materials in previous studies.

  14. Grafting Sulfated Zirconia on Mesoporous Silica

    SciTech Connect

    Wang, Yong; Lee, Kwan Young; Choi, Saemin; Liu, Jun; Wang, Li Q.; Peden, Charles HF

    2007-06-01

    Sulfated zirconia has received considerable attention as a potential solid acid catalyst in recent years. In this paper, the preparation and properties of acid catalysts obtained by grafting ziconia with atomic precision on MCM-41 mesoporous silica were studied. TEM and potential titration characterizations revealed that ZrO2/MCM-41 with monolayer coverage can be obtained using this grafting technique. Sulfated ZrO2/MCM-41 exhibits improved thermal stability than that of bulk sulfated zirconia, as evidenced by temperature programmed characterizations and XRD analysis. Temperature programmed reaction of isopropanol was used to evaluate the acidity of sulfated ZrO2/MCM-41. It was found that the acid strength of sulfated ZrO2/MCM-41 with monolayer coverage is weaker than bulk sulfated zirconia but stronger than SiO2-Al2O3, a common strong acid catalyst.

  15. Processing of Alumina-Toughened Zirconia Composites

    NASA Technical Reports Server (NTRS)

    Bansal, Narottam P.; Choi, Sung R.

    2003-01-01

    Dense and crack-free 10-mol%-yttria-stabilized zirconia (10YSZ)-alumina composites, containing 0 to 30 mol% of alumina, have been fabricated by hot pressing. Release of pressure before onset of cooling was crucial in obtaining crack-free material. Hot pressing at 1600 C resulted in the formation of ZrC by reaction of zirconia with grafoil. However, no such reaction was observed at 1500 C. Cubic zirconia and -alumina were the only phases detected from x-ray diffraction indicating no chemical reaction between the composite constituents during hot pressing. Microstructure of the composites was analyzed by scanning electron microscopy and transmission electron microscopy. Density and elastic modulus of the composites followed the rule-of-mixtures. Addition of alumina to 10YSZ resulted in lighter, stronger, and stiffer composites by decreasing density and increasing strength and elastic modulus.

  16. (Hyperfine experimental investigation of zirconia ceramics)

    SciTech Connect

    Not Available

    1992-01-01

    This research program has encompassed a broad investigation of microscopic structure and point defect properties in insulating materials and some recent exploratory work on semiconductors. The major experimental technique is perturbed angular correlation (PAC) spectroscopy. Our research provides information about the microscopic structure, nucleation, and equilibrium of structural phases in materials under investigation. We have studied phase equilibria in monoclinic, tetragonal, and cubic zirconia in the past and have recently begun more detailed investigation of high-temperature anomalies in monoclinic zirconia and tetragonal stabilized zirconia. We also have found a number of instances where the indium PAC probe has detected subtle phase changes, small precipitate formation, and other phase behavior that are difficult to detect by conventional diffraction methods. The PAC experimental technique is described briefly in section 2, and recent research is reviewed in section 3.

  17. 30 CFR 761.11 - Areas where surface coal mining operations are prohibited or limited.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Areas where surface coal mining operations are....11 Areas where surface coal mining operations are prohibited or limited. You may not conduct surface coal mining operations on the following lands unless you either have valid existing rights,...

  18. 30 CFR 761.11 - Areas where surface coal mining operations are prohibited or limited.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Areas where surface coal mining operations are....11 Areas where surface coal mining operations are prohibited or limited. You may not conduct surface coal mining operations on the following lands unless you either have valid existing rights,...

  19. 30 CFR 717.15 - Disposal of excess rock and earth materials on surface areas.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Disposal of excess rock and earth materials on surface areas. 717.15 Section 717.15 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND... STANDARDS § 717.15 Disposal of excess rock and earth materials on surface areas. Excess rock and...

  20. 30 CFR 717.15 - Disposal of excess rock and earth materials on surface areas.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 30 Mineral Resources 3 2012-07-01 2012-07-01 false Disposal of excess rock and earth materials on surface areas. 717.15 Section 717.15 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND... STANDARDS § 717.15 Disposal of excess rock and earth materials on surface areas. Excess rock and...

  1. 30 CFR 717.15 - Disposal of excess rock and earth materials on surface areas.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Disposal of excess rock and earth materials on surface areas. 717.15 Section 717.15 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND... STANDARDS § 717.15 Disposal of excess rock and earth materials on surface areas. Excess rock and...

  2. 30 CFR 717.15 - Disposal of excess rock and earth materials on surface areas.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 30 Mineral Resources 3 2011-07-01 2011-07-01 false Disposal of excess rock and earth materials on surface areas. 717.15 Section 717.15 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND... STANDARDS § 717.15 Disposal of excess rock and earth materials on surface areas. Excess rock and...

  3. 30 CFR 717.15 - Disposal of excess rock and earth materials on surface areas.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Disposal of excess rock and earth materials on surface areas. 717.15 Section 717.15 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND... STANDARDS § 717.15 Disposal of excess rock and earth materials on surface areas. Excess rock and...

  4. 30 CFR 761.11 - Areas where surface coal mining operations are prohibited or limited.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 30 Mineral Resources 3 2014-07-01 2014-07-01 false Areas where surface coal mining operations are....11 Areas where surface coal mining operations are prohibited or limited. You may not conduct surface coal mining operations on the following lands unless you either have valid existing rights,...

  5. 30 CFR 761.11 - Areas where surface coal mining operations are prohibited or limited.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 30 Mineral Resources 3 2013-07-01 2013-07-01 false Areas where surface coal mining operations are....11 Areas where surface coal mining operations are prohibited or limited. You may not conduct surface coal mining operations on the following lands unless you either have valid existing rights,...

  6. Expanded bed adsorption of human serum albumin from very dense Saccharomyces cerevesiae suspensions on fluoride-modified zirconia.

    PubMed

    Mullick, A; Flickinger, M C

    1999-11-05

    The adsorption of proteins from high cell density yeast suspensions on mixed-mode fluoride-modified zirconia (FmZr) particles (38 to 75 microm, surface area of 29 m(2)/g and density of 2.8 g/cm(3)) was investigated using human serum albumin (HSA) added to Saccharomyces cerevesiae as the model expression host. Because of the high density of the porous zirconia particles, HSA (4 mg/mL) can be adsorbed from a 100 g dry cell weight (DCW)/L yeast suspension in a threefold-expanded bed of FmZr. The expanded bed adsorption of any protein from a suspension containing >50 g DCW/L cells has not been previously reported. The FmZr bed expansion characteristics were well represented by the Richardson-Zaki correlation with a particle terminal velocity of 3.1 mm/s and a bed expansion index of 5.4. Expanded bed hydrodynamics were investigated as a function of bed expansion using residence time distribution studies with sodium nitrite as the tracer. The adsorption of HSA on FmZr exhibited features of multicomponent adsorption due to the presence of dimers. The protein binding capacity at 5% breakthrough decreased from 22 mg HSA/mL settled bed void volume for 20 g DCW/L yeast to 15 mg HSA/mL settled bed void volume for 40 g DCW/L yeast and remained unchanged for the higher yeast concentrations (60 to 100 g DCW/L). However, the batch (or equilibrium) binding capacity decreased monotonically as a function of yeast concentration (20 to 100 g DCW/L) and the binding capacity at 100 g DCW/L yeast was fivefold lower compared with that at 20 g DCW/L yeast. The lower batch binding capacity at high cell concentrations resulted from the adsorption of cells at the surface of the particles restricting access of HSA to the intraparticle surface area. Batch (or equilibrium) and column HSA adsorption results indicated that the adsorption of HSA on FmZr occurred at a time scale that may be much faster than that of yeast cells. The zirconia particles were cleaned of adsorbed HSA and yeast with a

  7. 30 CFR 761.11 - Areas where surface coal mining operations are prohibited or limited.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Areas where surface coal mining operations are prohibited or limited. 761.11 Section 761.11 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR AREAS UNSUITABLE FOR MINING AREAS DESIGNATED BY ACT OF CONGRESS §...

  8. Effects of Mechanical and Chemical Pretreatments of Zirconia or Fiber Posts on Resin Cement Bonding

    PubMed Central

    Li, Rui; Zhou, Hui; Wei, Wei; Wang, Chen; Sun, Ying Chun; Gao, Ping

    2015-01-01

    The bonding strength between resin cement and posts is important for post and core restorations. An important method of improving the bonding strength is the use of various surface pretreatments of the post. In this study, the surfaces of zirconia (fiber) posts were treated by mechanical and/or chemical methods such as sandblasting and silanization. The bonding strength between the zirconia (fiber) post and the resin cement was measured by a push-out method after thermocycling based on the adhesion to Panavia F 2.0 resin cement. The zirconia and fiber posts exhibited different bonding strengths after sandblasting and/or silanization because of the different strengths and chemical structures. The zirconia post showed a high bonding strength of up to 17.1 MPa after a combined treatment of sandblasting and silanization because of the rough surface and covalent bonds at the interface. This effect was also enhanced by using 1,2-bis(trimethoxysilyl)ethane for the formation of a flexible layer at the interface. In contrast, a high bonding strength of 13.9 MPa was obtained for the fiber post treated by silane agents because the sandblasting treatment resulted in damage to the fiber post, as observed by scanning electron microscopy. The results indicated that the improvement in the bonding strength between the post and the resin cement could be controlled by different chemical and/or mechanical treatments. Enhanced bonding strength depended on covalent bonding and the surface roughness. A zirconia post with high bonding strength could potentially be used for the restoration of teeth in the future. PMID:26066349

  9. Preparation of macroporous zirconia monoliths from ionic precursors via an epoxide-mediated sol-gel process accompanied by phase separation

    PubMed Central

    Song, Jie; Lvlin, Yixiu; Nakanishi, Kazuki; Kanamori, Kazuyoshi; Yang, Hui

    2015-01-01

    Monolithic macroporous zirconia (ZrO2) derived from ionic precursors has been successfully fabricated via the epoxide-mediated sol-gel route accompanied by phase separation in the presence of propylene oxide (PO) and poly(ethylene oxide) (PEO). The addition of PO used as an acid scavenger mediates the gelation, whereas PEO enhances the polymerization-induced phase separation. The appropriate choice of the starting compositions allows the production of a macroporous zirconia monolith with a porosity of 52.9% and a Brunauer–Emmett–Teller (BET) surface area of 171.9 m2 · g−1. The resultant dried gel is amorphous, whereas tetragonal ZrO2 and monoclinic ZrO2 are precipitated at 400 and 600 °C, respectively, without spoiling the macroporous morphology. After solvothermal treatment with an ethanol solution of ammonia, tetragonal ZrO2 monoliths with smooth skeletons and well-defined mesopores can be obtained, and the BET surface area is enhanced to 583.8 m2 · g−1. PMID:27877772

  10. Preparation of macroporous zirconia monoliths from ionic precursors via an epoxide-mediated sol-gel process accompanied by phase separation.

    PubMed

    Guo, Xingzhong; Song, Jie; Lvlin, Yixiu; Nakanishi, Kazuki; Kanamori, Kazuyoshi; Yang, Hui

    2015-04-01

    Monolithic macroporous zirconia (ZrO2) derived from ionic precursors has been successfully fabricated via the epoxide-mediated sol-gel route accompanied by phase separation in the presence of propylene oxide (PO) and poly(ethylene oxide) (PEO). The addition of PO used as an acid scavenger mediates the gelation, whereas PEO enhances the polymerization-induced phase separation. The appropriate choice of the starting compositions allows the production of a macroporous zirconia monolith with a porosity of 52.9% and a Brunauer-Emmett-Teller (BET) surface area of 171.9 m(2) · g(-1). The resultant dried gel is amorphous, whereas tetragonal ZrO2 and monoclinic ZrO2 are precipitated at 400 and 600 °C, respectively, without spoiling the macroporous morphology. After solvothermal treatment with an ethanol solution of ammonia, tetragonal ZrO2 monoliths with smooth skeletons and well-defined mesopores can be obtained, and the BET surface area is enhanced to 583.8 m(2) · g(-1).

  11. Preparation of macroporous zirconia monoliths from ionic precursors via an epoxide-mediated sol-gel process accompanied by phase separation

    NASA Astrophysics Data System (ADS)

    Guo, Xingzhong; Song, Jie; Lvlin, Yixiu; Nakanishi, Kazuki; Kanamori, Kazuyoshi; Yang, Hui

    2015-04-01

    Monolithic macroporous zirconia (ZrO2) derived from ionic precursors has been successfully fabricated via the epoxide-mediated sol-gel route accompanied by phase separation in the presence of propylene oxide (PO) and poly(ethylene oxide) (PEO). The addition of PO used as an acid scavenger mediates the gelation, whereas PEO enhances the polymerization-induced phase separation. The appropriate choice of the starting compositions allows the production of a macroporous zirconia monolith with a porosity of 52.9% and a Brunauer-Emmett-Teller (BET) surface area of 171.9 m2 · g-1. The resultant dried gel is amorphous, whereas tetragonal ZrO2 and monoclinic ZrO2 are precipitated at 400 and 600 °C, respectively, without spoiling the macroporous morphology. After solvothermal treatment with an ethanol solution of ammonia, tetragonal ZrO2 monoliths with smooth skeletons and well-defined mesopores can be obtained, and the BET surface area is enhanced to 583.8 m2 · g-1.

  12. Effect of colouring green stage zirconia on the adhesion of veneering ceramics with different thermal expansion coefficients.

    PubMed

    Aktas, Guliz; Sahin, Erdal; Vallittu, Pekka; Ozcan, Mutlu; Lassila, Lippo

    2013-12-01

    This study evaluated the adhesion of zirconia core ceramics with their corresponding veneering ceramics, having different thermal expansion coefficients (TECs), when zirconia ceramics were coloured at green stage. Zirconia blocks (N=240; 6 mm×7 mm×7 mm) were manufactured from two materials namely, ICE Zirconia (Group 1) and Prettau Zirconia (Group 2). In their green stage, they were randomly divided into two groups. Half of the specimens were coloured with colouring liquid (shade A2). Three different veneering ceramics with different TEC (ICE Ceramic, GC Initial Zr and IPS e.max Ceram) were fired on both coloured and non-coloured zirconia cores. Specimens of high noble alloys (Esteticor Plus) veneered with ceramic (VM 13) (n=16) acted as the control group. Core-veneer interface of the specimens were subjected to shear force in the Universal Testing Machine (0.5 mm⋅min(-1)). Neither the zirconia core material (P=0.318) nor colouring (P=0.188) significantly affected the results (three-way analysis of variance, Tukey's test). But the results were significantly affected by the veneering ceramic (P=0.000). Control group exhibited significantly higher mean bond strength values (45.7±8) MPa than all other tested groups ((27.1±4.1)-(39.7±4.7) and (27.4±5.6)-(35.9±4.7) MPa with and without colouring, respectively) (P<0.001). While in zirconia-veneer test groups, predominantly mixed type of failures were observed with the veneering ceramic covering <1/3 of the substrate surface, in the metal-ceramic group, veneering ceramic was left adhered >1/3 of the metal surface. Colouring zirconia did not impair adhesion of veneering ceramic, but veneering ceramic had a significant influence on the core-veneer adhesion. Metal-ceramic adhesion was more reliable than all zirconia-veneer ceramics tested.

  13. Influence of contamination on resin bond strength to nano-structured alumina-coated zirconia ceramic.

    PubMed

    Zhang, Shanchuan; Kocjan, Andraz; Lehmann, Frank; Kosmac, Tomaz; Kern, Matthias

    2010-08-01

    The purpose of this study was to evaluate the influence of contamination and subsequent cleaning on the bond strength and durability of an adhesive resin to nano-structured alumina-coated zirconia ceramic. Zirconia ceramic disks were coated with nano-structured alumina, utilizing the hydrolysis of aluminum nitride powder. After immersion in saliva or the use of a silicone disclosing agent, specimens were cleaned with phosphoric acid etching or with tap water rinsing only. Uncontaminated specimens served as controls. Plexiglas tubes filled with composite resin were bonded with a phosphate monomer [10-methacryloxydecyl-dihydrogenphosphate (MDP)]-containing resin (Panavia 21). Subgroups of eight specimens each were stored in distilled water at 37 degrees C, either for 3 d without thermal cycling (TC) or for 150 d with 37,500 thermal cycles from 5 to 55 degrees C. The tensile bond strength (TBS) was determined using a universal testing machine at a crosshead speed of 2 mm min(-1). The topography of the debonded surface was scrutinized for fractographic features, utilizing both optical and scanning electron microscopy. The TBS to uncontaminated nano-structured alumina-coated zirconia ceramic was durable, while contamination significantly reduced the TBS. Phosphoric acid cleaning was effective in removal of saliva contamination from the coated bonding surface but was not effective in removal of the silicone disclosing agent. Nano-structured alumina coating improves resin bonding to zirconia ceramic and eliminates the need for air-abrasion before bonding.

  14. Fracture resistance of three-unit zirconia fixed partial denture with modified framework.

    PubMed

    Partiyan, Arthur; Osman, Essam; Rayyan, Mohammad M; Aboushelib, Moustafa; Ibrahim, Ahmed; Jimbo, Ryo

    2017-01-01

    Obtaining ideal prosthetic framework design is at times hindered by anatomical limitations in the posterior region that might increase the risk for zirconia restoration fracture. Modification such as increasing the bulk thickness especially in the connector region could result in strengthening the zirconia framework. Three-unit zirconia fixed partial dentures replacing mandibular molars were fabricated using the following two techniques: CAD/CAM technology and manual copy milling. Modified framework with unveneered full thickness connectors were designed and fabricated with the aforementioned methods. Conventional frameworks (0.5 mm thick with rounded 3 mm connectors) served as control (N = 20). After cementation on epoxy dies, the frameworks were loaded to fracture in a universal testing machine. Fractured surfaces were prepared for examination using scanning electron microscopy. Statistical analysis revealed significant differences in fracture resistance between conventional and modified framework design for both fabrication techniques tested. SEM examination indicated that critical crack originated at the tensile surface of the connectors for conventional frameworks. The critical crack for modified frameworks occurred on the axial wall of the abutments. The modification of the zirconia framework design presented significant improvement of the fracture resistance compared to the conventional design.

  15. Nondestructive inspection of phase transformation in zirconia-containing hip joints by confocal Raman spectroscopy

    NASA Astrophysics Data System (ADS)

    Zhu, Wenliang; Sugano, Nobuhiko; Pezzotti, Giuseppe

    2013-12-01

    Environmental metastability of zirconia (ZrO2) ceramic in the human body [represented by a tetragonal-to-monoclinic (t→m) phase transformation] takes place on the surface of the artificial joint and proceeds with time toward its interior. Its quantitative characterization is mandatory for the safety of joint implants and consists of the assessment of the in-depth monoclinic profile fraction as compared to that of the initially untransformed material. We attempt to fully establish a characterization protocol and present two different nondestructive approaches for resolving highly graded phase-transformation profiles along the hip-joint subsurface by confocal Raman microprobe technique. A series of partially transformed tetragonal zirconia polycrystal and zirconia-toughened alumina ceramics are used as screening samples. Probe biases could be eliminated and the real transformation profiles retrieved through a deconvolution procedure of Raman experimental data collected as a function of pinhole aperture and focal depth, respectively. Confirmation of the confocal assessments was made by a destructive cross-sectional inspection by both laser optical microscope and Raman spectral line scans. This study unveils for the first time the real quantitative amount of surface phase-transformation fractions and the related subsurface profiles in zirconia-based retrieved medical samples.

  16. Chipping resistance of graded zirconia ceramics for dental crowns.

    PubMed

    Zhang, Y; Chai, H; Lee, J J-W; Lawn, B R

    2012-03-01

    A serious drawback of veneering porcelains is a pronounced susceptibility to chipping. Glass-infiltrated dense zirconia structures can now be produced with esthetic quality, making them an attractive alternative. In this study, we examined the hypothesis that such infiltrated structures are much more chip-resistant than conventional porcelains, and at least as chip-resistant as non-infiltrated zirconia. A sharp indenter was used to produce chips in flat and anatomically correct glass-infiltrated zirconia crown materials, and critical loads were measured as a function of distance from the specimen edge (flat) or side wall (crown). Control data were obtained on zirconia specimens without infiltration and on crowns veneered with porcelains. The results confirmed that the resistance to chipping in graded zirconia is more than 4 times higher than that of porcelain-veneered zirconia and is at least as high as that of non-veneered zirconia.

  17. 30 CFR 921.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 921.762 Section 921.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations....

  18. 30 CFR 933.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 933.762 Section 933.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designation Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  19. 30 CFR 941.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 941.762 Section 941.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations....

  20. 30 CFR 933.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 933.762 Section 933.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designation Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  1. 30 CFR 933.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 933.762 Section 933.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designation Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  2. 30 CFR 941.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 941.762 Section 941.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations....

  3. 30 CFR 939.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 939.762 Section 939.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  4. 30 CFR 905.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 905.762 Section 905.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining operations....

  5. 30 CFR 921.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 921.762 Section 921.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations....

  6. 30 CFR 942.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... surface coal mining operations. 942.764 Section 942.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE TENNESSEE § 942.764 Process for designating areas unsuitable for surface coal mining... Mining Operations, shall apply to surface coal mining and reclamation operations. (b) The Secretary...

  7. 30 CFR 942.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... surface coal mining operations. 942.764 Section 942.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE TENNESSEE § 942.764 Process for designating areas unsuitable for surface coal mining... Mining Operations, shall apply to surface coal mining and reclamation operations. (b) The Secretary...

  8. 30 CFR 939.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 939.762 Section 939.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  9. 30 CFR 942.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... surface coal mining operations. 942.764 Section 942.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE TENNESSEE § 942.764 Process for designating areas unsuitable for surface coal mining... Mining Operations, shall apply to surface coal mining and reclamation operations. (b) The Secretary...

  10. 30 CFR 941.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 941.762 Section 941.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations....

  11. 30 CFR 947.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 947.762 Section 947.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  12. 30 CFR 933.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 933.762 Section 933.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designation Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  13. 30 CFR 933.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 933.762 Section 933.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designation Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  14. 30 CFR 905.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 905.762 Section 905.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining operations....

  15. 30 CFR 905.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 905.762 Section 905.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining operations....

  16. 30 CFR 947.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 947.762 Section 947.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  17. 30 CFR 939.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 939.762 Section 939.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  18. 30 CFR 921.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 921.762 Section 921.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations....

  19. 30 CFR 942.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... surface coal mining operations. 942.764 Section 942.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE TENNESSEE § 942.764 Process for designating areas unsuitable for surface coal mining... Mining Operations, shall apply to surface coal mining and reclamation operations. (b) The Secretary...

  20. 30 CFR 939.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 939.762 Section 939.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  1. 30 CFR 947.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... for surface coal mining operations. 947.762 Section 947.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  2. 30 CFR 947.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 947.762 Section 947.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  3. 30 CFR 941.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 941.762 Section 941.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations....

  4. 30 CFR 942.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... surface coal mining operations. 942.764 Section 942.764 Mineral Resources OFFICE OF SURFACE MINING... WITHIN EACH STATE TENNESSEE § 942.764 Process for designating areas unsuitable for surface coal mining... Mining Operations, shall apply to surface coal mining and reclamation operations. (b) The Secretary...

  5. 30 CFR 921.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 921.762 Section 921.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations....

  6. 30 CFR 939.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... for surface coal mining operations. 939.762 Section 939.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  7. 30 CFR 941.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 941.762 Section 941.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations....

  8. 30 CFR 921.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... for surface coal mining operations. 921.762 Section 921.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mine operations....

  9. 30 CFR 905.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... for surface coal mining operations. 905.762 Section 905.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining operations....

  10. 30 CFR 905.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 905.762 Section 905.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining operations....

  11. 30 CFR 947.762 - Criteria for designating areas as unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... for surface coal mining operations. 947.762 Section 947.762 Mineral Resources OFFICE OF SURFACE MINING... mining operations. Part 762 of this chapter, Criteria for Designating Areas Unsuitable for Surface Coal Mining Operations, shall apply to surface coal mining and reclamation operations....

  12. Large-area fabrication of superhydrophobic surfaces for practical applications: an overview

    PubMed Central

    Xue, Chao-Hua; Jia, Shun-Tian; Zhang, Jing; Ma, Jian-Zhong

    2010-01-01

    This review summarizes the key topics in the field of large-area fabrication of superhydrophobic surfaces, concentrating on substrates that have been used in commercial applications. Practical approaches to superhydrophobic surface construction and hydrophobization are discussed. Applications of superhydrophobic surfaces are described and future trends in superhydrophobic surfaces are predicted. PMID:27877336

  13. 30 CFR 905.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... surface coal mining operations. 905.764 Section 905.764 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS WITHIN EACH STATE CALIFORNIA § 905.764 Process for designating areas unsuitable for surface coal...

  14. 30 CFR 910.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... surface coal mining operations. 910.764 Section 910.764 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS WITHIN EACH STATE GEORGIA § 910.764 Process for designating areas unsuitable for surface coal...

  15. 30 CFR 912.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... surface coal mining operations. 912.764 Section 912.764 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS WITHIN EACH STATE IDAHO § 912.764 Process for designating areas unsuitable for surface coal...

  16. 30 CFR 903.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... surface coal mining operations. 903.764 Section 903.764 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS WITHIN EACH STATE ARIZONA § 903.764 Process for designating areas unsuitable for surface coal...

  17. Large-area fabrication of superhydrophobic surfaces for practical applications: an overview.

    PubMed

    Xue, Chao-Hua; Jia, Shun-Tian; Zhang, Jing; Ma, Jian-Zhong

    2010-06-01

    This review summarizes the key topics in the field of large-area fabrication of superhydrophobic surfaces, concentrating on substrates that have been used in commercial applications. Practical approaches to superhydrophobic surface construction and hydrophobization are discussed. Applications of superhydrophobic surfaces are described and future trends in superhydrophobic surfaces are predicted.

  18. Rugometric and microtopographic non-invasive inspection in dental-resin composites and zirconia ceramics

    NASA Astrophysics Data System (ADS)

    Fernández-Oliveras, Alicia; Costa, Manuel F. M.; Pecho, Oscar E.; Rubiño, Manuel; Pérez, María. M.

    2013-11-01

    Surface properties are essential for a complete characterization of biomaterials. In restorative dentistry, the study of the surface properties of materials meant to replace dental tissues in an irreversibly diseased tooth is important to avoid harmful changes in future treatments. We have experimentally analyzed the surface characterization parameters of two different types of dental-resin composites and pre-sintered and sintered zirconia ceramics. We studied two shades of both composite types and two sintered zirconia ceramics: colored and uncolored. Moreover, a surface treatment was applied to one specimen of each dental-resin. All the samples were submitted to rugometric and microtopographic non-invasive inspection with the MICROTOP.06.MFC laser microtopographer in order to gather meaningful statistical parameters such as the average roughness (Ra), the root-mean-square deviation (Rq), the skewness (Rsk), and the kurtosis of the surface height distribution (Rku). For a comparison of the different biomaterials, the uncertainties associated to the surface parameters were also determined. With respect to Ra and Rq, significant differences between the composite shades were found. Among the dental resins, the nanocomposite presented the highest values and, for the zirconia ceramics, the pre-sintered sample registered the lowest ones. The composite performance may have been due to cluster-formation variations. Except for the composites with the surface treatment, the sample surfaces had approximately a normal distribution of heights. The surface treatment applied to the composites increased the average roughness and moved the height distribution farther away from the normal distribution. The zirconia-sintering process resulted in higher average roughness without affecting the height distribution.

  19. Metal Adatoms and Clusters on Ultrathin Zirconia Films

    PubMed Central

    2016-01-01

    Nucleation and growth of transition metals on zirconia has been studied by scanning tunneling microscopy (STM) and density functional theory (DFT) calculations. Since STM requires electrical conductivity, ultrathin ZrO2 films grown by oxidation of Pt3Zr(0001) and Pd3Zr(0001) were used as model systems. DFT studies were performed for single metal adatoms on supported ZrO2 films as well as the (1̅11) surface of monoclinic ZrO2. STM shows decreasing cluster size, indicative of increasing metal–oxide interaction, in the sequence Ag < Pd ≈ Au < Ni ≈ Fe. Ag and Pd nucleate mostly at steps and domain boundaries of ZrO2/Pt3Zr(0001) and form three-dimensional clusters. Deposition of low coverages of Ni and Fe at room temperature leads to a high density of few-atom clusters on the oxide terraces. Weak bonding of Ag to the oxide is demonstrated by removing Ag clusters with the STM tip. DFT calculations for single adatoms show that the metal–oxide interaction strength increases in the sequence Ag < Au < Pd < Ni on monoclinic ZrO2, and Ag ≈ Au < Pd < Ni on the supported ultrathin ZrO2 film. With the exception of Au, metal nucleation and growth on ultrathin zirconia films follow the usual rules: More reactive (more electropositive) metals result in a higher cluster density and wet the surface more strongly than more noble metals. These bind mainly to the oxygen anions of the oxide. Au is an exception because it can bind strongly to the Zr cations. Au diffusion may be impeded by changing its charge state between −1 and +1. We discuss differences between the supported ultrathin zirconia films and the surfaces of bulk ZrO2, such as the possibility of charge transfer to the substrate of the films. Due to their large in-plane lattice constant and the variety of adsorption sites, ZrO2{111} surfaces are more reactive than many other oxygen-terminated oxide surfaces. PMID:27213024

  20. Improved Zirconia Oxygen-Separation Cell

    NASA Technical Reports Server (NTRS)

    Walsh, John V.; Zwissler, James G.

    1988-01-01

    Cell structure distributes feed gas more evenly for more efficent oxygen production. Multilayer cell structure containing passages, channels, tubes, and pores help distribute pressure evenly over zirconia electrolytic membrane. Resulting more uniform pressure distribution expected to improve efficiency of oxygen production.

  1. Applicative Characteristics of a New Zirconia Bracket with Multiple Slots

    PubMed Central

    Maki, Koutaro; Futaki, Katsuyoshi; Tanabe, Satoru; Takahashi, Mariko; Ichikawa, Yuta; Yamaguchi, Tetsutaro

    2016-01-01

    We have developed a new orthodontic bracket with three slots with lubricative properties on the working surfaces and proposed a new orthodontic treatment system employing 0.012−0.014-inch Ni-Ti arch wires. We recruited 54 patients, of which 27 received treatment with the new zirconia bracket with multiple slots system (M group), and the others received treatment with standard edge-wise appliances (control group [C group]). We compared the (1) tooth movement rate at the early stage of leveling; (2) changes in the dental arch morphology before and after leveling; and (3) pain caused by orthodontic treatment. Student's t-test was used in all assessments. The tooth movement rate in the maxillomandibular dentition was higher in the M group. The basal arch width, anterior length, and the intercanine width in the maxillary dentition were not significantly different in the two groups; however, the intercanine width in the mandibular dentition was higher in the C group. In assessments of treatment-related pain, the visual analogue pain score was 56.0 mm and 22.6 mm in the C and M groups, respectively. A new zirconia bracket with multiple slots system provided better outcomes with respect to tooth movement rate, treatment period, and postoperative pain, thus indicating its effectiveness over conventional orthodontic systems. PMID:27212948

  2. Transition temperature of martensitic transformations in hafnia and zirconia

    NASA Astrophysics Data System (ADS)

    Luo, Xuhui; Demkov, A. A.

    2008-03-01

    Transition metal oxides find applications in ceramics, catalysis and semiconductor technology. In particular, hafnium dioxide or hafnia will succeed silica as a gate dielectric in advanced transistors. However, thermodynamic properties of thin hafnia films are not well understood, despite their technological importance. We use density functional theory to investigate the tetragonal to monoclinic phase transition in hafnia and zirconia. We find that unlike the case of the cubic to tetragonal transition, this phase transition is not driven by a soft mode. We use transition state theory to identify the minimum energy path (MEP) employing first principle calculations for hafnia and zirconia, sow that both transformations are martensitic, and obtain the transition barriers. Martensitic transformations include both the internal coordinate transformation and deformation of the cell lattice vectors (``strain and shuffle''), therefore the potential energy surface and MEP are function not only of the internal atomic coordinates but also of the unit cell lattice vectors. Considering the simplest case of uniform strain the transition temperatures we then relate the barrier height to the transition temperature. As a self-consistency check, assuming the equality of thermodynamics potentials of the tetragonal and monoclinic phases during the transition, and using the difference in the internal energy calculated from first principles we estimate the entropy change associated with the transition which is found in good agreement with that calculated form the phonon spectra.

  3. Sol-gel synthesis and catalytic properties of sulfated zirconia

    SciTech Connect

    Li, Binghui; Gonzalez, R.D.

    1996-10-01

    Sulfate zirconia catalysts were prepared using a two-step sol-gel method with zirconium n-propoxide as the alcoxide precursor and a water/alcoxide ratio of 40. The resulting xerogel was pretreated prior to sulfation in flowing He at 385{degrees}C for 3 hours. The sulfation step was performed by immersing the dried xerogel in 15 ml of H{sub 2}SO{sub 4} solution per gram of sample for 15 min followed by drying in an oven at 130{degrees}C for 16 hours. The sulfated zirconia was activated in flowing oxygen at 600{degrees}C for 1 hour. A thermal desorption study of the deactivated catalyst showed two SO{sub 2} (m/e=64) peaks at 600{degrees}C and 900{degrees}C. The SO{sub 2} desorption peak at 600{degrees}C was coincidental with a CO{sub 2} (m/e=44) peak at the same temperature. These results are interpreted in terms of an organo-sulfur complex on the surface of the deactivated catalyst.

  4. Microstructure of Cs-implanted zirconia: Role of temperature

    NASA Astrophysics Data System (ADS)

    Vincent, L.; Thomé, L.; Garrido, F.; Kaitasov, O.; Houdelier, F.

    2008-12-01

    The aim of this study was to identify experimentally the phase which includes cesium in yttria stabilized zirconia (YSZ). The solubility and retention of cesium in YSZ were studied at high temperature (HT). Cesium was ion implanted (at 300 keV) into YSZ at room temperature (RT), 750 °C, or 900 °C at fluences up to 5×1016 cm-2. The temperature dependence of the radiation-induced damage and of the cesium distribution in YSZ single crystals was investigated by Rutherford backscattering spectrometry and ion channeling. Transmission electron microscopy (TEM) studies were performed in order to determine the damage nature and search for a predicted ternary phase of cesium zirconate. Whatever the implantation temperature, the thickness of the damaged layer increases inwards with ion fluence. At RT, amorphization occurs, caused by the high Cs concentration (7at.%). In situ TEM during postannealing shows recrystallization of cubic zirconia after release of cesium. A high implantation temperature has a significant influence on the nature of radiation defects and on the retained Cs concentration. At HT, dislocation loops and voids are formed but no amorphization is observed whereas polygonization occurs at high fluence. The implanted cesium concentration reaches a saturation value of 1.5 at. % above which Cs can no longer be retained in the matrix and is then released at the surface. At that concentration, cesium forms a solid solution in YSZ; no other phase is formed, neither during irradiation nor after thermal annealing.

  5. Translucency of monolithic and core zirconia after hydrothermal aging

    PubMed Central

    Fathy, Salma M.; El-Fallal, Abeer A.; El-Negoly, Salwa A.; El Bedawy, Abu Baker

    2015-01-01

    Abstract Objective: To evaluate the hydrothermal aging effect on the translucency of partially stabilized tetragonal zirconia with yttria (Y-TZP) used as monolithic or fully milled zirconia and of core type. Methods: Twenty disc-shaped specimens (1 and 10 mm) for each type of monolithic and core Y-TZP materials were milled and sintered according to the manufacturer’s instruction. The final specimens were divided into two groups according to the type of Y-TZP used. Translucency parameter (TP) was measured over white and black backgrounds with the diffuse reflectance method; X-ray diffraction (XRD) and scanning electron microscope (SEM) were used to analyze the microstructure of both Y-TZP types before and after aging. Data for TP values was statistically analyzed using Student’s t-test. Results: Monolithic Y-TZP showed the highest TP mean value (16.4 ± 0.316) before aging while core Y-TZP showed the lowest TP mean value (7.05 ± 0.261) after aging. There was a significant difference between the two Y-TZP types before and after hydrothermal aging. XRD analysis showed increases in monoclinic content in both Y-TZP surfaces after aging. Conclusion: Monolithic Y-TZP has a higher chance to low-temperature degradation than core type, which may significantly affect the esthetic appearance and translucency hence durability of translucent Y-TZP. PMID:27335897

  6. On the influence of substrate morphology and surface area on phytofauna

    USGS Publications Warehouse

    Becerra-Munoz, S.; Schramm, H.L.

    2007-01-01

    The independent effects and interactions between substrate morphology and substrate surface area on invertebrate density or biomass colonizing artificial plant beds were assessed in a clear-water and a turbid playa lake in Castro County, Texas, USA. Total invertebrate density and biomass were consistently greater on filiform substrates than on laminar substrates with equivalent substrate surface areas. The relationship among treatments (substrates with different morphologies and surface areas) and response (invertebrate density or biomass) was assessed with equally spaced surface areas. Few statistically significant interactions between substrate morphology and surface area were detected, indicating that these factors were mostly independent from each other in their effect on colonizing invertebrates. Although infrequently, when substrate morphology and surface area were not independent, the effects of equally spaced changes in substrate surface area on the rate of change of phytofauna density or biomass per unit of substrate surface area were dependent upon substrate morphology. The absence of three-way interactions indicated that effects of substrate morphology and substrate area on phytofauna density or biomass were independent of environmental conditions outside and inside exclosures. ?? 2006 Springer Science+Business Media B.V.

  7. Pleistocene surface water temperatures in the Benguela upwelling area

    NASA Astrophysics Data System (ADS)

    Os'kina, N. S.; Dmitrenko, O. B.

    2011-08-01

    Analysis of carbonate microfossils (planktonic foraminifers and nannoplankton) in the DSDP Hole 362 Quaternary section made it possible to specify its zonal subdivision (almost all zones of Gartner's high-resolution nannofossil scale are recognized), establish depositional environments, and restore past surface water temperatures. The latter appeared to be several degrees lower than their present-day values, which is evident from the anomalously high share of the subpolar species Neogloboquadrina pachyderma sin. that constitutes 97% of the fossil assemblage in Lower Pleistocene sediments. It is shown that the Benguela upwelling existed throughout the entire Pleistocene, being less intense in the Late Pleistocene and Holocene.

  8. Development of a zirconia toughened hydroxyapatite

    NASA Astrophysics Data System (ADS)

    Mager, Carie Christine Wilkinson

    2000-10-01

    Because of its low fracture toughness (<1 MPa m 1/2) compared to bone (2--12 MPa m1/2), the use of HAp in dentistry and orthopedics is limited to low load bearing applications. In order to broaden its applications, HAp was reinforced through the addition of partially stabilized zirconia. HAp composites with varying amounts of zirconia were processed using a 2 level, 8 variable factorial design to determine the effect of various processing conditions on the stability of the zirconia and HAp phases and on the resulting toughening behavior of the composites. The processing conditions included in the design were; (a) milling times and fluid dispersion mediums; (b) sintering times and temperatures in ambient air and atmospheric pressure; and (c) hot isostatic pressing time and temperature in inert and "wet" environments. The effect of volume fraction and particle size of the zirconia in the range of 0--30 wt % and -0.9mum to -2.0mum respectively on the material's fracture toughness were also determined. The composites were also placed in a serum like solution for 6 months to study the effect of physiological environment on the various processing parameters and the resulting toughening behavior. The toughening behavior before and after in vitro exposure was monitored using micro Raman spectroscopy which enabled the size and shape of the transformation zone to, be quantified. The optimization of the design parameter's resulted in an increase in the fracture toughness by a factor of three and the six month in vitro study indicated that a zirconia toughened HAp implant could be processed so as to retain its hardness and toughness in vivo.

  9. In vitro and in vivo evaluation of an alumina-zirconia composite for arthroplasty applications.

    PubMed

    Roualdes, Olivier; Duclos, Marie-Eve; Gutknecht, Dan; Frappart, Lucien; Chevalier, Jérôme; Hartmann, Daniel J

    2010-03-01

    In order to improve the reliability and the mechanical properties of orthopaedic hip prosthesis, new ceramic composites starting with nanosized powders of alumina and zirconia have been recently developed. The aim of the present study was to investigate the biological tolerance of one of these sintered ceramics and of its alumina and zirconia constitutive nanosized powders with both in vitro and in vivo approaches. At first, osteoblasts and fibroblasts were cultured either upon sintered ceramic discs with polished or rough surfaces or in the presence of the corresponding alumina or zirconia powders at various concentrations. Thereafter, we chronically injected these powders in the knee articulation of rats. In vitro, the materials showed no deleterious effect on cell proliferation, extra-cellular matrix production (human type I collagen and fibronectin) or on cell morphology. In vivo, the histological examination showed only a very moderate and non-specific granulomatous response of the synovial membrane but no major inflammation as clinically described with metals or polyethylene wear debris. Besides its improved physical properties, this recently developed alumina-zirconia composite showed satisfactory biocompatibility.

  10. Influence of grinding procedures on the flexural strength of zirconia ceramics.

    PubMed

    Işerı, Ufuk; Ozkurt, Zeynep; Kazazoğlu, Ender; Küçükoğlu, Davut

    2010-01-01

    The surface of zirconia may be damaged during grinding, influencing the mechanical properties of the material. The purpose of this study was to compare the flexural strength of zirconia after different grinding procedures. Twenty bar-type zirconia specimens (21 x 5 x 2 mm) were divided into 4 groups and ground using a high-speed handpiece or a low-speed straight handpiece until the bars were reduced 1 mm using two different grinding times: continuous grinding and short-time grinding (n=5). Control specimens (n=5) were analyzed without grinding. The flexural strengths of the bars were determined by using 3-point bending test in a universal testing machine at a crosshead speed of 0.5 mm/min. The fracture load (N) was recorded, and the data were analyzed statistically by the Kruskal Wallis test at a significance level of 0.05. In the test groups, high-speed handpiece grinding for a short time had produced the highest mean flexural strength (878.5 ± 194.8 MPa), while micromotor continuous grinding produced the lowest mean flexural strength (733.8 ± 94.2 MPa). The control group was the strongest group (928.4 ± 186.5 MPa). However, there was no statistically significant differences among the groups (p>0.05). Within the limitations of the study, there was no difference in flexural strength of zirconia specimens ground with different procedures.

  11. A photoelastic assessment of residual stresses in zirconia-veneer crowns.

    PubMed

    Belli, R; Monteiro, S; Baratieri, L N; Katte, H; Petschelt, A; Lohbauer, U

    2012-03-01

    Residual stresses within the veneer are linked to the high prevalence of veneer chipping observed in clinical trials of zirconia prostheses. We hypothesized that the thermal mismatch between the zirconia infrastructure and the veneer porcelain, as well as the rate used for cooling zirconia-veneer crowns, would be directly proportional to the magnitude of residual stresses built within the veneer layer. Two porcelains with different coefficients of thermal expansion were used to veneer zirconia copings, to create high or low thermal mismatches. The crowns were cooled according to a fast- or a slow-cooling protocol. The retardation of polarized light waves was used to calculate the residual stress magnitude and distribution across the veneer, according to the photoelasticity principle, in 1.0-mm-thick crown sections. While thermal mismatch was an important factor influencing the maximum stress development in the veneer, cooling rate had a minor role. Curved surfaces were preferential sites for stress concentration regardless of thermal mismatch or cooling rate.

  12. Influence of superstructure geometry on the mechanical behavior of zirconia implant abutments: a finite element analysis.

    PubMed

    Geringer, Alexander; Diebels, Stefan; Nothdurft, Frank P

    2014-12-01

    To predict the clinical performance of zirconia abutments, it is crucial to examine the mechanical behavior of different dental implant-abutment connection configurations. The international standard protocol for dynamic fatigue tests of dental implants (ISO 14801) allows comparing these configurations using standardized superstructure geometries. However, from a mechanical point of view, the geometry of clinical crowns causes modified boundary conditions. The purpose of this finite element (FE) study was to evaluate the influence of the superstructure geometry on the maximum stress values of zirconia abutments with a conical implant-abutment connection. Geometry models of the experimental setup described in ISO 14801 were generated using CAD software following the reconstruction of computerized tomography scans from all relevant components. These models served as a basis for an FE simulation. To reduce the numerical complexity of the FE model, the interaction between loading stamp and superstructure geometry was taken into account by defining the boundary conditions with regard to the frictional force. The results of the FE simulations performed on standardized superstructure geometry and anatomically shaped crowns showed a strong influence of the superstructure geometry and related surface orientations on the mechanical behavior of the underlying zirconia abutments. In conclusion, ISO testing of zirconia abutments should be accompanied by load-bearing capacity testing under simulated clinical conditions to predict clinical performance.

  13. Response surfaces for climate change impact assessments in urban areas.

    PubMed

    Semadeni-Davies, A

    2003-01-01

    Assessment of the impacts of climate change in real-world water systems, such as urban drainage networks, is a research priority for IPCC (Intergovernmental Panel of Climate Change). The usual approach is to force a hydrological transformation model with a changed climate scenario. To tackle uncertainty, the model should be run with at least high, middle and low change scenarios. This paper shows the value of response surfaces for displaying multiple simulated responses to incremental changes in air temperature and precipitation. The example given is inflow, related to sewer infiltration, at the Lycksele waste water treatment plant. The range of plausible changes in inflow is displayed for a series of runs for eight GCMs (Global Circulation Model; ACACIA; Carter, 2002, pers. comm.). These runs are summarised by climate envelopes, one for each prediction time-slice (2020, 2050, 2080). Together, the climate envelopes and response surfaces allow uncertainty to be easily seen. Winter inflows are currently sensitive to temperature, but if average temperature rises to above zero, inflow will be most sensitive to precipitation. Spring inflows are sensitive to changes in winter snow accumulation and melt. Inflow responses are highly dependent on the greenhouse gas emission scenario and GCM chosen.

  14. 30 CFR 72.620 - Drill dust control at surface mines and surface areas of underground mines.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... § 72.620 Drill dust control at surface mines and surface areas of underground mines. Holes shall be collared and drilled wet, or other effective dust control measures shall be used, when drilling non-water-soluble material. Effective dust control measures shall be used when drilling water-soluble material....

  15. 30 CFR 72.620 - Drill dust control at surface mines and surface areas of underground mines.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... § 72.620 Drill dust control at surface mines and surface areas of underground mines. Holes shall be collared and drilled wet, or other effective dust control measures shall be used, when drilling non-water-soluble material. Effective dust control measures shall be used when drilling water-soluble material....

  16. 30 CFR 72.620 - Drill dust control at surface mines and surface areas of underground mines.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... § 72.620 Drill dust control at surface mines and surface areas of underground mines. Holes shall be collared and drilled wet, or other effective dust control measures shall be used, when drilling non-water-soluble material. Effective dust control measures shall be used when drilling water-soluble material....

  17. 30 CFR 72.620 - Drill dust control at surface mines and surface areas of underground mines.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... § 72.620 Drill dust control at surface mines and surface areas of underground mines. Holes shall be collared and drilled wet, or other effective dust control measures shall be used, when drilling non-water-soluble material. Effective dust control measures shall be used when drilling water-soluble material....

  18. 30 CFR 72.620 - Drill dust control at surface mines and surface areas of underground mines.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... § 72.620 Drill dust control at surface mines and surface areas of underground mines. Holes shall be collared and drilled wet, or other effective dust control measures shall be used, when drilling non-water-soluble material. Effective dust control measures shall be used when drilling water-soluble material....

  19. 30 CFR 933.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... WITHIN EACH STATE NORTH CAROLINA § 933.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated Unsuitable for Coal Mining by Act of Congress, with the exception of §§ 761.11(c) and 761.12(f)(1), shall apply to surface coal mining and...

  20. 30 CFR 933.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... WITHIN EACH STATE NORTH CAROLINA § 933.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated Unsuitable for Coal Mining by Act of Congress, with the exception of §§ 761.11(c) and 761.12(f)(1), shall apply to surface coal mining and...

  1. 30 CFR 933.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... WITHIN EACH STATE NORTH CAROLINA § 933.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated Unsuitable for Coal Mining by Act of Congress, with the exception of §§ 761.11(c) and 761.12(f)(1), shall apply to surface coal mining and...

  2. 30 CFR 933.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... WITHIN EACH STATE NORTH CAROLINA § 933.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated Unsuitable for Coal Mining by Act of Congress, with the exception of §§ 761.11(c) and 761.12(f)(1), shall apply to surface coal mining and...

  3. 30 CFR 933.761 - Areas designated unsuitable for surface coal mining by Act of Congress.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... WITHIN EACH STATE NORTH CAROLINA § 933.761 Areas designated unsuitable for surface coal mining by Act of Congress. Part 761 of this chapter, Areas Designated Unsuitable for Coal Mining by Act of Congress, with the exception of §§ 761.11(c) and 761.12(f)(1), shall apply to surface coal mining and...

  4. Age Differences in Prefrontal Surface Area and Thickness in Middle Aged to Older Adults

    PubMed Central

    Dotson, Vonetta M.; Szymkowicz, Sarah M.; Sozda, Christopher N.; Kirton, Joshua W.; Green, Mackenzie L.; O’Shea, Andrew; McLaren, Molly E.; Anton, Stephen D.; Manini, Todd M.; Woods, Adam J.

    2016-01-01

    Age is associated with reductions in surface area and cortical thickness, particularly in prefrontal regions. There is also evidence of greater thickness in some regions at older ages. Non-linear age effects in some studies suggest that age may continue to impact brain structure in later decades of life, but relatively few studies have examined the impact of age on brain structure within middle-aged to older adults. We investigated age differences in prefrontal surface area and cortical thickness in healthy adults between the ages of 51 and 81 years. Participants received a structural 3-Tesla magnetic resonance imaging scan. Based on a priori hypotheses, primary analyses focused on surface area and cortical thickness in the dorsolateral prefrontal cortex, anterior cingulate cortex, and orbitofrontal cortex. We also performed exploratory vertex-wise analyses of surface area and cortical thickness across the entire cortex. We found that older age was associated with smaller surface area in the dorsolateral prefrontal and orbitofrontal cortices but greater cortical thickness in the dorsolateral prefrontal and anterior cingulate cortices. Vertex-wise analyses revealed smaller surface area in primarily frontal regions at older ages, but no age effects were found for cortical thickness. Results suggest age is associated with reduced surface area but greater cortical thickness in prefrontal regions during later decades of life, and highlight the differential effects age has on regional surface area and cortical thickness. PMID:26834623

  5. Age Differences in Prefrontal Surface Area and Thickness in Middle Aged to Older Adults.

    PubMed

    Dotson, Vonetta M; Szymkowicz, Sarah M; Sozda, Christopher N; Kirton, Joshua W; Green, Mackenzie L; O'Shea, Andrew; McLaren, Molly E; Anton, Stephen D; Manini, Todd M; Woods, Adam J

    2015-01-01

    Age is associated with reductions in surface area and cortical thickness, particularly in prefrontal regions. There is also evidence of greater thickness in some regions at older ages. Non-linear age effects in some studies suggest that age may continue to impact brain structure in later decades of life, but relatively few studies have examined the impact of age on brain structure within middle-aged to older adults. We investigated age differences in prefrontal surface area and cortical thickness in healthy adults between the ages of 51 and 81 years. Participants received a structural 3-Tesla magnetic resonance imaging scan. Based on a priori hypotheses, primary analyses focused on surface area and cortical thickness in the dorsolateral prefrontal cortex, anterior cingulate cortex, and orbitofrontal cortex. We also performed exploratory vertex-wise analyses of surface area and cortical thickness across the entire cortex. We found that older age was associated with smaller surface area in the dorsolateral prefrontal and orbitofrontal cortices but greater cortical thickness in the dorsolateral prefrontal and anterior cingulate cortices. Vertex-wise analyses revealed smaller surface area in primarily frontal regions at older ages, but no age effects were found for cortical thickness. Results suggest age is associated with reduced surface area but greater cortical thickness in prefrontal regions during later decades of life, and highlight the differential effects age has on regional surface area and cortical thickness.

  6. A high-throughput and selective method for the measurement of surface areas of silver nanoparticles.

    PubMed

    Agustin, Yuana Elly; Tsai, Shen-Long

    2015-04-21

    A high-throughput and selective method based on biomolecule affinity coordination was employed for measuring nanoparticle surface area in solutions. In this design, silver binding peptides (AgBPs) are immobilized on bacterial cellulose via fusion with cellulose binding domains to capture silver nanoparticles whereas green fluorescent proteins are fused with AgBPs as reporters for surface area quantification.

  7. Effect of CO2 and Nd:YAG Lasers on Shear Bond Strength of Resin Cement to Zirconia Ceramic

    PubMed Central

    Kasraei, Shahin; Yarmohamadi, Ebrahim; Shabani, Amanj

    2015-01-01

    Objectives: Because of poor bond between resin cement and zirconia ceramics, laser surface treatments have been suggested to improve adhesion. The present study evaluated the effect of CO2 and Nd:YAG lasers on the shear bond strength (SBS) of resin cement to zirconia ceramic. Materials and Methods: Ninety zirconia disks (6×2 mm) were randomly divided into six groups of 15. In the control group, no surface treatment was used. In the test groups, laser surface treatment was accomplished using CO2 and Nd:YAG lasers, respectively (groups two and three). Composite resin disks (3×2 mm) were fabricated and cemented to zirconia disks with self-etch resin cement and stored in distilled water for 24 hours. In the test groups four-six, the samples were prepared as in groups one-three and then thermocycled and stored in distilled water for six months. The SBS tests were performed (strain rate of 0.5 mm/min). The fracture modes were observed via stereomicroscopy. Data were analyzed with one and two-way ANOVA, independent t and Tukey’s tests. Results: The SBS values of Nd:YAG group (18.95±3.46MPa) was significantly higher than that of the CO2 group (14.00±1.96MPa), but lower than that of controls (23.35±3.12MPa). After thermocycling and six months of water storage, the SBS of the untreated group (1.80±1.23 MPa) was significantly lower than that of the laser groups. In groups stored for 24 hours, 60% of the failures were adhesive; however, after thermocycling and six months of water storage, 100% of failures were adhesive. Conclusion: Bonding durability of resin cement to zirconia improved with CO2 and Nd:YAG laser surface treatment of zirconia ceramic. PMID:27148380

  8. The relation of stream sediment surface area, grain size and composition to trace element chemistry

    USGS Publications Warehouse

    Horowitz, A.J.; Elrick, K.A.

    1987-01-01

    Intensive studies of 17 geographically and hydrologically diverse stream bed sediments provide information on the relation between grain size, surface area, and operationally defined geochemical phases (e.g. Mn oxides, amorphous Fe oxides) to trace element concentrations. Of the size fractions investigated ( 125 ??m), each of the various phases contribute to overall sample surface area. For material having mean grain sizes in the very fine sand range and finer (<125 ??m), the same phases act as surface-area inhibitors by cementing fine grains together to form aggregates. This increases the mean grain size of the sample and reduces the surface area. The presence of these aggregates may explain why the <63 ??m or <125 ??m size fractions are more important to sediment-trace element levels and surface area than other finer fractions. ?? 1987.

  9. Zirconia-poly(propylene imine) dendrimer nanocomposite based electrochemical urea biosensor.

    PubMed

    Shukla, Sudheesh K; Mishra, Ajay K; Mamba, Bhekie B; Arotiba, Omotayo A

    2014-11-01

    In this article we report a selective urea electrochemical biosensor based on electro-co-deposited zirconia-polypropylene imine dendrimer (ZrO2-PPI) nanocomposite modified screen printed carbon electrode (SPCE). ZrO2 nanoparticles, prepared by modified sol-gel method were dispersed in PPI solution, and electro-co-deposited by cyclic voltammetry onto a SPCE surface. The material and the modified electrodes were characterised using FTIR, electron microscopy and electrochemistry. The synergistic effect of the high active surface area of both materials, i.e. PPI and ZrO2 nanoparticles, gave rise to a remarkable improvement in the electrocatalytic properties of the biosensor and aided the immobilisation of the urease enzyme. The biosensor has an ampereometric response time of ∼4 s in urea concentration ranging from 0.01 mM to 2.99 mM with a correlation coefficient of 0.9985 and sensitivity of 3.89 μA mM(-1) cm(-2). The biosensor was selective in the presence of interferences. Photochemical study of the immobilised enzyme revealed high stability and reactivity.

  10. Long-term studies on the effects of nonvolatile organic compounds on porous media surface areas.

    PubMed

    Khachikian, Crist S; Harmon, Thomas C

    2002-01-01

    This paper investigates the long-term behavior of porous media contaminated by nonvolatile organic compounds (NVOC) in terms of specific interfacial surface area. Specifically, a natural sand, Moffett sand (MS), was contaminated with naphthalene and the surface area was measured repeatedly over time using nitrogen adsorption-desorption techniques. A field-contaminated sand affected by lamp-black material (LB) from former manufactured gas plant operations was also studied. Lampblack is a carbonaceous skeleton containing polycyclic aromatic hydrocarbons (PAHs) and other hydrocarbons. It is hypothesized that soils contaminated by these types of chemicals will exhibit significantly less surface area than their clean counterparts. The surface areas for the contaminated MS samples increased toward their clean-MS values during the 700-h aging period, but achieved the clean values only after pentane extraction or heating at 60 degrees C. Heating at 50 degrees C failed to achieve a similar recovery of the clean-MS surface area value. Nonspecific mass loss tracked the increase in surface area as indirect evidence that naphthalene loss was the cause of the surface area increase. For the LB samples, aging at 100 degrees C produced a slight decrease in surface area and mass while aging at 250 degrees C caused the surface area to increase roughly threefold while the mass decreased by approximately 1%. These results suggest that, under moderate heating and over the time scale of this investigation, there is a redistribution of the complex contaminant mixture on the solid matrix. Greater temperatures remove mass more efficiently and therefore exhibited the surface area increase expected in this experiment.

  11. 30 CFR 921.764 - Process for designating areas unsuitable for surface coal mining operations.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... surface coal mining operations. 921.764 Section 921.764 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR PROGRAMS FOR THE CONDUCT OF SURFACE MINING OPERATIONS... mining operations. Part 764 of this chapter, State Processes for Designating Areas Unsuitable for...

  12. High surface area silicon materials: fundamentals and new technology.

    PubMed

    Buriak, Jillian M

    2006-01-15

    Crystalline silicon forms the basis of just about all computing technologies on the planet, in the form of microelectronics. An enormous amount of research infrastructure and knowledge has been developed over the past half-century to construct complex functional microelectronic structures in silicon. As a result, it is highly probable that silicon will remain central to computing and related technologies as a platform for integration of, for instance, molecular electronics, sensing elements and micro- and nanoelectromechanical systems. Porous nanocrystalline silicon is a fascinating variant of the same single crystal silicon wafers used to make computer chips. Its synthesis, a straightforward electrochemical, chemical or photochemical etch, is compatible with existing silicon-based fabrication techniques. Porous silicon literally adds an entirely new dimension to the realm of silicon-based technologies as it has a complex, three-dimensional architecture made up of silicon nanoparticles, nanowires, and channel structures. The intrinsic material is photoluminescent at room temperature in the visible region due to quantum confinement effects, and thus provides an optical element to electronic applications. Our group has been developing new organic surface reactions on porous and nanocrystalline silicon to tailor it for a myriad of applications, including molecular electronics and sensing. Integration of organic and biological molecules with porous silicon is critical to harness the properties of this material. The construction and use of complex, hierarchical molecular synthetic strategies on porous silicon will be described.

  13. Surface Area, and Oxidation Effects on Nitridation Kinetics of Silicon Powder Compacts

    NASA Technical Reports Server (NTRS)

    Bhatt, R. T.; Palczer, A. R.

    1998-01-01

    Commercially available silicon powders were wet-attrition-milled from 2 to 48 hr to achieve surface areas (SA's) ranging from 1.3 to 70 sq m/g. The surface area effects on the nitridation kinetics of silicon powder compacts were determined at 1250 or 1350 C for 4 hr. In addition, the influence of nitridation environment, and preoxidation on nitridation kinetics of a silicon powder of high surface area (approximately equals 63 sq m/g) was investigated. As the surface area increased, so did the percentage nitridation after 4 hr in N2 at 1250 or 1350 C. Silicon powders of high surface area (greater than 40 sq m/g) can be nitrided to greater than 70% at 1250 C in 4 hr. The nitridation kinetics of the high-surface-area powder compacts were significantly delayed by preoxidation treatment. Conversely, the nitridation environment had no significant influence on the nitridation kinetics of the same powder. Impurities present in the starting powder, and those accumulated during attrition milling, appeared to react with the silica layer on the surface of silicon particles to form a molten silicate layer, which provided a path for rapid diffusion of nitrogen and enhanced the nitridation kinetics of high surface area silicon powder.

  14. Development of a zirconia-mullite based ceramic for recuperator applications

    SciTech Connect

    Gonzalez, J.M. )

    1992-12-01

    GTE Products Corporation developed a compact ceramic high temperature recuperator for recovering heat from relatively clean exhaust gases at temperatures up to 2500F. The DOE program allowed GTE to improve the technical and economic characteristics of the recuperator and stimulate industrial acceptance of the recuperator as an energy-saving technology. From January 1981 to December 1984, 561 recuperators were installed by GTE on new or retrofitted furnaces. With over 1200 units sold commercially between 1981 and 1990, GTE has documented the effect (long and short term) of corrosive attack from alkalies and lead. One objective of this contract was to develop Z-1000 a zirconia-mullite mixed oxide ceramic for use in ceramic recuperator applications susceptible to corrosion. To first and second pass of the ceramic recuperator would utilize the current cordierite-mixed-oxide ceramic. A Z-1000 matrix element would be used in the preheated air side's third pass (exhaust inlet). Thermal stresses on Z-1000 cross flow module could be minimized by selecting appropriate heat transfer surface areas for each pass. A large surface area for first and second pass (cordierite section) could provide for sufficient heat transfer for 50% effectiveness. A surface area that generates minimal heat transfer in the third pass (Z-1000) section is envisioned. Heat transferred in this section reduces the differential temperature across the matrix and the thermal stresses. Hence, thermal shock resistance of the material in the third pass becomes less critical; however, its corrosion resistance must be sufficient to withstand corrosive attack. This modular design could utilize a field repairable, disposable matrix. This report is concerned with process technology development for fabricating such a matrix, and a series of corrosion tests that established the potential corrosion resistance of the Z-1000 ceramic.

  15. Separation of racemic 2,4-dinitrophenyl amino acids on zirconia-immobilized quinine carbamate in reversed-phase liquid chromatography.

    PubMed

    Park, Jung Hag; Lee, Joon Woo; Song, Young Tae; Ra, Chun Sup; Cha, Jin Soon; Ryoo, Jae Jeong; Lee, Wonjae; Kim, In Whan; Jang, Myung Duk

    2004-08-01

    Zirconia is known to be one of the best chromatographic support materials due to its excellent chemical, thermal, and mechanical stability. A quinine carbamate-coated zirconia was prepared as a chiral stationary phase for separation of enantiomers of DNP-amino acids in reversed-phase liquid chromatography. Retention and enantioselectivity of this phase were compared to those for quinine carbamate bonded onto silica. Most amino acids studied were separated on the quinine carbamate-zirconia CSP although retention was longer and chiral selectivity was somewhat lower than on the corresponding silica CSP. Increased retention and decreased selectivity are probably due to strong non-enantioselective Lewis acid-base interactions between the amino acid molecule and the residual Lewis acid sites on the zirconia surface.

  16. Shear Bond Strengths between Three Different Yttria-Stabilized Zirconia Dental Materials and Veneering Ceramic and Their Susceptibility to Autoclave Induced Low-Temperature Degradation

    PubMed Central

    Sehgal, Manoti; Bhargava, Akshay; Gupta, Sharad; Gupta, Prateek

    2016-01-01

    A study was undertaken to evaluate the effect of artificial aging through steam and thermal treatment as influencing the shear bond strength between three different commercially available zirconia core materials, namely, Upcera, Ziecon, and Cercon, layered with VITA VM9 veneering ceramic using Universal Testing Machine. The mode of failure between zirconia and ceramic was further analyzed as adhesive, cohesive, or mixed using stereomicroscope. X-ray diffraction and SEM (scanning electron microscope) analysis were done to estimate the phase transformation (m-phase fraction) and surface grain size of zirconia particles, respectively. The purpose of this study was to simulate the clinical environment by artificial aging through steam and thermal treatment so as the clinical function and nature of the bond between zirconia and veneering material as in a clinical trial of 15 years could be evaluated. PMID:27293439

  17. Shear Bond Strengths between Three Different Yttria-Stabilized Zirconia Dental Materials and Veneering Ceramic and Their Susceptibility to Autoclave Induced Low-Temperature Degradation.

    PubMed

    Sehgal, Manoti; Bhargava, Akshay; Gupta, Sharad; Gupta, Prateek

    2016-01-01

    A study was undertaken to evaluate the effect of artificial aging through steam and thermal treatment as influencing the shear bond strength between three different commercially available zirconia core materials, namely, Upcera, Ziecon, and Cercon, layered with VITA VM9 veneering ceramic using Universal Testing Machine. The mode of failure between zirconia and ceramic was further analyzed as adhesive, cohesive, or mixed using stereomicroscope. X-ray diffraction and SEM (scanning electron microscope) analysis were done to estimate the phase transformation (m-phase fraction) and surface grain size of zirconia particles, respectively. The purpose of this study was to simulate the clinical environment by artificial aging through steam and thermal treatment so as the clinical function and nature of the bond between zirconia and veneering material as in a clinical trial of 15 years could be evaluated.

  18. Development of cortical thickness and surface area in autism spectrum disorder.

    PubMed

    Mensen, Vincent T; Wierenga, Lara M; van Dijk, Sarai; Rijks, Yvonne; Oranje, Bob; Mandl, René C W; Durston, Sarah

    2017-01-01

    Autism spectrum disorder (ASD) is a neurodevelopmental disorder often associated with changes in cortical volume. The constituents of cortical volume - cortical thickness and surface area - have separable developmental trajectories and are related to different neurobiological processes. However, little is known about the developmental trajectories of cortical thickness and surface area in ASD. In this magnetic resonance imaging (MRI) study, we used an accelerated longitudinal design to investigate the cortical development in 90 individuals with ASD and 90 typically developing controls, aged 9 to 20 years. We quantified cortical measures using the FreeSurfer software package, and then used linear mixed model analyses to estimate the developmental trajectories for each cortical measure. Our primary finding was that the development of surface area follows a linear trajectory in ASD that differs from typically developing controls. In typical development, we found a decline in cortical surface area between the ages of 9 and 20 that was absent in ASD. We found this pattern in all regions where developmental trajectories for surface area differed between groups. When we applied a more stringent correction that takes the interdependency of measures into account, this effect on cortical surface area retained significance for left banks of superior temporal sulcus, postcentral area, and right supramarginal area. These areas have previously been implicated in ASD and are involved in the interpretation and processing of audiovisual social stimuli and distinction between self and others. Although some differences in cortical volume and thickness were found, none survived the more stringent correction for multiple testing. This study underscores the importance of distinguishing between cortical surface area and thickness in investigating cortical development, and suggests the development of cortical surface area is of importance to ASD.

  19. Effect of ionic conductivity of zirconia electrolytes on polarization properties of various electrodes in SOFC

    SciTech Connect

    Watanabe, Masahiro; Uchida, Hiroyuki; Yoshida, Manabu

    1996-12-31

    Solid oxide fuel cells (SOFCs) have been intensively investigated because, in principle, their energy conversion efficiency is fairly high. Lowering the operating temperature of SOFCs from 1000{degrees}C to around 800{degrees}C is desirable for reducing serious problems such as physical and chemical degradation of the constructing materials. The object of a series of the studies is to find a clue for achieving higher electrode performances at a low operating temperature than those of the present level. Although the polarization loss at electrodes can be reduced by using mixed-conducting ceria electrolytes, or introducing the mixed-conducting (reduced zirconia or ceria) laver on the conventional zirconia electrolyte surface, no reports are available on the effect of such an ionic conductivity of electrolytes on electrode polarizations. High ionic conductivity of the electrolyte, of course, reduces the ohmic loss. However, we have found that the IR-free polarization of a platinum anode attached to zirconia electrolytes is greatly influenced by the ionic conductivity, {sigma}{sub ion}, of the electrolytes used. The higher the {sigma}{sub ion}, the higher the exchange current density, j{sub 0}, for the Pt anode in H{sub 2} at 800 {approximately} 1000{degrees}C. It was indicated that the H{sub 2} oxidation reaction rate was controlled by the supply rate of oxide ions through the Pt/zirconia interface which is proportional to the {sigma}{sub ion}. Recently, we have proposed a new concept of the catalyzed-reaction layers which realizes both high-performances of anodes and cathodes for medium-temperature operating SOFCs. We present the interesting dependence of the polarization properties of various electrodes (the SDC anodes with and without Ru microcatalysts, Pt cathode, La(Sr)MnO{sub 3} cathodes with and without Pt microcatalysts) on the {sigma}{sub ion} of various zirconia electrolytes at 800 {approximately} 1000{degrees}C.

  20. Effect of grinding and heat treatment on the mechanical behavior of zirconia ceramic.

    PubMed

    Ramos, Gabriela Freitas; Pereira, Gabriel Kalil Rocha; Amaral, Marina; Valandro, Luiz Felipe; Bottino, Marco Antonio

    2016-01-01

    The present study investigated the effect of grinding on roughness, flexural strength, and reliability of a zirconia ceramic before and after heat treatment. Seven groups were tested (n = 15): a control group (labeled CG, untreated), and six groups of samples ground with diamond discs, simulating diamond burs, with grits of 200 µm (G80); 160 µm (G120), and 25 µm (G600), either untreated or heat-treated at 1200°C for 2 h (labeled A). Yttria tetragonal zirconia polycrystal discs were manufactured, ground, and submitted to roughness and crystalline phase analyses before the biaxial flexural strength test. There was no correlation between roughness (Ra and Rz) and flexural strength. The reliability of the materials was not affected by grinding or heat treatment, but the characteristic strength was higher after abrasion with diamond discs, irrespective of grit size. The X-ray diffraction data showed that grinding leads to a higher monoclinic (m) phase content, whereas heat treatment produces reverse transformation, leading to a fraction of m-phase in ground samples similar to that observed in the control group. However, after heat treatment, only the G80A samples presented strength similar to that of the control group, while the other groups showed higher strength values. When zirconia pieces must be adjusted for clinical use, a smoother surface can be obtained by employing finer-grit diamond burs. Moreover, when the amount of monoclinic phase is related to the degradation of zirconia, the laboratory heat treatment of ground pieces is indicated for the reverse transformation of zirconia crystals.